BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10004_c0_seq1-m.1 5prime_partial 3-1076(+) 358 (+)
         (357 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511009541|gb|EPB90782.1| hypothetical protein HMPREF1544_0236...   449   e-124   Mucor circinelloides f. circinelloides 1006PhL
gi|328860877|gb|EGG09982.1| hypothetical protein MELLADRAFT_7110...   405   e-111   Melampsora larici-populina 98AG31
gi|384484371|gb|EIE76551.1| hypothetical protein RO3G_01255 [Rhi...   396   e-108   Rhizopus delemar RA 99-880
gi|392595756|gb|EIW85079.1| hypothetical protein CONPUDRAFT_9772...   391   e-106   Coniophora puteana RWD-64-598 SS2
gi|260830806|ref|XP_002610351.1| hypothetical protein BRAFLDRAFT...   390   e-106   Branchiostoma floridae
gi|395333684|gb|EJF66061.1| pre-mRNA-splicing factor SLT11 [Dich...   388   e-105   Dichomitus squalens LYAD-421 SS1
gi|449547344|gb|EMD38312.1| hypothetical protein CERSUDRAFT_1134...   388   e-105   Gelatoporia subvermispora B
gi|389748674|gb|EIM89851.1| hypothetical protein STEHIDRAFT_7416...   388   e-105   Stereum hirsutum FP-91666 SS1
gi|340372441|ref|XP_003384752.1| PREDICTED: pre-mRNA-splicing fa...   385   e-105   Amphimedon queenslandica
gi|432878644|ref|XP_004073359.1| PREDICTED: pre-mRNA-splicing fa...   384   e-104   Oryzias latipes [Japanese rice fish]
gi|410913889|ref|XP_003970421.1| PREDICTED: pre-mRNA-splicing fa...   384   e-104   Takifugu rubripes [tiger puffer]
gi|149064345|gb|EDM14548.1| RNA binding motif protein 22, isofor...   383   e-104   Rattus norvegicus [brown rat]
gi|499042324|ref|XP_004571771.1| PREDICTED: pre-mRNA-splicing fa...   383   e-104   Maylandia zebra
gi|348535548|ref|XP_003455262.1| PREDICTED: pre-mRNA-splicing fa...   382   e-104   Oreochromis niloticus
gi|12858161|dbj|BAB31220.1| unnamed protein product [Mus musculus]    382   e-104   Mus musculus [mouse]
gi|301765526|ref|XP_002918204.1| PREDICTED: pre-mRNA-splicing fa...   382   e-104   
gi|426229912|ref|XP_004009027.1| PREDICTED: pre-mRNA-splicing fa...   382   e-104   
gi|61371511|gb|AAX43680.1| RNA binding motif protein 22 [synthet...   382   e-103   synthetic construct
gi|71043848|ref|NP_001020847.1| pre-mRNA-splicing factor RBM22 [...   382   e-103   Rattus norvegicus [brown rat]
gi|296193255|ref|XP_002744418.1| PREDICTED: pre-mRNA-splicing fa...   382   e-103   Callithrix jacchus [common marmoset]
gi|507960323|ref|XP_004686945.1| PREDICTED: pre-mRNA-splicing fa...   382   e-103   Condylura cristata
gi|504150384|ref|XP_004587587.1| PREDICTED: pre-mRNA-splicing fa...   382   e-103   Ochotona princeps [southern American pika]
gi|403285535|ref|XP_003934078.1| PREDICTED: pre-mRNA-splicing fa...   382   e-103   Saimiri boliviensis boliviensis
gi|8922328|ref|NP_060517.1| pre-mRNA-splicing factor RBM22 [Homo...   382   e-103   Homo sapiens [man]
gi|426229914|ref|XP_004009028.1| PREDICTED: pre-mRNA-splicing fa...   381   e-103   
gi|512854675|ref|XP_004888135.1| PREDICTED: pre-mRNA-splicing fa...   381   e-103   
gi|148677878|gb|EDL09825.1| mCG6024, isoform CRA_c [Mus musculus]     381   e-103   Mus musculus [mouse]
gi|148677877|gb|EDL09824.1| mCG6024, isoform CRA_b [Mus musculus]     381   e-103   Mus musculus [mouse]
gi|126290582|ref|XP_001369324.1| PREDICTED: pre-mRNA-splicing fa...   381   e-103   Monodelphis domestica
gi|338713130|ref|XP_001917686.2| PREDICTED: LOW QUALITY PROTEIN:...   381   e-103   Equus caballus [domestic horse]
gi|449267139|gb|EMC78105.1| Pre-mRNA-splicing factor RBM22 [Colu...   381   e-103   Columba livia [carrier pigeon]
gi|224067689|ref|XP_002198708.1| PREDICTED: pre-mRNA-splicing fa...   381   e-103   Taeniopygia guttata
gi|327265402|ref|XP_003217497.1| PREDICTED: pre-mRNA-splicing fa...   380   e-103   Anolis carolinensis [Carolina anole]
gi|507645302|ref|XP_004631365.1| PREDICTED: pre-mRNA-splicing fa...   380   e-103   Octodon degus
gi|471406496|ref|XP_004384944.1| PREDICTED: pre-mRNA-splicing fa...   380   e-103   Trichechus manatus latirostris
gi|83715976|ref|NP_001032907.1| pre-mRNA-splicing factor RBM22 [...   380   e-103   Bos taurus [bovine]
gi|47086019|ref|NP_998379.1| pre-mRNA-splicing factor RBM22 [Dan...   380   e-103   Danio rerio [leopard danio]
gi|197098656|ref|NP_001125624.1| pre-mRNA-splicing factor RBM22 ...   379   e-103   Pongo abelii [Orang-utan]
gi|395817744|ref|XP_003782315.1| PREDICTED: pre-mRNA-splicing fa...   379   e-103   
gi|326928574|ref|XP_003210452.1| PREDICTED: pre-mRNA-splicing fa...   379   e-103   Meleagris gallopavo [common turkey]
gi|334311193|ref|XP_003339587.1| PREDICTED: pre-mRNA-splicing fa...   379   e-103   
gi|74195542|dbj|BAE39585.1| unnamed protein product [Mus musculus]    379   e-103   Mus musculus [mouse]
gi|148231899|ref|NP_001080776.1| pre-mRNA-splicing factor RBM22 ...   378   e-102   Xenopus laevis [clawed frog]
gi|395504854|ref|XP_003756761.1| PREDICTED: pre-mRNA-splicing fa...   378   e-102   Sarcophilus harrisii
gi|431918047|gb|ELK17275.1| Pre-mRNA-splicing factor RBM22 [Pter...   378   e-102   Pteropus alecto
gi|45360865|ref|NP_989108.1| pre-mRNA-splicing factor RBM22 [Xen...   378   e-102   Xenopus tropicalis [western clawed frog]
gi|472587753|gb|EMS25249.1| pre-mRNA-splicing factor RBM22/SLT11...   378   e-102   Rhodotorula toruloides NP11
gi|157422918|gb|AAI53464.1| RNA binding motif protein 22 [Danio ...   378   e-102   Danio rerio [leopard danio]
gi|57525003|ref|NP_001006151.1| pre-mRNA-splicing factor RBM22 [...   377   e-102   Gallus gallus [bantam]
gi|291243067|ref|XP_002741428.1| PREDICTED: RNA binding motif pr...   377   e-102   Saccoglossus kowalevskii
gi|505854452|ref|XP_004622809.1| PREDICTED: LOW QUALITY PROTEIN:...   377   e-102   
gi|302690562|ref|XP_003034960.1| hypothetical protein SCHCODRAFT...   377   e-102   Schizophyllum commune H4-8
gi|355691758|gb|EHH26943.1| hypothetical protein EGK_17030 [Maca...   377   e-102   Macaca mulatta [rhesus macaque]
gi|354488436|ref|XP_003506375.1| PREDICTED: pre-mRNA-splicing fa...   377   e-102   
gi|119582116|gb|EAW61712.1| RNA binding motif protein 22, isofor...   377   e-102   Homo sapiens [man]
gi|355750335|gb|EHH54673.1| hypothetical protein EGM_15557 [Maca...   377   e-102   Macaca fascicularis [crab eating macaque]
gi|392566926|gb|EIW60101.1| hypothetical protein TRAVEDRAFT_1646...   376   e-102   Trametes versicolor FP-101664 SS1
gi|224106323|ref|XP_002314129.1| predicted protein [Populus tric...   376   e-102   Populus trichocarpa [western balsam poplar]
gi|224106319|ref|XP_002314127.1| predicted protein [Populus tric...   376   e-102   Populus trichocarpa [western balsam poplar]
gi|472396723|ref|XP_004417583.1| PREDICTED: pre-mRNA-splicing fa...   375   e-102   
gi|444723694|gb|ELW64335.1| Pre-mRNA-splicing factor RBM22 [Tupa...   375   e-101   Tupaia chinensis
gi|432114097|gb|ELK36142.1| Pre-mRNA-splicing factor RBM22 [Myot...   375   e-101   Myotis davidii
gi|393216915|gb|EJD02405.1| hypothetical protein FOMMEDRAFT_1097...   374   e-101   Fomitiporia mediterranea MF3/22
gi|390361169|ref|XP_003729862.1| PREDICTED: LOW QUALITY PROTEIN:...   373   e-101   Strongylocentrotus purpuratus [purple urchin]
gi|449453956|ref|XP_004144722.1| PREDICTED: zinc finger CCCH dom...   373   e-101   
gi|462414448|gb|EMJ19185.1| hypothetical protein PRUPE_ppa005493...   372   e-100   Prunus persica
gi|221128187|ref|XP_002162583.1| PREDICTED: pre-mRNA-splicing fa...   371   e-100   Hydra vulgaris
gi|405971196|gb|EKC36046.1| Pre-mRNA-splicing factor RBM22 [Cras...   371   e-100   Crassostrea gigas
gi|115466664|ref|NP_001056931.1| Os06g0170500 [Oryza sativa Japo...   370   e-100   
gi|242066226|ref|XP_002454402.1| hypothetical protein SORBIDRAFT...   370   e-100   Sorghum bicolor [broomcorn]
gi|390597824|gb|EIN07223.1| hypothetical protein PUNSTDRAFT_8938...   369   e-100   Punctularia strigosozonata HHB-11173 SS5
gi|413952999|gb|AFW85648.1| pre-mRNA-splicing factor SLT11 [Zea ...   369   e-100   Zea mays [maize]
gi|472366690|ref|XP_004402882.1| PREDICTED: pre-mRNA-splicing fa...   369   e-100   Odobenus rosmarus divergens
gi|326677860|ref|XP_003200931.1| PREDICTED: pre-mRNA-splicing fa...   369   e-100   
gi|225434698|ref|XP_002280897.1| PREDICTED: zinc finger CCCH dom...   369   e-100   Vitis vinifera
gi|241710461|ref|XP_002403460.1| RNA-binding protein, putative [...   369   e-99    Ixodes scapularis [blacklegged tick]
gi|226509868|ref|NP_001151426.1| LOC100285059 [Zea mays] >gi|195...   369   1e-99   Zea mays [maize]
gi|149412599|ref|XP_001510991.1| PREDICTED: pre-mRNA-splicing fa...   369   1e-99   Ornithorhynchus anatinus [duck-billed platypus]
gi|195496994|ref|XP_002095913.1| GE25369 [Drosophila yakuba] >gi...   368   1e-99   Drosophila yakuba
gi|460407526|ref|XP_004249203.1| PREDICTED: zinc finger CCCH dom...   368   1e-99   
gi|223974935|gb|ACN31655.1| unknown [Zea mays] >gi|413952998|gb|...   368   2e-99   Zea mays [maize]
gi|357125138|ref|XP_003564252.1| PREDICTED: zinc finger CCCH dom...   368   2e-99   Brachypodium distachyon [annual false brome]
gi|115471551|ref|NP_001059374.1| Os07g0281000 [Oryza sativa Japo...   367   2e-99   
gi|125777509|ref|XP_001359630.1| GA13140 [Drosophila pseudoobscu...   367   2e-99   Drosophila pseudoobscura pseudoobscura
gi|403417885|emb|CCM04585.1| predicted protein [Fibroporia radic...   367   2e-99   Fibroporia radiculosa
gi|482576010|gb|EOA40197.1| hypothetical protein CARUB_v10008917...   367   3e-99   Capsella rubella
gi|194898376|ref|XP_001978788.1| GG11763 [Drosophila erecta] >gi...   367   3e-99   Drosophila erecta
gi|194741630|ref|XP_001953292.1| GF17279 [Drosophila ananassae] ...   367   3e-99   Drosophila ananassae
gi|475609743|gb|EMT27491.1| Zinc finger CCCH domain-containing p...   367   4e-99   Aegilops tauschii
gi|169852840|ref|XP_001833102.1| pre-mRNA-splicing factor SLT11 ...   367   4e-99   Coprinopsis cinerea okayama7#130
gi|28573264|ref|NP_649440.3| CG14641 [Drosophila melanogaster] >...   366   4e-99   Drosophila melanogaster
gi|195445733|ref|XP_002070461.1| GK11018 [Drosophila willistoni]...   366   5e-99   Drosophila willistoni
gi|83283985|gb|ABC01900.1| RRM-containing RNA-binding protein-li...   366   5e-99   Solanum tuberosum [potatoes]
gi|195343343|ref|XP_002038257.1| GM10722 [Drosophila sechellia] ...   366   6e-99   Drosophila sechellia
gi|242094866|ref|XP_002437923.1| hypothetical protein SORBIDRAFT...   365   8e-99   Sorghum bicolor [broomcorn]
gi|331237169|ref|XP_003331242.1| hypothetical protein PGTG_13205...   365   1e-98   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|170087442|ref|XP_001874944.1| predicted protein [Laccaria bic...   365   1e-98   Laccaria bicolor S238N-H82
gi|356553476|ref|XP_003545082.1| PREDICTED: zinc finger CCCH dom...   365   1e-98   Glycine max [soybeans]
gi|18390760|ref|NP_563788.1| MOS4-associated complex subunit 5A ...   365   1e-98   Arabidopsis thaliana [mouse-ear cress]
gi|82400164|gb|ABB72821.1| RRM-containing RNA-binding protein-li...   365   1e-98   Solanum tuberosum [potatoes]
gi|15450878|gb|AAK96710.1| Unknown protein [Arabidopsis thaliana...   364   2e-98   Arabidopsis thaliana [mouse-ear cress]
gi|242011910|ref|XP_002426686.1| pre-mRNA-splicing factor SLT11,...   364   2e-98   Pediculus humanus corporis [human body lice]
gi|170059381|ref|XP_001865339.1| pre-mRNA-splicing factor RBM22 ...   364   2e-98   Culex quinquefasciatus
gi|351702162|gb|EHB05081.1| Pre-mRNA-splicing factor RBM22 [Hete...   364   2e-98   Heterocephalus glaber [naked mole rat]
gi|195113937|ref|XP_002001524.1| GI21935 [Drosophila mojavensis]...   364   2e-98   Drosophila mojavensis
gi|156546667|ref|XP_001603806.1| PREDICTED: pre-mRNA-splicing fa...   363   4e-98   Nasonia vitripennis
gi|156357140|ref|XP_001624081.1| predicted protein [Nematostella...   363   4e-98   Nematostella vectensis
gi|195399758|ref|XP_002058486.1| GJ14294 [Drosophila virilis] >g...   363   4e-98   Drosophila virilis
gi|498997400|ref|XP_004533593.1| PREDICTED: pre-mRNA-splicing fa...   363   4e-98   Ceratitis capitata
gi|158828226|gb|ABW81104.1| unknown [Cleome spinosa]                  363   4e-98   Tarenaya spinosa
gi|335310006|ref|XP_003361854.1| PREDICTED: pre-mRNA-splicing fa...   363   4e-98   
gi|443697641|gb|ELT98008.1| hypothetical protein CAPTEDRAFT_1230...   363   5e-98   Capitella teleta
gi|218197672|gb|EEC80099.1| hypothetical protein OsI_21840 [Oryz...   363   5e-98   Oryza sativa Indica Group [Indian rice]
gi|508699821|gb|EOX91717.1| CCCH-type zinc fingerfamily protein ...   363   6e-98   Theobroma cacao [chocolate]
gi|297849030|ref|XP_002892396.1| hypothetical protein ARALYDRAFT...   363   6e-98   Arabidopsis lyrata subsp. lyrata
gi|502134059|ref|XP_004501986.1| PREDICTED: zinc finger CCCH dom...   362   7e-98   
gi|502134056|ref|XP_004501985.1| PREDICTED: zinc finger CCCH dom...   362   7e-98   Cicer arietinum [garbanzo]
gi|157128887|ref|XP_001661533.1| RNA binding motif protein [Aede...   362   8e-98   Aedes aegypti
gi|356574477|ref|XP_003555373.1| PREDICTED: zinc finger CCCH dom...   362   9e-98   
gi|512908697|ref|XP_004926745.1| PREDICTED: pre-mRNA-splicing fa...   362   9e-98   Bombyx mori [silk moth]
gi|357629028|gb|EHJ78065.1| putative RNA binding motif protein 2...   362   1e-97   Danaus plexippus [American monarch]
gi|195053830|ref|XP_001993829.1| GH21879 [Drosophila grimshawi] ...   362   1e-97   Drosophila grimshawi
gi|322792638|gb|EFZ16520.1| hypothetical protein SINV_01234 [Sol...   362   1e-97   Solenopsis invicta [imported red fire ant]
gi|356499475|ref|XP_003518565.1| PREDICTED: zinc finger CCCH dom...   362   1e-97   
gi|66536941|ref|XP_395009.2| PREDICTED: pre-mRNA-splicing factor...   361   2e-97   Apis mellifera [European honey bee]
gi|380020369|ref|XP_003694059.1| PREDICTED: pre-mRNA-splicing fa...   361   2e-97   Apis florea [dwarf honeybee]
gi|340722791|ref|XP_003399785.1| PREDICTED: pre-mRNA-splicing fa...   361   2e-97   Bombus terrestris [large earth bumblebee]
gi|402225246|gb|EJU05307.1| hypothetical protein DACRYDRAFT_9268...   361   2e-97   Dacryopinax primogenitus
gi|297745955|emb|CBI16011.3| unnamed protein product [Vitis vini...   361   2e-97   Vitis vinifera
gi|356549608|ref|XP_003543184.1| PREDICTED: zinc finger CCCH dom...   360   2e-97   
gi|383857285|ref|XP_003704135.1| PREDICTED: pre-mRNA-splicing fa...   360   3e-97   Megachile rotundata
gi|158292281|ref|XP_313808.4| AGAP004509-PA [Anopheles gambiae s...   360   4e-97   Anopheles gambiae str. PEST
gi|470325719|ref|XP_004364532.1| Rbm22 protein [Capsaspora owcza...   360   5e-97   
gi|118344182|ref|NP_001071914.1| zinc finger protein [Ciona inte...   358   9e-97   Ciona intestinalis [sea vase]
gi|290561328|gb|ADD38066.1| Pre-mRNA-splicing factor RBM22 [Lepe...   358   1e-96   Lepeophtheirus salmonis
gi|391327440|ref|XP_003738208.1| PREDICTED: pre-mRNA-splicing fa...   358   2e-96   Metaseiulus occidentalis
gi|307181748|gb|EFN69209.1| Pre-mRNA-splicing factor RBM22 [Camp...   358   2e-96   Camponotus floridanus
gi|297822673|ref|XP_002879219.1| hypothetical protein ARALYDRAFT...   357   2e-96   Arabidopsis lyrata subsp. lyrata
gi|426199988|gb|EKV49912.1| hypothetical protein AGABI2DRAFT_190...   357   3e-96   Agaricus bisporus var. bisporus H97
gi|15227567|ref|NP_180518.1| MOS4-associated complex subunit MAC...   357   3e-96   Arabidopsis thaliana [mouse-ear cress]
gi|409082162|gb|EKM82520.1| hypothetical protein AGABI1DRAFT_111...   357   3e-96   Agaricus bisporus var. burnettii JB137-S8
gi|357462041|ref|XP_003601302.1| Zinc finger CCCH domain-contain...   357   3e-96   Medicago truncatula
gi|307192892|gb|EFN75920.1| Pre-mRNA-splicing factor RBM22 [Harp...   356   6e-96   Harpegnathos saltator
gi|374256067|gb|AEZ00895.1| putative zinc finger CCCH-type famil...   354   2e-95   Elaeis guineensis
gi|302808802|ref|XP_002986095.1| hypothetical protein SELMODRAFT...   354   2e-95   Selaginella moellendorffii
gi|168027976|ref|XP_001766505.1| predicted protein [Physcomitrel...   354   2e-95   Physcomitrella patens
gi|470121309|ref|XP_004296718.1| PREDICTED: zinc finger CCCH dom...   353   5e-95   Fragaria vesca subsp. vesca
gi|302800509|ref|XP_002982012.1| hypothetical protein SELMODRAFT...   352   7e-95   Selaginella moellendorffii
gi|339247155|ref|XP_003375211.1| Pre-mRNA-splicing factor RBM22 ...   352   8e-95   Trichinella spiralis
gi|353237820|emb|CCA69784.1| related to Pre-mRNA-splicing factor...   352   1e-94   Serendipita indica DSM 11827
gi|393234593|gb|EJD42154.1| pre-mRNA-splicing factor SLT11 [Auri...   351   2e-94   Auricularia subglabra TFB-10046 SS5
gi|193610466|ref|XP_001943081.1| PREDICTED: pre-mRNA-splicing fa...   351   2e-94   Acyrthosiphon pisum
gi|321459833|gb|EFX70882.1| hypothetical protein DAPPUDRAFT_2020...   348   1e-93   Daphnia pulex
gi|443924909|gb|ELU43855.1| pre-mRNA-splicing factor SLT11 [Rhiz...   348   2e-93   Rhizoctonia solani AG-1 IA
gi|358340385|dbj|GAA34086.2| pre-mRNA-splicing factor RBM22/SLT1...   346   5e-93   Clonorchis sinensis [oriental liver fluke]
gi|339247335|ref|XP_003375301.1| Pre-mRNA-splicing factor RBM22 ...   346   6e-93   Trichinella spiralis
gi|256075299|ref|XP_002573957.1| rna binding motif protein [Schi...   346   6e-93   
gi|313229243|emb|CBY23829.1| unnamed protein product [Oikopleura...   344   2e-92   Oikopleura dioica
gi|91088695|ref|XP_975014.1| PREDICTED: similar to RNA binding m...   341   2e-91   Tribolium castaneum [rust-red flour beetle]
gi|432098820|gb|ELK28315.1| Pre-mRNA-splicing factor RBM22 [Myot...   339   8e-91   Myotis davidii
gi|71993749|ref|NP_502014.2| Protein T11G6.8 [Caenorhabditis ele...   338   2e-90   Caenorhabditis elegans [roundworm]
gi|405118063|gb|AFR92838.1| pre-mRNA-splicing factor SLT11 [Cryp...   337   2e-90   Cryptococcus neoformans var. grubii H99
gi|507622860|ref|XP_004697148.1| PREDICTED: pre-mRNA-splicing fa...   337   3e-90   Echinops telfairi [lesser hedgehog tenrec]
gi|268552599|ref|XP_002634282.1| Hypothetical protein CBG17615 [...   336   7e-90   Caenorhabditis briggsae
gi|308452652|ref|XP_003089126.1| hypothetical protein CRE_23244 ...   335   1e-89   Caenorhabditis remanei
gi|465952073|gb|EMP24702.1| Dynactin subunit 4 [Chelonia mydas]       335   1e-89   Chelonia mydas [green seaturtle]
gi|170584256|ref|XP_001896921.1| Rbm22 protein [Brugia malayi] >...   330   3e-88   Brugia malayi [agent of lymphatic filariasis]
gi|58259011|ref|XP_566918.1| cell wall organization and biogenes...   330   4e-88   Cryptococcus neoformans var. neoformans JEC21
gi|341892124|gb|EGT48059.1| hypothetical protein CAEBREN_15812 [...   330   5e-88   Caenorhabditis brenneri
gi|321250497|ref|XP_003191828.1| cell wall organization and biog...   329   6e-88   Cryptococcus gattii WM276
gi|392576636|gb|EIW69766.1| hypothetical protein TREMEDRAFT_2954...   329   8e-88   Tremella mesenterica DSM 1558
gi|462396408|gb|EMJ02207.1| hypothetical protein PRUPE_ppa005371...   328   1e-87   Prunus persica
gi|358059803|dbj|GAA94449.1| hypothetical protein E5Q_01101 [Mix...   327   4e-87   Mixia osmundae IAM 14324
gi|482576009|gb|EOA40196.1| hypothetical protein CARUB_v10008917...   322   8e-86   Capsella rubella
gi|307111201|gb|EFN59436.1| hypothetical protein CHLNCDRAFT_3388...   321   2e-85   Chlorella variabilis
gi|470146032|ref|XP_004308634.1| PREDICTED: zinc finger CCCH dom...   321   2e-85   Fragaria vesca subsp. vesca
gi|483523738|gb|EOB07946.1| Pre-mRNA-splicing factor RBM22, part...   320   4e-85   Anas platyrhynchos [duck]
gi|281345654|gb|EFB21238.1| hypothetical protein PANDA_006585 [A...   318   1e-84   Ailuropoda melanoleuca
gi|474262820|gb|EMS60621.1| Zinc finger CCCH domain-containing p...   317   3e-84   Triticum urartu
gi|294888423|ref|XP_002772458.1| pre-mRNA-splicing factor SLT11,...   315   1e-83   Perkinsus marinus ATCC 50983
gi|294942681|ref|XP_002783643.1| pre-mRNA-splicing factor SLT11,...   313   3e-83   Perkinsus marinus ATCC 50983
gi|478259080|gb|ENN79015.1| hypothetical protein YQE_04517, part...   313   4e-83   Dendroctonus ponderosae
gi|401399032|ref|XP_003880458.1| hypothetical protein NCLIV_0089...   313   6e-83   Neospora caninum Liverpool
gi|384249712|gb|EIE23193.1| hypothetical protein COCSUDRAFT_2381...   310   5e-82   Coccomyxa subellipsoidea C-169
gi|118380139|ref|XP_001023234.1| hypothetical protein TTHERM_004...   308   1e-81   
gi|167525647|ref|XP_001747158.1| hypothetical protein [Monosiga ...   307   2e-81   Monosiga brevicollis MX1
gi|422294185|gb|EKU21485.1| pre-mRNA-splicing factor RBM22/SLT11...   307   3e-81   Nannochloropsis gaditana CCMP526
gi|237840441|ref|XP_002369518.1| RRM / zinc finger (CCCH type) d...   304   2e-80   Toxoplasma gondii ME49
gi|221504135|gb|EEE29812.1| RRM / zinc finger (CCCH type) domain...   301   2e-79   
gi|238595509|ref|XP_002393786.1| hypothetical protein MPER_06426...   301   2e-79   
gi|470319707|gb|EMR11317.1| hypothetical protein PNEG_00346 [Pne...   299   1e-78   Pneumocystis murina B123
gi|281202587|gb|EFA76789.1| CCCH-type zinc finger-containing pro...   295   1e-77   Polysphondylium pallidum PN500
gi|403356826|gb|EJY78018.1| pre-mRNA-splicing factor RBM22 [Oxyt...   295   1e-77   Oxytricha trifallax
gi|303279645|ref|XP_003059115.1| predicted protein [Micromonas p...   293   4e-77   Micromonas pusilla CCMP1545
gi|334187480|ref|NP_001190247.1| MOS4-associated complex subunit...   293   6e-77   Arabidopsis thaliana [mouse-ear cress]
gi|15240684|ref|NP_196323.1| MOS4-associated complex subunit 5C ...   293   6e-77   Arabidopsis thaliana [mouse-ear cress]
gi|116831459|gb|ABK28682.1| unknown [Arabidopsis thaliana]            293   8e-77   Arabidopsis thaliana [mouse-ear cress]
gi|168040006|ref|XP_001772487.1| predicted protein [Physcomitrel...   290   5e-76   Physcomitrella patens
gi|406699966|gb|EKD03159.1| cell wall organization and biogenesi...   287   3e-75   Trichosporon asahii var. asahii CBS 8904
gi|298710981|emb|CBJ32288.1| conserved unknown protein [Ectocarp...   285   1e-74   Ectocarpus siliculosus
gi|507114399|emb|CDF37952.1| unnamed protein product [Chondrus c...   285   1e-74   Chondrus crispus [Irish moss]
gi|399217792|emb|CCF74679.1| unnamed protein product [Babesia mi...   285   2e-74   
gi|388855259|emb|CCF51153.1| related to Cell cycle control prote...   285   2e-74   Ustilago hordei
gi|452820260|gb|EME27305.1| pre-mRNA-splicing factor RBM22/SLT11...   284   3e-74   Galdieria sulphuraria
gi|239792619|dbj|BAH72632.1| ACYPI009745 [Acyrthosiphon pisum]        284   3e-74   Acyrthosiphon pisum
gi|443896563|dbj|GAC73907.1| predicted RNA-binding protein [Pseu...   284   3e-74   Moesziomyces antarcticus T-34
gi|401887387|gb|EJT51375.1| cell wall organization and biogenesi...   283   5e-74   Trichosporon asahii var. asahii CBS 2479
gi|332028626|gb|EGI68661.1| Pre-mRNA-splicing factor RBM22 [Acro...   281   2e-73   Acromyrmex echinatior
gi|308804982|ref|XP_003079803.1| RRM-containing RNA-binding prot...   281   3e-73   Ostreococcus tauri
gi|255641757|gb|ACU21149.1| unknown [Glycine max]                     277   3e-72   Glycine max [soybeans]
gi|145347969|ref|XP_001418431.1| predicted protein [Ostreococcus...   277   4e-72   Ostreococcus lucimarinus CCE9901
gi|345569666|gb|EGX52531.1| hypothetical protein AOL_s00043g25 [...   272   1e-70   Arthrobotrys oligospora ATCC 24927
gi|325193318|emb|CCA27661.1| conserved unknown protein putative ...   270   4e-70   Albugo laibachii Nc14
gi|255073423|ref|XP_002500386.1| predicted protein [Micromonas s...   270   6e-70   Micromonas commoda
gi|125557962|gb|EAZ03498.1| hypothetical protein OsI_25637 [Oryz...   269   1e-69   Oryza sativa Indica Group [Indian rice]
gi|465795589|emb|CCV00079.1| unnamed protein product [Malassezia...   268   2e-69   Malassezia sympodialis ATCC 42132
gi|323508215|emb|CBQ68086.1| related to Cell cycle control prote...   267   3e-69   Sporisorium reilianum SRZ2
gi|312380972|gb|EFR26830.1| hypothetical protein AND_06808 [Anop...   266   6e-69   
gi|71004296|ref|XP_756814.1| hypothetical protein UM00667.1 [Ust...   263   4e-68   
gi|81177562|ref|XP_723726.1| hypothetical protein [Plasmodium yo...   263   8e-68   Plasmodium yoelii yoelii 17XNL
gi|402579051|gb|EJW73004.1| zinc finger protein [Wuchereria banc...   261   2e-67   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|224001676|ref|XP_002290510.1| predicted protein [Thalassiosir...   261   2e-67   Thalassiosira pseudonana CCMP1335
gi|124806921|ref|XP_001350866.1| RNA binding protein, putative [...   261   2e-67   Plasmodium falciparum 3D7
gi|501310661|dbj|GAC99419.1| RNA recognition motif containing pr...   260   4e-67   Pseudozyma hubeiensis SY62
gi|68066426|ref|XP_675196.1| RNA-binding protein [Plasmodium ber...   259   6e-67   Plasmodium berghei ANKA
gi|312079522|ref|XP_003142211.1| Rbm22 protein [Loa loa]              258   2e-66   Loa loa
gi|221061969|ref|XP_002262554.1| RNA binding protein [Plasmodium...   257   4e-66   Plasmodium knowlesi strain H
gi|195131747|ref|XP_002010307.1| GI14756 [Drosophila mojavensis]...   256   7e-66   Drosophila mojavensis
gi|156095945|ref|XP_001614007.1| RNA binding protein [Plasmodium...   254   3e-65   Plasmodium vivax Sal-1
gi|397635517|gb|EJK71891.1| hypothetical protein THAOC_06625 [Th...   252   1e-64   Thalassiosira oceanica
gi|470393657|ref|XP_004334907.1| RNA recognition motif domain co...   250   4e-64   Acanthamoeba castellanii str. Neff
gi|302840588|ref|XP_002951849.1| hypothetical protein VOLCADRAFT...   249   7e-64   Volvox carteri f. nagariensis
gi|452989014|gb|EME88769.1| hypothetical protein MYCFIDRAFT_3551...   249   1e-63   Cercospora fijiensis CIRAD86
gi|393912251|gb|EFO21859.2| Rbm22 protein [Loa loa]                   248   3e-63   Loa loa
gi|407927292|gb|EKG20190.1| hypothetical protein MPH_02547 [Macr...   247   4e-63   Macrophomina phaseolina MS6
gi|412993121|emb|CCO16654.1| predicted protein [Bathycoccus pras...   246   6e-63   Bathycoccus prasinos
gi|194384782|dbj|BAG59551.1| unnamed protein product [Homo sapiens]   246   9e-63   Homo sapiens [man]
gi|449296802|gb|EMC92821.1| hypothetical protein BAUCODRAFT_2632...   243   6e-62   Baudoinia panamericana UAMH 10762
gi|219112609|ref|XP_002178056.1| predicted protein [Phaeodactylu...   241   2e-61   Phaeodactylum tricornutum CCAP 1055/1
gi|425768261|gb|EKV06791.1| Pre-mRNA-splicing factor slt11 [Peni...   240   4e-61   Penicillium digitatum Pd1
gi|255933816|ref|XP_002558287.1| Pc12g14830 [Penicillium chrysog...   240   5e-61   Penicillium rubens Wisconsin 54-1255
gi|330812947|ref|XP_003291377.1| hypothetical protein DICPUDRAFT...   240   5e-61   Dictyostelium purpureum
gi|317156711|ref|XP_001825943.2| pre-mRNA-splicing factor slt11 ...   239   1e-60   Aspergillus oryzae RIB40
gi|121714491|ref|XP_001274856.1| pre-RNA splicing factor Slt11, ...   239   1e-60   Aspergillus clavatus NRRL 1
gi|119487176|ref|XP_001262443.1| pre-RNA splicing factor Slt11, ...   238   1e-60   Aspergillus fischeri NRRL 181
gi|378731886|gb|EHY58345.1| pre-mRNA-splicing factor slt11 [Exop...   238   2e-60   Exophiala dermatitidis NIH/UT8656
gi|428185581|gb|EKX54433.1| hypothetical protein GUITHDRAFT_9991...   238   2e-60   Guillardia theta CCMP2712
gi|505755542|gb|EOQ99749.1| Pre-mRNA-splicing factor RBM22 [Wall...   238   2e-60   Wallemia ichthyophaga EXF-994
gi|145248892|ref|XP_001400785.1| pre-mRNA-splicing factor slt11 ...   237   4e-60   Aspergillus niger CBS 513.88
gi|358370509|dbj|GAA87120.1| pre-RNA splicing factor Slt11 [Aspe...   236   6e-60   Aspergillus kawachii IFO 4308
gi|398405724|ref|XP_003854328.1| hypothetical protein MYCGRDRAFT...   236   9e-60   Zymoseptoria tritici IPO323
gi|169610673|ref|XP_001798755.1| hypothetical protein SNOG_08444...   236   9e-60   Parastagonospora nodorum SN15
gi|388582044|gb|EIM22350.1| hypothetical protein WALSEDRAFT_6003...   235   1e-59   Wallemia mellicola CBS 633.66
gi|296819213|ref|XP_002849811.1| pre-mRNA-splicing factor slt11 ...   235   2e-59   Arthroderma otae CBS 113480
gi|294896686|ref|XP_002775681.1| pre-mRNA-splicing factor SLT11,...   235   2e-59   Perkinsus marinus ATCC 50983
gi|453083210|gb|EMF11256.1| pre-RNA splicing factor Slt11 [Mycos...   234   2e-59   Sphaerulina musiva SO2202
gi|303320785|ref|XP_003070387.1| RNA recognition motif containin...   234   3e-59   Coccidioides posadasii C735 delta SOWgp
gi|258577645|ref|XP_002543004.1| pre-mRNA splicing factor slt-11...   234   4e-59   Uncinocarpus reesii 1704
gi|70982045|ref|XP_746551.1| pre-RNA splicing factor Slt11 [Aspe...   233   4e-59   Aspergillus fumigatus Af293
gi|494828528|gb|EON65340.1| hypothetical protein W97_04578 [Coni...   233   5e-59   Coniosporium apollinis CBS 100218
gi|19075594|ref|NP_588094.1| RNA-binding protein Cwf5 [Schizosac...   233   5e-59   Schizosaccharomyces pombe 972h-
gi|238492699|ref|XP_002377586.1| pre-RNA splicing factor Slt11, ...   232   1e-58   Aspergillus flavus NRRL3357
gi|485925280|gb|EOD49903.1| putative pre-mrna-splicing factor sl...   232   1e-58   Neofusicoccum parvum UCRNP2
gi|242815097|ref|XP_002486503.1| pre-RNA splicing factor Slt11, ...   231   2e-58   Talaromyces stipitatus ATCC 10500
gi|406861308|gb|EKD14363.1| pre-mRNA-splicing factor slt11 [Mars...   231   2e-58   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|451847899|gb|EMD61206.1| hypothetical protein COCSADRAFT_2403...   231   3e-58   Bipolaris sorokiniana ND90Pr
gi|115387691|ref|XP_001211351.1| pre-mRNA splicing factor slt-11...   231   4e-58   Aspergillus terreus NIH2624
gi|327297727|ref|XP_003233557.1| pre-mRNA splicing factor slt11 ...   230   4e-58   Trichophyton rubrum CBS 118892
gi|367021052|ref|XP_003659811.1| hypothetical protein MYCTH_2142...   229   8e-58   Myceliophthora thermophila ATCC 42464
gi|171684159|ref|XP_001907021.1| hypothetical protein [Podospora...   228   2e-57   Podospora anserina S mat+
gi|470237250|ref|XP_004350582.1| CCCH-type zinc finger-containin...   228   2e-57   Dictyostelium fasciculatum
gi|322702843|gb|EFY94466.1| pre-mRNA splicing factor slt11 [Meta...   228   2e-57   Metarhizium robertsii ARSEF 23
gi|396459659|ref|XP_003834442.1| similar to pre-mRNA-splicing fa...   228   2e-57   Leptosphaeria maculans JN3
gi|213408935|ref|XP_002175238.1| RNA-binding protein Cwf5 [Schiz...   228   2e-57   Schizosaccharomyces japonicus yFS275
gi|322693854|gb|EFY85700.1| pre-mRNA splicing factor slt11 [Meta...   228   2e-57   Metarhizium acridum CQMa 102
gi|302507448|ref|XP_003015685.1| hypothetical protein ARB_05996 ...   228   3e-57   Arthroderma benhamiae CBS 112371
gi|357529049|sp|Q5AX35.2|SLT11_EMENI RecName: Full=Pre-mRNA-spli...   227   4e-57   Aspergillus nidulans FGSC A4
gi|67541963|ref|XP_664749.1| hypothetical protein AN7145.2 [Aspe...   227   4e-57   Aspergillus nidulans FGSC A4
gi|400600014|gb|EJP67705.1| RNA recognition domain-containing pr...   226   7e-57   Beauveria bassiana ARSEF 2860
gi|320592547|gb|EFX04977.1| pre-RNA splicing factor [Grosmannia ...   226   9e-57   
gi|328771001|gb|EGF81042.1| hypothetical protein BATDEDRAFT_8811...   226   9e-57   
gi|119179371|ref|XP_001241282.1| hypothetical protein CIMG_08445...   226   1e-56   
gi|346319008|gb|EGX88610.1| pre-mRNA splicing factor slt11 [Cord...   225   1e-56   
gi|399168466|emb|CCE30727.1| related to cell cycle control prote...   225   1e-56   
gi|512207009|gb|EPE35827.1| RNA-binding, RBD [Glarea lozoyensis ...   225   1e-56   
gi|326470244|gb|EGD94253.1| pre-mRNA splicing factor slt-11 [Tri...   224   2e-56   
gi|457878228|ref|XP_004225245.1| RNA binding protein [Plasmodium...   223   5e-56   
gi|302884193|ref|XP_003040993.1| hypothetical protein NECHADRAFT...   222   1e-55   
gi|166240221|ref|XP_635624.2| CCCH-type zinc finger-containing p...   221   2e-55   
gi|440136416|gb|AGB85052.1| RRM-containing RNA-binding protein, ...   221   2e-55   
gi|116192845|ref|XP_001222235.1| hypothetical protein CHGG_06140...   221   2e-55   
gi|84994216|ref|XP_951830.1| hypothetical protein [Theileria ann...   221   3e-55   
gi|342887098|gb|EGU86728.1| hypothetical protein FOXB_02737 [Fus...   221   3e-55   
gi|475677537|gb|EMT74539.1| Pre-mRNA-splicing factor slt-11 [Fus...   221   4e-55   
gi|403222479|dbj|BAM40611.1| uncharacterized protein TOT_0200008...   219   9e-55   
gi|408395125|gb|EKJ74312.1| hypothetical protein FPSE_05609 [Fus...   219   9e-55   
gi|510909612|ref|XP_004832944.1| conserved hypothetical protein ...   219   1e-54   
gi|500251897|gb|EON95761.1| putative pre-mrna splicing factor sl...   219   1e-54   
gi|297810819|ref|XP_002873293.1| hypothetical protein ARALYDRAFT...   218   2e-54   
gi|452839251|gb|EME41190.1| hypothetical protein DOTSEDRAFT_7357...   217   4e-54   
gi|71031616|ref|XP_765450.1| hypothetical protein [Theileria par...   216   1e-53   
gi|156082467|ref|XP_001608718.1| hypothetical protein [Babesia b...   214   2e-53   
gi|300122238|emb|CBK22811.2| unnamed protein product [Blastocyst...   214   4e-53   
gi|294878714|ref|XP_002768461.1| pre-mRNA-splicing factor SLT11,...   214   4e-53   
gi|344250874|gb|EGW06978.1| Pre-mRNA-splicing factor RBM22 [Cric...   212   1e-52   
gi|302815924|ref|XP_002989642.1| hypothetical protein SELMODRAFT...   211   4e-52   
gi|395756367|ref|XP_003780114.1| PREDICTED: LOW QUALITY PROTEIN:...   210   4e-52   
gi|339257502|ref|XP_003369874.1| Pre-mRNA-splicing factor RBM22 ...   207   5e-51   
gi|4096748|gb|AAC99998.1| ORF; Method: conceptual translation su...   201   2e-49   
gi|350639299|gb|EHA27653.1| hypothetical protein ASPNIDRAFT_2109...   199   7e-49   
gi|83774687|dbj|BAE64810.1| unnamed protein product [Aspergillus...   199   8e-49   
gi|326431240|gb|EGD76810.1| pre-mRNA-splicing factor RBM22 [Salp...   191   3e-46   
gi|164663417|ref|XP_001732830.1| hypothetical protein MGL_0605 [...   187   3e-45   
gi|485648418|gb|EOD41327.1| hypothetical protein EMIHUDRAFT_4620...   187   6e-45   
gi|119582114|gb|EAW61710.1| RNA binding motif protein 22, isofor...   185   1e-44   
gi|76163139|gb|AAX30926.2| SJCHGC08802 protein [Schistosoma japo...   184   3e-44   
gi|145484023|ref|XP_001428034.1| hypothetical protein [Parameciu...   182   9e-44   
gi|358393303|gb|EHK42704.1| hypothetical protein TRIATDRAFT_2939...   182   1e-43   
gi|440891428|gb|ELR45116.1| Pre-mRNA-splicing factor RBM22 [Bos ...   181   2e-43   
gi|326481082|gb|EGE05092.1| pre-mRNA splicing factor slt-11 [Tri...   181   2e-43   
gi|482805363|gb|EOA82449.1| hypothetical protein SETTUDRAFT_1649...   180   6e-43   
gi|451996985|gb|EMD89451.1| hypothetical protein COCHEDRAFT_1196...   179   1e-42   
gi|156058912|ref|XP_001595379.1| hypothetical protein SS1G_03468...   178   2e-42   
gi|406604196|emb|CCH44282.1| Zinc finger CCCH domain-containing ...   177   3e-42   
gi|154308321|ref|XP_001553497.1| hypothetical protein BC1G_07906...   177   3e-42   
gi|189205144|ref|XP_001938907.1| pre-mRNA-splicing factor slt11 ...   177   4e-42   
gi|50554679|ref|XP_504748.1| YALI0E33847p [Yarrowia lipolytica] ...   177   5e-42   
gi|330923136|ref|XP_003300116.1| hypothetical protein PTT_11272 ...   177   6e-42   
gi|212545240|ref|XP_002152774.1| pre-RNA splicing factor Slt11, ...   176   7e-42   
gi|145508161|ref|XP_001440030.1| hypothetical protein [Parameciu...   176   1e-41   
gi|336465179|gb|EGO53419.1| Pre-mRNA-splicing factor slt-11 [Neu...   176   1e-41   
gi|325092104|gb|EGC45414.1| pre-mRNA-splicing factor Slt11 [Ajel...   176   1e-41   
gi|336275251|ref|XP_003352378.1| hypothetical protein SMAC_01213...   176   1e-41   
gi|164427549|ref|XP_965393.2| pre-mRNA splicing factor slt11 [Ne...   175   1e-41   
gi|154272808|ref|XP_001537256.1| pre-mRNA splicing factor slt-11...   175   2e-41   
gi|350295475|gb|EGZ76452.1| hypothetical protein NEUTE2DRAFT_153...   175   2e-41   
gi|261188975|ref|XP_002620900.1| pre-mRNA splicing factor slt-11...   174   2e-41   
gi|295672039|ref|XP_002796566.1| pre-mRNA-splicing factor slt11 ...   174   3e-41   
gi|225683129|gb|EEH21413.1| pre-mRNA-splicing factor slt11 [Para...   174   3e-41   
gi|225555183|gb|EEH03476.1| pre-mRNA-splicing factor slt11 [Ajel...   174   4e-41   
gi|226288404|gb|EEH43916.1| pre-mRNA-splicing factor slt11 [Para...   174   4e-41   
gi|346976176|gb|EGY19628.1| pre-mRNA-splicing factor slt-11 [Ver...   172   1e-40   
gi|367043064|ref|XP_003651912.1| hypothetical protein THITE_2112...   172   1e-40   
gi|310791328|gb|EFQ26857.1| RNA recognition domain-containing pr...   172   2e-40   
gi|471564268|gb|EMR65241.1| putative pre-mrna splicing factor sl...   171   2e-40   
gi|402084929|gb|EJT79947.1| hypothetical protein GGTG_05029 [Gae...   171   2e-40   
gi|302419789|ref|XP_003007725.1| pre-mRNA-splicing factor slt-11...   171   2e-40   
gi|440631905|gb|ELR01824.1| hypothetical protein GMDG_00924 [Geo...   171   3e-40   
gi|341038932|gb|EGS23924.1| putative pre-mRNA splicing protein [...   170   6e-40   
gi|302655686|ref|XP_003019628.1| hypothetical protein TRV_06346 ...   170   7e-40   
gi|402577763|gb|EJW71719.1| hypothetical protein WUBG_17370, par...   170   7e-40   
gi|145520385|ref|XP_001446048.1| hypothetical protein [Parameciu...   170   7e-40   
gi|296424053|ref|XP_002841565.1| hypothetical protein [Tuber mel...   169   1e-39   
gi|315040385|ref|XP_003169570.1| pre-mRNA-splicing factor slt11 ...   169   2e-39   
gi|512193429|gb|EPE09186.1| pre-rna splicing factor [Ophiostoma ...   168   2e-39   
gi|340519711|gb|EGR49949.1| predicted protein [Trichoderma reese...   168   3e-39   
gi|358385182|gb|EHK22779.1| hypothetical protein TRIVIDRAFT_6038...   166   9e-39   
gi|477525039|gb|ENH76958.1| pre-RNA splicing factor [Colletotric...   164   3e-38   
gi|471221259|ref|XP_004027573.1| RNA binding motif protein 22, p...   159   1e-36   
gi|501751441|emb|CCG84317.1| protein of unknown function [Taphri...   158   2e-36   
gi|294658310|ref|XP_460640.2| DEHA2F06490p [Debaryomyces hanseni...   154   3e-35   
gi|485620165|gb|EOD16827.1| hypothetical protein EMIHUDRAFT_4160...   153   7e-35   
gi|325302908|tpg|DAA34485.1| TPA_inf: RNA-binding protein [Ambly...   152   1e-34   
gi|485637081|gb|EOD31610.1| hypothetical protein EMIHUDRAFT_4201...   152   2e-34   
gi|260941378|ref|XP_002614855.1| hypothetical protein CLUG_04870...   152   2e-34   
gi|150865644|ref|XP_001384954.2| hypothetical protein PICST_4650...   141   2e-31   
gi|448103582|ref|XP_004200071.1| Piso0_002637 [Millerozyma farin...   141   3e-31   
gi|336364951|gb|EGN93304.1| hypothetical protein SERLA73DRAFT_14...   140   5e-31   
gi|16945378|emb|CAB97290.2| conserved hypothetical protein [Neur...   140   7e-31   
gi|448099768|ref|XP_004199218.1| Piso0_002637 [Millerozyma farin...   137   4e-30   
gi|380494791|emb|CCF32886.1| pre-mRNA-splicing factor slt-11 [Co...   135   1e-29   
gi|86196070|gb|EAQ70708.1| hypothetical protein MGCH7_ch7g115 [M...   135   2e-29   
gi|344228981|gb|EGV60867.1| hypothetical protein CANTEDRAFT_1001...   135   2e-29   
gi|430814721|emb|CCJ28085.1| unnamed protein product [Pneumocyst...   134   4e-29   
gi|380353335|emb|CCG26091.1| pre-mRNA splicing factor [Candida o...   134   6e-29   
gi|344302442|gb|EGW32716.1| hypothetical protein SPAPADRAFT_6007...   131   3e-28   
gi|255558830|ref|XP_002520438.1| RNA binding motif protein, puta...   126   1e-26   
gi|354548246|emb|CCE44983.1| hypothetical protein CPAR2_407860 [...   125   2e-26   
gi|429847868|gb|ELA23418.1| pre-rna splicing factor, partial [Co...   122   1e-25   
gi|254565927|ref|XP_002490074.1| Pre-mRNA splicing factor [Komag...   119   1e-24   
gi|255725602|ref|XP_002547730.1| conserved hypothetical protein ...   118   2e-24   
gi|70944020|ref|XP_741987.1| hypothetical protein [Plasmodium ch...   115   2e-23   
gi|70919713|ref|XP_733483.1| hypothetical protein [Plasmodium ch...   114   5e-23   
gi|302808804|ref|XP_002986096.1| hypothetical protein SELMODRAFT...   112   1e-22   
gi|459371703|gb|EMG49405.1| hypothetical protein G210_5818 [Cand...   111   4e-22   
gi|209878195|ref|XP_002140539.1| hypothetical protein [Cryptospo...   108   2e-21   
gi|238883923|gb|EEQ47561.1| conserved hypothetical protein [Cand...   107   4e-21   
gi|241952414|ref|XP_002418929.1| pre-mRNA-splicing factor, putat...   107   6e-21   
gi|159487657|ref|XP_001701839.1| predicted protein [Chlamydomona...   107   7e-21   
gi|66363418|ref|XP_628675.1| Cwf5-like  with 2 ZnR domains (CCCH...   102   1e-19   
gi|407041379|gb|EKE40699.1| cell cycle control protein cwf5, put...   102   2e-19   
gi|471198979|ref|XP_004256377.1| pre-mRNA-splicing factor SLT11,...   102   2e-19   
gi|67603925|ref|XP_666582.1| hypothetical protein [Cryptosporidi...   101   3e-19   
gi|123437919|ref|XP_001309750.1| hypothetical protein [Trichomon...   101   4e-19   
gi|67482985|ref|XP_656787.1| cell cycle control protein cwf5 [En...   101   4e-19   
gi|430812036|emb|CCJ30563.1| unnamed protein product, partial [P...   101   4e-19   
gi|167394432|ref|XP_001740966.1| pre-mRNA-splicing factor SLT11 ...   100   9e-19   
gi|68477707|ref|XP_717166.1| hypothetical protein CaO19.5364 [Ca...    98   4e-18   
gi|328350477|emb|CCA36877.1| Pre-mRNA-splicing factor RBM22 [Kom...    96   2e-17   
gi|478259081|gb|ENN79016.1| hypothetical protein YQE_04518, part...    94   5e-17   
gi|253723319|pdb|2YTC|A Chain A, Solution Structure Of Rna Bindi...    92   2e-16   
gi|513033931|gb|AGO13897.1| AaceriAGR032Wp [Saccharomycetaceae s...    91   5e-16   
gi|430814722|emb|CCJ28086.1| unnamed protein product [Pneumocyst...    91   6e-16   
gi|367013278|ref|XP_003681139.1| hypothetical protein TDEL_0D034...    91   7e-16   
gi|45201127|ref|NP_986697.1| AGR032Wp [Ashbya gossypii ATCC 1089...    90   9e-16   
gi|365762122|gb|EHN03732.1| Ecm2p [Saccharomyces cerevisiae x Sa...    89   3e-15   
gi|363749933|ref|XP_003645184.1| hypothetical protein Ecym_2656 ...    89   3e-15   
gi|366996809|ref|XP_003678167.1| hypothetical protein NCAS_0I015...    88   3e-15   
gi|401626879|gb|EJS44797.1| ecm2p [Saccharomyces arboricola H-6]       86   1e-14   
gi|255712345|ref|XP_002552455.1| KLTH0C05280p [Lachancea thermot...    86   2e-14   
gi|403217675|emb|CCK72168.1| hypothetical protein KNAG_0J00860 [...    84   5e-14   
gi|313213231|emb|CBY37075.1| unnamed protein product [Oikopleura...    84   7e-14   
gi|156843585|ref|XP_001644859.1| hypothetical protein Kpol_1065p...    84   7e-14   
gi|157135233|ref|XP_001663441.1| hypothetical protein AaeL_AAEL0...    84   9e-14   
gi|323310226|gb|EGA63418.1| Ecm2p [Saccharomyces cerevisiae Fost...    83   1e-13   
gi|323349698|gb|EGA83913.1| Ecm2p [Saccharomyces cerevisiae Lalv...    83   1e-13   
gi|151946456|gb|EDN64678.1| conserved protein [Saccharomyces cer...    83   1e-13   
gi|349576442|dbj|GAA21613.1| K7_Ecm2p [Saccharomyces cerevisiae ...    83   2e-13   
gi|398364587|ref|NP_009621.3| Ecm2p [Saccharomyces cerevisiae S2...    83   2e-13   
gi|395511300|ref|XP_003759898.1| PREDICTED: LOW QUALITY PROTEIN:...    82   2e-13   
gi|207347735|gb|EDZ73817.1| YBR065Cp-like protein [Saccharomyces...    82   2e-13   
gi|290878083|emb|CBK39142.1| Ecm2p [Saccharomyces cerevisiae EC1...    82   2e-13   
gi|1870097|emb|CAA85009.1| ECM2 [Saccharomyces cerevisiae]             82   2e-13   
gi|367006791|ref|XP_003688126.1| hypothetical protein TPHA_0M011...    82   2e-13   
gi|15237649|ref|NP_196041.1| CCCH-type zinc fingerfamily protein...    80   1e-12   
gi|365982619|ref|XP_003668143.1| hypothetical protein NDAI_0A074...    79   2e-12   
gi|351701728|gb|EHB04647.1| Pre-mRNA-splicing factor RBM22, part...    79   2e-12   
gi|444322229|ref|XP_004181770.1| hypothetical protein TBLA_0G031...    79   2e-12   
gi|393216976|gb|EJD02466.1| hypothetical protein FOMMEDRAFT_1576...    78   3e-12   
gi|410077193|ref|XP_003956178.1| hypothetical protein KAFR_0C004...    74   8e-11   


>gi|511009541|gb|EPB90782.1| hypothetical protein HMPREF1544_02360 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 355

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/356 (60%), Positives = 269/356 (75%), Gaps = 13/356 (3%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KADPNKQGW +SEFPI+CETCLGDNPYVRMT+Q FGKECK+C RP+T+FRWLPG   RYK
Sbjct: 5   KADPNKQGWEDSEFPIVCETCLGDNPYVRMTKQPFGKECKICQRPYTVFRWLPGTNARYK 64

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           KTEICQTCAK+KNVCQTC+LDLQY LPV+VRD ALN+ ++AP ++INR+YFAQNI  K+ 
Sbjct: 65  KTEICQTCAKVKNVCQTCVLDLQYGLPVEVRDKALNLKSEAPSTDINRQYFAQNIASKVE 124

Query: 126 --SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
                E + +  +     R++L KLAR+EPYYKRNR HICSFF+KG C RG+ CPYRHE+
Sbjct: 125 DGGDGEGIYDAARLTPESRDILSKLARSEPYYKRNRAHICSFFLKGECKRGEGCPYRHEL 184

Query: 184 PEENELS-HQNIKDRYYGTNDPVAKKILNRVKGGN-GSNITPPEDKTITSLFITGVEDDI 241
           P EN+ +  QNI DRY G NDPVA K+LNRV+GGN G+++TPP DKT+T+LFITGVE +I
Sbjct: 185 PGENQSTVKQNITDRYNGVNDPVANKMLNRVRGGNSGASLTPPADKTVTTLFITGVESEI 244

Query: 242 DEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDK-SHSNLNIKEHDLKITW 300
            + DL+G+FY FG+IKS++V HK++CAFINFATR SAE A DK +   L +K H LK+ W
Sbjct: 245 TQDDLQGFFYVFGDIKSIIVAHKTKCAFINFATRTSAELAADKVAEVGLKLKGHSLKVVW 304

Query: 301 GRPRPTGPKTEVQAATTQNVVLP-PLESMQIPAPPGEAPSDFL-YPSQDPTYQGSS 354
            +     PKT+   +   N   P     MQ PAPP  +  +   YPSQ+P+ QGS+
Sbjct: 305 AK-----PKTQSGKSNNNNSSKPIDFNKMQPPAPPSMSGKEAQKYPSQNPSAQGST 355



>gi|328860877|gb|EGG09982.1| hypothetical protein MELLADRAFT_71106 [Melampsora larici-populina
           98AG31]
          Length = 334

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/307 (61%), Positives = 234/307 (76%), Gaps = 7/307 (2%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  K D NK G  +S+FPILCETCLG NPYVRM++Q  GKECK+C+RPFTIFRWLPGAGM
Sbjct: 1   MPPKHDLNKAGQEDSDFPILCETCLGANPYVRMSKQSLGKECKICTRPFTIFRWLPGAGM 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYKKTEICQTCAKLKNVCQTCLLDLQY LP QVRDTAL + + AP S INREYFAQN+E 
Sbjct: 61  RYKKTEICQTCAKLKNVCQTCLLDLQYGLPTQVRDTALGLNSKAPTSNINREYFAQNMEN 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           ++ G   +INY + D+ G+++LKKLART+PYYKRNRPHICSF+ KG C RGD CPYRHE+
Sbjct: 121 QLEGTSEMINYDRQDAGGKDVLKKLARTDPYYKRNRPHICSFYAKGECARGDGCPYRHEL 180

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV-EDDID 242
           P ENELS QNI+DRY+G NDPVA+KIL+     N + +TPPED++I SLF++ +  +  +
Sbjct: 181 PVENELSKQNIQDRYHGRNDPVARKILSTY--ANSTGLTPPEDESIVSLFLSSLPPEATN 238

Query: 243 EADLKGYFYAFG----EIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKI 298
           E+ ++ +F + G    +IKSVVVV  SRCAFINF  R  AE A  +    + I   ++ +
Sbjct: 239 ESIIRHFFTSIGIESNKIKSVVVVPTSRCAFINFINRGVAEDAASRCSVRVQISGKEVMV 298

Query: 299 TWGRPRP 305
            WGR +P
Sbjct: 299 RWGRSKP 305



>gi|384484371|gb|EIE76551.1| hypothetical protein RO3G_01255 [Rhizopus delemar RA 99-880]
          Length = 302

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/307 (59%), Positives = 225/307 (73%), Gaps = 16/307 (5%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KADPNKQGW  SEFPI+CETCLGDNPYVRM          +C  PFT+FRW PG  MR+K
Sbjct: 5   KADPNKQGWENSEFPIVCETCLGDNPYVRM----------ICQTPFTVFRWQPGTNMRHK 54

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           KTEICQTCA++KNVCQTC+LDLQY LPV+VRD ALNV ++AP + INR+Y+AQN+     
Sbjct: 55  KTEICQTCARVKNVCQTCILDLQYGLPVEVRDKALNVKSEAPSTNINRQYYAQNVARNAE 114

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
           G+E L N G+     +EML +L+R EPYYKRNR H+CSFF+KG C RGD CPYRHE P E
Sbjct: 115 GSEELYNPGRITPESKEMLNQLSRKEPYYKRNRAHVCSFFLKGECNRGDACPYRHEEPTE 174

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
             +  QN KDRY+G NDPVA+K+LNR +     N++PPEDK+ITSLFITGVE+DI + DL
Sbjct: 175 TNVK-QNFKDRYHGINDPVAQKMLNRAR----HNLSPPEDKSITSLFITGVEEDISQEDL 229

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDK-SHSNLNIKEHDLKITWGRPRP 305
             YF  FG+IKS++V HK +CAF+NF TR S E A  K +   L +KEH L + W +P+P
Sbjct: 230 NEYFSVFGDIKSIIVAHKKKCAFVNFVTRMSTELAAAKIAEDGLTLKEHSLVVVWAKPKP 289

Query: 306 TGPKTEV 312
              K +V
Sbjct: 290 QESKKQV 296



>gi|392595756|gb|EIW85079.1| hypothetical protein CONPUDRAFT_97728 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 321

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 235/316 (74%), Gaps = 10/316 (3%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK GW +SEFPILCETCLG NP+VRM++Q FG+ C  C+RPFT+FRW PG+G 
Sbjct: 1   MPPKADINKAGWEQSEFPILCETCLGPNPFVRMSKQEFGRSCGTCARPFTVFRWNPGSGA 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYK T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL + ++AP S+INREY+AQN+E 
Sbjct: 61  RYKATVICQTCAKVKNVCQTCLLDLEYGLPTQVRDTALAIQSEAPTSDINREYYAQNMES 120

Query: 124 KI-SGAESLINYG-KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH 181
           K+  G +S++  G +A S+G+EMLK+LART PYYKRNRPHICSF+VKG C RG ECPYRH
Sbjct: 121 KMEDGTKSMMEVGNRASSAGKEMLKQLARTNPYYKRNRPHICSFYVKGECKRGSECPYRH 180

Query: 182 EIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDI 241
           E P ENELSHQNI+DRY+G NDPVAKKI++      G  +TPPED+T+TSLF++ +  D 
Sbjct: 181 EKPMENELSHQNIQDRYHGHNDPVAKKIMSTHATNQG--LTPPEDETVTSLFLSSLPTDA 238

Query: 242 DEADLKGYFY------AFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
           +E  ++ Y        +  ++KSVV V KSRCAF+NF  R +AE A     + L++    
Sbjct: 239 NEDSIRTYVVNSLTHISASQLKSVVYVAKSRCAFVNFKDRPTAESAAQAWANGLDMDGDR 298

Query: 296 LKITWGRPRPTGPKTE 311
           + + WGR +   PK++
Sbjct: 299 ISVRWGRGKTGAPKSK 314



>gi|260830806|ref|XP_002610351.1| hypothetical protein BRAFLDRAFT_145268 [Branchiostoma floridae]
 gi|229295716|gb|EEN66361.1| hypothetical protein BRAFLDRAFT_145268 [Branchiostoma floridae]
          Length = 435

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/333 (54%), Positives = 248/333 (74%), Gaps = 11/333 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +SEFPILC+TCLGDNPY+RMT++ FGKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDSEFPILCQTCLGDNPYIRMTKEKFGKECKICQRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LPV+VRD AL + +D P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPVEVRDRALQLKDDVPKSDVNKEYYTQNMEREIANTDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
           ++++   GKA +   +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 SKAVGTLGKAQAPS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R    N  ++ PPED++IT+L+I G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGVNDPVANKLLKRYD--NMPSLKPPEDRSITTLYIGGLGDKITEQD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+S+ +V + +CAFI F +R +AE A +++ + L I    L + WGR + 
Sbjct: 248 LRDHFYQFGEIRSITMVARQQCAFIQFTSRPAAEMAAERTFNKLIINGRRLSVRWGRSQA 307

Query: 306 TGPKTEVQAATTQNVVLPPLESM--QIPAPPGE 336
            G   +++ +   ++ L P+  +   +P PPGE
Sbjct: 308 QGKDKKLEHSEL-DMSLAPVPGLPGALPLPPGE 339



>gi|395333684|gb|EJF66061.1| pre-mRNA-splicing factor SLT11 [Dichomitus squalens LYAD-421 SS1]
          Length = 319

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/304 (59%), Positives = 227/304 (74%), Gaps = 8/304 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +SEFPILCETCLGDNP+VRM++Q FG+ C  C+RPFT+FRW PG GMR+K
Sbjct: 3   KADINKVGWEQSEFPILCETCLGDNPFVRMSKQEFGRACGTCARPFTVFRWNPGTGMRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL Y LP QVRDTAL + ++AP SEINREY+AQN+E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLVYGLPTQVRDTALGIESEAPTSEINREYYAQNMENKLE 122

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
           GA+SL++  K+ S+G+EMLK+LART+PYYKRNRPH+CSFF KG C RGD CPYRHE+P +
Sbjct: 123 GAKSLLDVDKSSSAGKEMLKQLARTDPYYKRNRPHLCSFFAKGECNRGDACPYRHEMPVQ 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           NELS QNI+DRY+G NDPVAKKIL+      G  + PPED++ITSLF+T +  +  E  +
Sbjct: 183 NELSKQNIQDRYHGRNDPVAKKILSTHAANMG--LQPPEDQSITSLFLTSLPANATEESI 240

Query: 247 KGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           +             ++KSVV V K+RCAF+N+  RA+AE A     + L I    + I W
Sbjct: 241 RTRVLKSLPAVQPSQLKSVVHVAKTRCAFVNWRDRATAELAAQAWANGLEIGGETVGIRW 300

Query: 301 GRPR 304
           GR +
Sbjct: 301 GRSK 304



>gi|449547344|gb|EMD38312.1| hypothetical protein CERSUDRAFT_113478 [Ceriporiopsis subvermispora
           B]
          Length = 309

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 226/304 (74%), Gaps = 8/304 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K+D NK GW +S+FPILCETCLGDN +VRM++Q FG+ C  C+RPFT+FRW PG+GMR+K
Sbjct: 3   KSDINKAGWEQSDFPILCETCLGDNAFVRMSKQEFGRSCGTCARPFTVFRWNPGSGMRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL V N AP SEINREY+AQN+E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALAVGNAAPTSEINREYYAQNMEAKLE 122

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
           G +SL++  +A S+ ++MLK+LART+PYYKRNRPHICSF+ KG C RGDECPYRHEIP +
Sbjct: 123 GNKSLLDTSRASSAAKDMLKQLARTDPYYKRNRPHICSFYAKGECKRGDECPYRHEIPVD 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           NELS QNI+DRY+G NDPVA+KI++      G  +TPPED TITSLF+T +  +  E  +
Sbjct: 183 NELSRQNIQDRYHGRNDPVAQKIMSTHAASMG--LTPPEDPTITSLFLTNLPANATEQSI 240

Query: 247 KGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           +             ++KSVV V K+RCAFINF  R SAE A     + L+I    + + W
Sbjct: 241 RTRVLTSLPAVQPAQLKSVVHVTKTRCAFINFKDRTSAELAAQAWANGLDIDGESVNVKW 300

Query: 301 GRPR 304
           GR +
Sbjct: 301 GRSK 304



>gi|389748674|gb|EIM89851.1| hypothetical protein STEHIDRAFT_74165 [Stereum hirsutum FP-91666
           SS1]
          Length = 341

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 226/305 (74%), Gaps = 8/305 (2%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK GW +S+FPILCETCLGDNP+VRM++Q +G+ C  C+RPFT+FRW PG GM
Sbjct: 1   MPPKADINKAGWEQSDFPILCETCLGDNPFVRMSKQEYGRSCGTCARPFTVFRWNPGTGM 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYK T +CQTCAK+KNVCQTCLLDL+Y LP QVRDTAL + N+AP SEINREY+AQN+EG
Sbjct: 61  RYKTTVVCQTCAKIKNVCQTCLLDLEYGLPTQVRDTALQLQNEAPTSEINREYYAQNMEG 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           K+ G +SL++ GKA ++G+EMLK+LART+PYYKRNRPH+CSFF+KG C RG ECPYRHE 
Sbjct: 121 KLEGNKSLLDSGKASTAGKEMLKQLARTDPYYKRNRPHVCSFFIKGDCKRGSECPYRHEK 180

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDE 243
           P ENELS QNI+DRY+G NDPVA+KIL       G  + PPED ++ SLF++ +     E
Sbjct: 181 PIENELSKQNIQDRYHGRNDPVARKILRTHATNQG--LPPPEDPSVVSLFLSSLPPAATE 238

Query: 244 ADLKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLK 297
             ++             +++S+V V KSRCAF+NF  RA+AE A     + L++    L 
Sbjct: 239 TTVRTRVLQSLPMIQPSQVRSIVHVAKSRCAFVNFKDRATAETAAQAWANGLDMDGERLA 298

Query: 298 ITWGR 302
           + WGR
Sbjct: 299 VRWGR 303



>gi|340372441|ref|XP_003384752.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Amphimedon
           queenslandica]
          Length = 412

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/297 (60%), Positives = 230/297 (77%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W +SEFPILC+TCLGDNPY+RM +  +G ECK+C+RPFT+FRW PGA MRYK+TEI
Sbjct: 11  NRLNWEQSEFPILCQTCLGDNPYLRMLKDSYGDECKICNRPFTVFRWCPGARMRYKRTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQ CA+LKNVCQTCLLDL+Y LPVQVRD AL V +D P+S++N+EY+ QNI+ +I+    
Sbjct: 71  CQVCAQLKNVCQTCLLDLEYGLPVQVRDHALKVKDDLPKSDVNKEYYIQNIQKEIANTGN 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E     GKA +   ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE+P + 
Sbjct: 131 TEPGGAVGKAQAPS-DLLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEMPSDP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + LS QNIKDRYYGTNDPVA+K+L + K      ++PPEDK+ITSL+I G+ DDI E D
Sbjct: 190 SDPLSLQNIKDRYYGTNDPVAEKLLGQAK--ELPQLSPPEDKSITSLYIGGLSDDISERD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           L+ +FY FGEI+ + V+HK  CAFI F TR +AE+A++++ S L IK + LK+ WGR
Sbjct: 248 LRDHFYQFGEIEDINVIHKQNCAFITFTTRPAAEKAVEQTFSKLIIKGNRLKVLWGR 304



>gi|432878644|ref|XP_004073359.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Oryzias latipes]
          Length = 426

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/297 (58%), Positives = 229/297 (77%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+CSRPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICSRPFTVFRWCPGTRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L V ++ PRS++N+EY+ QN+E +++   G
Sbjct: 71  CQTCSKMKNVCQTCLLDLEYGLPIQVRDTGLTVKDEIPRSDVNKEYYTQNMEREMANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGQLGKATSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDK+IT+L+I G+ D++ + D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKSITTLYIGGLGDNVTDGD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           LKG+FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR
Sbjct: 248 LKGHFYQFGEIRTITVVQRQQCAFIQFATRQAAEMAAEKSFNKLILNGRRLTVKWGR 304



>gi|410913889|ref|XP_003970421.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Takifugu rubripes]
          Length = 426

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/297 (58%), Positives = 228/297 (76%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG+ MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGSRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L +  D PRS++N+EY+ QNIE +++   G
Sbjct: 71  CQTCSKIKNVCQTCLLDLEYGLPIQVRDTGLAIKEDIPRSDVNKEYYTQNIERELANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGQVGKAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L+I G+ D++ + D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKRASA--MPRLDPPEDKTITTLYIGGLGDNVTDGD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           LK +FY FGEI+++ +V + +CAFI FATR +AE A +KS + L I    L + WGR
Sbjct: 248 LKNFFYQFGEIRTITIVQRQQCAFIQFATRQAAEMAAEKSFNKLIINGRRLTVKWGR 304



>gi|149064345|gb|EDM14548.1| RNA binding motif protein 22, isoform CRA_a [Rattus norvegicus]
          Length = 377

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI++V VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTVTVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|499042324|ref|XP_004571771.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Maylandia zebra]
          Length = 427

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/297 (58%), Positives = 228/297 (76%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGTRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L+V ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKMKNVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGQLGKAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDK+IT+L+I G+ D + + D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKSITTLYIGGLGDTVTDGD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           LK +FY FGEI+++ +V + +CAFI FATR SAE A +KS + L I    L + WGR
Sbjct: 248 LKSHFYQFGEIRTITIVQRQQCAFIQFATRQSAETAAEKSFNKLIINGRRLTVKWGR 304



>gi|348535548|ref|XP_003455262.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Oreochromis
           niloticus]
          Length = 427

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/297 (58%), Positives = 228/297 (76%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGTRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L+V ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKMKNVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGQLGKAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDK+IT+L+I G+ D + + D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKSITTLYIGGLGDTVTDGD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           LK +FY FGEI+++ +V + +CAFI FATR SAE A +KS + L I    L + WGR
Sbjct: 248 LKSHFYQFGEIRTITIVQRQQCAFIQFATRQSAETAAEKSFNKLIINGRRLTVKWGR 304



>gi|12858161|dbj|BAB31220.1| unnamed protein product [Mus musculus]
          Length = 420

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|301765526|ref|XP_002918204.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Ailuropoda
           melanoleuca]
          Length = 454

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 45  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 104

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 105 CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 164

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 165 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 223

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 224 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 281

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 282 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 341

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 342 ARGKEKEKDGTTDSGIKLEPV 362



>gi|426229912|ref|XP_004009027.1| PREDICTED: pre-mRNA-splicing factor RBM22 isoform 1 [Ovis aries]
          Length = 430

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|61371511|gb|AAX43680.1| RNA binding motif protein 22 [synthetic construct]
          Length = 421

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|71043848|ref|NP_001020847.1| pre-mRNA-splicing factor RBM22 [Rattus norvegicus]
 gi|81907895|sp|Q4V7D7.1|RBM22_RAT RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|66910908|gb|AAH97991.1| RNA binding motif protein 22 [Rattus norvegicus]
          Length = 420

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI++V VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTVTVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|296193255|ref|XP_002744418.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Callithrix jacchus]
          Length = 420

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|507960323|ref|XP_004686945.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Condylura cristata]
          Length = 422

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTESGIKLEPV 328



>gi|504150384|ref|XP_004587587.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Ochotona princeps]
          Length = 420

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTESGIKLEPV 328



>gi|403285535|ref|XP_003934078.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Saimiri boliviensis
           boliviensis]
          Length = 420

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|8922328|ref|NP_060517.1| pre-mRNA-splicing factor RBM22 [Homo sapiens]
 gi|110625591|ref|NP_080052.1| pre-mRNA-splicing factor RBM22 [Mus musculus]
 gi|383873093|ref|NP_001244425.1| pre-mRNA-splicing factor RBM22 [Macaca mulatta]
 gi|73954184|ref|XP_546302.2| PREDICTED: pre-mRNA-splicing factor RBM22 [Canis lupus familiaris]
 gi|114602891|ref|XP_001167240.1| PREDICTED: pre-mRNA-splicing factor RBM22 isoform 2 [Pan
           troglodytes]
 gi|291387642|ref|XP_002710359.1| PREDICTED: RNA binding motif protein 22 [Oryctolagus cuniculus]
 gi|332235023|ref|XP_003266703.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Nomascus leucogenys]
 gi|344265156|ref|XP_003404652.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Loxodonta africana]
 gi|348583291|ref|XP_003477406.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Cavia porcellus]
 gi|397517732|ref|XP_003829060.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Pan paniscus]
 gi|402873102|ref|XP_003900425.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Papio anubis]
 gi|410949463|ref|XP_003981441.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Felis catus]
 gi|426350648|ref|XP_004042882.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Gorilla gorilla gorilla]
 gi|466061152|ref|XP_004280390.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Orcinus orca]
 gi|470636755|ref|XP_004323703.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Tursiops truncatus]
 gi|478508830|ref|XP_004428697.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Ceratotherium simum
           simum]
 gi|488564733|ref|XP_004472054.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Dasypus novemcinctus]
 gi|507537151|ref|XP_004652603.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Jaculus jaculus]
 gi|511826177|ref|XP_004737867.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Mustela putorius furo]
 gi|511967236|ref|XP_004801721.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Mustela putorius furo]
 gi|512985058|ref|XP_004854489.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Heterocephalus glaber]
 gi|74762758|sp|Q9NW64.1|RBM22_HUMAN RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22; AltName: Full=Zinc
           finger CCCH domain-containing protein 16
 gi|75075716|sp|Q4R4J1.1|RBM22_MACFA RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|81913160|sp|Q8BHS3.1|RBM22_MOUSE RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|7022226|dbj|BAA91521.1| unnamed protein product [Homo sapiens]
 gi|12053361|emb|CAB66867.1| hypothetical protein [Homo sapiens]
 gi|13097297|gb|AAH03402.1| RNA binding motif protein 22 [Homo sapiens]
 gi|26337089|dbj|BAC32229.1| unnamed protein product [Mus musculus]
 gi|51480449|gb|AAH80205.1| RNA binding motif protein 22 [Mus musculus]
 gi|60654947|gb|AAX32038.1| RNA binding motif protein 22 [synthetic construct]
 gi|67971284|dbj|BAE01984.1| unnamed protein product [Macaca fascicularis]
 gi|74151559|dbj|BAE38885.1| unnamed protein product [Mus musculus]
 gi|74198886|dbj|BAE30665.1| unnamed protein product [Mus musculus]
 gi|74212676|dbj|BAE31073.1| unnamed protein product [Mus musculus]
 gi|74214020|dbj|BAE29427.1| unnamed protein product [Mus musculus]
 gi|74223191|dbj|BAE40732.1| unnamed protein product [Mus musculus]
 gi|117646096|emb|CAL38515.1| hypothetical protein [synthetic construct]
 gi|119582115|gb|EAW61711.1| RNA binding motif protein 22, isoform CRA_b [Homo sapiens]
 gi|208965472|dbj|BAG72750.1| RNA binding motif protein 22 [synthetic construct]
 gi|296485163|tpg|DAA27278.1| TPA: pre-mRNA-splicing factor RBM22 [Bos taurus]
          Length = 420

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|426229914|ref|XP_004009028.1| PREDICTED: pre-mRNA-splicing factor RBM22 isoform 2 [Ovis aries]
          Length = 417

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|512854675|ref|XP_004888135.1| PREDICTED: pre-mRNA-splicing factor RBM22, partial [Heterocephalus
           glaber]
          Length = 412

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 3   NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 62

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 63  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 122

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 123 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 181

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 182 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 239

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 240 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 299

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 300 ARGKEKEKDGTTDSGIKLEPV 320



>gi|148677878|gb|EDL09825.1| mCG6024, isoform CRA_c [Mus musculus]
          Length = 421

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 233/314 (74%), Gaps = 8/314 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQN 319
              K + +  TT +
Sbjct: 308 ARGKEKEKDGTTDS 321



>gi|148677877|gb|EDL09824.1| mCG6024, isoform CRA_b [Mus musculus]
          Length = 436

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 233/314 (74%), Gaps = 8/314 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 26  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 85

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 86  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 145

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 146 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 204

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 205 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 262

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 263 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 322

Query: 306 TGPKTEVQAATTQN 319
              K + +  TT +
Sbjct: 323 ARGKEKEKDGTTDS 336



>gi|126290582|ref|XP_001369324.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Monodelphis domestica]
          Length = 420

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/321 (54%), Positives = 236/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNVEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA ++  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGVLGKATATS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTISETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEMAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E +  T   + L P+
Sbjct: 308 ARGKEKEKEGTTDSGIKLEPV 328



>gi|338713130|ref|XP_001917686.2| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing factor RBM22-like
           [Equus caballus]
          Length = 421

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/331 (54%), Positives = 240/331 (72%), Gaps = 14/331 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQN-VVLPPLESMQIPAPPG 335
              K + +  TT + + L P     +P  PG
Sbjct: 308 ARXKEKEKDGTTDSGIKLEP-----VPGLPG 333



>gi|449267139|gb|EMC78105.1| Pre-mRNA-splicing factor RBM22 [Columba livia]
          Length = 420

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 237/316 (75%), Gaps = 8/316 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ ++ P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKDEMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E+D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTISESD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVV 321
              K + +  TT++ +
Sbjct: 308 ARGKEKDKEGTTESGI 323



>gi|224067689|ref|XP_002198708.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Taeniopygia guttata]
          Length = 420

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 237/316 (75%), Gaps = 8/316 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ ++ P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKDEMPKSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E+D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITESD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVV 321
              K + +  TT++ +
Sbjct: 308 ARGKEKDKEGTTESGI 323



>gi|327265402|ref|XP_003217497.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Anolis
           carolinensis]
          Length = 421

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/321 (54%), Positives = 236/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI---SG 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ +D P+S++N+EY+ QN+E +I    G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKDDMPKSDVNKEYYTQNMEREIMNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E +  T   + L P+
Sbjct: 308 ARGKEKEREGITDSGIKLEPV 328



>gi|507645302|ref|XP_004631365.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Octodon degus]
          Length = 420

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPED+TIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDETITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI++V VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYRFGEIRTVAVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|471406496|ref|XP_004384944.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Trichechus manatus
           latirostris]
          Length = 420

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 234/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GK  S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKTTSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|83715976|ref|NP_001032907.1| pre-mRNA-splicing factor RBM22 [Bos taurus]
 gi|115502617|sp|Q3B7L8.1|RBM22_BOVIN RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|78174395|gb|AAI07552.1| RNA binding motif protein 22 [Bos taurus]
          Length = 420

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 234/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS +   +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKFIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|47086019|ref|NP_998379.1| pre-mRNA-splicing factor RBM22 [Danio rerio]
 gi|326677871|ref|XP_003200934.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Danio rerio]
 gi|82237380|sp|Q6NZZ9.1|RBM22_DANRE RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|41388933|gb|AAH65892.1| RNA binding motif protein 22 [Danio rerio]
 gi|49619055|gb|AAT68112.1| FLJ10290-like [Danio rerio]
          Length = 425

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 238/320 (74%), Gaps = 8/320 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLG+NPY+RMT++ FGKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDSDFPILCQTCLGENPYIRMTKEKFGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L+V ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKMKNVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGLLGKAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L  ++      +  P+DK+IT+L+I G+ +++ +++
Sbjct: 190 DDPLADQNIKDRYYGINDPVANKLL--MRASTMPRLDVPDDKSITTLYIGGLGENVTDSE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ +V + +CAFI FATR +AE A +KS + L I    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITIVQRQQCAFIQFATRQAAETAAEKSFNKLIINGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVVLPPL 325
              K E    T   + L P+
Sbjct: 308 ARGKGEKDGVTESGIRLEPV 327



>gi|197098656|ref|NP_001125624.1| pre-mRNA-splicing factor RBM22 [Pongo abelii]
 gi|75070751|sp|Q5RAY5.1|RBM22_PONAB RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|55728671|emb|CAH91075.1| hypothetical protein [Pongo abelii]
          Length = 420

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+R+T++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRVTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|395817744|ref|XP_003782315.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Otolemur garnettii]
          Length = 406

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/297 (58%), Positives = 226/297 (76%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR 304



>gi|326928574|ref|XP_003210452.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Meleagris
           gallopavo]
          Length = 420

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/316 (54%), Positives = 237/316 (75%), Gaps = 8/316 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ ++ P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKDEMPKSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E+D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTITESD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVV 321
              K + +  TT++ +
Sbjct: 308 ARGKEKDKEGTTESGI 323



>gi|334311193|ref|XP_003339587.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Monodelphis
           domestica]
          Length = 422

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/407 (46%), Positives = 251/407 (61%), Gaps = 67/407 (16%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLG+NPYVRMT+  +GK CK+C++PFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDSDFPILCQTCLGENPYVRMTKDIYGKACKICAKPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDVGLSLKDDMPKSDVNQEYYTQNVEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA ++  +ML KLART PYYKRN PHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGLLGKATATS-DMLLKLARTTPYYKRNHPHICSFWVKGECKRGEECPYRHEKPTNP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           E+ L+ QNIKDRYY  NDPVA K+L R       ++ PP+DKTIT+L++ G+ D I EAD
Sbjct: 190 EDPLADQNIKDRYYAINDPVADKLLKR--ASTMPHLDPPDDKTITTLYVGGLGDTISEAD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV +  CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQHCAFIQFATRQAAEMAAEKSFNKLILNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQ-------------------------------------------NVVL 322
              K + +  TT                                            N+ L
Sbjct: 308 ARGKEKEKEGTTDSGLKLEPVPGLPGALPPPPPPPTAEEASANYFNLPPSGLPAVVNIAL 367

Query: 323 PPLESMQIPAPPGEAPSDF----------------LYPSQDPTYQGS 353
           PP   +  P+PPG  P  F                 YPSQDP   G+
Sbjct: 368 PPPSRIAPPSPPGFGPQVFHPMGPPPPFMPAPGPIHYPSQDPQRMGA 414



>gi|74195542|dbj|BAE39585.1| unnamed protein product [Mus musculus]
          Length = 420

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 234/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VK  C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKRECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPV 328



>gi|148231899|ref|NP_001080776.1| pre-mRNA-splicing factor RBM22 [Xenopus laevis]
 gi|82241534|sp|Q7ZXB5.1|RBM22_XENLA RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|28280011|gb|AAH45067.1| Cg14641-prov protein [Xenopus laevis]
          Length = 417

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/297 (57%), Positives = 229/297 (77%), Gaps = 8/297 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRDT +++ ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDTGVSLKDEMPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDR+YG NDPVA K+L R        + PPEDK+IT+L++ G+ D I E++
Sbjct: 190 DDPLADQNIKDRFYGINDPVADKLLKRA--STMPRLDPPEDKSITTLYVGGLGDTISESE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           L+ +FY FGEI+++ VV + +CAFI FATR SAE A +KS + L +    L + WGR
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQSAETAAEKSFNKLIVNGRRLNVKWGR 304



>gi|395504854|ref|XP_003756761.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Sarcophilus harrisii]
          Length = 420

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 235/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TC G+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCPGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNVEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA ++  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGVLGKATATS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTISETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEMAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E +  T   + L P+
Sbjct: 308 ARGKEKEKEGTTDSGIKLEPV 328



>gi|431918047|gb|ELK17275.1| Pre-mRNA-splicing factor RBM22 [Pteropus alecto]
 gi|440904796|gb|ELR55260.1| Pre-mRNA-splicing factor RBM22 [Bos grunniens mutus]
          Length = 424

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 234/325 (72%), Gaps = 13/325 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYR E+  E 
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRQELKHEK 189

Query: 187 -----NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDI 241
                + L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I
Sbjct: 190 PTDPDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTI 247

Query: 242 DEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
            E DL+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WG
Sbjct: 248 TETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWG 307

Query: 302 RPRPT-GPKTEVQAATTQNVVLPPL 325
           R +   G + E    T   + L P+
Sbjct: 308 RSQAARGKEKEKDGTTDSGIKLEPV 332



>gi|45360865|ref|NP_989108.1| pre-mRNA-splicing factor RBM22 [Xenopus (Silurana) tropicalis]
 gi|82237531|sp|Q6P616.1|RBM22_XENTR RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|38566013|gb|AAH62518.1| RNA binding motif protein 22 [Xenopus (Silurana) tropicalis]
 gi|89267971|emb|CAJ81393.1| RNA binding motif protein 5 [Xenopus (Silurana) tropicalis]
          Length = 417

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 237/321 (73%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD   ++ ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGASLKDEMPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDK+IT+L++ G+ D I E++
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKSITTLYVGGLGDTISESE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEMAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E   ++   + L P+
Sbjct: 308 ARGKERERDGSSDPGMKLEPV 328



>gi|472587753|gb|EMS25249.1| pre-mRNA-splicing factor RBM22/SLT11 [Rhodosporidium toruloides
           NP11]
          Length = 332

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/309 (57%), Positives = 220/309 (71%), Gaps = 9/309 (2%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK G   S+FP LC  CLG NPY+RM++Q  G ECKVC+RPFT+FRWLPG GM
Sbjct: 1   MPPKADLNKAGHESSDFPSLCNVCLGPNPYIRMSKQPLGAECKVCTRPFTVFRWLPGQGM 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYKKTEICQ CAK KNVCQTCLLDLQ+ LP QVRDT L V + AP S INREY+AQN+E 
Sbjct: 61  RYKKTEICQVCAKAKNVCQTCLLDLQFGLPTQVRDTVLGVQSKAPTSNINREYYAQNLEK 120

Query: 124 --KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH 181
             +  GA     +GKADS+GR++LK+LAR +P YKRNRPH+CSF+ KG+C RGD CPYRH
Sbjct: 121 AQEEGGASGAFQFGKADSAGRDLLKRLARNDPTYKRNRPHLCSFYAKGACNRGDACPYRH 180

Query: 182 EIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDI 241
           E+P EN LSHQNIKDRY+G NDPVA+KIL +  G  G  + PP D  ITSLF+T +    
Sbjct: 181 ELPVENALSHQNIKDRYHGNNDPVARKILAKHAGEAG--LAPPADTDITSLFLTSLPATA 238

Query: 242 DEADLKGYFYAFG-----EIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDL 296
            E  ++ +F A       ++KS+V+V  S+ AF+NF  R +AE A +K    + +  H +
Sbjct: 239 TEDAIRHWFTATAGLPDNKLKSIVLVSASKSAFVNFRDRDAAEMAAEKCSVGVKVDGHPV 298

Query: 297 KITWGRPRP 305
           K+ WGR RP
Sbjct: 299 KVQWGRSRP 307



>gi|157422918|gb|AAI53464.1| RNA binding motif protein 22 [Danio rerio]
          Length = 425

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 237/320 (74%), Gaps = 8/320 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLG+NPY+RMT++ FGKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDSDFPILCQTCLGENPYIRMTKEKFGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KNVCQTCLLDL+Y LP+QVRDT L+V ++ PRS++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKMKNVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA SS  +ML KLART PYYKRNRPHICSF+VKG C RG ECPYRHE P   
Sbjct: 131 TRPVGLLGKAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGVECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L  ++      +  P+DK+IT+L+I G+ +++ +++
Sbjct: 190 DDPLADQNIKDRYYGINDPVANKLL--MRASTMPRLDVPDDKSITTLYIGGLGENVTDSE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ +V + +CAFI FATR +AE A +KS + L I    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITIVQRQQCAFIQFATRQAAETAAEKSFNKLIINGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVVLPPL 325
              K E    T   + L P+
Sbjct: 308 ARGKGEKDGVTESGIRLEPV 327



>gi|57525003|ref|NP_001006151.1| pre-mRNA-splicing factor RBM22 [Gallus gallus]
 gi|82233932|sp|Q5ZM16.1|RBM22_CHICK RecName: Full=Pre-mRNA-splicing factor RBM22; AltName:
           Full=RNA-binding motif protein 22
 gi|53127796|emb|CAG31227.1| hypothetical protein RCJMB04_3g16 [Gallus gallus]
          Length = 420

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 237/316 (75%), Gaps = 8/316 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ ++ P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKDEMPKSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ Q+IKDRYYG NDPVA K+L R        + PP+DKTIT+L++ G+ D I E+D
Sbjct: 190 DDPLADQDIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKTITTLYVGGLGDTITESD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVV 321
              K + +  TT++ +
Sbjct: 308 ARGKEKDKEGTTESGI 323



>gi|291243067|ref|XP_002741428.1| PREDICTED: RNA binding motif protein 22-like [Saccoglossus
           kowalevskii]
          Length = 429

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/335 (52%), Positives = 243/335 (72%), Gaps = 11/335 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRMT++ +GKECK+C+RPFTIFRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMTKEKYGKECKICARPFTIFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+K+KN CQTCLLDL+Y LP+QVRD AL++ +D P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKVKNCCQTCLLDLEYGLPLQVRDAALSIKDDMPKSDVNKEYYTQNMEREIANSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
            +++   GK+ S   ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TQAVGAVGKSQSPS-DLLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDR+YG NDPVA K+LNR        +  PED+TIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRFYGVNDPVAHKLLNR--AATMPKLEAPEDRTITTLYVGGLGDKISEKD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+S+ VV + +CAF+ F TR S+E A ++S + L +    L I WGR + 
Sbjct: 248 LRDHFYQFGEIRSINVVARQQCAFVQFTTRQSSELAAERSFNKLIMNGRRLNIKWGRSQA 307

Query: 306 TGPKTEVQAATTQNVV-LPPLESM--QIPAPPGEA 337
                  +    +++V L P+  +   +P PP + 
Sbjct: 308 QQALMGKKDGEFKDIVQLEPVPGLPGALPLPPTDG 342



>gi|505854452|ref|XP_004622809.1| PREDICTED: LOW QUALITY PROTEIN: RNA binding motif protein 22 [Sorex
           araneus]
          Length = 432

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 233/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W   +FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEXXDFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L   +      + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLK--QASIMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDGTTESGIKLEPV 328



>gi|302690562|ref|XP_003034960.1| hypothetical protein SCHCODRAFT_81197 [Schizophyllum commune H4-8]
 gi|300108656|gb|EFJ00058.1| hypothetical protein SCHCODRAFT_81197 [Schizophyllum commune H4-8]
          Length = 324

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/306 (58%), Positives = 226/306 (73%), Gaps = 9/306 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +SEFPILCETCLGDNP+VRM++Q +G+ C  C+RPFT+FRW PG GMR+K
Sbjct: 3   KADLNKAGWEQSEFPILCETCLGDNPFVRMSKQEYGRSCGTCARPFTVFRWNPGTGMRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL V NDAP S+INREY+AQN+E K++
Sbjct: 63  TTVICQTCAKVKNVCQTCLLDLEYGLPTQVRDTALGVVNDAPTSDINREYYAQNMEAKMA 122

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
             +S +N  +  S+G+EMLK+LART+PYYKRNRPHICSFFVKG C RG ECPYRHE+P +
Sbjct: 123 DNQSAVNTVRTSSAGKEMLKQLARTDPYYKRNRPHICSFFVKGECKRGKECPYRHEMPVQ 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           NELS+Q ++DRY+G NDPVAKKI+ +     G  + PP+D+TITSLF++ +  +  EA +
Sbjct: 183 NELSNQKLQDRYHGVNDPVAKKIMRQHAEAQG--LKPPDDETITSLFVSSLPANSTEASV 240

Query: 247 KGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD-LKIT 299
           +              I+SVV V KSRCAFINF  R +AE A     + L+  +     + 
Sbjct: 241 RNRVIQTLPSISPERIRSVVHVEKSRCAFINFKDRQAAETAAAAWSNGLDFDDGTRASVK 300

Query: 300 WGRPRP 305
           WGR RP
Sbjct: 301 WGRSRP 306



>gi|355691758|gb|EHH26943.1| hypothetical protein EGK_17030 [Macaca mulatta]
          Length = 421

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 235/322 (72%), Gaps = 10/322 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQY-NLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS--- 126
           CQTC+KLKNVCQTCLLDL+Y  LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYAGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSD 130

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
           G   +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P  
Sbjct: 131 GTRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTD 189

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
            ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E 
Sbjct: 190 PDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITET 247

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +
Sbjct: 248 DLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQ 307

Query: 305 PT-GPKTEVQAATTQNVVLPPL 325
              G + E    T   + L P+
Sbjct: 308 AARGKEKEKDGTTDSGIKLEPV 329



>gi|354488436|ref|XP_003506375.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Cricetulus griseus]
          Length = 431

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 231/319 (72%), Gaps = 9/319 (2%)

Query: 13  QGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQ 72
           Q W   +FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQ
Sbjct: 24  QDWEHRDFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQ 83

Query: 73  TCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---GAE 129
           TC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G  
Sbjct: 84  TCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTR 143

Query: 130 SLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--EN 187
            +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   ++
Sbjct: 144 PVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDD 202

Query: 188 ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK 247
            L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E DL+
Sbjct: 203 PLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETDLR 260

Query: 248 GYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT- 306
            +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +   
Sbjct: 261 NHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAAR 320

Query: 307 GPKTEVQAATTQNVVLPPL 325
           G + E    T   + L P+
Sbjct: 321 GKEKEKDGTTDSGIKLEPV 339



>gi|119582116|gb|EAW61712.1| RNA binding motif protein 22, isoform CRA_c [Homo sapiens]
          Length = 421

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 235/322 (72%), Gaps = 10/322 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR-HEIPE- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYR HE P  
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRQHEKPTD 189

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
            ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E 
Sbjct: 190 PDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITET 247

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +
Sbjct: 248 DLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQ 307

Query: 305 PT-GPKTEVQAATTQNVVLPPL 325
              G + E    T   + L P+
Sbjct: 308 AARGKEKEKDGTTDSGIKLEPV 329



>gi|355750335|gb|EHH54673.1| hypothetical protein EGM_15557 [Macaca fascicularis]
          Length = 421

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/322 (54%), Positives = 235/322 (72%), Gaps = 10/322 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQY-NLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS--- 126
           CQTC+KLKN+CQTCLLDL+Y  LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   
Sbjct: 71  CQTCSKLKNICQTCLLDLEYAGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSD 130

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
           G   +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P  
Sbjct: 131 GTRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTD 189

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
            ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E 
Sbjct: 190 PDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITET 247

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +
Sbjct: 248 DLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQ 307

Query: 305 PT-GPKTEVQAATTQNVVLPPL 325
              G + E    T   + L P+
Sbjct: 308 AARGKEKEKDGTTDSGIKLEPV 329



>gi|392566926|gb|EIW60101.1| hypothetical protein TRAVEDRAFT_164606 [Trametes versicolor
           FP-101664 SS1]
          Length = 325

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 224/305 (73%), Gaps = 9/305 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +SEFPILCETCLGDNP+VRM++Q FG+ C  C+RPFT+FRW PG GMR+K
Sbjct: 3   KADINKAGWEQSEFPILCETCLGDNPFVRMSKQEFGRSCGTCARPFTVFRWNPGTGMRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL V ++AP SEINREY+AQN+E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGVESEAPTSEINREYYAQNMESKLD 122

Query: 127 G-AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           G A+SL++  +  S+G++MLK+LART+PYYKRN+PH+CSF+ KG C RGD CPYRHE P 
Sbjct: 123 GAAKSLLDLNRTSSAGKDMLKQLARTDPYYKRNKPHVCSFYAKGECNRGDACPYRHEKPV 182

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           +NELS QNI+DRY+G NDPVAKKI++      G  + PPED+ ITSLF++ +     E  
Sbjct: 183 QNELSKQNIQDRYHGRNDPVAKKIMSTHAANMG--LQPPEDQNITSLFLSQLSPSSTEES 240

Query: 246 LKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
           ++             ++KSVV V KSRCAF+N+  RA+AE A     + L I    + + 
Sbjct: 241 VRTRVLKSLPAVQPSQLKSVVHVGKSRCAFVNWRDRATAELAAQAWANGLEIDGETVGVR 300

Query: 300 WGRPR 304
           WGR +
Sbjct: 301 WGRSK 305



>gi|224106323|ref|XP_002314129.1| predicted protein [Populus trichocarpa]
 gi|222850537|gb|EEE88084.1| predicted protein [Populus trichocarpa]
          Length = 531

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 249/375 (66%), Gaps = 36/375 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           DP   GW  S+FPI+CE+CLGDNPYVRMTR  F KECK+C+RPFT+FRW PG   R+KKT
Sbjct: 8   DPEADGWERSDFPIICESCLGDNPYVRMTRADFDKECKICTRPFTVFRWRPGRDARFKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA ++  + + KL RT PYYKRNR H+CSFF +G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSYGKAQAN--DTILKLQRTTPYYKRNRAHVCSFFARGECTRGAECPYRHEMPI 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G+  ++ PPED++I +L++ G++  I+E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLN--KAGDMPSLEPPEDESIKTLYVGGLDARINEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A  +  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDQFYAHGEIESIKMVPQRAIAFVTYTTREGAEKAAAELSNRLVIKGLRLKLMWGRPQA 303

Query: 306 TGPKTEV------QAATTQNVVL---------------------PPLESMQIPAPPGEAP 338
             P++E       QAA   + +L                     PP+    IP PP +  
Sbjct: 304 PKPESESSDEARQQAAMAHSGMLPRAVVSQQHNHLNPPGTQDQHPPMHYFNIPPPPQQ-- 361

Query: 339 SDFLYPSQDPTYQGS 353
               YPS DP   G+
Sbjct: 362 ERAFYPSMDPQRMGA 376



>gi|224106319|ref|XP_002314127.1| predicted protein [Populus trichocarpa]
 gi|222850535|gb|EEE88082.1| predicted protein [Populus trichocarpa]
          Length = 531

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 249/375 (66%), Gaps = 36/375 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           DP   GW  S+FPI+CE+CLGDNPYVRMTR  F KECK+C+RPFT+FRW PG   R+KKT
Sbjct: 8   DPEADGWERSDFPIICESCLGDNPYVRMTRADFDKECKICTRPFTVFRWRPGRDARFKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA ++  + + KL RT PYYKRNR H+CSFF +G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSYGKAQAN--DTILKLQRTTPYYKRNRAHVCSFFARGECTRGAECPYRHEMPI 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G+  ++ PPED++I +L++ G++  I+E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLN--KAGDMPSLEPPEDESIKTLYVGGLDARINEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A  +  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDQFYAHGEIESIKMVPQRAIAFVTYTTREGAEKAAAELSNRLVIKGLRLKLMWGRPQA 303

Query: 306 TGPKTEV------QAATTQNVVL---------------------PPLESMQIPAPPGEAP 338
             P++E       QAA   + +L                     PP+    IP PP +  
Sbjct: 304 PKPESESSDEARQQAAMAHSGMLPRAVVSQQHNHLNPPGTQDQHPPMHYFNIPPPPQQ-- 361

Query: 339 SDFLYPSQDPTYQGS 353
               YPS DP   G+
Sbjct: 362 ERAFYPSMDPQRMGA 376



>gi|472396723|ref|XP_004417583.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Odobenus rosmarus
           divergens]
          Length = 440

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 232/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  M +KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMHFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQT LLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTYLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEKEISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ +V + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITIVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P 
Sbjct: 308 ARGKEKEKDGTTDSGIKLEPF 328



>gi|444723694|gb|ELW64335.1| Pre-mRNA-splicing factor RBM22 [Tupaia chinensis]
          Length = 428

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/329 (54%), Positives = 235/329 (71%), Gaps = 17/329 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR------- 180
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYR       
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRQGLSCIS 189

Query: 181 -HEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV 237
            HE P   ++ L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+
Sbjct: 190 VHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGL 247

Query: 238 EDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLK 297
            D I E DL+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L 
Sbjct: 248 GDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLN 307

Query: 298 ITWGRPRPT-GPKTEVQAATTQNVVLPPL 325
           + WGR +   G + E    T   + L P+
Sbjct: 308 VKWGRSQAARGKEKEKDGTTDSGIKLEPV 336



>gi|432114097|gb|ELK36142.1| Pre-mRNA-splicing factor RBM22 [Myotis davidii]
          Length = 384

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 232/321 (72%), Gaps = 9/321 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY++MT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIQMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQ C+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQACSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
              +   GKA S+  +ML KLART PY +RNRPHICSF+VKG C RGDECPYRHE P + 
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYSRRNRPHICSFWVKGECRRGDECPYRHETPTDP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            N L+ QNIKDRYYG NDPVA K+L R        + P ED+TIT+L++ G+ D I E D
Sbjct: 190 ANALADQNIKDRYYGINDPVADKLLKRASA--MPRLDPSEDRTITTLYVGGLGDTITETD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR + 
Sbjct: 248 LRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGPRLNVQWGRSQA 307

Query: 306 T-GPKTEVQAATTQNVVLPPL 325
             G + E    T   + L P+
Sbjct: 308 ARGKEKEKDRTTDSGIKLEPV 328



>gi|393216915|gb|EJD02405.1| hypothetical protein FOMMEDRAFT_109756 [Fomitiporia mediterranea
           MF3/22]
          Length = 338

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 230/309 (74%), Gaps = 10/309 (3%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK GW +SEFPILCETCLGDN +VRM++Q FG+ C  C+RPFT+FRW PGAGM
Sbjct: 1   MPPKADINKAGWEQSEFPILCETCLGDNAFVRMSKQEFGRSCGTCARPFTVFRWNPGAGM 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           R+K T +CQTCAK+KNVCQTCLLDL+Y LP QVRD AL + + AP S+INREYFAQN++G
Sbjct: 61  RFKTTVVCQTCAKIKNVCQTCLLDLEYGLPTQVRDAALAIKSAAPSSDINREYFAQNMDG 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           K+ G +SL++ G+A S+G+EMLK+LART+PYYKRNRP +CSFFVKG C RG ECPYRHE+
Sbjct: 121 KLEGNKSLLDSGRAHSAGKEMLKQLARTDPYYKRNRPKVCSFFVKGDCNRGTECPYRHEM 180

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDE 243
           PE+NELS QN++DRY+G NDPVA+KI        G  + PPED++ITSLF++ +  +  E
Sbjct: 181 PEDNELSKQNMQDRYHGRNDPVARKIFTEHAKTQG--LEPPEDESITSLFLSSLPQNATE 238

Query: 244 ADLKGYFYA--------FGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
             ++ +              I+SVV V KSRCAF+NF +RA+AE+A +   + L I    
Sbjct: 239 QSIRTHVVQTLPPSTNPATVIRSVVYVAKSRCAFVNFTSRAAAERAAEVWSNGLEIDGVM 298

Query: 296 LKITWGRPR 304
           + I WGR R
Sbjct: 299 VGIKWGRSR 307



>gi|390361169|ref|XP_003729862.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing factor RBM22-like
           [Strongylocentrotus purpuratus]
          Length = 483

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 225/299 (75%), Gaps = 8/299 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W E++FPILC+TCLGDNPYVRMT++ FG+ECK+C RPFTIFRW PGA MR+KKTE+
Sbjct: 11  NRLNWEEADFPILCQTCLGDNPYVRMTKEKFGRECKICQRPFTIFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAE- 129
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD ALNV ++ P+S++N+EY++QN+E +++ AE 
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAALNVKDEMPKSDVNKEYYSQNMERELANAEG 130

Query: 130 --SLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
             +L   GKA +   ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 NQALGAVGKAQAPS-DLLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDR+YG +DPVA K++ R        +  PED+ IT+L++ G+ D + E D
Sbjct: 190 DDPLADQNIKDRFYGVDDPVADKLMRRAAA--MPKLEAPEDRMITTLYVGGLGDKVTEED 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           LKG+FY FGE++S+ VV K +CAF+ F  R  AE A + S   L I    L I WG+P+
Sbjct: 248 LKGHFYQFGELRSINVVPKQQCAFVTFTNRQGAEXAAENSFQKLIIXGRMLNIKWGKPQ 306



>gi|449453956|ref|XP_004144722.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Cucumis sativus]
 gi|449525922|ref|XP_004169965.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Cucumis sativus]
          Length = 517

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 249/376 (66%), Gaps = 38/376 (10%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DLEADGWERSDFPIICESCLGDNPYVRMTKADYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKARPN--DTILKLQRTTPYYKRNRAHVCSFYIRGECTRGSECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PPED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLN--KAGEMPSLEPPEDESIRTLYVGGLDARVSEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L I+   LK+ WGRP+ 
Sbjct: 244 LRDNFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELSNKLVIRGLRLKLMWGRPQ- 302

Query: 306 TGPKTEV-------QAATTQNVVLP---------------------PLESMQIPAPPGEA 337
             PK E+       QAA   + +LP                      +    IP PP + 
Sbjct: 303 -APKAEIEGSDEAKQAAVAHSGMLPRAVISQQHNQLHPPGTHDQPQAMHYFNIPPPPPQQ 361

Query: 338 PSDFLYPSQDPTYQGS 353
              F YPS DP   G+
Sbjct: 362 ERAF-YPSMDPQRMGA 376



>gi|462414448|gb|EMJ19185.1| hypothetical protein PRUPE_ppa005493mg [Prunus persica]
          Length = 458

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/364 (51%), Positives = 244/364 (67%), Gaps = 30/364 (8%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           GW  S+FPI+CE+CLGDNPYVRMTR  + KECK+C+RPFT+FRW PG   R+KK+EICQT
Sbjct: 13  GWERSDFPIICESCLGDNPYVRMTRADYDKECKICTRPFTVFRWRPGRDARFKKSEICQT 72

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI-SGAES 130
           C+KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA P+S++NRE+FA+  + K  +G + 
Sbjct: 73  CSKLKNVCQVCLLDLEYGLPVQVRDTALAISSNDAIPKSDVNREFFAEEHDRKARAGIDY 132

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELS 190
             +YGKA  S  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+P   ELS
Sbjct: 133 ESSYGKARPS--DTILKLQRTTPYYKRNRAHVCSFYIRGECTRGAECPYRHEMPITGELS 190

Query: 191 HQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYF 250
            QNIKDRYYG NDPVA K+LN  K G   ++ PPED++I +L++ G+++ I E DL+  F
Sbjct: 191 QQNIKDRYYGVNDPVAMKLLN--KAGEMPSLEPPEDESIRTLYVGGLDERISEQDLRDQF 248

Query: 251 YAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKT 310
           YA GEI+SV +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+     +
Sbjct: 249 YAHGEIESVRMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQAPKQDS 308

Query: 311 EVQAATTQNVV-----LP----------------PLESMQIPAPPGEAPSDFLYPSQDPT 349
           E  A   Q  V     LP                P+    +P PP +  S   YPS DP 
Sbjct: 309 EGTAEARQQAVAHSGLLPRAVISQQQNHLQDQPAPVHYYNMPPPPSQERS--FYPSMDPQ 366

Query: 350 YQGS 353
             G+
Sbjct: 367 RMGA 370



>gi|221128187|ref|XP_002162583.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Hydra
           magnipapillata]
          Length = 470

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/334 (52%), Positives = 235/334 (70%), Gaps = 8/334 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLGDNPYVRM +  FGKECK+C RPFTIF+W PGA MRYKKTEI
Sbjct: 11  NRQNWEQSDFPILCQTCLGDNPYVRMLKDKFGKECKICVRPFTIFKWCPGAKMRYKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAKLKNVCQTCLLDL+Y LP++VRD AL + +  PRS++N+E+F Q +E +++  + 
Sbjct: 71  CQTCAKLKNVCQTCLLDLEYGLPIEVRDKALAIADTLPRSDVNKEFFHQTLEKELANTDG 130

Query: 131 LINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
            +  G    S    ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE+P   +
Sbjct: 131 TVAAGTLGKSQAASDLLMKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEMPNAPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + LS+QNIKDR+YG NDPVA K+L R +  +   +  P DK+IT+L++ G+++ I E DL
Sbjct: 191 DPLSNQNIKDRFYGVNDPVAAKMLKRAE--SMPKLESPSDKSITTLYVGGLDERIKEDDL 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP- 305
           + +FY +GEI+SVVV     C FI + +R +AE A ++S + + IK   LK+ WGR +  
Sbjct: 249 RNFFYQYGEIRSVVVASNKSCGFICYTSRQAAEMAAERSFNKVIIKGKRLKVLWGRSQEQ 308

Query: 306 -TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAP 338
            +G K E      +   +P L     P P  +AP
Sbjct: 309 RSGGKDEKGDRLKEYPPVPGLPDALPPIPTEDAP 342



>gi|405971196|gb|EKC36046.1| Pre-mRNA-splicing factor RBM22 [Crassostrea gigas]
          Length = 434

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 243/348 (69%), Gaps = 9/348 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RM ++ +GKECK+C+RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMMKEKYGKECKICARPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LPVQVRD AL V ++ P+S++N+EY+ QN+E +I+   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPVQVRDAALKVQDNMPKSDVNKEYYTQNMEREIATNDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GKA +   +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TAPGGALGKAMAPS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDR+YG+NDPVA K+L R    +   +T PEDKTIT+L+I  + + I E +
Sbjct: 190 DDPLADQNIKDRFYGSNDPVADKLLQRYT--DMPKLTLPEDKTITTLYIGNLGEKIGEKE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+ + VV K +CAF+ F +R+SAE A +KS + L +    L I WGR + 
Sbjct: 248 LRDHFYQFGEIRMINVVAKQQCAFVQFTSRSSAEAAAEKSFNKLIVGGRRLTIKWGRSQG 307

Query: 306 TGPKTEVQAATTQNVVLP-PLESMQIPAPPGEAPSDFLYPSQDPTYQG 352
                + +       + P P     +PAPP E  ++F   S  P   G
Sbjct: 308 QQLALKKEGEEDDKDLEPVPGLPGALPAPPEEIANNFFNLSNPPPPMG 355



>gi|115466664|ref|NP_001056931.1| Os06g0170500 [Oryza sativa Japonica Group]
 gi|75321585|sp|Q5SNN4.1|C3H40_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 40;
           Short=OsC3H40
 gi|55773636|dbj|BAD72175.1| RRM-containing RNA-binding protein-like [Oryza sativa Japonica
           Group]
 gi|113594971|dbj|BAF18845.1| Os06g0170500 [Oryza sativa Japonica Group]
 gi|125596196|gb|EAZ35976.1| hypothetical protein OsJ_20278 [Oryza sativa Japonica Group]
 gi|215767752|dbj|BAG99980.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 482

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/383 (50%), Positives = 245/383 (63%), Gaps = 44/383 (11%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKIS 126
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRK-- 125

Query: 127 GAESLINYGKADSSGR--EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIP 184
            A + I+Y  +    R  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+P
Sbjct: 126 -ARAGIDYDSSHGKARPNDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYRHEMP 184

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
           E  ELS QNIKDRYYG NDPVA K+L   K G   ++TPP+D++I +L+I G+ + I E 
Sbjct: 185 ETGELSQQNIKDRYYGVNDPVALKLLG--KAGEMPSLTPPDDESIRTLYIGGLNNRITEQ 242

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+  FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+
Sbjct: 243 DLRDQFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGIRLKLMWGKPQ 302

Query: 305 PTGPKTEVQAATTQNVVL---------------------PPLESMQ----------IPAP 333
              PK E   A  Q  V                      P +E  Q          IPAP
Sbjct: 303 --APKPEDDEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQAPSGSYYFNIPAP 360

Query: 334 PGEAPSDFLYPSQDPTYQGSSTK 356
           PG   +  LYPS DP   G+  K
Sbjct: 361 PGAERT--LYPSMDPQRMGALVK 381



>gi|242066226|ref|XP_002454402.1| hypothetical protein SORBIDRAFT_04g030200 [Sorghum bicolor]
 gi|241934233|gb|EES07378.1| hypothetical protein SORBIDRAFT_04g030200 [Sorghum bicolor]
          Length = 491

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 247/379 (65%), Gaps = 35/379 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSFFV+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTAPYYKRNRAHVCSFFVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D+TI +L+I G+++ I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDETIRTLYIGGLDNRITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRAIAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 306 TGPKTEVQAATTQ--------NVVLPPLESMQIPAPPG-------EAPSDF--------- 341
             P+ +      Q          V+   +S   P PPG        AP+ +         
Sbjct: 304 PKPEEDESGRQGQVSHGGLLPRAVISQQQSGDQPQPPGMEGQQQQAAPASYYFNIPAPPA 363

Query: 342 ----LYPSQDPTYQGSSTK 356
               LYPS DP   G+  K
Sbjct: 364 AERTLYPSMDPQRMGAIVK 382



>gi|390597824|gb|EIN07223.1| hypothetical protein PUNSTDRAFT_89383 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 328

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 218/305 (71%), Gaps = 8/305 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D NK GW +SEFPILCETCLGDN ++RM++Q FG+ C  C+RPFT+FRW PG+G RYK
Sbjct: 3   KLDINKAGWEQSEFPILCETCLGDNAFIRMSKQEFGRSCGTCARPFTVFRWNPGSGARYK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL +  +AP S+INREY+AQN+E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGIQTEAPNSDINREYYAQNMETKLE 122

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
           G +  ++  +A S+G+EMLK LART+PYYKRNRPHICSFFVKG C RG ECPYRHE P +
Sbjct: 123 GGKPSLDAHRAQSAGKEMLKSLARTDPYYKRNRPHICSFFVKGECKRGSECPYRHEKPVD 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           ++L+ QN++DRY+G NDPVA+KI++      G  + PPED +ITSLF+TG+     E  +
Sbjct: 183 SDLAKQNMQDRYHGRNDPVARKIMSTHAKNQG--LAPPEDTSITSLFLTGLPATATEETV 240

Query: 247 KGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           +              IKSVV V KSRCAF+NF  R SAE A     + L+       + W
Sbjct: 241 RTRVVKSLPSLNPSYIKSVVHVAKSRCAFVNFTDRPSAELAAQAWPNGLDFDGELANVKW 300

Query: 301 GRPRP 305
           GR RP
Sbjct: 301 GRSRP 305



>gi|413952999|gb|AFW85648.1| pre-mRNA-splicing factor SLT11 [Zea mays]
          Length = 493

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 247/379 (65%), Gaps = 35/379 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPRSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSFFV+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTAPYYKRNRAHVCSFFVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D+TI +L+I G++  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDETIRTLYIGGLDSRITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRAIAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 306 TGPKTEVQAATTQ--------NVVLPPLESMQIPAPPG-------EAPSDF--------- 341
             P+ +      Q          V+   +S   P PPG        AP+ +         
Sbjct: 304 PKPEEDESGRLGQVSHGGLLPRAVISQQQSGDQPQPPGMEGQQQQAAPASYYFNIPAPPA 363

Query: 342 ----LYPSQDPTYQGSSTK 356
               +YPS DP   G+  K
Sbjct: 364 TERTVYPSMDPQRMGAIVK 382



>gi|472366690|ref|XP_004402882.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Odobenus rosmarus
           divergens]
          Length = 419

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 231/320 (72%), Gaps = 8/320 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P + 
Sbjct: 131 TRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           ++    +I D YYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E DL
Sbjct: 190 DDPLADHIIDGYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETDL 247

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +  
Sbjct: 248 RNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAA 307

Query: 307 -GPKTEVQAATTQNVVLPPL 325
            G + E    T   + L P+
Sbjct: 308 RGKEKEKDGTTDSGIKLEPV 327



>gi|326677860|ref|XP_003200931.1| PREDICTED: pre-mRNA-splicing factor RBM22-like, partial [Danio
           rerio]
          Length = 407

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/312 (54%), Positives = 231/312 (74%), Gaps = 8/312 (2%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           +FPILC+TCLG+NPY+RMT++ FGKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+K+K
Sbjct: 1   DFPILCQTCLGENPYIRMTKEKFGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKMK 60

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYG 135
           NVCQTCLLDL+Y LP+QVRDT L+V ++ PRS++N+EY+ QN+E +I+   G   +   G
Sbjct: 61  NVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDGTRPVGLLG 120

Query: 136 KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQN 193
           KA SS  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ L+ QN
Sbjct: 121 KAPSSS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQN 179

Query: 194 IKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAF 253
           IKDRYYG NDPVA K+L R        +  P+DK+IT+L+I G+ +++ +++L+ +FY F
Sbjct: 180 IKDRYYGINDPVANKLLMR--ASTMPRLDVPDDKSITTLYIGGLGENVTDSELRNHFYQF 237

Query: 254 GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQ 313
           GEI+++ +V + +CAFI FATR +AE A +KS + L I    L + WGR +    K E  
Sbjct: 238 GEIRTITIVQRQQCAFIQFATRQAAETAAEKSFNKLIINGRRLNVKWGRSQAARGKGEKD 297

Query: 314 AATTQNVVLPPL 325
             T   + L P+
Sbjct: 298 GVTESGIRLEPV 309



>gi|225434698|ref|XP_002280897.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           [Vitis vinifera]
          Length = 474

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/377 (48%), Positives = 247/377 (65%), Gaps = 38/377 (10%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   R+KKT
Sbjct: 8   DLEADGWERSDFPIICESCLGDNPYVRMTKADYDKECKICTRPFTVFRWRPGRDARFKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSFGKVRPN--DTILKLQRTTPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPI 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PPED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLN--KAGEMPSLEPPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+SV +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESVRMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQA 303

Query: 306 TGPKTE-----------------------------VQAATTQNVVLPPLESMQIPAPPGE 336
             P+ E                             +Q   TQ+   PP+    IP PP +
Sbjct: 304 PKPEGESSEEARQQAALAHGGMLPRAVISQQQNQVIQPPGTQDQPPPPMHYFNIPPPPQQ 363

Query: 337 APSDFLYPSQDPTYQGS 353
             +   YPS DP   G+
Sbjct: 364 ERT--FYPSMDPQRMGA 378



>gi|241710461|ref|XP_002403460.1| RNA-binding protein, putative [Ixodes scapularis]
 gi|215505106|gb|EEC14600.1| RNA-binding protein, putative [Ixodes scapularis]
          Length = 566

 Score =  369 bits (946), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 175/353 (49%), Positives = 243/353 (68%), Gaps = 15/353 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W E+EFPILC+TCLGDNPYVRMT++ +GKECK+CSRPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRLNWEEAEFPILCQTCLGDNPYVRMTKEHYGKECKICSRPFTVFRWCPGGRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKNVCQTCLLDL Y LPVQVRD AL++ ++ P+S++N+EY++QN+E  ++  ++
Sbjct: 71  CQTCSKLKNVCQTCLLDLDYGLPVQVRDNALSIKDEMPKSDVNKEYYSQNVERAVAEGDA 130

Query: 131 LINYG---KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              YG   KA S   ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 GQPYGALAKAQSPS-DLLMKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNI+DRYYG NDPVA K+L R        + PPED +IT+L++  + + + E D
Sbjct: 190 DDPLADQNIRDRYYGVNDPVADKLLRR--AAAMPRLEPPEDGSITTLYVGNLGERLTEKD 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+ + ++ + +CAF+ F +R SAE A DK+ + L +    L I WGR   
Sbjct: 248 LRDHFYQYGEIRQITMLARHQCAFVQFTSRTSAELAADKTFNKLILAGRRLVIKWGRALA 307

Query: 306 TGPKTEVQAATTQNVVLPPLESM--QIPAPPGEAPSDFL----YPSQDPTYQG 352
              +  +    +Q+  L P+  +   +P PP E  +++      P   PT+  
Sbjct: 308 RS-EPAIAPTPSQSRPLEPVPGLPAPLPMPPEELANNYFNLACLPHPPPTFMA 359



>gi|226509868|ref|NP_001151426.1| LOC100285059 [Zea mays]
 gi|195646758|gb|ACG42847.1| pre-mRNA-splicing factor SLT11 [Zea mays]
          Length = 490

 Score =  369 bits (946), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 247/379 (65%), Gaps = 35/379 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPRSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSFFV+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTAPYYKRNRAHVCSFFVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D+TI +L+I G++  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDETIRTLYIGGLDSRITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRAIAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 306 TGPKTEVQAATTQ--------NVVLPPLESMQIPAPPG-------EAPSDF--------- 341
             P+ +      Q          V+   +S   P PPG        AP+ +         
Sbjct: 304 PKPEEDESGRLGQVSHGGLLPRAVISQQQSGDQPQPPGMEGQQQQAAPASYYFNIPAPPA 363

Query: 342 ----LYPSQDPTYQGSSTK 356
               +YPS DP   G+  K
Sbjct: 364 TERTVYPSMDPQRMGAIVK 382



>gi|149412599|ref|XP_001510991.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Ornithorhynchus
           anatinus]
          Length = 423

 Score =  369 bits (946), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 234/324 (72%), Gaps = 12/324 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDIPKSDVNKEYYTQNMEREISNSDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
              +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K+L R        + PP+DK+IT+L++ G+ D I E D
Sbjct: 190 DDPLADQNIKDRYYGINDPVADKLLKR--ASTMPRLDPPDDKSITTLYVGGLGDTITETD 247

Query: 246 LKGYFY---AFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           L+ +F      GEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR
Sbjct: 248 LRNHFLLRDGMGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR 307

Query: 303 PRPT-GPKTEVQAATTQNVVLPPL 325
            +   G + + +  T   + L P+
Sbjct: 308 SQAARGKEKDKEGTTDSGIKLEPV 331



>gi|195496994|ref|XP_002095913.1| GE25369 [Drosophila yakuba]
 gi|194182014|gb|EDW95625.1| GE25369 [Drosophila yakuba]
          Length = 418

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 240/342 (70%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI---SG 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++   +G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGNG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FY FGEI+S+ +V + +CAF+ +  R +AE A +++ + L I+   + I W     
Sbjct: 248 LRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +   L       IP PP   P+D+    Q+
Sbjct: 305 SQAKQSTAAKTDRRFDL-----AGIP-PPSAKPNDYFNLRQE 340



>gi|460407526|ref|XP_004249203.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           [Solanum lycopersicum]
 gi|133711805|gb|ABO36623.1| putative RNA-binding protein [Solanum lycopersicum]
          Length = 479

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 237/324 (73%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DAEADGWERSDFPIICESCLGDSPYVRMTKADYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK  ++  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRAN--DTIMKLQRTTPYYKRNRAHVCSFYIRGQCTRGLECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PP+D++I +L++ GV+  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLN--KAGEMPSLEPPDDESIRTLYVGGVDARITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  A +A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVVQRGCAFVTYTTREGAVKAAEELANKLVIKGLRLKLLWGRPQV 303

Query: 306 TGPKTEV------QAATTQNVVLP 323
             P++EV      QAA T + +LP
Sbjct: 304 PKPESEVSDEARQQAALTHSGLLP 327



>gi|223974935|gb|ACN31655.1| unknown [Zea mays]
 gi|413952998|gb|AFW85647.1| hypothetical protein ZEAMMB73_699245 [Zea mays]
          Length = 441

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 247/379 (65%), Gaps = 35/379 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPRSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSFFV+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTAPYYKRNRAHVCSFFVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D+TI +L+I G++  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDETIRTLYIGGLDSRITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRAIAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 306 TGPKTEVQAATTQ--------NVVLPPLESMQIPAPPG-------EAPSDF--------- 341
             P+ +      Q          V+   +S   P PPG        AP+ +         
Sbjct: 304 PKPEEDESGRLGQVSHGGLLPRAVISQQQSGDQPQPPGMEGQQQQAAPASYYFNIPAPPA 363

Query: 342 ----LYPSQDPTYQGSSTK 356
               +YPS DP   G+  K
Sbjct: 364 TERTVYPSMDPQRMGAIVK 382



>gi|357125138|ref|XP_003564252.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           [Brachypodium distachyon]
          Length = 488

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 246/380 (64%), Gaps = 38/380 (10%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGK-I 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRKAA 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK  S   + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGK--SRPNDTILKLQRTSPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G   ++TPP+D++I +L+I G+++ + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMPSLTPPDDESIRTLYIGGLDNRVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQ- 302

Query: 306 TGPKTEVQAATTQN----------VVLPPLESMQIPAPPG------EAPSDF-------- 341
             P+ +   A  Q            V+    S   P PPG       AP+ +        
Sbjct: 303 -APRADDDEAGRQGHVSHGGLLPRAVISQQHSSDQPQPPGMEGQQQAAPASYYFNIPAPP 361

Query: 342 -----LYPSQDPTYQGSSTK 356
                +YPS DP   G+  +
Sbjct: 362 ATERTMYPSMDPQRMGAVVR 381



>gi|115471551|ref|NP_001059374.1| Os07g0281000 [Oryza sativa Japonica Group]
 gi|75325391|sp|Q6Z358.1|C3H49_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 49;
           Short=OsC3H49
 gi|34394813|dbj|BAC84225.1| RRM-containing RNA-binding protein-like [Oryza sativa Japonica
           Group]
 gi|113610910|dbj|BAF21288.1| Os07g0281000 [Oryza sativa Japonica Group]
 gi|222636833|gb|EEE66965.1| hypothetical protein OsJ_23846 [Oryza sativa Japonica Group]
          Length = 486

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 245/380 (64%), Gaps = 44/380 (11%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKIS 126
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL+  +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSTNSNDAIPRSDVNREYFAEEHDRR-- 125

Query: 127 GAESLINYGKADSSGR--EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIP 184
            A + I+Y  ++   R  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+P
Sbjct: 126 -ARAGIDYDSSNGKARANDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYRHEMP 184

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
           E  ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D++I +L+I G++  + E 
Sbjct: 185 ETGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDESIRTLYIGGLDSRVTEQ 242

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+  FYA GEI+++ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+
Sbjct: 243 DLRDQFYAHGEIETIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQ 302

Query: 305 PTGPKTEVQAATTQNVVL---------------------PPLESMQ----------IPAP 333
              PK E   A  Q  V                      P +E  Q          IPAP
Sbjct: 303 --APKPEEDEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQPASASYYFNIPAP 360

Query: 334 PGEAPSDFLYPSQDPTYQGS 353
           P  A    LYPS DP   G+
Sbjct: 361 P--AAERTLYPSMDPQRMGA 378



>gi|125777509|ref|XP_001359630.1| GA13140 [Drosophila pseudoobscura pseudoobscura]
 gi|195156856|ref|XP_002019312.1| GL12337 [Drosophila persimilis]
 gi|54639378|gb|EAL28780.1| GA13140 [Drosophila pseudoobscura pseudoobscura]
 gi|194115903|gb|EDW37946.1| GL12337 [Drosophila persimilis]
          Length = 422

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 238/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V +  P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADTMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FY +GEI+S+ +V + +CAF+ +  R++AE A ++S + L I    + I W     
Sbjct: 248 LRDQFYQYGEIRSIALVPRQQCAFVQYTKRSAAELAAERSFNKLVIHGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +       E   IP PP   P+D+    Q+
Sbjct: 305 SQAKQGTAAKTDRR-----FEVAGIP-PPSAKPNDYFNLRQE 340



>gi|403417885|emb|CCM04585.1| predicted protein [Fibroporia radiculosa]
          Length = 322

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/314 (55%), Positives = 223/314 (71%), Gaps = 15/314 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D NK GW +SEFPILCETCLGDN +   ++Q +G+ C  C+RPFT+FRW PG  MR+K
Sbjct: 3   KLDINKAGWEQSEFPILCETCLGDNAF---SKQEYGRSCGTCARPFTVFRWNPGTAMRFK 59

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL + N+AP SEINREY+AQN+EGK S
Sbjct: 60  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALAIENEAPTSEINREYYAQNLEGKAS 119

Query: 127 ----GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHE 182
               G +SL++ G+A S+G++MLK+LART+PYYKRNRPH+CSF+ KG C RG ECPYRHE
Sbjct: 120 SRLEGNKSLLDSGRASSAGKDMLKQLARTDPYYKRNRPHLCSFYAKGECKRGSECPYRHE 179

Query: 183 IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDID 242
           +P ENELS QNI+DRY+G +DPVA+KIL+      G  + PPED+++ SLF+T +     
Sbjct: 180 LPVENELSKQNIQDRYHGRSDPVARKILSTHAASMG--LQPPEDQSVMSLFLTSLPTTAT 237

Query: 243 EADLKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDL 296
           E  ++             +IKSVV V KSRCAF+NF  R SAE A     + L ++   L
Sbjct: 238 EQSIRTRVAQSLPAVQPSQIKSVVHVAKSRCAFVNFKDRQSAELAAQAWANGLELEGTTL 297

Query: 297 KITWGRPRPTGPKT 310
            + WGR +    K+
Sbjct: 298 NVKWGRGKGAASKS 311



>gi|482576010|gb|EOA40197.1| hypothetical protein CARUB_v10008917mg, partial [Capsella rubella]
          Length = 503

 Score =  367 bits (942), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 239/360 (66%), Gaps = 20/360 (5%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 28  DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 87

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NREYFA+  + K  
Sbjct: 88  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREYFAEEHDRKTR 147

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSFF++G CTRG ECPYRHE+PE
Sbjct: 148 AGLDYESSFGKMRPN--DTILKLQRTTPYYKRNRAHVCSFFIRGECTRGAECPYRHEMPE 205

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  PED++I +L++ G+   I E D
Sbjct: 206 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMGTLESPEDESIKTLYVGGLNSRILEQD 263

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FYA+GEI+S+ ++    CAF+ + +R  AE+A  +  + L +    LK+TWGRP+P
Sbjct: 264 IRDQFYAYGEIESIRILADKACAFVTYTSREGAEKAAQELSNRLVVNGQRLKLTWGRPKP 323

Query: 306 TGPKTEVQAATTQNVVL------------PPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
               + +Q +   + +L            PP++   +  PP        YPS DP   G+
Sbjct: 324 DQ-DSNLQGSVAHSGLLPRAVISQQHNQPPPVQQYYMHPPPAANQDKPYYPSMDPQRMGA 382



>gi|194898376|ref|XP_001978788.1| GG11763 [Drosophila erecta]
 gi|190650491|gb|EDV47746.1| GG11763 [Drosophila erecta]
          Length = 418

 Score =  367 bits (942), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 239/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FY FGEI+S+ +V + +CAF+ +  R +AE A +++ + L I+   + I W     
Sbjct: 248 LRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +   L       IP PP   P+D+    Q+
Sbjct: 305 SQAKQGTAAKTDRRFDL-----AGIP-PPSAKPNDYFNLRQE 340



>gi|194741630|ref|XP_001953292.1| GF17279 [Drosophila ananassae]
 gi|190626351|gb|EDV41875.1| GF17279 [Drosophila ananassae]
          Length = 418

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 165/296 (55%), Positives = 223/296 (75%), Gaps = 8/296 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V+++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVSDNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
           L+  FY FGEI+S+ +V + +CAF+ +  R +AE A +++ + L I    + I W 
Sbjct: 248 LRDQFYQFGEIRSIALVPRQQCAFVQYTKRGAAELAAERTFNKLVIHGRKVSIKWA 303



>gi|475609743|gb|EMT27491.1| Zinc finger CCCH domain-containing protein 40 [Aegilops tauschii]
          Length = 482

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 189/379 (49%), Positives = 244/379 (64%), Gaps = 35/379 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGK-I 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRKAA 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTSPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G   ++ PP+D+TI +L+I G+++ + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMPSLQPPDDETIRTLYIGGLDNRVSEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR--- 302
           L+  FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+   
Sbjct: 244 LRDQFYAHGEIESIRMVIQRACAFVTYTTREGAERAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 303 PRPTGPKTEVQAATTQNVVL----------------PPLESMQIPAPPGE---------A 337
           PRP   +   Q   +   +L                P +E  Q  AP G          A
Sbjct: 304 PRPDDDEAGRQGHVSHGGLLPRAVISQQHSSDQPQPPGMEGQQQVAPQGSGYFNIPPPPA 363

Query: 338 PSDFLYPSQDPTYQGSSTK 356
               +YPS DP   G+  +
Sbjct: 364 VDQRMYPSMDPQRMGAVVR 382



>gi|169852840|ref|XP_001833102.1| pre-mRNA-splicing factor SLT11 [Coprinopsis cinerea okayama7#130]
 gi|116505896|gb|EAU88791.1| pre-mRNA-splicing factor SLT11 [Coprinopsis cinerea okayama7#130]
          Length = 330

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 178/313 (56%), Positives = 220/313 (70%), Gaps = 13/313 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +SEFPILCETCLG NP++RM++Q FG+ C  C+RPFT+FRW PG G RYK
Sbjct: 3   KADINKAGWEQSEFPILCETCLGSNPFIRMSKQEFGRSCGTCARPFTVFRWNPGEGARYK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
            T ICQTCAK+KN+CQTCLLDL++ LP QVRDTAL VTNDAP S++NREY+AQN+E K+ 
Sbjct: 63  TTVICQTCAKVKNICQTCLLDLEFGLPTQVRDTALGVTNDAPTSDVNREYYAQNMEAKLQ 122

Query: 126 --SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
              G +S ++  +   +G+EMLK+LART+PYYKRNRPHICSFFVKG+CTRG ECPYRHEI
Sbjct: 123 DSGGNKSGLDITRTSIAGKEMLKQLARTDPYYKRNRPHICSFFVKGNCTRGSECPYRHEI 182

Query: 184 PEENEL--SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFI-----TG 236
           P E     + Q+I+DRY+GTNDPVAKK+L       G  +  P D +ITSLFI     T 
Sbjct: 183 PAETSKVGAQQSIQDRYHGTNDPVAKKLLTTYAESMG--LAAPADTSITSLFISSLPATA 240

Query: 237 VEDDIDEADLKGY-FYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
            ED +  A ++        +I+S+V V KSRCAF NF  R SAE A       L +    
Sbjct: 241 TEDTVRTAVVQSVPSLDPQKIRSIVHVAKSRCAFANFRDRESAELAALAWAKGLEVDGQK 300

Query: 296 LKITWGRPRPTGP 308
           + + WGR RP  P
Sbjct: 301 VNVKWGRSRPAKP 313



>gi|28573264|ref|NP_649440.3| CG14641 [Drosophila melanogaster]
 gi|16769690|gb|AAL29064.1| LD46870p [Drosophila melanogaster]
 gi|28381138|gb|AAF52166.2| CG14641 [Drosophila melanogaster]
 gi|220956458|gb|ACL90772.1| CG14641-PA [synthetic construct]
          Length = 418

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 239/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FY FGEI+S+ +V + +CAF+ +  R +AE A +++ + L I+   + I W     
Sbjct: 248 LRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +   L       IP PP   P+D+    Q+
Sbjct: 305 SQAKQGTAAKTDRRFDL-----AGIP-PPSAKPNDYFNLRQE 340



>gi|195445733|ref|XP_002070461.1| GK11018 [Drosophila willistoni]
 gi|194166546|gb|EDW81447.1| GK11018 [Drosophila willistoni]
          Length = 419

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 237/337 (70%), Gaps = 17/337 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNLPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FY FGEI+S+ +V + +CAF+ +  R++AE A +++ + L I    + I W     
Sbjct: 248 IRDQFYQFGEIRSIALVPRQQCAFVQYTKRSAAELAAERTFNKLVIHSRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFL 342
           +  K    A T +       +   IP PP   P+D+ 
Sbjct: 305 SQAKQNTAAKTDRR-----FDINGIP-PPSAKPNDYF 335



>gi|83283985|gb|ABC01900.1| RRM-containing RNA-binding protein-like protein [Solanum tuberosum]
          Length = 487

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 235/324 (72%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DAEADGWERSDFPIICESCLGDSPYVRMTKADYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK  ++  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRAN--DTILKLQRTTPYYKRNRAHVCSFYIRGQCTRGLECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PP+D++I +L++ GV+  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLN--KAGEMPSLEPPDDESIRTLYVGGVDARISEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +  CAF+ + TR  A +A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDQFYAHGEIESIKMVLQRGCAFVTYTTREGAVKAAEELANKLVIKGLRLKLLWGRPQA 303

Query: 306 TGPKTEV------QAATTQNVVLP 323
             P TE+      QAA T + +LP
Sbjct: 304 PKPDTELSDEARQQAAVTHSGLLP 327



>gi|195343343|ref|XP_002038257.1| GM10722 [Drosophila sechellia]
 gi|195568111|ref|XP_002102061.1| GD19696 [Drosophila simulans]
 gi|194133278|gb|EDW54794.1| GM10722 [Drosophila sechellia]
 gi|194197988|gb|EDX11564.1| GD19696 [Drosophila simulans]
          Length = 418

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 239/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FY FGEI+S+ +V + +CAF+ +  R +AE A +++ + L I+   + I W     
Sbjct: 248 LRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +   L       IP PP   P+D+    Q+
Sbjct: 305 SQAKQGTAAKTDRRFDL-----AGIP-PPSAKPNDYFNLRQE 340



>gi|242094866|ref|XP_002437923.1| hypothetical protein SORBIDRAFT_10g004840 [Sorghum bicolor]
 gi|241916146|gb|EER89290.1| hypothetical protein SORBIDRAFT_10g004840 [Sorghum bicolor]
          Length = 491

 Score =  365 bits (938), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 246/381 (64%), Gaps = 39/381 (10%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGKA  +  + + KL RT PYYKRNR H+CSFFV+G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYDSSYGKARPN--DTILKLQRTAPYYKRNRAHVCSFFVRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++TPP+D+TI +L+I G++  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTPPDDETIRTLYIGGLDSRITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +   AF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDQFYAHGEIESIRMVLQRAIAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGKPQA 303

Query: 306 TGPKTE---VQAATTQNVVLP----------------PLESMQ-----------IPAPPG 335
             P+ +    Q   +   +LP                 +E  Q           IPAP  
Sbjct: 304 PKPEEDESGRQGQVSHGGLLPRAVISQQQSSDQPQPPGMEDQQQQAAPASYYFNIPAP-- 361

Query: 336 EAPSDFLYPSQDPTYQGSSTK 356
            A    LYPS DP   G+  K
Sbjct: 362 AATERTLYPSMDPQRMGAIVK 382



>gi|331237169|ref|XP_003331242.1| hypothetical protein PGTG_13205 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309310232|gb|EFP86823.1| hypothetical protein PGTG_13205 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 305

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 213/275 (77%), Gaps = 7/275 (2%)

Query: 36  MTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQ 95
           M++Q  GKECK+C+RPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQY LP Q
Sbjct: 1   MSKQSLGKECKICTRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYGLPTQ 60

Query: 96  VRDTALNVTNDAPRSEINREYFAQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYY 155
           VRDTAL + + AP S INREY AQN+EGK+ G+  LINY + D+ G+++LK+LART+PYY
Sbjct: 61  VRDTALGINSKAPISNINREYHAQNMEGKLEGSSDLINYDRQDAGGKDVLKRLARTDPYY 120

Query: 156 KRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKG 215
           KRNRPHICSF+ KG C RGD CPYRHE+P ENELS QNI+DRY+G NDPVA+KIL+    
Sbjct: 121 KRNRPHICSFYAKGECARGDGCPYRHEVPVENELSKQNIQDRYHGRNDPVARKILSAYAQ 180

Query: 216 GNGSNITPPEDKTITSLFITGV-EDDIDEADLKGYFYAFG----EIKSVVVVHKSRCAFI 270
             G  +TPPED++I SLF++ +  +  +E+ ++ +F + G    +IKSVVVV  S+CAF+
Sbjct: 181 TTG--LTPPEDESIVSLFLSSLPSEATNESMIRHFFNSIGIESPKIKSVVVVPTSKCAFV 238

Query: 271 NFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           NFA+R+ AE A  +    + I   D+ + WGR +P
Sbjct: 239 NFASRSIAEDAASRCSVRVQIAAKDVLVRWGRSKP 273



>gi|170087442|ref|XP_001874944.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650144|gb|EDR14385.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 298

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           NK GW +SEFPILCETCLGDNP++RM++Q +G+ C  C+RPFT+FRW PG G R+K T I
Sbjct: 1   NKAGWEQSEFPILCETCLGDNPFIRMSKQEYGRSCGTCARPFTVFRWNPGTGSRFKTTVI 60

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAK+KNVCQTCLLDL+Y LP QVRDTAL   NDAP S+INREY+AQN+EGK+ G +S
Sbjct: 61  CQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGFQNDAPTSDINREYYAQNMEGKLDGNKS 120

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELS 190
            ++ G+A S+G+EMLK+LART+PYYKRNRPH+CSF+ KG CTRG+ECPYRHE+P +N+L+
Sbjct: 121 GLDSGRAVSAGKEMLKQLARTDPYYKRNRPHLCSFYAKGDCTRGNECPYRHEMPVDNDLA 180

Query: 191 HQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK--- 247
           HQN++DRY+G NDPVA KIL+      G  +  P+DKTITS+F++ +     E  ++   
Sbjct: 181 HQNMQDRYHGKNDPVAHKILSTHAESQG--LKAPDDKTITSIFLSSLSPSSTEGSIRSRG 238

Query: 248 ---GYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
               YF+A    ++   +   RCAF+NF  R +AE A     + L I E  + + WGR R
Sbjct: 239 SQGSYFHA--TYRAYKFLTSDRCAFVNFKERGAAETAAAAWANGLEIDEVQVTVKWGRSR 296



>gi|356553476|ref|XP_003545082.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Glycine max]
          Length = 482

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 234/324 (72%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMTR  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTRAEYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTALN+ ++DA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALNIDSHDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRPN--DTILKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  + +  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMNTLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQT 303

Query: 306 TGPKTE------VQAATTQNVVLP 323
           + P+++       QA+   + +LP
Sbjct: 304 SKPESDGSDQARQQASVAHSGLLP 327



>gi|18390760|ref|NP_563788.1| MOS4-associated complex subunit 5A [Arabidopsis thaliana]
 gi|75335266|sp|Q9LNV5.1|C3H4_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 4;
           Short=AtC3H4
 gi|8778549|gb|AAF79557.1|AC022464_15 F22G5.30 [Arabidopsis thaliana]
 gi|332189993|gb|AEE28114.1| MOS4-associated complex subunit 5A [Arabidopsis thaliana]
          Length = 481

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 236/360 (65%), Gaps = 20/360 (5%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSFF++G CTRG ECPYRHE+PE
Sbjct: 128 AGLDYESSFGKMRPN--DTILKLQRTTPYYKRNRAHVCSFFIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  P+D++I +L++ G+   I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMGTLESPDDESIKTLYVGGLNSRILEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FYA GEI+S+ ++    CAF+ + +R  AE+A  +  + L I    LK+TWGRP+P
Sbjct: 244 IRDQFYAHGEIESIRILADKACAFVTYTSREGAEKAAQELSNRLVINGQRLKLTWGRPKP 303

Query: 306 TGPKTEVQAATTQNVVL------------PPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
                  Q     + +L            PP++   +  PP      + YPS DP   G+
Sbjct: 304 DQDGANQQGGVAHSGLLPRAVISQQHNQPPPMQQYYMHPPPANQDKPY-YPSMDPQRMGA 362



>gi|82400164|gb|ABB72821.1| RRM-containing RNA-binding protein-like protein [Solanum tuberosum]
          Length = 462

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 234/324 (72%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DAEADGWERSDFPIICESCLGDSPYVRMTKADYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQ RDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQFRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK  ++  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRAN--DTILKLQRTTPYYKRNRAHVCSFYIRGQCTRGLECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PP+D++I +L++ GV+  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLN--KAGEMPSLEPPDDESIRTLYVGGVDARISEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +  CAF+ + TR  A +A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDQFYAHGEIESIKMVLQRGCAFVTYTTREGAVKAAEELANKLVIKGLRLKLLWGRPQA 303

Query: 306 TGPKTEV------QAATTQNVVLP 323
             P TE+      QAA T + +LP
Sbjct: 304 PKPDTELSDEARQQAAVTHSGLLP 327



>gi|15450878|gb|AAK96710.1| Unknown protein [Arabidopsis thaliana]
 gi|21387095|gb|AAM47951.1| unknown protein [Arabidopsis thaliana]
          Length = 481

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 236/360 (65%), Gaps = 20/360 (5%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSFF++G CTRG ECPYRHE+PE
Sbjct: 128 AGLDYESSFGKMRPN--DTILKLQRTTPYYKRNRAHVCSFFIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  P+D++I +L++ G+   I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMGTLESPDDESIKTLYVGGLNSRILEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FYA GEI+S+ ++    CAF+ + +R  AE+A  +  + L I    LK+TWGRP+P
Sbjct: 244 IRDQFYAHGEIESIRILADKACAFVTYTSREGAEKAAQELSNRLVINGQRLKLTWGRPKP 303

Query: 306 TGPKTEVQAATTQNVVL------------PPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
                  Q     + +L            PP++   +  PP      + YPS DP   G+
Sbjct: 304 DRDGANQQGGVAHSGLLPRAVISQQHNQPPPMQQYYMHPPPANQDKPY-YPSMDPQRMGA 362



>gi|242011910|ref|XP_002426686.1| pre-mRNA-splicing factor SLT11, putative [Pediculus humanus
           corporis]
 gi|212510857|gb|EEB13948.1| pre-mRNA-splicing factor SLT11, putative [Pediculus humanus
           corporis]
          Length = 457

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/342 (52%), Positives = 244/342 (71%), Gaps = 10/342 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+CSRPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKEKYGKECKICSRPFTVFRWNPGAKMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC+++KNVCQTCLLDL+Y LP+QVRD AL + +D PRSEIN+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRMKNVCQTCLLDLEYGLPIQVRDAALKIKDDIPRSEINKEYYVQNIDRELGKIDA 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPTGAVGKSQAAS-DLLLKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA+K++ R +      +  PEDK++T+L++  V D I E +
Sbjct: 190 DDPLADQNIKDRYYGVNDPVAEKLMRRAE--TMPKLELPEDKSVTTLYVGNVSDRITEKE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+S+ V+ K +CAFI F TRA+AE A +++ + L +    + I WGR + 
Sbjct: 248 LQDHFYQYGEIRSITVLAKQQCAFIQFTTRAAAESAAERTFNKLILCGRRMTIRWGRSQG 307

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
              KT ++        +P L    +P PP E    F  PSQ+
Sbjct: 308 RQ-KTSLEEGEIDLEPVPGLPGA-LPLPPDEVTGSFSSPSQN 347



>gi|170059381|ref|XP_001865339.1| pre-mRNA-splicing factor RBM22 [Culex quinquefasciatus]
 gi|167878167|gb|EDS41550.1| pre-mRNA-splicing factor RBM22 [Culex quinquefasciatus]
          Length = 428

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 233/339 (68%), Gaps = 11/339 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +SEFPILC+TCLGDNPYVRM ++ +GKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSEFPILCQTCLGDNPYVRMIKERYGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGA-E 129
           CQTC+KLKNVCQTCLLDL+Y LP QVRD AL + +  P S++N+EY+ Q IEG++  A +
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPTQVRDAALKIQDKIPESDVNKEYYIQTIEGQLKAAGD 130

Query: 130 SLINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
           + +  G    S    +ML KLART PYYKRN PHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 NTVAAGVVGKSLAASDMLAKLARTAPYYKRNLPHICSFWVKGECKRGEECPYRHDKPVEP 190

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + LS QNI+DRYYG NDPVA K++ R    +   + PPEDKTIT+L++  + + I E D
Sbjct: 191 DDPLSEQNIRDRYYGRNDPVADKLMKR--AASIPTLDPPEDKTITTLYVGNLGEHITEVD 248

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FY +GEI+SV +V + +CAF+ +  R++AE A +K+ + L +    L I W   + 
Sbjct: 249 IRDNFYHYGEIRSVSLVPRQQCAFVQYTKRSAAELAAEKTFNKLVLGGKKLTIKWAHSQA 308

Query: 306 TGPKTEVQAATTQNVVLPPLESM--QIPAPPGEAPSDFL 342
                   +    N +  P+  +  Q+P PP   P+D+ 
Sbjct: 309 KSTAYAQSSVPRNNRIFDPVPGLPGQLPMPPN--PNDYF 345



>gi|351702162|gb|EHB05081.1| Pre-mRNA-splicing factor RBM22 [Heterocephalus glaber]
          Length = 420

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 170/311 (54%), Positives = 225/311 (72%), Gaps = 7/311 (2%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           +FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+KLK
Sbjct: 21  DFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLK 80

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYG 135
           NVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G   +   G
Sbjct: 81  NVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLG 140

Query: 136 KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSHQNIK 195
           KA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECP+      ++ L+ QNIK
Sbjct: 141 KATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPHEKPTDPDDPLADQNIK 199

Query: 196 DRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGE 255
           DRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E DL+ +FY FGE
Sbjct: 200 DRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGE 257

Query: 256 IKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT-GPKTEVQA 314
           I+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +   G + E   
Sbjct: 258 IRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDG 317

Query: 315 ATTQNVVLPPL 325
            T   + L P+
Sbjct: 318 TTDSGIKLEPV 328



>gi|195113937|ref|XP_002001524.1| GI21935 [Drosophila mojavensis]
 gi|193918118|gb|EDW16985.1| GI21935 [Drosophila mojavensis]
          Length = 428

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 239/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGTVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FY +GEI+S+ +V + +C+F+ +  R +AE A +++ + L I+   + I W     
Sbjct: 248 IRDQFYQYGEIRSIALVPRQQCSFVQYTKRNAAELAAERTFNKLVIQGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +       +   IP PP   P+D+    Q+
Sbjct: 305 SQAKQSTAAKTDRR-----FDVAGIP-PPSAKPNDYFNLRQE 340



>gi|156546667|ref|XP_001603806.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Nasonia
           vitripennis]
          Length = 409

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 231/319 (72%), Gaps = 9/319 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKEKYGKECKICVRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+ +IS  + 
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDIPRSDVNKEYYVQNIDNEISKNDP 130

Query: 131 LINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
               G    S    ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   +
Sbjct: 131 TTPAGAVGKSAAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA K++ R        + PPED +IT+L+I  + + + E  L
Sbjct: 191 DPLADQNIKDRYYGFNDPVADKLMRRAAA--MPKLEPPEDTSITTLYIGNIGEVLTEKTL 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + +FY +GEI+SV +V K++CAFI +  R++AE A +++ + L +    L I WGR +  
Sbjct: 249 RDHFYQYGEIRSVTMVAKNQCAFIEYTNRSAAELAAERTFNKLILGGRRLNIKWGRSQ-- 306

Query: 307 GPKTEVQAATTQNVVLPPL 325
           G +T + AA     +L P+
Sbjct: 307 GRQT-ISAAEGVREILEPV 324



>gi|156357140|ref|XP_001624081.1| predicted protein [Nematostella vectensis]
 gi|156210835|gb|EDO31981.1| predicted protein [Nematostella vectensis]
          Length = 413

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 241/332 (72%), Gaps = 11/332 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMTR+  G+ECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTRETHGRECKICARPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKN+CQTCLLDL+Y LPVQVRD +L + ++ P+S++N+EY+ QN+E +++ ++ 
Sbjct: 71  CQTCSKLKNICQTCLLDLEYGLPVQVRDKSLGLKDEMPKSDVNKEYYTQNVERELADSDG 130

Query: 131 L----INYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
                   GKA++   ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRH++P +
Sbjct: 131 TSPGGALQGKANAPS-DLLMKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHDMPTD 189

Query: 187 --NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
             + L+ QNIKDRYYG NDPVA K+L + +  +   +  P D++IT+L++ G+E  + E 
Sbjct: 190 PNDPLADQNIKDRYYGVNDPVANKLLKQAQ--SMPMLDTPTDRSITTLYVGGLEGKVTEQ 247

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+ +FY FGE++S+ +V +  CAF+ F +RA+AE A D+S + L +K   LKI WG+ +
Sbjct: 248 DLRDHFYQFGELRSISMVPRQNCAFVCFTSRAAAEAAADRSFNKLILKGRRLKIMWGKSQ 307

Query: 305 PTGPKTEVQAATTQNVVLPPLESMQIPAPPGE 336
              P    Q   T   V  P     +PAPP E
Sbjct: 308 GQQPAPGRQGGHTLTPV--PGLPGALPAPPAE 337



>gi|195399758|ref|XP_002058486.1| GJ14294 [Drosophila virilis]
 gi|194142046|gb|EDW58454.1| GJ14294 [Drosophila virilis]
          Length = 428

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 239/342 (69%), Gaps = 17/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+ ++    G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLQDGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + +DI E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEDITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FY +GEI+S+ +V + +C+F+ +  R++AE A +++ + L +    + I W     
Sbjct: 248 IRDQFYQYGEIRSIALVPRQQCSFVQYTKRSAAELAAERTFNKLVMHGRKVSIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +       +   IP PP   P+D+    Q+
Sbjct: 305 SQAKQGTAAKTDRR-----FDVAGIP-PPSAKPNDYFNLRQE 340



>gi|498997400|ref|XP_004533593.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Ceratitis capitata]
          Length = 419

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 173/342 (50%), Positives = 237/342 (69%), Gaps = 16/342 (4%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL+Y LP+QVRD AL V ++ P+S++N+EY+ QNI+  ++   G
Sbjct: 71  CQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVVDNIPQSDVNKEYYIQNIDRDLADGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGTVGRSLAAN-EMLAKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R        + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AATLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY FGEI+S+ +V + +CAF+ +  R ++E A +++ + L +      I W     
Sbjct: 248 LRDHFYQFGEIRSIALVPRQQCAFVQYTKRGASELAAERTFNKLVLHGRKATIKWAH--- 304

Query: 306 TGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
           +  K    A T +   +P      +P  P   P+DF    Q+
Sbjct: 305 SQAKQGGVAKTDRRFEVP-----AVPPTPVANPNDFFNLQQE 341



>gi|158828226|gb|ABW81104.1| unknown [Cleome spinosa]
          Length = 504

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 227/318 (71%), Gaps = 9/318 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMTR  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTRADYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVT--NDAPRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTALN++  +  PRS++N+EYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALNISSHDSIPRSDVNKEYFAEEHDRKTR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGLDYESSYGKIRPN--DTIMKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  PED++I +L++ G+   I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMGTLEAPEDESIKTLYVGGLNSRILEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR- 304
           ++  FYA+GEI+S+ ++ +  CAF+ + TR  AE+A ++  + L +    LK+TWGRP+ 
Sbjct: 244 IRDQFYAYGEIESIRILPEKACAFVTYTTREGAEKATEELCNKLVVNGQRLKLTWGRPQV 303

Query: 305 -PTGPKTEVQAATTQNVV 321
             T P+   QAA  Q +V
Sbjct: 304 PKTEPEGSDQAAKQQGIV 321



>gi|335310006|ref|XP_003361854.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Sus scrofa]
          Length = 417

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 172/313 (54%), Positives = 225/313 (71%), Gaps = 9/313 (2%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           +FPILC+TCLG+NPY+RMT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+KLK
Sbjct: 16  DFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLK 75

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYG 135
           NVCQTCLLDL+Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G   +   G
Sbjct: 76  NVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLG 135

Query: 136 KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQN 193
           KA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ L+ QN
Sbjct: 136 KATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQN 194

Query: 194 IKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAF 253
           IKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D       + +FY F
Sbjct: 195 IKDRYYGINDPVADKLLKR--ASTMPRLDPPEDKTITTLYVGGLGDXXXXCPFRNHFYQF 252

Query: 254 GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT-GPKTEV 312
           GEI++V VV + +CAFI FATR +AE A +KS + L +    L + WGR +   G + E 
Sbjct: 253 GEIRTVTVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEK 312

Query: 313 QAATTQNVVLPPL 325
              T   + L P+
Sbjct: 313 DGTTDSGIKLEPV 325



>gi|443697641|gb|ELT98008.1| hypothetical protein CAPTEDRAFT_123077 [Capitella teleta]
          Length = 416

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 229/326 (70%), Gaps = 11/326 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FP LC+TCLGDNPY+RM +  +G ECKVC RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDSDFPTLCQTCLGDNPYIRMMKDKYGMECKVCERPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAKL+N+CQTCLLDL+Y LP QVRD AL V    P+S++N+E++ QN+E +I+ ++ 
Sbjct: 71  CQTCAKLRNICQTCLLDLEYGLPTQVRDAALKVHESMPKSDVNKEFYTQNMEREIANSDG 130

Query: 131 LINYGKADSSGR-----EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
               G     G+     EML KLART PYYKRNRPH+CSF+VKG C RG+ECPYRHE P 
Sbjct: 131 TTAVGPYAGGGKSQNSHEMLMKLARTAPYYKRNRPHVCSFWVKGECKRGEECPYRHEKPT 190

Query: 186 --ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV-EDDID 242
             ++ LS QNI+DRYYG NDPVA+K+++R        + PPEDK++ +L++  + ED+I 
Sbjct: 191 DPDDPLSDQNIRDRYYGINDPVAEKLMSRY--STLPKLEPPEDKSVCTLYVGNLGEDEIT 248

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           E DL+ YFY FGE+++V +V + +CAFI F TRA+AE+A++K+ + L +    L I WG+
Sbjct: 249 ETDLRNYFYQFGELRAVSLVIRQQCAFIQFTTRAAAEEAVEKTFNKLVMHGRRLNIKWGK 308

Query: 303 PRPTGPKTEVQAATTQNVVLPPLESM 328
             P                LPP ES+
Sbjct: 309 -SPGQTADGGGNLVDTGPALPPCESL 333



>gi|218197672|gb|EEC80099.1| hypothetical protein OsI_21840 [Oryza sativa Indica Group]
          Length = 617

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 187/353 (52%), Positives = 239/353 (67%), Gaps = 24/353 (6%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 140 DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 199

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + K  
Sbjct: 200 EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRKAR 259

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GKA  +  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+PE
Sbjct: 260 AGIDYDSSHGKAQPN--DTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPE 317

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G   ++TPP+D++I +L+I G+ + I E D
Sbjct: 318 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMPSLTPPDDESIRTLYIGGLNNRITEQD 375

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 376 LRDQFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGIRLKLMWGKPQ- 434

Query: 306 TGPKTEVQAATTQ----------NVVLPPLESMQIPAPPG-----EAPSDFLY 343
             PK E   A  Q            V+   +S   P PPG     +APS   Y
Sbjct: 435 -APKPEEDEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGTEGQQQAPSGSYY 486



 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 95/118 (80%), Gaps = 2/118 (1%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGK 124
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA PRS++NREYFA+  + K
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAEEHDRK 125



>gi|508699821|gb|EOX91717.1| CCCH-type zinc fingerfamily protein with RNA-binding domain
           [Theobroma cacao]
          Length = 495

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 184/377 (48%), Positives = 244/377 (64%), Gaps = 38/377 (10%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKADYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+V+G CTRG ECPYRHE+P 
Sbjct: 128 AGLDYESSYGKVRPN--DTILKLQRTTPYYKRNRAHICSFYVRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PPED+ I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLN--KAGEMPSLEPPEDEGIKTLYVGGLDKRVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+++ +V    CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+ 
Sbjct: 244 LRDNFYAHGEIETIKMVLDKACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGKPQA 303

Query: 306 TGPKTEV------QAATTQNVVLP-----------------------PLESMQIPAPPGE 336
             P++E       Q A   + +LP                       P++   IP PP  
Sbjct: 304 PRPESETSEGGMQQVAVAHSGMLPRAVISQQQNQFQPSGPGVQDQPQPMQYFNIPPPPQL 363

Query: 337 APSDFLYPSQDPTYQGS 353
                 YPS DP   G+
Sbjct: 364 --DRAFYPSMDPQRMGA 378



>gi|297849030|ref|XP_002892396.1| hypothetical protein ARALYDRAFT_470757 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338238|gb|EFH68655.1| hypothetical protein ARALYDRAFT_470757 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 481

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 176/360 (48%), Positives = 237/360 (65%), Gaps = 20/360 (5%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NREYFA+  + K  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREYFAEEHDRKTR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSFF++G CTRG ECPYRHE+PE
Sbjct: 128 AGLDYESSFGKMRPN--DTILKLQRTTPYYKRNRAHVCSFFIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  P+D++I +L++ G+   I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMGTLESPDDESIKTLYVGGLNSRILEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FYA+GEI+S+ ++    CAF+ + +R  AE+A  +  + L +    LK+TWGRP+P
Sbjct: 244 IRDQFYAYGEIESIRILADKACAFVTYTSREGAEKAAQELANRLVVNGQRLKLTWGRPKP 303

Query: 306 TGPKTEVQAATTQNVVL------------PPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
               +  Q     + +L            PP++   +   P      + YPS DP   G+
Sbjct: 304 DQDGSNQQGGVAHSGLLPRAVISQQHNQPPPMQQYYMHPLPANQDKPY-YPSMDPQRMGA 362



>gi|502134059|ref|XP_004501986.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           isoform X2 [Cicer arietinum]
          Length = 485

 Score =  362 bits (930), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 235/324 (72%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMTR  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTRAEYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSISSNDAIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GKA  +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSFGKARPN--DTILKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  +++  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMASLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQS 303

Query: 306 TGPKTE------VQAATTQNVVLP 323
           + P+++       QA+   + +LP
Sbjct: 304 SKPESDGSDQARQQASVAHSGLLP 327



>gi|502134056|ref|XP_004501985.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           isoform X1 [Cicer arietinum]
          Length = 484

 Score =  362 bits (930), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 235/324 (72%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMTR  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTRAEYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSISSNDAIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GKA  +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSFGKARPN--DTILKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  +++  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMASLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQS 303

Query: 306 TGPKTE------VQAATTQNVVLP 323
           + P+++       QA+   + +LP
Sbjct: 304 SKPESDGSDQARQQASVAHSGLLP 327



>gi|157128887|ref|XP_001661533.1| RNA binding motif protein [Aedes aegypti]
 gi|108872461|gb|EAT36686.1| AAEL011251-PA [Aedes aegypti]
          Length = 429

 Score =  362 bits (929), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 233/339 (68%), Gaps = 11/339 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +SEFP+LC+TCLGDNPYVRM ++ +GKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSEFPVLCQTCLGDNPYVRMIKERYGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI-SGAE 129
           CQTC+KLKNVCQTCLLDL+Y LP QVRD AL + +  P S++N+EY+ Q IE ++ +G +
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPTQVRDAALKIQDKIPESDVNKEYYIQTIEAQLKAGGD 130

Query: 130 SLINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
           + +  G    S    +ML KLART PYYKRN PHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 NTVAAGTVGKSLAASDMLAKLARTAPYYKRNLPHICSFWVKGECKRGEECPYRHDKPVEP 190

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + LS QNI+DRYYG NDPVA K++ R    +   + PPEDKTIT+L++  + + + E D
Sbjct: 191 DDPLSEQNIRDRYYGRNDPVADKLMKR--AASIPTLEPPEDKTITTLYVGNLGEHLTEVD 248

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FY +GEI+SV +V + +CAF+ +  RA+AE A +K+ + L +    L I W   + 
Sbjct: 249 IRDNFYHYGEIRSVSLVPRQQCAFVQYTKRAAAELAAEKTFNKLVLGGKKLTIKWAHSQA 308

Query: 306 TGPKTEVQAATTQNVVLPPLESM--QIPAPPGEAPSDFL 342
                   +    + +  P+  +  Q+P PP   P+D+ 
Sbjct: 309 KSTAYAQSSVPRTSRIFDPVPGLPGQLPMPPN--PNDYF 345



>gi|356574477|ref|XP_003555373.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Glycine max]
          Length = 481

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 182/368 (49%), Positives = 246/368 (66%), Gaps = 29/368 (7%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTKAEYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSIDSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSYGKVRPN--DTIMKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  S +  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMSTLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQT 303

Query: 306 TGPKTE------VQAATTQNVVLP--------------PLESMQIPAPPGEAPSDFLYPS 345
           + P+++       QA+   + +LP               +     P PP +  S   YPS
Sbjct: 304 SKPESDGSDQARPQASVAHSGLLPRAVISQQQNQDQAQGMLYYNNPPPPQQERS--YYPS 361

Query: 346 QDPTYQGS 353
            DP   G+
Sbjct: 362 MDPQRMGA 369



>gi|512908697|ref|XP_004926745.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Bombyx mori]
          Length = 409

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 232/319 (72%), Gaps = 11/319 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLGDNPY+RMT++ +GKECK+CSRPFT+FRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDADFPILCQTCLGDNPYIRMTKEKYGKECKICSRPFTVFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD AL V +D PR+E+N+EY+ QN+E ++S ++ 
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAALKVQDDLPRNEVNKEYYIQNLESQLSNSDP 130

Query: 131 LINYGKADSSG-REMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--EN 187
                   S G  ++L +LART PYYKRNRPH+CSF+VKG C RG+ECPYRHE P   ++
Sbjct: 131 TQPTNSLKSKGSSDLLVRLARTAPYYKRNRPHVCSFWVKGECRRGEECPYRHEKPTDPDD 190

Query: 188 ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK 247
            L+ QNIKDRYYG NDPVA+K++ R            EDKT+T+L++  + D++ E +L+
Sbjct: 191 PLADQNIKDRYYGVNDPVAEKLMRRAAAMPALPPP--EDKTVTTLYVGNLPDNVTEDELR 248

Query: 248 GYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTG 307
           G+FY +GEI+ + +V +++CAF+ + +R +AE A +K+ + L I    L I WG+ +   
Sbjct: 249 GHFYQYGEIRCLTLVPRAQCAFVQYTSRNAAEHAAEKTFNRLVIFGKRLTIKWGKSQGR- 307

Query: 308 PKTEVQAATTQNVVLPPLE 326
                Q  T +N  +P LE
Sbjct: 308 -----QGLTEKNDGVPMLE 321



>gi|357629028|gb|EHJ78065.1| putative RNA binding motif protein 22 [Danaus plexippus]
          Length = 405

 Score =  362 bits (929), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 228/311 (73%), Gaps = 7/311 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSDFPILCQTCLGDNPYIRMTKEKYGKECKICVRPFTVFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAE- 129
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD AL + +D PR+E+N+EY+ QN++ ++S  + 
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAALKIQDDLPRNEVNKEYYIQNLDSQMSKFDP 130

Query: 130 -SLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
               N         ++L +LART PYYKRNRPH+CSF+VKG C RG+ECPYRHE P   +
Sbjct: 131 SQPSNSALKSKGASDLLMRLARTAPYYKRNRPHVCSFWVKGECRRGEECPYRHEKPTDPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA+K++ R            ED+T+T+L+I  + ++I E +L
Sbjct: 191 DPLADQNIKDRYYGVNDPVAEKLMRRAAAMPALPPP--EDRTVTTLYIGNLPENITEEEL 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR-P 305
           +G+FY +GEI+S+ +V +++CAF+ + TR++AE A +K+ + L I    L I WG+ +  
Sbjct: 249 RGHFYQYGEIRSLTLVPRAQCAFVQYTTRSAAEHAAEKTFNRLVIAGRRLAIKWGKSQGR 308

Query: 306 TGPKTEVQAAT 316
            GP   ++A  
Sbjct: 309 QGPSEAIEAGV 319



>gi|195053830|ref|XP_001993829.1| GH21879 [Drosophila grimshawi]
 gi|193895699|gb|EDV94565.1| GH21879 [Drosophila grimshawi]
          Length = 423

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 224/296 (75%), Gaps = 8/296 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPYVRM ++ FGKECK+C+RPFTIFRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---G 127
           CQTCA+LKNVCQTCLLDL++ LP+QVRD AL V ++ P+S++N+EY+ QNI+ +++   G
Sbjct: 71  CQTCARLKNVCQTCLLDLEFGLPIQVRDAALKVADNMPQSDVNKEYYIQNIDAQLADGDG 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
            E+    G++ ++  EML KLART PYYKRNRPHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 TEAAGAVGRSLAAN-EMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHDKPNEP 189

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + L  QNIKDRYYG NDPVA+KI+ R    +   + PPED+ IT+L++  + ++I E +
Sbjct: 190 DDPLCEQNIKDRYYGRNDPVAEKIMKR--AASLPTLEPPEDRNITTLYVGNLPEEITEPE 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
           ++  FY +GEI+S+ +V + +C+F+ +  R++AE A +++ + L I    + I W 
Sbjct: 248 IRDQFYQYGEIRSIALVPRQQCSFVQYTKRSAAELAAERTFNKLVIHGRKVSIKWA 303



>gi|322792638|gb|EFZ16520.1| hypothetical protein SINV_01234 [Solenopsis invicta]
          Length = 411

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 229/317 (72%), Gaps = 8/317 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKERYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+ +I   + 
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDNEIGKIDP 130

Query: 131 LINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
               G    S    ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   +
Sbjct: 131 TTPAGAVGKSAAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L+I  + D + E  L
Sbjct: 191 DPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYIGNLGDVLTEKQL 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + +FY +GEI+ V +V + +CAFI +  R++AE A +++ + L +    L I WGR +  
Sbjct: 249 RDHFYQYGEIRMVTMVQRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ-- 306

Query: 307 GPKTEVQAATTQNVVLP 323
           G +T   A TT+ ++ P
Sbjct: 307 GRQTVSAADTTREILEP 323



>gi|356499475|ref|XP_003518565.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Glycine max]
          Length = 484

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 233/324 (71%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMTR  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTRAEYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSIDSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRPN--DTIMKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L +    N   +  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLGKAVEMN--TLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQT 303

Query: 306 TGPKTE------VQAATTQNVVLP 323
           + P+++       QA+   + +LP
Sbjct: 304 SKPESDGSDQAKQQASVAHSGLLP 327



>gi|66536941|ref|XP_395009.2| PREDICTED: pre-mRNA-splicing factor RBM22-like [Apis mellifera]
          Length = 411

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 232/318 (72%), Gaps = 10/318 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKERYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDSEIGKIDP 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPAGAVGKS-AAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L++  + D + E  
Sbjct: 190 DDPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYVGNLGDVLTEKQ 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+SV +V + +CAFI +  R++AE A +++ + L +    L I WGR + 
Sbjct: 248 LRDHFYQYGEIRSVTMVPRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ- 306

Query: 306 TGPKTEVQAATTQNVVLP 323
            G +T   A  T+ ++ P
Sbjct: 307 -GRQTVSAAEATREILEP 323



>gi|380020369|ref|XP_003694059.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Apis florea]
          Length = 411

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 232/318 (72%), Gaps = 10/318 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKERYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDSEIGKIDP 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPAGAVGKS-AAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L++  + D + E  
Sbjct: 190 DDPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYVGNLGDVLTEKQ 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+SV +V + +CAFI +  R++AE A +++ + L +    L I WGR + 
Sbjct: 248 LRDHFYQYGEIRSVTMVPRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ- 306

Query: 306 TGPKTEVQAATTQNVVLP 323
            G +T   A  T+ ++ P
Sbjct: 307 -GRQTVSAAEATREILEP 323



>gi|340722791|ref|XP_003399785.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Bombus terrestris]
 gi|350424167|ref|XP_003493709.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Bombus impatiens]
          Length = 411

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 232/318 (72%), Gaps = 10/318 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKERYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDSEIGKIDP 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPAGAVGKS-AAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L++  + D + E  
Sbjct: 190 DDPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYVGNLGDVLTEKQ 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+SV +V + +CAFI +  R++AE A +++ + L +    L I WGR + 
Sbjct: 248 LRDHFYQYGEIRSVTMVPRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ- 306

Query: 306 TGPKTEVQAATTQNVVLP 323
            G +T   A  T+ ++ P
Sbjct: 307 -GRQTVSAAEATREILEP 323



>gi|402225246|gb|EJU05307.1| hypothetical protein DACRYDRAFT_92681 [Dacryopinax sp. DJM-731 SS1]
          Length = 323

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 212/303 (69%), Gaps = 7/303 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW  S+FPILCETCLG+N Y+RM++Q FGKEC  C+RPFT+FRW PG G R+K
Sbjct: 3   KADINKAGWETSDFPILCETCLGENAYIRMSKQEFGKECGSCARPFTVFRWNPGQGARFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
            T +CQTCAK+KNVCQ CLLDL+Y LP QVRDTAL V  DAP+SEINREY+AQN+E K+ 
Sbjct: 63  STVVCQTCAKVKNVCQCCLLDLEYGLPAQVRDTALGVRADAPQSEINREYYAQNMEAKMD 122

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
               L   G A ++G+EMLKKLAR  PYYKRN P+ICSFFVKG C RG +CPYRHEIP++
Sbjct: 123 SNGMLSGTGSASTAGKEMLKKLARQTPYYKRNAPNICSFFVKGQCNRGADCPYRHEIPQK 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
            ELS+Q ++DRY+GTNDPVA KIL  ++    + + PPED++IT+  +  +     EA  
Sbjct: 183 TELSNQKLQDRYHGTNDPVAHKIL--IQHAADAGLAPPEDQSITAFMLAALPQTSQEAIT 240

Query: 247 KGYFYAFGEIK-----SVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
                A  ++K      VV V KS CAFINF TRA+AE+        L I    + + W 
Sbjct: 241 FALRQAVPKLKEEDLRGVVYVEKSNCAFINFRTRAAAEENAKALAKGLEIGGRTIGLRWA 300

Query: 302 RPR 304
           RPR
Sbjct: 301 RPR 303



>gi|297745955|emb|CBI16011.3| unnamed protein product [Vitis vinifera]
          Length = 349

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/317 (53%), Positives = 228/317 (71%), Gaps = 7/317 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   R+KKT
Sbjct: 8   DLEADGWERSDFPIICESCLGDNPYVRMTKADYDKECKICTRPFTVFRWRPGRDARFKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSFGKVRPN--DTILKLQRTTPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPI 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+LN  K G   ++ PPED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLN--KAGEMPSLEPPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+SV +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESVRMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQA 303

Query: 306 TGPKTEVQAATTQNVVL 322
             P+ E      Q   L
Sbjct: 304 PKPEGESSEEARQQAAL 320



>gi|356549608|ref|XP_003543184.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Glycine max]
          Length = 467

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 233/324 (71%), Gaps = 13/324 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTKAEYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRD+AL++ +NDA P+S++NREYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDSALSIDSNDAIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSYGKVRPN--DTILKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  S +  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMSTLEAPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDHFYAHGEIESIKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQT 303

Query: 306 TGPKTE------VQAATTQNVVLP 323
           T P+++       QA+   + +LP
Sbjct: 304 TKPESDGSDQARQQASVAHSGLLP 327



>gi|383857285|ref|XP_003704135.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Megachile
           rotundata]
          Length = 412

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 232/318 (72%), Gaps = 10/318 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKEKYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDSEIGKIDP 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPAGAVGKS-AAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L+I  + D + E  
Sbjct: 190 DDPLADQNIKDRYYGVNDPVADKLMRR--AAAMPKLDPPEDKSITTLYIGNLGDVLTEKQ 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+S+ +V + +CAFI +  R++AE A +++ + L +    L I WGR + 
Sbjct: 248 LRDHFYQYGEIRSITMVPRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ- 306

Query: 306 TGPKTEVQAATTQNVVLP 323
            G +T   A  T+ ++ P
Sbjct: 307 -GRQTVSAAEATREILEP 323



>gi|158292281|ref|XP_313808.4| AGAP004509-PA [Anopheles gambiae str. PEST]
 gi|347972043|ref|XP_003436831.1| AGAP004509-PB [Anopheles gambiae str. PEST]
 gi|157017362|gb|EAA09240.4| AGAP004509-PA [Anopheles gambiae str. PEST]
 gi|333469145|gb|EGK97189.1| AGAP004509-PB [Anopheles gambiae str. PEST]
          Length = 441

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 165/296 (55%), Positives = 218/296 (73%), Gaps = 7/296 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +SEFPILC+TCLGDNPYVRM ++ +GKECK+C+RPFTIFRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSEFPILCQTCLGDNPYVRMIKERYGKECKICTRPFTIFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI-SGAE 129
           CQTC+KLKNVCQTCLLDL+Y LP QVRD AL + +  P S++N+E++ QNIE ++ +G +
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPTQVRDAALKIQDKIPESDVNKEFYIQNIESQLKAGGD 130

Query: 130 SLINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE- 186
           + +  G    S    +ML KLART PYYKRN PHICSF+VKG C RG+ECPYRH+ P E 
Sbjct: 131 NTVAAGTVGKSLAASDMLAKLARTAPYYKRNLPHICSFWVKGECKRGEECPYRHDKPVEP 190

Query: 187 -NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
            + LS QNI+DRYYG NDPVA K++ R    +   + PPEDKTIT+L++  + + I E D
Sbjct: 191 DDPLSEQNIRDRYYGRNDPVADKLMKR--AASIPTLDPPEDKTITTLYVGNLGEHITEVD 248

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
           ++  FY +GEI+SV +V + +CAF+ +  RA+AE A +K+ + L +    L I W 
Sbjct: 249 IRDNFYHYGEIRSVSLVPRQQCAFVQYTKRAAAELAAEKTFNKLVLGGKKLTIKWA 304



>gi|470325719|ref|XP_004364532.1| Rbm22 protein [Capsaspora owczarzaki ATCC 30864]
 gi|320166721|gb|EFW43620.1| Rbm22 protein [Capsaspora owczarzaki ATCC 30864]
          Length = 409

 Score =  360 bits (923), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 237/410 (57%), Gaps = 65/410 (15%)

Query: 5   AAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMR 64
           A +  P+  GW  SEFPILC+TCLGDNPY+RMT++ +G ECK+CSRPFTIFRW PG  MR
Sbjct: 3   AGQQLPSVMGWESSEFPILCQTCLGDNPYLRMTKEQYGNECKICSRPFTIFRWQPGRNMR 62

Query: 65  YKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGK 124
           +KKTEICQTCAKLKNVCQTC+LDL+Y LPVQVRD    V ND PRS++NR+Y   N+   
Sbjct: 63  FKKTEICQTCAKLKNVCQTCILDLEYALPVQVRDQLSGVANDLPRSDVNRQYHVHNMANA 122

Query: 125 ISGAE-----------------------------------------------SLINYGKA 137
           I+ +E                                               ++++    
Sbjct: 123 IANSENPALASPYTGTLPLAHGSLSAEAVVIPGATGEGGSSSSGNSGGDNALAVLSASDV 182

Query: 138 DSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE--NELSHQNIK 195
              G + L +LAR EPYYKRN  HIC+FFVKG C RG+ CPYRHE+P +  + L+ QNI 
Sbjct: 183 SKVGPDALSRLARREPYYKRNAAHICTFFVKGECKRGETCPYRHELPTDPSSALAKQNIV 242

Query: 196 DRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGE 255
           DRYYGTNDPVA K+L ++       ITPP DK+IT+L++  ++D I E DL+ YFY FGE
Sbjct: 243 DRYYGTNDPVAAKMLGQLV--KMPKITPPADKSITTLYVGNLDDSISEDDLRDYFYQFGE 300

Query: 256 IKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQ-- 313
           I+S+ +  K+ CAF+ F TR  AE A ++S++   I +  LKI WG+             
Sbjct: 301 IRSITISRKAACAFVAFTTRLFAEAAAERSYNKAIIHDRKLKIMWGKSAANQSSFGGGSS 360

Query: 314 -----AATTQNVVLPPLESMQIPAPPGEAPSDFL-YPSQDPTYQGSSTKG 357
                AA    V LPP      P P     S  L Y SQDP   GS+  G
Sbjct: 361 SPANGAAAAGTVSLPP------PPPTASGASGSLRYSSQDPQRMGSNKGG 404



>gi|118344182|ref|NP_001071914.1| zinc finger protein [Ciona intestinalis]
 gi|92081514|dbj|BAE93304.1| zinc finger protein [Ciona intestinalis]
          Length = 413

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 232/334 (69%), Gaps = 12/334 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ES+FPILC+TCLGDNPY+RMT++ FGKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEESDFPILCQTCLGDNPYIRMTKETFGKECKICDRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKN+CQTCLLDL+Y LPVQ RD AL + +D P+S++N+E++ QN+E +I+  + 
Sbjct: 71  CQTCSKLKNICQTCLLDLEYGLPVQTRDEALAIKDDIPKSDVNKEFYTQNMEREIANTDG 130

Query: 131 LI---NYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
            +   + GKA +   ++L ++ART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TVAVGSVGKAQAPS-DLLVRMARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRV-KGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
           ++ LS QNIKDRYYG NDPVA K++ R  +      + PPED+TIT+L+I G+ + ++E 
Sbjct: 190 DDPLSDQNIKDRYYGINDPVANKLMRRATESAEQEAVAPPEDQTITTLYIGGLGEAVNEE 249

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+  FY +GEI+S+ +      AF+ F  R+ AE A  ++   L IK   + + WG+ +
Sbjct: 250 DLRDQFYHYGEIRSIHMATNQNYAFVQFTKRSDAETAAKRTAGRLMIKGKRIVVRWGKSQ 309

Query: 305 PTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAP 338
            +  K   +   + +    P     +P  PG  P
Sbjct: 310 GSIKKGGDKGDKSSHSSYNP-----VPGLPGALP 338



>gi|290561328|gb|ADD38066.1| Pre-mRNA-splicing factor RBM22 [Lepeophtheirus salmonis]
          Length = 362

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 232/362 (64%), Gaps = 33/362 (9%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC+TCLGDNPY+RM ++ +GKECK+CSRPF  FRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSDFPILCQTCLGDNPYLRMMKERYGKECKICSRPFATFRWCPGAKMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAKLKNVCQTCLLDL+Y LP+QVRD  L +  D P+S++NREY+ QN++        
Sbjct: 71  CQTCAKLKNVCQTCLLDLEYGLPIQVRDQMLKLKTDLPQSDVNREYYLQNVDSN------ 124

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENE 188
                K  S   E+L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ 
Sbjct: 125 ----SKMPSQKNEVLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRHERPNDPDDP 180

Query: 189 LSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKG 248
           L+ QNI+DRYYG NDPVA K+L R +      +  PED  IT+L++ G++D +DE D+  
Sbjct: 181 LNDQNIRDRYYGVNDPVADKLLKRAEA--LPKLETPEDPLITTLYVGGLDDVLDEKDISS 238

Query: 249 YFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGP 308
           +FY +GEI+++ +V K  CAF+ F+ R+SAE A +K+ +NL I    + + WG+ +    
Sbjct: 239 HFYQYGEIRNITLVPKQGCAFVQFSKRSSAELAAEKTFNNLVIHGRKIIVRWGKSQGRQL 298

Query: 309 KTEVQAATTQ-----------------NVVLPPLESMQIPAPPGEAPSDFLYPSQDPTYQ 351
              V  A  Q                 N    P  S      PG       YPSQDP+  
Sbjct: 299 TPAVVNAAPQVPGLPGLLPPPPEELQNNFFNIPSTSSTTVGYPGTLL--IHYPSQDPSRL 356

Query: 352 GS 353
           GS
Sbjct: 357 GS 358



>gi|391327440|ref|XP_003738208.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Metaseiulus
           occidentalis]
          Length = 364

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 217/296 (73%), Gaps = 6/296 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W ++EFPILC+TCLG+NP +RM +  +GKECK+C+RPFT+FRW PG   R+KKTE+
Sbjct: 11  NRLNWEDAEFPILCQTCLGENPLIRMMKDRYGKECKICARPFTVFRWCPGPKSRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAKLKNVCQTCLLDL Y LPVQVRD ALN+ ++ P+S++NREY+ QN+E  ++  + 
Sbjct: 71  CQTCAKLKNVCQTCLLDLDYGLPVQVRDQALNIKDEIPKSDVNREYYQQNVEATVAVGDP 130

Query: 131 LINYGKADSSG--REMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
              YG+   +    ++L K+AR+ PYYKRNRPHICSF+VKG C RGDECPYRHE P   +
Sbjct: 131 SRPYGQLAKAQAPSDVLAKMARSTPYYKRNRPHICSFWVKGECKRGDECPYRHEKPTDPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYGTNDPVA K++ R +      I PP DK IT+L++ GV  +  + D+
Sbjct: 191 DPLADQNIKDRYYGTNDPVAHKLMQRAQ--TMPKIEPPADKNITTLYLGGVPKETTDQDI 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           + +FY FGEI+++ +V K  CAFI F TRASA+ A ++S + L +    + + WGR
Sbjct: 249 RNHFYQFGEIRAINIVEKQSCAFICFMTRASAQLAAERSFNKLFLHGRRINVKWGR 304



>gi|307181748|gb|EFN69209.1| Pre-mRNA-splicing factor RBM22 [Camponotus floridanus]
          Length = 411

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 218/296 (73%), Gaps = 6/296 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKEKYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+ +I   + 
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDNEIGKIDP 130

Query: 131 LINYGKADSS--GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
               G    S    ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   +
Sbjct: 131 TTPAGAVGKSAAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPD 190

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L+I  + D + E  L
Sbjct: 191 DPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYIGNLGDILTEKQL 248

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           + +FY +GEI+SV +V + +CAFI +  R +AE A +++ + L +    L I WGR
Sbjct: 249 RDHFYQYGEIRSVTMVPRQQCAFIQYTQRNAAEAAAERTFNKLILGGRRLTIKWGR 304



>gi|297822673|ref|XP_002879219.1| hypothetical protein ARALYDRAFT_344719 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297325058|gb|EFH55478.1| hypothetical protein ARALYDRAFT_344719 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 464

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 221/303 (72%), Gaps = 7/303 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NRE+FA+  + K  
Sbjct: 68  EVCQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREFFAEEHDRKTR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + ++ L RT PYYKRNR HICSFF++G CTRGDECPYRHE+PE
Sbjct: 128 AGLDYESSFGKIRPN--DTIRMLQRTTPYYKRNRAHICSFFIRGECTRGDECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  PED++I +L++ G+   + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMGTLESPEDQSIKTLYVGGLNSRVLEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           ++  FYA+GEI+S+ ++ +  CAF+ + TR  AE+A ++  + L +    LK+TWGRP+ 
Sbjct: 244 IRDQFYAYGEIESIRILAEKACAFVTYTTREGAEKAAEELSNRLVVNGQRLKLTWGRPQV 303

Query: 306 TGP 308
             P
Sbjct: 304 PKP 306



>gi|426199988|gb|EKV49912.1| hypothetical protein AGABI2DRAFT_190345 [Agaricus bisporus var.
           bisporus H97]
          Length = 333

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 218/314 (69%), Gaps = 16/314 (5%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +S+FPILCETCLG NP+VRM++Q +G+ C  C+RPFT+FRW PG G R+K
Sbjct: 3   KADLNKAGWEQSDFPILCETCLGGNPFVRMSKQEYGRSCGTCARPFTVFRWNPGQGGRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL   N+AP S+INREY+AQ +E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGFKNEAPTSDINREYYAQVMESKMQ 122

Query: 126 ---SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHE 182
              S   S ++  ++ ++G+EMLK LART+P+YKRNRPH+CSFF KG C RG ECPYRHE
Sbjct: 123 QDGSNGRSGLDVSQSANAGKEMLKTLARTDPFYKRNRPHVCSFFAKGDCNRGTECPYRHE 182

Query: 183 IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSN--ITPPEDKTITSLFITGVEDD 240
            P +NEL+HQN++DRY+G NDPVA KIL    GG+  +  + PPED TITSLF++ +   
Sbjct: 183 KPVDNELAHQNMQDRYHGRNDPVANKIL----GGHAESQGLKPPEDTTITSLFLSSLPPS 238

Query: 241 IDEADLKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEH 294
             E  ++              +KS+V V K++CAF+NF  R SAE A     + + I   
Sbjct: 239 STEQSIRTRVLQSLPAIQPTNLKSIVHVAKTKCAFVNFKDRGSAEHAAQAWANGVEIDGQ 298

Query: 295 DLKITWGRPRPTGP 308
              + WGR RP  P
Sbjct: 299 IASVKWGRSRPKNP 312



>gi|15227567|ref|NP_180518.1| MOS4-associated complex subunit MAC5B [Arabidopsis thaliana]
 gi|75339110|sp|Q9ZW36.1|C3H25_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 25;
           Short=AtC3H25
 gi|16226863|gb|AAL16284.1|AF428354_1 At2g29580/F16P2.4 [Arabidopsis thaliana]
 gi|3980378|gb|AAC95181.1| putative RNA-binding protein [Arabidopsis thaliana]
 gi|27363236|gb|AAO11537.1| At2g29580/F16P2.4 [Arabidopsis thaliana]
 gi|330253181|gb|AEC08275.1| zinc finger CCCH domain-containing protein 25 [Arabidopsis
           thaliana]
          Length = 483

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 227/321 (70%), Gaps = 10/321 (3%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC KLKNVCQ CLLDL+Y LPVQVRDTALN+ T+D+ P+S++NRE+FA+  + K  
Sbjct: 68  EVCQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREFFAEEHDRKTR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + ++ L RT PYYKRNR HICSFF++G CTRGDECPYRHE+PE
Sbjct: 128 AGLDYESSFGKIRPN--DTIRMLQRTTPYYKRNRAHICSFFIRGECTRGDECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G    +  PED++I +L++ G+   + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLG--KAGEMGTLESPEDQSIRTLYVGGLNSRVLEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR--- 302
           ++  FYA GEI+S+ ++ +  CAF+ + TR  AE+A ++  + L +    LK+TWGR   
Sbjct: 244 IRDQFYAHGEIESIRILAEKACAFVTYTTREGAEKAAEELSNRLVVNGQRLKLTWGRPQV 303

Query: 303 PRPTGPKTEVQAATTQNVVLP 323
           P+P    +  Q +   + +LP
Sbjct: 304 PKPDQDGSNQQGSVAHSGLLP 324



>gi|409082162|gb|EKM82520.1| hypothetical protein AGABI1DRAFT_111127 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 333

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 218/314 (69%), Gaps = 16/314 (5%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KAD NK GW +S+FPILCETCLG NP+VRM++Q +G+ C  C+RPFT+FRW PG G R+K
Sbjct: 3   KADLNKAGWEQSDFPILCETCLGGNPFVRMSKQEYGRSCGTCARPFTVFRWNPGQGGRFK 62

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
            T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL   N+AP S+INREY+AQ +E K+ 
Sbjct: 63  TTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGFKNEAPTSDINREYYAQVMESKMQ 122

Query: 126 ---SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHE 182
              S   S ++  ++ ++G+EMLK LART+P+YKRNRPH+CSFF KG C RG ECPYRHE
Sbjct: 123 QDGSNGRSGLDVSQSANAGKEMLKTLARTDPFYKRNRPHVCSFFAKGDCNRGTECPYRHE 182

Query: 183 IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSN--ITPPEDKTITSLFITGVEDD 240
            P +NEL+HQN++DRY+G NDPVA KIL    GG+  +  + PPED TITSLF++ +   
Sbjct: 183 KPVDNELAHQNMQDRYHGRNDPVANKIL----GGHAESQGLKPPEDTTITSLFLSSLPPS 238

Query: 241 IDEADLKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEH 294
             E  ++              +KS+V V K++CAF+NF  R SAE A     + + I   
Sbjct: 239 STEQSIRTRVLQSLPAIQPTNLKSIVHVAKTKCAFVNFKDRGSAEHAAQAWANGVEIDGQ 298

Query: 295 DLKITWGRPRPTGP 308
              + WGR RP  P
Sbjct: 299 IASVKWGRSRPKNP 312



>gi|357462041|ref|XP_003601302.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gi|355490350|gb|AES71553.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
          Length = 492

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 225/306 (73%), Gaps = 7/306 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGD+PYVRMT+  + KECK+C+RPFT+FRW PG   RYKK+
Sbjct: 8   DHEADGWERSDFPIICESCLGDSPYVRMTKAEYDKECKICTRPFTVFRWRPGRDARYKKS 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL++ +NDA P+S++NREYFA+  + K  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSISSNDAIPKSDVNREYFAEEHDRKAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GKA  +  + + KL RT PYYKRNR HICSF+ +G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSFGKARPN--DTILKLQRTTPYYKRNRAHICSFYTRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G  S++  PED++I +L++ G++  + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAMKLLG--KAGEMSSLEVPEDESIKTLYVGGLDARVTEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+  FYA GEI+SV +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WGRP+ 
Sbjct: 244 LRDNFYAHGEIESVKMVLQRACAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGRPQS 303

Query: 306 TGPKTE 311
             P+++
Sbjct: 304 AKPESD 309



>gi|307192892|gb|EFN75920.1| Pre-mRNA-splicing factor RBM22 [Harpegnathos saltator]
          Length = 415

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 171/318 (53%), Positives = 231/318 (72%), Gaps = 10/318 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT++ +GKECK+C RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMTKERYGKECKICMRPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTC++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+   GKI  
Sbjct: 71  CQTCSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDNEIGKIDP 130

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE-- 185
                  GK+ ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   
Sbjct: 131 TSPAGAVGKS-AAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDP 189

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
           ++ L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L+I  + D + E  
Sbjct: 190 DDPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYIGNLGDVLTEKQ 247

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           L+ +FY +GEI+SV +V + +CAFI +  R +AE A +++ + L +    L I WGR + 
Sbjct: 248 LRDHFYQYGEIRSVTMVPRQQCAFIQYTQRTAAEAAAERTFNKLILGGRRLTIKWGRSQ- 306

Query: 306 TGPKTEVQAATTQNVVLP 323
            G +T   A  T+ ++ P
Sbjct: 307 -GRQTVSAAEATREILEP 323



>gi|374256067|gb|AEZ00895.1| putative zinc finger CCCH-type family protein, partial [Elaeis
           guineensis]
          Length = 307

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/299 (55%), Positives = 220/299 (73%), Gaps = 7/299 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMTR  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMTRADYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           E+CQTC KLKNVCQ CLLDL+Y LPVQVRDTAL + +NDA P+S++NREYFA+  + +  
Sbjct: 68  EVCQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR H+CSF+ +G CTRG ECPYRHE+P 
Sbjct: 128 AGIDYESSYGKVRPN--DTILKLQRTTPYYKRNRAHVCSFYARGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L+  K G   ++T PED++I +L++ G++  I E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVALKLLS--KAGEMPSLTAPEDESIKTLYVGGLDARITEQD 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           L+ +FYA GEI+S+ +V +  CAF+ + TR  AE+A ++  + L IK   LK+ WG+P+
Sbjct: 244 LRDHFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGLRLKLMWGKPQ 302



>gi|302808802|ref|XP_002986095.1| hypothetical protein SELMODRAFT_44024 [Selaginella moellendorffii]
 gi|300146243|gb|EFJ12914.1| hypothetical protein SELMODRAFT_44024 [Selaginella moellendorffii]
          Length = 366

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 185/363 (50%), Positives = 234/363 (64%), Gaps = 34/363 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CETCLGDNPYVRMT+  F KECK+C+RPFT+FRW  G   RYKKT
Sbjct: 8   DLEADGWERSDFPIICETCLGDNPYVRMTKANFDKECKICARPFTVFRWKAGRDSRYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKIS 126
           EICQTC+KLKNVCQ C+LDL+Y LPVQ RD+AL V TND  P+S++NREYFA+  + K+ 
Sbjct: 68  EICQTCSKLKNVCQVCVLDLEYGLPVQARDSALGVDTNDVIPKSDVNREYFAEEHDRKVD 127

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
              S   +GK   +  +M+ KL RT PYYKRNR HICSFFV+G C RGD CPYRHE+P  
Sbjct: 128 HESS---FGKVRPN--DMILKLQRTSPYYKRNRAHICSFFVRGGCQRGDACPYRHEMPVT 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
            ELS QNIKDRYYG NDPVA K+L   K    S +TPP+D T+ +L++ G+++ +   DL
Sbjct: 183 GELSQQNIKDRYYGLNDPVAAKLLK--KAEEMSTLTPPDDTTVRTLYVGGLDERVTTEDL 240

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           K  FY++GEI+S+ +V +  CAFI + TR  AE+A +     L +    LK+ WG+P+  
Sbjct: 241 KDNFYSYGEIESLRLVPQRACAFITYTTREDAEKAAEDLAHKLVVNGVRLKLMWGKPQAA 300

Query: 307 -------GPKTEVQA-----ATTQN----VVLPPLESMQIPAPPGEAPSDFLYPSQDPTY 350
                  G   E Q+     A  Q+      LPP      PAP  + P    YPS DP  
Sbjct: 301 KSDLSSGGGAQEEQSNEDGGAAEQDGGAAYYLPP------PAPLSDNP---YYPSMDPQR 351

Query: 351 QGS 353
            GS
Sbjct: 352 MGS 354



>gi|168027976|ref|XP_001766505.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682414|gb|EDQ68833.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 474

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 222/314 (70%), Gaps = 9/314 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRMT+  F KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DVEADGWERSDFPIICESCLGDNPYVRMTKANFDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL--NVTNDAPRSEINREYFAQNIEGKI- 125
           E+CQTC+KLKNVCQ CLLDL+Y LPVQVRDTAL  N +   P+S++NRE+FA+  + K  
Sbjct: 68  EVCQTCSKLKNVCQVCLLDLEYGLPVQVRDTALGINTSESIPKSDVNREFFAEEQDRKAK 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GKA  +  + + KL RT PYYKRNR HICSF+V+G CTRG ECPYRHE+P 
Sbjct: 128 AGLDYESSFGKARPN--DTILKLQRTTPYYKRNRAHICSFYVRGECTRGAECPYRHEMPV 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELS QNIKDRYYG NDPVA K+L   K G   ++  PED +I +L++ G+ D + E D
Sbjct: 186 TGELSQQNIKDRYYGVNDPVAAKLLK--KAGEMPSLMAPEDMSIKTLYVGGLVDRVTEED 243

Query: 246 LKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           LK  FY +GEI+S+ +V +  CAF+ + TR  AE+A D   + L I    LK+ WGRP+ 
Sbjct: 244 LKDQFYGYGEIESIRMVPQRACAFVTYTTREGAEKAADHLANKLVINGLRLKLMWGRPQV 303

Query: 306 TGPKTEVQAATTQN 319
              K +++AA  ++
Sbjct: 304 A--KADMEAAGEKD 315



>gi|470121309|ref|XP_004296718.1| PREDICTED: zinc finger CCCH domain-containing protein 40-like
           [Fragaria vesca subsp. vesca]
          Length = 497

 Score =  353 bits (906), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 180/371 (48%), Positives = 246/371 (66%), Gaps = 36/371 (9%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           GW  S+FPI+CE+CLGDNPYVRMT+  + KECK+C+RPFT+FRW PG   R+KK+EICQT
Sbjct: 13  GWERSDFPIICESCLGDNPYVRMTKADYDKECKICTRPFTVFRWRPGRDARFKKSEICQT 72

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTALNVTND--APRSEINREYFAQNIEGKI-SGAES 130
           C+KLKNVCQ CLLDL Y LPVQVRDTAL + +D   P+S++NRE+FA+  + K  +G + 
Sbjct: 73  CSKLKNVCQVCLLDLDYGLPVQVRDTALAIASDDAIPKSDVNREFFAEEHDRKARAGIDY 132

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELS 190
             +YGKA  +  + + KL RT PYYKRNR H+CSF+++G CTRG ECPYRHE+P   ELS
Sbjct: 133 ESSYGKARPN--DTILKLQRTTPYYKRNRAHVCSFYIRGECTRGAECPYRHEMPVTGELS 190

Query: 191 HQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYF 250
            QNIKDRYYG NDPVA K+LN  K G   ++ PP+D++I +L++ GV+  + E DL+  F
Sbjct: 191 QQNIKDRYYGVNDPVAMKLLN--KAGEMPSLEPPDDESIRTLYVGGVDARVSEQDLRDQF 248

Query: 251 YAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKT 310
           YA GEI+SV +V +  CAF+ + TR +AE+A ++  + L +K   LK+ WGRP+   PK 
Sbjct: 249 YAHGEIESVRMVVQRACAFVTYTTREAAEKAAEELSNRLVVKGLRLKLMWGRPQ--APKQ 306

Query: 311 EV--------QAATTQNVV----------------LPPLES-MQIPAPPGEAPSDFLYPS 345
           ++        QAA    ++                 PP++    +P PP +  +   YPS
Sbjct: 307 DLEGTAEARQQAAAHSGLLPRAVISQQQGQLQDQSAPPMQHYYNMPPPPSQERT--YYPS 364

Query: 346 QDPTYQGSSTK 356
            DP   G+  +
Sbjct: 365 MDPQRMGAVVR 375



>gi|302800509|ref|XP_002982012.1| hypothetical protein SELMODRAFT_154896 [Selaginella moellendorffii]
 gi|300150454|gb|EFJ17105.1| hypothetical protein SELMODRAFT_154896 [Selaginella moellendorffii]
          Length = 398

 Score =  352 bits (904), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 234/363 (64%), Gaps = 34/363 (9%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CETCLGDNPYVRMT+  F KECK+C+RPFT+FRW  G   RYKKT
Sbjct: 8   DLEADGWERSDFPIICETCLGDNPYVRMTKANFDKECKICARPFTVFRWKAGRDSRYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKIS 126
           EICQTC+KLKNVCQ C+LDL+Y LPVQ RD+AL V T+D  P+S++NREYFA+  + K+ 
Sbjct: 68  EICQTCSKLKNVCQVCVLDLEYGLPVQARDSALEVDTSDVIPKSDVNREYFAEEHDRKVD 127

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
              S   +GK   +  +M+ KL RT PYYKRNR HICSFFV+G C RGD CPYRHE+P  
Sbjct: 128 HESS---FGKVRPN--DMILKLQRTSPYYKRNRAHICSFFVRGGCQRGDACPYRHEMPVT 182

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
            ELS QNIKDRYYG NDPVA K+L   K    S +TPP+D T+ +L++ G+++ +   DL
Sbjct: 183 GELSQQNIKDRYYGLNDPVAAKLLK--KAEEMSTLTPPDDTTVRTLYVGGLDERVTTEDL 240

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           K  FY++GEI+S+ +V +  CAFI + TR  AE+A +     L +    LK+ WG+P+  
Sbjct: 241 KDNFYSYGEIESLRLVPQRACAFITYTTREDAEKAAEDLAHKLVVNGVRLKLMWGKPQAA 300

Query: 307 -------GPKTEVQA-----ATTQN----VVLPPLESMQIPAPPGEAPSDFLYPSQDPTY 350
                  G   E Q+     A  Q+      LPP      PAP  + P    YPS DP  
Sbjct: 301 KSDLSSGGGAQEEQSNEDGGAAEQDDGVAYYLPP------PAPLSDNP---YYPSMDPQR 351

Query: 351 QGS 353
            GS
Sbjct: 352 MGS 354



>gi|339247155|ref|XP_003375211.1| Pre-mRNA-splicing factor RBM22 [Trichinella spiralis]
 gi|316971466|gb|EFV55227.1| Pre-mRNA-splicing factor RBM22 [Trichinella spiralis]
          Length = 331

 Score =  352 bits (904), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 165/302 (54%), Positives = 217/302 (71%), Gaps = 10/302 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W ++EFPILCETCLG+NPY+RM ++ +G ECK+C+RPFTIFRW PG  MRYK+TE+
Sbjct: 11  NRMNWEDAEFPILCETCLGNNPYLRMMKERYGGECKICNRPFTIFRWCPGRNMRYKRTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKNVCQTCLLDL+Y LPVQVRD AL V +D P++  N+++F Q  + +I  ++ 
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPVQVRDYALGVKDDIPKTGANKDFFIQAAQREIDKSDG 130

Query: 131 LINYGK----ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
               G      D    E+L KLART PYY RNRPHICSF+VKG C RG+ECPYRHE P  
Sbjct: 131 TTLAGPLAELVDQRPNELLNKLARTNPYYDRNRPHICSFWVKGECRRGEECPYRHEKPTD 190

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD--ID 242
            ++ LS QNI+DRYYG+ DPVA K+LN+ K      + PPEDKTIT++++  + DD  I 
Sbjct: 191 PDDPLSVQNIRDRYYGSKDPVADKLLNKAKA--LPVLKPPEDKTITTIYLGNIGDDNVIT 248

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           E D+K YFY FGEI+S+V++ +  C F+ F TR +AE A +K+   L IK   + + WGR
Sbjct: 249 EDDIKNYFYQFGEIRSIVILSEKGCGFVQFTTREAAELASEKTFGKLMIKGRRITVRWGR 308

Query: 303 PR 304
           P+
Sbjct: 309 PQ 310



>gi|353237820|emb|CCA69784.1| related to Pre-mRNA-splicing factor RBM22 [Piriformospora indica
           DSM 11827]
          Length = 322

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/326 (52%), Positives = 234/326 (71%), Gaps = 13/326 (3%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK GW +S+FPILCETCLG NP+VRM++Q FG+EC  C+RPFT+FRW PG G 
Sbjct: 1   MPPKADLNKAGWEQSDFPILCETCLGPNPFVRMSKQEFGRECGTCARPFTVFRWNPGEGG 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           R+K T ICQTCAK+KN+CQTCLLDL++ LPVQ RDTAL V ++AP SEINRE++AQN EG
Sbjct: 61  RFKMTVICQTCAKIKNICQTCLLDLEFGLPVQARDTALAVRSEAPTSEINREWYAQNAEG 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           K++  ESL+  G+  S+ +EML++LAR++PYYKRNRPHICSFFVKG C RG  CPYRHE+
Sbjct: 121 KLAPHESLMKTGRVGSATKEMLQQLARSDPYYKRNRPHICSFFVKGQCNRGAACPYRHEM 180

Query: 184 P--EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDI 241
           P  +++ ++ QNIKDRY+G NDPVAKKIL+      G  + PP+D ++ SLF+T +  D 
Sbjct: 181 PTDKDDPMAKQNIKDRYHGRNDPVAKKILSNYAASKG--LVPPDDPSVQSLFLTPLPQDA 238

Query: 242 DEADLKGY------FYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
            E  ++        F +  +I+S+V V K++ AF+NF +R +AE+A +   + L+     
Sbjct: 239 TEDSIRTRVVQALPFLSPSDIRSIVHVAKTKSAFVNFTSRNAAERAAEAWANGLDWDGSI 298

Query: 296 LKITWGRPRPTGPKTEVQAATTQNVV 321
           + + WGR +    KT   A+T++ V 
Sbjct: 299 VGVKWGRSK---NKTAPVASTSETVA 321



>gi|393234593|gb|EJD42154.1| pre-mRNA-splicing factor SLT11 [Auricularia delicata TFB-10046 SS5]
          Length = 310

 Score =  351 bits (901), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 221/303 (72%), Gaps = 13/303 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA--GMR 64
           K D NK GW +S+FPILCETCLGDNPY+RMT+Q FGK C  C+RP+T+FRW PGA  G R
Sbjct: 3   KLDINKAGWEQSDFPILCETCLGDNPYIRMTKQEFGKACGTCARPYTVFRWNPGAQSGSR 62

Query: 65  YKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGK 124
            K T +CQTCAK+KN+CQTCLLDL+Y LPVQVRDTAL +   AP S+INREY+AQN +GK
Sbjct: 63  AKSTVVCQTCAKVKNICQTCLLDLEYGLPVQVRDTALGLQRSAPTSDINREYYAQNHDGK 122

Query: 125 ISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIP 184
             G E      KA+S+G+EMLK+LART+PYYKRNRP ICSFFVKG+CTRGDECPYRHE+P
Sbjct: 123 DQGLE---GGRKANSAGKEMLKQLARTDPYYKRNRPQICSFFVKGTCTRGDECPYRHEMP 179

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
            E  L+ Q+I+DR++GTNDPVA K+L R     G  + PPED +ITSLF++ +     E+
Sbjct: 180 TEGPLAKQSIQDRFHGTNDPVAHKLLARHAESQG--LKPPEDTSITSLFLSSLPSSATES 237

Query: 245 DLKGY------FYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKI 298
            ++        F     I+SVV V K+RCAF+NF +R SAE+A +   + L++    + +
Sbjct: 238 SIRTLAVNTLPFLEPDAIRSVVHVAKTRCAFVNFTSRTSAERAAEAWANGLDLDGERIGV 297

Query: 299 TWG 301
            WG
Sbjct: 298 RWG 300



>gi|193610466|ref|XP_001943081.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Acyrthosiphon
           pisum]
          Length = 381

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 212/293 (72%), Gaps = 7/293 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPI+CETCLGD+PY+RM ++ +GKEC+VC+RPFT+FRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSDFPIVCETCLGDSPYLRMAKEKYGKECEVCARPFTVFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCA+L+N CQTCLLDL+Y LP+QVRD AL +    P+S++N+EYF QN++ +++  + 
Sbjct: 71  CQTCARLRNACQTCLLDLEYGLPLQVRDAALKIKEQIPKSDVNKEYFVQNMDSELAKMDE 130

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENE 188
               G    +  ++L K+AR  PYY+RNRPHICSF+VKG C RG+ECPYRHE P   E+ 
Sbjct: 131 A---GGKCQNASDVLAKMARKAPYYERNRPHICSFWVKGECRRGEECPYRHERPTDPEDP 187

Query: 189 LSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKG 248
           LS+QN KDRYYG NDPVA+K++NR        +  PED+TIT+L++  + D   E DL+ 
Sbjct: 188 LSNQNFKDRYYGVNDPVAEKMMNR--ASEMPKLEKPEDQTITTLYVGNLNDITTEKDLRD 245

Query: 249 YFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
            FY +GEI+++  V    CAFI + TRA+AE   + ++  L +  H L + WG
Sbjct: 246 VFYQYGEIRNITHVAHQNCAFIQYTTRAAAEMGAESTYGRLTLGGHKLNVRWG 298



>gi|321459833|gb|EFX70882.1| hypothetical protein DAPPUDRAFT_202081 [Daphnia pulex]
          Length = 414

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 217/308 (70%), Gaps = 11/308 (3%)

Query: 4   MAAKADPNKQG---WGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPG 60
           MA     N  G   W +SEFPILC TCLGDNPYVRM ++ FG ECK+C RPFT FRW PG
Sbjct: 1   MALSKSSNTYGRTSWEDSEFPILCPTCLGDNPYVRMMKEKFGSECKICVRPFTTFRWCPG 60

Query: 61  AGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQN 120
           A MR+KKTEICQTCAKLKNVCQTCLLDL+Y LP+QVRD ALN+ ++  +S++N+EYF QN
Sbjct: 61  ARMRFKKTEICQTCAKLKNVCQTCLLDLEYGLPIQVRDQALNIKDNIAKSDVNKEYFIQN 120

Query: 121 IEGKISGAESLINYGKADSSG----REMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDE 176
            E ++S  +  +              ++L KLART PYY+RN PHICSF+VKG C RG+E
Sbjct: 121 AEKQLSATDHGVPGAAGGPGKSHPPSDLLMKLARTAPYYRRNLPHICSFWVKGECKRGEE 180

Query: 177 CPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFI 234
           CPYRHE P   ++ L+ QNIKDRYYGTNDPVA+K++ R        +  PEDK+IT+L++
Sbjct: 181 CPYRHEKPTDPDDPLADQNIKDRYYGTNDPVAEKLMRR--AATLPRLDAPEDKSITTLYV 238

Query: 235 TGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEH 294
             + + + E +L+ +FY +GEI+S+ +V + +CAF+ + TR++AE A + + + L I+  
Sbjct: 239 GNIGEKMLEKELRDHFYQYGEIRSITIVSRQQCAFVTYVTRSAAELAAEGTFNKLIIQNR 298

Query: 295 DLKITWGR 302
            L I WG+
Sbjct: 299 RLVIRWGK 306



>gi|443924909|gb|ELU43855.1| pre-mRNA-splicing factor SLT11 [Rhizoctonia solani AG-1 IA]
          Length = 347

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 218/318 (68%), Gaps = 15/318 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQG-FGKECKVCSRPFTIFRWLPGAGMRY 65
           KAD NK GW +S+FPILC   LGDN +VRM R   +G+EC  C+RPFT+FRW  GAG R+
Sbjct: 24  KADINKAGWEQSDFPILC---LGDNAFVRMVRGVVYGRECGTCARPFTVFRWKAGAGGRF 80

Query: 66  KKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI 125
           K T +CQTCAK+KNVCQTCLLDL+Y LPVQVRDTAL   N+AP SE+NREY+AQN++GK+
Sbjct: 81  KSTVVCQTCAKIKNVCQTCLLDLEYGLPVQVRDTALGRKNEAPSSEVNREYYAQNMDGKV 140

Query: 126 SGA-----ESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR 180
             +     +SL++  +A S+ ++MLK LART+PYYKRNR H+CSFF KG C RG+ECPYR
Sbjct: 141 WSSQLEANQSLLDSSRASSAAKDMLKSLARTDPYYKRNRAHLCSFFAKGECNRGNECPYR 200

Query: 181 HEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD 240
           HE+P+ENELSHQNIKDR+YG NDPVAKKIL+      G  + PPED++I +      E  
Sbjct: 201 HELPKENELSHQNIKDRFYGRNDPVAKKILSVHATKQG--LEPPEDQSIVA---DATEAS 255

Query: 241 IDEADLKGY-FYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
           +  A L    F     +KSVV V KSRCAFINF  R   E+A +     + +    + + 
Sbjct: 256 VRTALLNSIPFIPPTAVKSVVHVEKSRCAFINFKERKDTERAAEAWAGGVEVDGTKVNVK 315

Query: 300 WGRPRPTGPKTEVQAATT 317
           WGR R         A+T+
Sbjct: 316 WGRSRGAAAGATPSASTS 333



>gi|358340385|dbj|GAA34086.2| pre-mRNA-splicing factor RBM22/SLT11 [Clonorchis sinensis]
          Length = 534

 Score =  346 bits (888), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 216/314 (68%), Gaps = 26/314 (8%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S FPILCETCLG +P+VRM R+ +GKECK+C RPFT+FRW PG   R+KKTE+
Sbjct: 11  NRQNWEDSSFPILCETCLGPSPFVRMMRERYGKECKICDRPFTVFRWCPGPKARFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---- 126
           CQ+CAK+KNVCQTC+ DL+Y LPV+VRD AL ++   P++++NREYF Q IE  +     
Sbjct: 71  CQSCAKVKNVCQTCIFDLEYGLPVEVRDKALRMSQQIPKNDVNREYFHQQIEQHLETDGD 130

Query: 127 -----GAESLINYGKA-----------DSSGREMLKKLARTEPYYKRNRPHICSFFVKGS 170
                G   LI  GKA              G ++L KLART PYY+RNRPHICSF+VKG 
Sbjct: 131 VTAPYGGHQLI--GKALSNTTAASSSSGGGGTDLLLKLARTAPYYRRNRPHICSFWVKGE 188

Query: 171 CTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKT 228
           C RG+ECPYRHE P   ++ LS QN+KDRYYG  DPVA K+L++        + PPED+T
Sbjct: 189 CRRGEECPYRHEKPTDPDDPLSDQNLKDRYYGHEDPVAAKLLSKYDA--MPKLVPPEDRT 246

Query: 229 ITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSN 288
           IT+L+I  + D++ E DL+ +FY FGEI+SV +  +  CAFI F TR SAE+A ++S+  
Sbjct: 247 ITTLYIGSIPDEVTERDLRNHFYQFGEIRSVNLHPRQHCAFIQFTTRQSAEKAAERSYER 306

Query: 289 LNIKEHDLKITWGR 302
           L +  H L + WG+
Sbjct: 307 LILGGHRLTVNWGK 320



>gi|339247335|ref|XP_003375301.1| Pre-mRNA-splicing factor RBM22 [Trichinella spiralis]
 gi|316971378|gb|EFV55159.1| Pre-mRNA-splicing factor RBM22 [Trichinella spiralis]
          Length = 494

 Score =  346 bits (887), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 233/349 (66%), Gaps = 31/349 (8%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W ++EFPILCETCLG+NPY+RM ++ +G ECK+C+RPFTIFRW PG  MRYK+TE+
Sbjct: 63  NRMNWEDAEFPILCETCLGNNPYLRMMKERYGGECKICNRPFTIFRWCPGRNMRYKRTEV 122

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKNVCQTCLLDL+Y LPVQVRD AL V +D P++  N+++F Q  + +I  ++ 
Sbjct: 123 CQTCSKLKNVCQTCLLDLEYGLPVQVRDYALGVKDDIPKTGANKDFFIQAAQREIDKSDG 182

Query: 131 LINYGK----ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
               G      D    E+L KLART PYY RNRPHICSF+VKG C RG+ECPYRHE P  
Sbjct: 183 TTLAGPLAELVDQRPNELLNKLARTNPYYDRNRPHICSFWVKGECRRGEECPYRHEKPTD 242

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD--ID 242
            ++ LS QNI+DRYYG+ DPVA K+LN+ K      + PPEDKTIT++++  + DD  I 
Sbjct: 243 PDDPLSVQNIRDRYYGSKDPVADKLLNKAKA--LPVLKPPEDKTITTIYLGNIGDDNVIT 300

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           E D+K     FGEI+S+V++ +  C F+ F TR +AE A +K+   L IK   + + WGR
Sbjct: 301 EDDIK----LFGEIRSIVILSEKGCGFVQFTTREAAELASEKTFGKLMIKGRRITVRWGR 356

Query: 303 PRPTGPKTEVQAATTQNVVLPPLES-----MQIPAPPGEAPS-DFLYPS 345
           P+           + QNV+   +ES       +P  PG  P+ DFL P+
Sbjct: 357 PQ-----------SQQNVIGQLVESEHPTYQDVPGLPGNIPNVDFLGPN 394



>gi|256075299|ref|XP_002573957.1| rna binding motif protein [Schistosoma mansoni]
 gi|360044844|emb|CCD82392.1| putative rna binding motif protein [Schistosoma mansoni]
          Length = 425

 Score =  346 bits (887), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 221/314 (70%), Gaps = 26/314 (8%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S FPILCETCLG +P+VRM ++ +GKECK+C RPFT+FRW PG   R+KKTE+
Sbjct: 11  NRQNWEDSSFPILCETCLGPSPFVRMMKEKYGKECKICDRPFTVFRWCPGPKARFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNI------EGK 124
           CQ+CAK+KNVCQTCL DL+Y LPV+VRD AL ++   P++++NREYF Q I      EG 
Sbjct: 71  CQSCAKIKNVCQTCLFDLEYGLPVEVRDKALRLSQQLPKNDVNREYFHQQIEQNLEVEGD 130

Query: 125 IS---GAESLINYGKADSSGR-----------EMLKKLARTEPYYKRNRPHICSFFVKGS 170
           I+   G   LI  GKA S+             ++L KLART PYY+RNRPHICSF+VKG 
Sbjct: 131 ITAPYGGNQLI--GKAISNTASASSSSGGGGTDLLLKLARTAPYYRRNRPHICSFWVKGE 188

Query: 171 CTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKT 228
           C RG+ECPYRHE P   ++ LS QN++DRYYG +DPVA K+L+  K      + PPED+T
Sbjct: 189 CRRGEECPYRHEKPTDPDDPLSDQNLRDRYYGHDDPVAAKLLS--KYDTMPKLVPPEDRT 246

Query: 229 ITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSN 288
           IT+L+I G+ D + E DL+ +FY FGE++SV +  K  CAFI FATR +AE+A ++++  
Sbjct: 247 ITTLYIGGIPDGMTEKDLRNHFYQFGELRSVNLHAKQHCAFIQFATRGAAERAAERTYDR 306

Query: 289 LNIKEHDLKITWGR 302
           L +  H L + WG+
Sbjct: 307 LILGGHRLTVNWGK 320



>gi|313229243|emb|CBY23829.1| unnamed protein product [Oikopleura dioica]
          Length = 441

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 215/311 (69%), Gaps = 8/311 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPILC TCLGDNPY+RM +  +GKEC +C RPFT FRW PG GMRYKKTEI
Sbjct: 21  NRQNWEDSDFPILCPTCLGDNPYIRMMKDKYGKECSICERPFTTFRWCPGRGMRYKKTEI 80

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAK+KNVCQTC+ DL+Y LPV VRD AL + +D P  + N+E+F QN+  ++  A  
Sbjct: 81  CQTCAKMKNVCQTCVFDLEYGLPVAVRDHALGLKDDIPTGDFNKEHFHQNLGKEL--ALQ 138

Query: 131 LINYGKADSSGREMLKKLA--RTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
             +  +A S+    L++++  R  PYYKRN PHICSF+VKG C RG+ECPYRHE P   +
Sbjct: 139 GDDLRQAHSAPNAFLERISQGRKGPYYKRNLPHICSFWVKGECRRGEECPYRHEKPSDPD 198

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + LS QNI DR+YGT DPVA K+L R +     ++ PPEDKTIT+L+  GV  ++ E+DL
Sbjct: 199 DPLSVQNIVDRFYGTKDPVADKLLRRAE--EMPSMAPPEDKTITTLWCGGVTSELAESDL 256

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + YFY FGE+  + +V KS CAF+ F  R SAE A +K +  L++K   L + WG+P+ +
Sbjct: 257 QEYFYQFGEVACINIVQKSSCAFVQFTKRESAENAANKCYGRLDLKGVRLNVRWGKPQQS 316

Query: 307 GPKTEVQAATT 317
           G K       T
Sbjct: 317 GAKHHADIEKT 327



>gi|91088695|ref|XP_975014.1| PREDICTED: similar to RNA binding motif protein 22 [Tribolium
           castaneum]
 gi|270012288|gb|EFA08736.1| hypothetical protein TcasGA2_TC006411 [Tribolium castaneum]
          Length = 420

 Score =  341 bits (875), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 172/332 (51%), Positives = 235/332 (70%), Gaps = 19/332 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +++FPILC+TCLGDNPY+RMT++ +GKECK+C+RPFT+FRW PGA MR+KKTE+
Sbjct: 11  NRQNWEDADFPILCQTCLGDNPYIRMTKEKYGKECKICARPFTVFRWCPGARMRFKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTC+KLKNVCQTCLLDL+Y LP+QVRD AL + +D P+S++N+EY+ QN+E ++  +++
Sbjct: 71  CQTCSKLKNVCQTCLLDLEYGLPIQVRDAALKLKDDLPKSDVNKEYYIQNMERELQRSDT 130

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENE 188
            +   K +    ++L +LART PYYKRNRPH+CSF+VKG C RG+ECPYRHE P   E+ 
Sbjct: 131 GVLSNKLNEPN-DLLMRLARTAPYYKRNRPHVCSFWVKGECRRGEECPYRHEKPTDPEDP 189

Query: 189 LSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKG 248
           L+ QNIKDRYYG NDPVA K+L R            EDKTIT+L+I G    + E D++ 
Sbjct: 190 LADQNIKDRYYGVNDPVADKLLKRAAAMPALPPP--EDKTITTLYI-GNLGTLTEQDIRD 246

Query: 249 YFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP-TG 307
           +FY +GEI+SV +V K +CAF+ + TRA+AE A +K+ + L +    L I WGR +   G
Sbjct: 247 HFYQYGEIRSVSLVPKQQCAFVQYTTRAAAETAAEKTFNKLILGGRRLTIKWGRSQGRAG 306

Query: 308 PKTEVQAATTQNVVLPPLESMQ-IPAPPGEAP 338
           P            + P LE+ + +P  PG  P
Sbjct: 307 P-----------AINPGLEAYEPVPGLPGALP 327



>gi|432098820|gb|ELK28315.1| Pre-mRNA-splicing factor RBM22 [Myotis davidii]
          Length = 385

 Score =  339 bits (869), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 162/296 (54%), Positives = 212/296 (71%), Gaps = 9/296 (3%)

Query: 36  MTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQ 95
           MT++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+Q
Sbjct: 1   MTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQ 60

Query: 96  VRDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYGKADSSGREMLKKLARTE 152
           VRD  L+  +D P+S++N+EY+ QN+E +IS   G   +   GKA S+  +ML KLART 
Sbjct: 61  VRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTS-DMLLKLARTT 119

Query: 153 PYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKIL 210
           PYYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ L+ QNIKDRYYG NDPVA K+L
Sbjct: 120 PYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLL 179

Query: 211 NRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFI 270
            R        + PPEDKTIT+L++ G+ D I E DL+ +FY FGEI+++ VV + +CAFI
Sbjct: 180 KR--ASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFI 237

Query: 271 NFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT-GPKTEVQAATTQNVVLPPL 325
            FATR +AE A +KS + L +    L + WGR +   G + E    T   + L P+
Sbjct: 238 QFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPV 293



>gi|71993749|ref|NP_502014.2| Protein T11G6.8 [Caenorhabditis elegans]
 gi|30145708|emb|CAA93419.2| Protein T11G6.8 [Caenorhabditis elegans]
          Length = 408

 Score =  338 bits (866), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/339 (49%), Positives = 224/339 (66%), Gaps = 18/339 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N++ W +S+FPILCETCLG+NPY+RM +  +G+ECK+C RPFT FRW PG G RYK TE+
Sbjct: 12  NRKNWEDSDFPILCETCLGNNPYMRMMKDKYGRECKICERPFTTFRWQPGKGARYKNTEL 71

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTCAK+KNVCQTC+ DL+Y LPVQVRD  L + ++ P+   NR++F QN+E   G+  G
Sbjct: 72  CQTCAKVKNVCQTCMFDLEYGLPVQVRDHELQIADNIPKQGANRDFFLQNVERTLGQGDG 131

Query: 128 AESLINYG-KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
            + +       D +  + L+++ RT+PYYKRN PHICSFFVKG C RG+ECPYRHE P  
Sbjct: 132 TQPIAQIANNMDQAAHDRLRRMGRTQPYYKRNAPHICSFFVKGECKRGEECPYRHEKPTD 191

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV----EDD 240
            ++ LS QNI+DRYYGTNDPVA+KILNR        ++PP D TIT+L+I  +       
Sbjct: 192 PDDPLSRQNIRDRYYGTNDPVAEKILNRAAA--APTLSPPADTTITTLYIGNLGPSGAQQ 249

Query: 241 IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           + E DL  +FY +G+I+ + V+ +  CAFI F TR +AE+A ++S +   IK   L I W
Sbjct: 250 VTEKDLNDFFYQYGDIRCLRVLTEKGCAFIEFTTREAAERAAERSFNKTFIKGKRLTIRW 309

Query: 301 GRPRPTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPS 339
           G P+        +AA   N V P      +P P G APS
Sbjct: 310 GEPQAK------RAADNSNYVTPVPSVPILPVPDGLAPS 342



>gi|405118063|gb|AFR92838.1| pre-mRNA-splicing factor SLT11 [Cryptococcus neoformans var. grubii
           H99]
          Length = 326

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/314 (54%), Positives = 214/314 (68%), Gaps = 15/314 (4%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M AK D NK G   S+FPILCETCLG NPYVRM +Q FG ECKVC+RPFT+FRW PG G 
Sbjct: 1   MPAKHDINKVGVESSDFPILCETCLGPNPYVRMNKQEFGHECKVCNRPFTVFRWNPGEG- 59

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           R KKTEIC TCAK+K VCQTCLLDL++ LP QVRD AL     AP S+IN++Y+ QN+E 
Sbjct: 60  RMKKTEICTTCAKIKGVCQTCLLDLEFGLPTQVRDAALARKAQAPSSDINKQYYIQNLEA 119

Query: 124 KISGAESLINYGK--ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH 181
           +++ +   + Y    A+ +GREMLK LART+PYYKRNRPHICSFFVKG C RG ECP+RH
Sbjct: 120 QMAESPDGLAYDSEVANRAGREMLKNLARTDPYYKRNRPHICSFFVKGECKRGAECPFRH 179

Query: 182 EIPEENEL---SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV- 237
           E+P+ENE    S Q++ DRYYG NDPVAKKIL++     G  +  PEDK+IT+L   G+ 
Sbjct: 180 EMPKENETQKPSQQSLVDRYYGRNDPVAKKILSQNAESKG--LKAPEDKSITTLLFLGLP 237

Query: 238 --EDDIDEADLKGY--FYAFGEIKSVVVVHKSRCAFINFATRASAEQAID--KSHSNLNI 291
              D    A L G   F    ++KS+ +V  S CAF+NF  R+ AE+  D   +   + +
Sbjct: 238 QCNDSHVRASLVGACPFVKPSDVKSISIVEASHCAFVNFNQRSIAERTADALAAQGGIEV 297

Query: 292 KEHDLKITWGRPRP 305
           +    KI WGR RP
Sbjct: 298 EGKKAKIVWGRARP 311



>gi|507622860|ref|XP_004697148.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Echinops telfairi]
          Length = 392

 Score =  337 bits (864), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 162/295 (54%), Positives = 211/295 (71%), Gaps = 9/295 (3%)

Query: 37  TRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQV 96
           T++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+QV
Sbjct: 9   TKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQV 68

Query: 97  RDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYGKADSSGREMLKKLARTEP 153
           RD  L+  +D P+S++N+EY+ QN+E +IS   G   +   GKA S+  +ML KLART P
Sbjct: 69  RDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTS-DMLLKLARTTP 127

Query: 154 YYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILN 211
           YYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ L+ QNIKDRYYG NDPVA K+L 
Sbjct: 128 YYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLK 187

Query: 212 RVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFIN 271
           R        + PPEDKTIT+L++ G+ D I E DL+ +FY FGEI++V VV + +CAFI 
Sbjct: 188 R--ASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTVTVVQRQQCAFIQ 245

Query: 272 FATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT-GPKTEVQAATTQNVVLPPL 325
           FATR +AE A +KS + L +    L + WGR +   G + E    T   + L P+
Sbjct: 246 FATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPV 300



>gi|268552599|ref|XP_002634282.1| Hypothetical protein CBG17615 [Caenorhabditis briggsae]
          Length = 406

 Score =  336 bits (861), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 168/339 (49%), Positives = 224/339 (66%), Gaps = 18/339 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N++ W +S+FPILCETCLG+NPY+RM +   G+ECK+C RPFT FRW PG G RYK TE+
Sbjct: 12  NRKNWEDSDFPILCETCLGNNPYMRMMKDKHGRECKICERPFTTFRWQPGKGARYKNTEL 71

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTCAK+KNVCQTC+ DL+Y LPVQVRD  L + ++ P+   NR++F QN+E   G+  G
Sbjct: 72  CQTCAKVKNVCQTCMFDLEYGLPVQVRDHELQIADNIPKQGANRDFFLQNVERTLGQGDG 131

Query: 128 AESLINYG-KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
            + +       D +  + L+++AR++PYYKRN PHICSFFVKG C RG+ECPYRHE P  
Sbjct: 132 TQPIAQIANNMDQAAHDRLRRMARSQPYYKRNAPHICSFFVKGECKRGEECPYRHEKPTD 191

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV----EDD 240
            ++ LS QNI+DRYYGTNDPVA+KILNR        ++PP D TIT+L+I  +       
Sbjct: 192 PDDPLSRQNIRDRYYGTNDPVAEKILNRAAA--APTLSPPADTTITTLYIGNLGPNGPQQ 249

Query: 241 IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           + E DL  +FY +G+I+ + V+ +  CAFI F TR +AE+A ++S +   IK   L I W
Sbjct: 250 VTEKDLNDFFYQYGDIRCLRVLTEKGCAFIEFTTREAAERAAERSFNKTFIKGRRLTIRW 309

Query: 301 GRPRPTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPS 339
           G P+        +AA   N V P      +P P G APS
Sbjct: 310 GEPQ------AKRAADNSNYVTPVPSVPILPIPDGLAPS 342



>gi|308452652|ref|XP_003089126.1| hypothetical protein CRE_23244 [Caenorhabditis remanei]
 gi|308492590|ref|XP_003108485.1| hypothetical protein CRE_11038 [Caenorhabditis remanei]
 gi|308243114|gb|EFO87066.1| hypothetical protein CRE_23244 [Caenorhabditis remanei]
 gi|308248225|gb|EFO92177.1| hypothetical protein CRE_11038 [Caenorhabditis remanei]
          Length = 406

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 224/339 (66%), Gaps = 18/339 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N++ W +S+FPILCETCLG+NPY+RM +   G+ECK+C RPFT FRW PG G RYK TE+
Sbjct: 12  NRKNWEDSDFPILCETCLGNNPYMRMMKDKHGRECKICERPFTTFRWQPGKGARYKNTEL 71

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTCAK+KNVCQTC+ DL+Y LPVQVRD  L + ++ P+   NR++F QN+E   G+  G
Sbjct: 72  CQTCAKVKNVCQTCMFDLEYGLPVQVRDHELQIADNIPKQGANRDFFLQNVERTLGQGDG 131

Query: 128 AESLINYG-KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
            + +       D +  + L+++AR++PYYKRN PHICSFFVKG C RG+ECPYRHE P  
Sbjct: 132 TQPIAQIANNMDQAAHDRLRRMARSQPYYKRNAPHICSFFVKGECKRGEECPYRHEKPTD 191

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV----EDD 240
            ++ LS QNI+DRYYG+NDPVA+KILNR        ++PP D TIT+L+I  +       
Sbjct: 192 PDDPLSRQNIRDRYYGSNDPVAEKILNRAAA--APTLSPPADTTITTLYIGNLGPSGAQQ 249

Query: 241 IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           + E DL  +FY +G+I+ + V+ +  CAFI F TR +AE+A ++S +   IK   L I W
Sbjct: 250 VTEKDLNDFFYQYGDIRCLRVLTEKGCAFIEFTTREAAERAAERSFNKTFIKGRRLTIRW 309

Query: 301 GRPRPTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPS 339
           G P+        +AA   N V P      +P P G APS
Sbjct: 310 GEPQAK------RAADNSNYVTPVPSVPILPIPDGLAPS 342



>gi|465952073|gb|EMP24702.1| Dynactin subunit 4 [Chelonia mydas]
          Length = 777

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 224/373 (60%), Gaps = 59/373 (15%)

Query: 37  TRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQV 96
           T++ +GKECK+C+RPFT+FRW PG  MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+QV
Sbjct: 400 TKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQV 459

Query: 97  RDTALNVTNDAPRSEINREYFAQNIEGKIS---GAESLINYGKADSSGREMLKKLARTEP 153
           RD  L+  +D P+S++N+EY+ QN+E +IS   G   +   GKA S+  +ML KLART P
Sbjct: 460 RDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGALGKATSTS-DMLLKLARTTP 518

Query: 154 YYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILN 211
           YYKRNRPHICSF+VKG C RG+ECPYRHE P   ++ L+ QNIKDRYYG NDPVA K+L 
Sbjct: 519 YYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLK 578

Query: 212 RVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFIN 271
           R        + PP+DKTIT+L++ G+ D I E DL+ +FY FGEI+++ VV + +CAFI 
Sbjct: 579 R--ASTMPRLDPPDDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQ 636

Query: 272 FATRASAEQAIDKSHSNLNIKEHDLKITWG----------------------RPRPTGPK 309
           FATR +AE A +KS + L +    L + WG                       P P  P 
Sbjct: 637 FATRQAAEVAAEKSFNKLIVNGRRLNVKWGSSNAFGFEEKEKEGTTESGIKLEPVPGLPG 696

Query: 310 TEVQAATTQNVVLPP-----------------------------LESMQIPAPPGEAPSD 340
              + A+     LPP                               +M  P P   AP  
Sbjct: 697 AAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHTMGPPPPFMRAPGP 756

Query: 341 FLYPSQDPTYQGS 353
             YPSQDP   G+
Sbjct: 757 IHYPSQDPQRMGA 769



>gi|170584256|ref|XP_001896921.1| Rbm22 protein [Brugia malayi]
 gi|158595698|gb|EDP34229.1| Rbm22 protein, putative [Brugia malayi]
          Length = 400

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 214/316 (67%), Gaps = 23/316 (7%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQ---GFGKECKVCSRPFTIFRWLPGAGMRYKK 67
           N++ W +SEFPILC+TCLG NPY+RM R+     G ECK+C RPFT FRW+PG GMRYKK
Sbjct: 11  NRKTWEDSEFPILCQTCLGSNPYIRMVRKLKDRHGAECKICQRPFTCFRWMPGKGMRYKK 70

Query: 68  TEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISG 127
           TE+CQTCAK+KNVC          LPVQVRD AL + +D PR   NR+Y+ QN E +++ 
Sbjct: 71  TEVCQTCAKMKNVC----------LPVQVRDHALQIHDDLPRQGANRDYYIQNQERELAL 120

Query: 128 AESLINYGK----ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
            +     G      DS+  ++LKKLAR +PYY+RN+PHICSFFVKG C RG+ECPYRHE 
Sbjct: 121 TDGTTPGGALAKITDSASNDLLKKLARNQPYYQRNKPHICSFFVKGECRRGEECPYRHEK 180

Query: 184 PE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFI--TGVED 239
           P   ++ LSHQN++DRYYG NDPVA+K+L R K      +  PED TIT+L++   G   
Sbjct: 181 PSDPDDPLSHQNMRDRYYGNNDPVAEKLLTRAKA--LPVLQAPEDTTITTLYVGDLGPAG 238

Query: 240 DIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
            I E  L+ YFY FGEI+S+ ++    CAFI+F TR +AE+A ++S + L ++   LKI 
Sbjct: 239 MIGEVALRDYFYQFGEIRSLNLLPNKGCAFISFTTRLAAEKAAERSFNKLILQGRRLKIR 298

Query: 300 WGRPRPTGPKTEVQAA 315
           WGRP+    + E + A
Sbjct: 299 WGRPQAQNTQEEKKRA 314



>gi|58259011|ref|XP_566918.1| cell wall organization and biogenesis-related protein [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|134107327|ref|XP_777548.1| hypothetical protein CNBA6700 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|338819468|sp|P0CR51.1|SLT11_CRYNB RecName: Full=Pre-mRNA-splicing factor SLT11
 gi|338819469|sp|P0CR50.1|SLT11_CRYNJ RecName: Full=Pre-mRNA-splicing factor SLT11
 gi|50260242|gb|EAL22901.1| hypothetical protein CNBA6700 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223055|gb|AAW41099.1| cell wall organization and biogenesis-related protein, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 326

 Score =  330 bits (846), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 169/314 (53%), Positives = 210/314 (66%), Gaps = 15/314 (4%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M AK D NK G   S+FPILCETCLG NPYVRM +Q FG ECKVC+RPFT+FRW PG G 
Sbjct: 1   MPAKHDINKVGVESSDFPILCETCLGPNPYVRMNKQEFGHECKVCNRPFTVFRWNPGEG- 59

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           R KKTEIC TCAK+K VCQTCLLDL++ LP QVRD AL     AP S+IN++Y+ QN+E 
Sbjct: 60  RMKKTEICTTCAKIKGVCQTCLLDLEFGLPTQVRDAALARKAQAPSSDINKQYYIQNLEA 119

Query: 124 KISGAESLINYGK--ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH 181
           +++ +   + Y    A+ +GREMLK LART+PYYKRNRPHICSFFVKG C RG ECP+RH
Sbjct: 120 QMAESPDGLAYDSEVANRAGREMLKNLARTDPYYKRNRPHICSFFVKGECKRGAECPFRH 179

Query: 182 EIPEENEL---SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV- 237
           E+P+ENE    S Q++ DRYYG NDPVAKKIL++     G  +  PEDK+IT+L   G+ 
Sbjct: 180 EMPKENETQKPSQQSLVDRYYGRNDPVAKKILSQNAESKG--LKAPEDKSITTLLFLGLP 237

Query: 238 --EDDIDEADLKGY--FYAFGEIKSVVVVHKSRCAFINFATRA--SAEQAIDKSHSNLNI 291
              D    A L G   F    ++KS+ +V  S CAF+NF  R+          +   + +
Sbjct: 238 QCNDSHVRASLVGACPFVKPSDVKSISIVEASHCAFVNFNQRSMAERAADALAAQGGIEV 297

Query: 292 KEHDLKITWGRPRP 305
           +    KI WGR RP
Sbjct: 298 EGKKAKIVWGRARP 311



>gi|341892124|gb|EGT48059.1| hypothetical protein CAEBREN_15812 [Caenorhabditis brenneri]
 gi|341903893|gb|EGT59828.1| hypothetical protein CAEBREN_23793 [Caenorhabditis brenneri]
          Length = 407

 Score =  330 bits (845), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 170/363 (46%), Positives = 229/363 (63%), Gaps = 27/363 (7%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N++ W +S+FPILCETCLG+NPY+RM +   G+ECK+C RPFT FRW PG G RYK TE+
Sbjct: 12  NRKNWEDSDFPILCETCLGNNPYMRMMKDKHGRECKICERPFTTFRWQPGKGARYKNTEL 71

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE---GKISG 127
           CQTCAK+KNVCQTC+ DL+Y LPVQVRD  L + ++ P+   NR++F QN+E   G+  G
Sbjct: 72  CQTCAKVKNVCQTCMFDLEYGLPVQVRDHELQIADNIPKQGANRDFFLQNVERTLGQGDG 131

Query: 128 AESLINYG-KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
            + +       D +  + L+++AR++PYYKRN PHICSFFVKG C RG+ECPYRHE P  
Sbjct: 132 TQPIAQIANNMDQAAHDRLRRMARSQPYYKRNAPHICSFFVKGECKRGEECPYRHEKPTD 191

Query: 186 -ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV----EDD 240
            ++ LS QNI+DRYYGTNDPVA+KILNR        ++PP D TIT+L+I  +       
Sbjct: 192 PDDPLSRQNIRDRYYGTNDPVAEKILNRAAA--APTLSPPADTTITTLYIGNLGPAGPQQ 249

Query: 241 IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           + E +L   FY +G+I+ + V+ +  CAFI + TR +AE+A +++ +   IK   L I W
Sbjct: 250 VTEKELNDVFYQYGDIRCLRVLTEKGCAFIEYTTREAAERAAERAFNKTFIKGRKLSIRW 309

Query: 301 GRPRPTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPS---------DFLYPSQDPTYQ 351
           G P+        +AA   N V P      +P P G APS             P   PT+ 
Sbjct: 310 GEPQAK------RAADNSNYVTPVPSVPILPIPDGLAPSTSSQHRFTGSMPRPPAPPTFA 363

Query: 352 GSS 354
           G S
Sbjct: 364 GPS 366



>gi|321250497|ref|XP_003191828.1| cell wall organization and biogenesis-related protein [Cryptococcus
           gattii WM276]
 gi|317458295|gb|ADV20041.1| Cell wall organization and biogenesis-related protein, putative
           [Cryptococcus gattii WM276]
          Length = 326

 Score =  329 bits (844), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 168/314 (53%), Positives = 210/314 (66%), Gaps = 15/314 (4%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M AK D NK G   S+FPILCETCLG NPYVRM +Q FG ECKVC+RPFT+FRW PG G 
Sbjct: 1   MPAKHDINKVGVESSDFPILCETCLGPNPYVRMNKQEFGHECKVCNRPFTVFRWNPGEG- 59

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           R KKTEIC TCAK+K VCQTCLLDL++ LP QVRD AL     AP S+IN++Y+ QN+E 
Sbjct: 60  RMKKTEICTTCAKIKGVCQTCLLDLEFGLPTQVRDAALARKAQAPSSDINKQYYIQNLEA 119

Query: 124 KISGAESLINYGK--ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH 181
           +++ +   + Y    A+ +GREMLK LART+PYYKRNRPHICSFFVKG C RG ECP+RH
Sbjct: 120 QMAESPDGLAYDSEVANRAGREMLKNLARTDPYYKRNRPHICSFFVKGECKRGAECPFRH 179

Query: 182 EIPEENEL---SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGV- 237
           E+P+ENE    S Q++ DRYYG NDPVAKKIL++     G  +  PEDK+IT+L   G+ 
Sbjct: 180 EMPKENETHKPSQQSLVDRYYGRNDPVAKKILSQNAESKG--LKAPEDKSITTLLFLGLP 237

Query: 238 --EDDIDEADLKGY--FYAFGEIKSVVVVHKSRCAFINFATRA--SAEQAIDKSHSNLNI 291
              D    A L G   F    ++KS+ +V  S CAF+NF  R+          +   + +
Sbjct: 238 QCNDSHVRASLVGACPFIKPPDVKSITIVETSHCAFVNFNQRSMAERAADALAAQGGIEV 297

Query: 292 KEHDLKITWGRPRP 305
           +    K+ WGR RP
Sbjct: 298 EGKKAKVVWGRARP 311



>gi|392576636|gb|EIW69766.1| hypothetical protein TREMEDRAFT_29541 [Tremella mesenterica DSM
           1558]
          Length = 332

 Score =  329 bits (843), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 163/314 (51%), Positives = 213/314 (67%), Gaps = 14/314 (4%)

Query: 4   MAAKADPNKQGWGESEFPIL--CETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA 61
           M AK D NK G   S+FPIL    T LG+NPY+RM++Q FG ECK+C+RPFT+FRW PGA
Sbjct: 1   MPAKHDINKVGVESSDFPILYLTGTGLGENPYLRMSKQEFGSECKICNRPFTVFRWNPGA 60

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNI 121
           G RYKKTE+C TCAK+K VCQTCLLDL++ LPVQVRD AL   N AP ++IN++Y+ Q +
Sbjct: 61  GARYKKTEVCTTCAKIKGVCQTCLLDLEFGLPVQVRDAALGRKNGAPSTDINKQYYIQGL 120

Query: 122 EGKI--SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPY 179
           E ++  SG  +  +   A+ +G+EMLK +AR++PYYKRNRPHICSFFVKG C RG +CP+
Sbjct: 121 ESQMERSGDGTTFDAEVANRAGKEMLKNIARSDPYYKRNRPHICSFFVKGDCKRGADCPF 180

Query: 180 -RHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE 238
            RHEIPEEN L +Q + DRYYG NDPVAKKIL +     G  +  PEDK++T+L   G+ 
Sbjct: 181 SRHEIPEENGLQNQKLADRYYGRNDPVAKKILTQHAESKG--LMAPEDKSVTTLIFLGLP 238

Query: 239 DDIDEADLKGYFYAFG-----EIKSVVVVHKSRCAFINFATRASAEQAID--KSHSNLNI 291
              D        +        +IK++ VV  S CAFI F TRA+AE+  +   +   + +
Sbjct: 239 KCTDSHVRSALMFTCPFLKPIDIKTISVVEASHCAFIVFVTRATAERVAEALSAQGGMEV 298

Query: 292 KEHDLKITWGRPRP 305
           +    K+ WGRPRP
Sbjct: 299 QGKRAKVVWGRPRP 312



>gi|462396408|gb|EMJ02207.1| hypothetical protein PRUPE_ppa005371mg [Prunus persica]
          Length = 464

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/342 (49%), Positives = 224/342 (65%), Gaps = 30/342 (8%)

Query: 36  MTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQ 95
           MTR  + KECK+C+RPFT+FRW PG   R+KK+EICQTC+KLKNVCQ CLLDL+Y LPVQ
Sbjct: 1   MTRADYDKECKICTRPFTVFRWRPGRDARFKKSEICQTCSKLKNVCQVCLLDLEYGLPVQ 60

Query: 96  VRDTALNV-TNDA-PRSEINREYFAQNIEGKI-SGAESLINYGKADSSGREMLKKLARTE 152
           VRDTAL + +NDA P+S++NRE+FA+  + K  +G +   +YGKA  S  + + KL RT 
Sbjct: 61  VRDTALAIGSNDAIPKSDVNREFFAEEHDRKARAGIDYESSYGKARPS--DTILKLQRTT 118

Query: 153 PYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSHQNIKDRYYGTNDPVAKKILNR 212
           PYYKRNR H+CSF+++G CTRG ECPYRHE+P   ELS QNIKDRYYG NDPVA K+LN 
Sbjct: 119 PYYKRNRAHVCSFYIRGECTRGAECPYRHEMPITGELSQQNIKDRYYGVNDPVAMKLLN- 177

Query: 213 VKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINF 272
            K G   ++ PPED++I +L++ G+++ I E DL+  FYA GEI+SV +V +  CAF+ +
Sbjct: 178 -KAGEMPSLEPPEDESIRTLYVGGLDERISEQDLRDQFYAHGEIESVRMVLQRACAFVTY 236

Query: 273 ATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQAATTQNVV-----LP---- 323
            TR  AE+A ++  + L IK   LK+ WGRP+     +E  A   Q  V     LP    
Sbjct: 237 TTREGAEKAAEELSNKLVIKGLRLKLMWGRPQAPKQDSEGTAEARQQAVAHSGLLPRAVI 296

Query: 324 ------------PLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
                       P+    +P PP +  S   YPS DP   G+
Sbjct: 297 SQQQNQLQDQPAPVHYYNMPPPPSQERS--FYPSMDPQRMGA 336



>gi|358059803|dbj|GAA94449.1| hypothetical protein E5Q_01101 [Mixia osmundae IAM 14324]
          Length = 325

 Score =  327 bits (837), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 218/319 (68%), Gaps = 21/319 (6%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  K D NK  +  S+FPILCETCLG +PY+R+T+Q +G+ECK+C+RPFT+FRW PG+G 
Sbjct: 1   MPPKRDLNKASFENSDFPILCETCLGPSPYLRITKQDYGQECKICTRPFTVFRWNPGSGA 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIE- 122
           R+KKTE+CQ+CAK+KNVCQTCLLDL Y LPVQVRDTAL     AP ++INR+Y+ QN+E 
Sbjct: 61  RFKKTEVCQSCAKIKNVCQTCLLDLVYELPVQVRDTALGRLEGAPSTDINRQYYIQNLEN 120

Query: 123 -GKI-SGAESLINY--GKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECP 178
            G + + A+ +  Y  GK+DS+ +E+LK LAR  P YKRNRPH+CSFF KG C+RGD CP
Sbjct: 121 SGALDNAAKGVAAYGGGKSDSAAKELLKSLARQTPDYKRNRPHLCSFFAKGECSRGDACP 180

Query: 179 YRHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITG-- 236
           YRHE+P+ N +  Q I++RY GT+D V + IL +     G  +TPPED ++ SL++T   
Sbjct: 181 YRHELPQANAMPSQTIQERYAGTSDAVGRAILAKAASSKG--LTPPEDTSVMSLYLTSLP 238

Query: 237 ----VEDDIDEADLKGYF------YAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSH 286
               V  D+  A LK +F       A   IKSV VV  S CAF+NF +R +AE A   + 
Sbjct: 239 EAGQVSTDLSSA-LKTWFLEHTSGLAPASIKSVTVVEASHCAFVNFTSRQAAESAAATAG 297

Query: 287 S-NLNIKEHDLKITWGRPR 304
           +  + ++   + I WGR R
Sbjct: 298 TIGITLEGRPISIAWGRSR 316



>gi|482576009|gb|EOA40196.1| hypothetical protein CARUB_v10008917mg, partial [Capsella rubella]
          Length = 459

 Score =  322 bits (826), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 159/333 (47%), Positives = 218/333 (65%), Gaps = 20/333 (6%)

Query: 36  MTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQ 95
           +T+  + KECK+C+RPFT+FRW PG   RYKKTEICQTC KLKNVCQ CLLDL+Y LPVQ
Sbjct: 11  VTKANYDKECKICTRPFTVFRWRPGRDARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQ 70

Query: 96  VRDTALNV-TNDA-PRSEINREYFAQNIEGKI-SGAESLINYGKADSSGREMLKKLARTE 152
           VRDTALN+ T+D+ P+S++NREYFA+  + K  +G +   ++GK   +  + + KL RT 
Sbjct: 71  VRDTALNISTHDSIPKSDVNREYFAEEHDRKTRAGLDYESSFGKMRPN--DTILKLQRTT 128

Query: 153 PYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSHQNIKDRYYGTNDPVAKKILNR 212
           PYYKRNR H+CSFF++G CTRG ECPYRHE+PE  ELS QNIKDRYYG NDPVA K+L  
Sbjct: 129 PYYKRNRAHVCSFFIRGECTRGAECPYRHEMPETGELSQQNIKDRYYGVNDPVAMKLLG- 187

Query: 213 VKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINF 272
            K G    +  PED++I +L++ G+   I E D++  FYA+GEI+S+ ++    CAF+ +
Sbjct: 188 -KAGEMGTLESPEDESIKTLYVGGLNSRILEQDIRDQFYAYGEIESIRILADKACAFVTY 246

Query: 273 ATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQAATTQNVVL---------- 322
            +R  AE+A  +  + L +    LK+TWGRP+P    + +Q +   + +L          
Sbjct: 247 TSREGAEKAAQELSNRLVVNGQRLKLTWGRPKPDQ-DSNLQGSVAHSGLLPRAVISQQHN 305

Query: 323 --PPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
             PP++   +  PP        YPS DP   G+
Sbjct: 306 QPPPVQQYYMHPPPAANQDKPYYPSMDPQRMGA 338



>gi|307111201|gb|EFN59436.1| hypothetical protein CHLNCDRAFT_33881 [Chlorella variabilis]
          Length = 377

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/351 (48%), Positives = 219/351 (62%), Gaps = 18/351 (5%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           DP   GW  S+FPI+C TCLG NP+VRM R  +G +C + +RP+T+FRW PG   RYKKT
Sbjct: 8   DPEADGWERSDFPIVCSTCLGPNPFVRMQRIEYGGQCHISNRPYTVFRWRPGTDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDA-PRSEINREYFAQNIEGKISG 127
            ICQ  AK KNVCQ CLLDL+Y LPVQVRD AL + N+  P S+  +EY  Q ++  + G
Sbjct: 68  IICQEVAKAKNVCQVCLLDLEYGLPVQVRDQALGMANEGLPESDPGKEYALQRMQ--VEG 125

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEEN 187
                 Y     +  ++L KL RTEPYY+RNR  ICSFFV+G C RG ECPYRHE+P   
Sbjct: 126 DLDRSQYETHKPN--DLLMKLRRTEPYYQRNRARICSFFVRGECKRGAECPYRHEMPTSG 183

Query: 188 ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK 247
            LS QNIKDRYYG NDPVA K+++R      + +TPPED+TI +LF+ GV DDI + DL+
Sbjct: 184 PLSEQNIKDRYYGVNDPVANKMMDRAN--KLAKLTPPEDQTICTLFVGGVTDDISKDDLR 241

Query: 248 GYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTG 307
             FY FGE++SV  V   +CAF+ +ATR +AE+A ++  + L +K   LK+ WG+P+   
Sbjct: 242 DQFYPFGELRSVKKVASRKCAFVTYATRGAAERAAEELANKLVVKGERLKLLWGKPQQPR 301

Query: 308 P-----KTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQDPTYQGS 353
           P          AA       PP     +PA PG       YPS DP   GS
Sbjct: 302 PAAEGGGGGAAAAAGPASGYPP---AYMPAAPG---GGGYYPSMDPMALGS 346



>gi|470146032|ref|XP_004308634.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like
           [Fragaria vesca subsp. vesca]
          Length = 368

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/360 (46%), Positives = 233/360 (64%), Gaps = 28/360 (7%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           G   S+FP++CE+CLGDNPYVRMTR  F KEC  C RPFT+FRW PG   RYKKTEICQT
Sbjct: 14  GRERSDFPVVCESCLGDNPYVRMTRAYFDKECFTCCRPFTVFRWKPGRDARYKKTEICQT 73

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTALNVT-NDA--PRSEINREYFAQNIEGKISGAES 130
           C+K++NVCQ C+LDL   LPVQV +TAL V  NDA  P+S++NREYFA+  + ++  A  
Sbjct: 74  CSKVRNVCQVCVLDLHTGLPVQVHNTALGVNPNDAVLPKSDVNREYFAEEYDRRVR-ASG 132

Query: 131 LIN-----YGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +I+     YGK  ++  + + KL RT PYY+RNR H+CSF+ +G CTRG ECP+RHE+P 
Sbjct: 133 IIDPYEQEYGKVRTN--DTILKLQRTTPYYQRNREHVCSFYTRGQCTRGTECPFRHEMPI 190

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD-IDEA 244
             EL++QNIKDR++G NDPVA K+L   K G   ++ PPED++  +L++ GV D  + E 
Sbjct: 191 TGELANQNIKDRFHGVNDPVALKLLR--KAGEMGSLEPPEDESTRTLYVGGVVDGRVSEQ 248

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           DL+  F+  G+I+S+ +V +  CAF+ + TR  AE+A D+  + + +K   LK+ WGRP+
Sbjct: 249 DLRDCFWVHGDIESIKIVGQRGCAFVTYTTRDGAEKAADELCNKVVVKGLRLKLAWGRPQ 308

Query: 305 PTGPKTEVQAATTQNVV-----LPPLES------MQIPAPPGEAPSDFLYPSQDPTYQGS 353
              P+ + +  + Q         P  +         +P PP +  +  LYPS DP   G+
Sbjct: 309 --APRVQDEGVSGQPEAAYGGWFPQQDQSVAQQYYYMPPPPSQGGTS-LYPSMDPQRMGA 365



>gi|483523738|gb|EOB07946.1| Pre-mRNA-splicing factor RBM22, partial [Anas platyrhynchos]
          Length = 375

 Score =  320 bits (820), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 205/281 (72%), Gaps = 8/281 (2%)

Query: 46  KVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN 105
           ++C+RPFT+FRW PG  MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L++ +
Sbjct: 1   QICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSLKD 60

Query: 106 DAPRSEINREYFAQNIEGKIS---GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHI 162
           + P+S++N+EY+ QN+E +I+   G   +   GKA S+  +ML KLART PYYKRNRPHI
Sbjct: 61  EMPKSDVNKEYYTQNMEREIANSDGTRPVGALGKATSTS-DMLLKLARTTPYYKRNRPHI 119

Query: 163 CSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSN 220
           CSF+VKG C RG+ECPYRHE P   ++ L+ QNIKDRYYG NDPVA K+L R        
Sbjct: 120 CSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKR--ASTMPR 177

Query: 221 ITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQ 280
           + PP+DKTIT+L++ G+ D I E+DL+ +FY FGEI+++ VV + +CAFI FATR +AE 
Sbjct: 178 LDPPDDKTITTLYVGGLGDTITESDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEV 237

Query: 281 AIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQAATTQNVV 321
           A +KS + L +    L + WGR +    K + +  TT++ +
Sbjct: 238 AAEKSFNKLIVNGRRLNVKWGRSQAARGKEKDKEGTTESGI 278



>gi|281345654|gb|EFB21238.1| hypothetical protein PANDA_006585 [Ailuropoda melanoleuca]
          Length = 376

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/287 (54%), Positives = 203/287 (70%), Gaps = 10/287 (3%)

Query: 46  KVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN 105
           ++C+RPFT+FRW PG  MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+QVRD  L+  +
Sbjct: 1   QICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKD 60

Query: 106 DAPRSEINREYFAQNIEGKIS---GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHI 162
           D P+S++N+EY+ QN+E +IS   G   +   GKA S+  +ML KLART PYYKRNRPHI
Sbjct: 61  DMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHI 119

Query: 163 CSFFVKGSCTRGDECPYR-HEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGS 219
           CSF+VKG C RG+ECPYR HE P   ++ L+ QNIKDRYYG NDPVA K+L R       
Sbjct: 120 CSFWVKGECKRGEECPYRQHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKR--ASTMP 177

Query: 220 NITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAE 279
            + PPEDKTIT+L++ G+ D I E DL+ +FY FGEI+++ VV + +CAFI FATR +AE
Sbjct: 178 RLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAE 237

Query: 280 QAIDKSHSNLNIKEHDLKITWGRPRPT-GPKTEVQAATTQNVVLPPL 325
            A +KS + L +    L + WGR +   G + E    T   + L P+
Sbjct: 238 VAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPV 284



>gi|474262820|gb|EMS60621.1| Zinc finger CCCH domain-containing protein 40 [Triticum urartu]
          Length = 480

 Score =  317 bits (813), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 222/352 (63%), Gaps = 39/352 (11%)

Query: 38  RQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVR 97
           R  + KECK+C+RPFT+FRW PG   RYKKTEICQTC KLKNVCQ CLLDL+Y LPVQVR
Sbjct: 23  RAEYDKECKICARPFTVFRWRPGRDARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQVR 82

Query: 98  DTALNV-TNDA-PRSEINREYFAQNIEGKIS-GAESLINYGKADSSGREMLKKLARTEPY 154
           DTAL + +NDA PRS++NREYFA+  + K + G +   +YGKA  +  + + KL RT PY
Sbjct: 83  DTALAINSNDAIPRSDVNREYFAEEHDRKAAAGIDYDSSYGKARPN--DTILKLQRTSPY 140

Query: 155 YKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVK 214
           YKRNR H+CSF+V+G CTRG ECPYRHE+PE  ELS QNIKDRYYG NDPVA K+L   K
Sbjct: 141 YKRNRAHVCSFYVRGECTRGAECPYRHEMPETGELSQQNIKDRYYGVNDPVALKLLG--K 198

Query: 215 GGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFAT 274
            G   ++ PP+D+TI +L+I G+++ + E DL+  FYA GEI+S+ +V +  CAF+ + T
Sbjct: 199 AGEMPSLQPPDDETIRTLYIGGLDNRVSEQDLRDQFYAHGEIESIRMVIQRACAFVTYTT 258

Query: 275 RASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQAATTQNVVL------------ 322
           R  AE+A ++  + L IK   LK+ WG+P+   P+ +   A  Q  V             
Sbjct: 259 REGAERAAEELANKLVIKGVRLKLMWGKPQ--APRQDDDEAGRQGHVSHGGLLPRAVISQ 316

Query: 323 ---------PPLESMQIPAPPGE---------APSDFLYPSQDPTYQGSSTK 356
                    P +E  Q  AP G          A    +YPS DP   G+  +
Sbjct: 317 QHSSDQPQPPGMEGQQQVAPQGSGYFNIPPPPAVDQRMYPSMDPQRMGAVVR 368



>gi|294888423|ref|XP_002772458.1| pre-mRNA-splicing factor SLT11, putative [Perkinsus marinus ATCC
           50983]
 gi|239876684|gb|EER04274.1| pre-mRNA-splicing factor SLT11, putative [Perkinsus marinus ATCC
           50983]
          Length = 367

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 223/351 (63%), Gaps = 19/351 (5%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N  G  E+ FPI+CETCLGDNPYVRM ++  G ECK+C RP+T+FRW  G+  RYK+T +
Sbjct: 13  NHIGAEEATFPIVCETCLGDNPYVRMQKEPMGDECKICERPYTMFRWKAGSKGRYKQTVL 72

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKISGA 128
           CQ CA++KNVCQ C+ DL + LPVQVRD  L+       P S + R+Y A N       A
Sbjct: 73  CQNCARMKNVCQVCIFDLDFGLPVQVRDKFLSEAEKLSLPESTVGRDYQALN---NSQNA 129

Query: 129 ESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI--PEE 186
              + YGK       ML+KLART PYY+RN+  ICSFFVKG+C RGDECPYRHE+  PE 
Sbjct: 130 NPALTYGKLKH--HSMLQKLARTAPYYERNQARICSFFVKGTCNRGDECPYRHEMPKPEG 187

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD--IDEA 244
           N+L+ QNI+DRY+GT+DPVAKKIL   +      +  PED +IT+L+I G++ +  I E+
Sbjct: 188 NDLNDQNIRDRYHGTDDPVAKKILK--QAAEKFQLEAPEDTSITTLYIGGIDPNAQIGES 245

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQ-AIDKSHSNLNIKEHDLKITWGRP 303
           +++  F  FG+I S+V+V KS CAF+ F +R SAE+ A +K  SNL I    L+++W +P
Sbjct: 246 NIRAEFEEFGQIDSIVLVEKSNCAFVEFTSRQSAEKAAAEKGGSNLVINGARLRVSWAKP 305

Query: 304 RPTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQDPTYQGSS 354
           + TG  +   +A  +           + AP G      +YPS +P   G++
Sbjct: 306 K-TGGLSAGSSALVKAAAEGSAIKQTVLAPAGSG----VYPSMNPMVHGNA 351



>gi|294942681|ref|XP_002783643.1| pre-mRNA-splicing factor SLT11, putative [Perkinsus marinus ATCC
           50983]
 gi|239896145|gb|EER15439.1| pre-mRNA-splicing factor SLT11, putative [Perkinsus marinus ATCC
           50983]
          Length = 367

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 223/355 (62%), Gaps = 27/355 (7%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N  G  E+ FPI+CETCLGDNPYVRM ++  G ECK+C RP+T+FRW  G+  RYK+T +
Sbjct: 13  NHIGAEEATFPIVCETCLGDNPYVRMQKEPMGDECKICERPYTMFRWKAGSKGRYKQTVL 72

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKISGA 128
           CQ CA++KNVCQ C+ DL + LPVQVRD  L+       P S + R+Y A N       A
Sbjct: 73  CQNCARMKNVCQVCIFDLDFGLPVQVRDKFLSEAEKLSLPESTVGRDYQALN---NSQNA 129

Query: 129 ESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI--PEE 186
              + YGK       ML+KLART PYY+RN+  ICSFFVKG+C RGDECPYRHE+  PE 
Sbjct: 130 NPALTYGKLKH--HPMLQKLARTAPYYERNQARICSFFVKGTCNRGDECPYRHEMPKPEG 187

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD--IDEA 244
           N+L+ QNI+DRY+GT+DPVAKKIL   +      +  PED +IT+L+I G++ +  I E+
Sbjct: 188 NDLNDQNIRDRYHGTDDPVAKKILK--QAAEKFQLEAPEDTSITTLYIGGIDPNAQIGES 245

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQ-AIDKSHSNLNIKEHDLKITWGRP 303
           +++  F  FG+I S+V+V KS CAF+ F  R SAE+ A +K  SNL I    L+++W +P
Sbjct: 246 NIRAEFEEFGQIDSIVLVEKSNCAFVEFTGRQSAEKAAAEKGGSNLVINGARLRVSWAKP 305

Query: 304 R----PTGPKTEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQDPTYQGSS 354
           +      G    V+AA   + V        + AP G      +YPS +P   G++
Sbjct: 306 KSGGLSAGSSALVKAAAEGSAV-----KQTVLAPAGSG----VYPSMNPMVHGNA 351



>gi|478259080|gb|ENN79015.1| hypothetical protein YQE_04517, partial [Dendroctonus ponderosae]
 gi|478266191|gb|ENN82720.1| hypothetical protein YQE_00913, partial [Dendroctonus ponderosae]
          Length = 297

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 145/269 (53%), Positives = 200/269 (74%), Gaps = 6/269 (2%)

Query: 36  MTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQ 95
           MT++ +GKECK+CSRPFT+FRW PGA MR+KKTE+CQTC+KLKNVCQTCLLDL+Y LP+Q
Sbjct: 1   MTKEKYGKECKICSRPFTVFRWCPGARMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQ 60

Query: 96  VRDTALNVTNDAPRSEINREYFAQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYY 155
           VRD AL + +D P+S++N+E++ QN+E  ++ +++     K +    ++L +LART PYY
Sbjct: 61  VRDAALKLKDDLPKSDVNKEFYIQNMERDLARSDARSMNAKLNEPN-DLLIRLARTAPYY 119

Query: 156 KRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRV 213
           KRNRPH+CSF+VKG C RG+ECPYRHE P   ++ L+ QNIKDRYYG NDPVA K+L R 
Sbjct: 120 KRNRPHVCSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVADKLLKR- 178

Query: 214 KGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFA 273
                  + PP+DKTIT+L++ G    + E D++ +FY +GEI+SV +V K +CAF+ F 
Sbjct: 179 -AAAMPTLEPPDDKTITTLYL-GNLGVLTEGDIRDHFYQYGEIRSVSLVPKQQCAFVQFT 236

Query: 274 TRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           TR++AE A +K+ + L +    L I WGR
Sbjct: 237 TRSAAETAAEKTFNKLILGGRRLTIKWGR 265



>gi|401399032|ref|XP_003880458.1| hypothetical protein NCLIV_008920 [Neospora caninum Liverpool]
 gi|325114868|emb|CBZ50424.1| hypothetical protein NCLIV_008920 [Neospora caninum Liverpool]
          Length = 400

 Score =  313 bits (801), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 223/351 (63%), Gaps = 21/351 (5%)

Query: 17  ESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAK 76
           +S+FPILCETCLGDNPYVRM R   GKEC++C+RP+T FRW PG   RYK T +CQTCAK
Sbjct: 22  QSDFPILCETCLGDNPYVRMQRNREGKECRICTRPYTAFRWKPGPKARYKSTVVCQTCAK 81

Query: 77  LKNVCQTCLLDLQYNLPVQVRDTAL-NVTNDAPRSEINREYFAQNIEGKISGAESLINYG 135
           LKNVCQTCL DLQY LPVQVRD  L     D P   +NR+Y A    G++  A   + YG
Sbjct: 82  LKNVCQTCLFDLQYGLPVQVRDKILEGAKVDLPEHPLNRDYMA----GRLEKAADQLPYG 137

Query: 136 KA-DSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIPEENELSHQN 193
           K  D  GR  L+ +ART+PYY+RN P +C+F+ +G C RGDECPY H E+  +  L++QN
Sbjct: 138 KLEDPDGR--LRAIARTQPYYRRNAPRVCTFWQRGECKRGDECPYLHQEVHHDPALANQN 195

Query: 194 IKDRYYGTNDPVAKKILNRVKGGNGSN--ITPPEDKTITSLFITGVEDDIDEADLKGYFY 251
           ++DRY G +DPVA+KIL R+     S+  +TPP D T T++F+ G+   + E DL+  FY
Sbjct: 196 LRDRYSGQDDPVAEKIL-RLAASKPSDDSVTPPADTTNTTVFVGGLTKGVTEQDLRDAFY 254

Query: 252 AFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTE 311
           AFGE+ S+ +    + AF+ +A R+SAE+A+ + HSNL IK   L++ W +P     K +
Sbjct: 255 AFGELLSIKMYRGQQYAFLCYAERSSAEEAVKQLHSNLVIKGVRLRVAWAKPSDKRKKPD 314

Query: 312 ------VQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQDPTYQGSSTK 356
                  QA     V+ PPL  +  P+     P  F+  S D   +G+S +
Sbjct: 315 DNDLPAAQADLGVTVIPPPLPGL--PSVRAPVPLPFMLDSADAN-RGASVR 362



>gi|384249712|gb|EIE23193.1| hypothetical protein COCSUDRAFT_23819 [Coccomyxa subellipsoidea
           C-169]
          Length = 464

 Score =  310 bits (793), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 215/369 (58%), Gaps = 44/369 (11%)

Query: 18  SEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKL 77
           S+FPI+CETCLG NPYVRM R  FG EC +  RP+T+FRW PG   RYKKT ICQ  AK 
Sbjct: 12  SDFPIVCETCLGPNPYVRMQRIEFGGECHISGRPYTVFRWRPGNDARYKKTIICQEVAKA 71

Query: 78  KNVCQTCLLDLQYNLPVQVRDTALNVTNDA-PRSEINREYFAQNIEGKISGAESLINYGK 136
           KNVCQ CLLDL Y++PVQ RD AL + ++  P S++ +E+  + +E          N G 
Sbjct: 72  KNVCQVCLLDLDYSIPVQARDAALGIEDEVLPESDVGKEFKLKELE----------NAGT 121

Query: 137 ADSS-----GREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSH 191
            DSS       + + K+ RT PYYKRNR  ICSFFVKG C RG ECPYRHE+P    L+ 
Sbjct: 122 LDSSYSKTQANDKILKMQRTTPYYKRNRAPICSFFVKGECKRGAECPYRHEMPTTGPLAE 181

Query: 192 QNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFY 251
           QNIKDRYYG NDPVA K+L RV       I  PED+ I +L++ G+  ++++ DL+ +FY
Sbjct: 182 QNIKDRYYGVNDPVANKMLARVDA--MPKIEAPEDREIKTLYVGGLAPEVEDQDLRDHFY 239

Query: 252 AFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTE 311
            +GEI S+ ++    CAF+ +ATR +AE+A  +    L ++    K+ WG+P+      E
Sbjct: 240 PYGEISSIKILSARHCAFVTYATRPAAERAAQELQHKLIVRGQRAKLMWGKPQEKR-TLE 298

Query: 312 VQAATTQNV---------VLPPLESMQIPA---------------PPGEAPSDFLYPSQD 347
            Q                +LPP  +MQ+                 PPG AP   LYPS D
Sbjct: 299 YQDGMAPPEGGPQPPPMSMLPPQVAMQMGGAVPFGAPPGPNFFNLPPGGAPGQ-LYPSMD 357

Query: 348 PTYQGSSTK 356
           P+  G+  +
Sbjct: 358 PSQAGTRAQ 366



>gi|118380139|ref|XP_001023234.1| hypothetical protein TTHERM_00494500 [Tetrahymena thermophila]
 gi|89305001|gb|EAS02989.1| hypothetical protein TTHERM_00494500 [Tetrahymena thermophila
           SB210]
          Length = 376

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 210/334 (62%), Gaps = 24/334 (7%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRM------------TRQGFGKECKVCSRPFTIFRWL 58
           NKQGW ++EFPILCETCLGDNPYVRM             ++  G+ECK+C+RPFT+FRW 
Sbjct: 14  NKQGWEDAEFPILCETCLGDNPYVRMIGQQPYFQLLKQMKEKHGQECKICTRPFTVFRWK 73

Query: 59  PGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL-NVTNDAPRSEINREYF 117
            G   R+KKTEICQTCAKLKNVCQTC+ DLQY LPV+VRD  L       P  + N++YF
Sbjct: 74  AGTKGRFKKTEICQTCAKLKNVCQTCIFDLQYGLPVEVRDKFLAEQAVHMPTQQSNKDYF 133

Query: 118 AQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDEC 177
                  +      ++     + G  +L+K+AR +PYY+RN+  ICSF+VKG+CTRGD C
Sbjct: 134 THLANNNLDQ----LSLPYDQTVGNTILEKVARLKPYYERNKARICSFWVKGNCTRGDLC 189

Query: 178 PYRHE----IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLF 233
           PY HE      E++ L+ QN+KDR++G NDP+A+K++N+++    ++I PP D TITSL+
Sbjct: 190 PYSHEKRENQDEDDPLNKQNLKDRFHGKNDPLAQKVMNKIQNHKENDIKPPADPTITSLY 249

Query: 234 ITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKE 293
           I  +  D  E D    F  +G I+S+ ++ +  CAF+NF  R +AE+AI   + N N+K 
Sbjct: 250 IGNITPDFTEQDFHQIFVKYGPIQSIKIISQKSCAFVNFIARKAAEEAIKDLYGNFNVKG 309

Query: 294 HDLKITWGRPRPTGPKTEVQAATTQNVVLPPLES 327
             L I+W R    G   + Q+      + PP E+
Sbjct: 310 IQLSISWSR---AGKNQQQQSEFQGYNIQPPQEN 340



>gi|167525647|ref|XP_001747158.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774453|gb|EDQ88082.1| predicted protein [Monosiga brevicollis MX1]
          Length = 409

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 211/344 (61%), Gaps = 26/344 (7%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W  +EFPI+CETCLG NPYVRMT++ FG  CKVC RPFT+FRW PG G R+KKTE+
Sbjct: 12  NRQAWESAEFPIVCETCLGPNPYVRMTKEAFGSACKVCERPFTVFRWQPGKGSRFKKTEL 71

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAK+KNVCQTC+LDL+Y +PVQ+RD  L      P S +N+EY+ QN E K +  E 
Sbjct: 72  CQTCAKIKNVCQTCVLDLEYGVPVQLRDRLLGQEQALPESAVNKEYYIQNQEAKFAQIEG 131

Query: 131 LINYGKADS-------------------SGREMLKKLARTEPYYKRNRPHICSFFVKGSC 171
              + ++ +                   +GR +L++L    PYYKRN   ICSF+VKG C
Sbjct: 132 HNAFNQSSALAITGGGDAAGGPAGGKLAAGRAILERLKARGPYYKRNEARICSFWVKGQC 191

Query: 172 TRGDECPYRHEIPEE--NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTI 229
           TRGD CP+RHE+P +  N L+ QN+  RY+GT DPVA+K L +++  +      P D +I
Sbjct: 192 TRGDTCPFRHEMPTDPKNPLAKQNLMGRYHGTEDPVAEKYLKKIQ--SRPKAEAPADTSI 249

Query: 230 TSLFITGVEDD--IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHS 287
           T+L+I GV  D  I   DL+ YF    ++ +V +  K   AF+ FATR  AEQA++ +  
Sbjct: 250 TTLYIGGVRPDLNITADDLRDYFEKHSQVAAVRLAPKQSAAFVEFATREGAEQAMEIAAV 309

Query: 288 NLNIKEHDLKITWGRPRPTGPKTEVQAATTQNVVLPPLESMQIP 331
           N  IK   L++ WG+ R +   +  +     +V +P L    +P
Sbjct: 310 NCIIKGEPLRVMWGKAR-SNNNSGGRGGAAPSVAVPALPGFGLP 352



>gi|422294185|gb|EKU21485.1| pre-mRNA-splicing factor RBM22/SLT11 [Nannochloropsis gaditana
           CCMP526]
          Length = 448

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 206/319 (64%), Gaps = 29/319 (9%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD NK+GW  S+FP++CETCLGDNPYVRMT++  GK CK+C RPFTIFRW PGA  
Sbjct: 6   MQIKADLNKEGWESSDFPLVCETCLGDNPYVRMTKEPAGKACKICDRPFTIFRWRPGAKA 65

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL------------NVTNDAPRSE 111
           R+KKTE+CQTCAK+KNVCQTC+LDL Y LPVQVRD+ L            +     P+S+
Sbjct: 66  RFKKTEVCQTCAKMKNVCQTCVLDLTYGLPVQVRDSVLAEAAAAGEGGAASYAMTVPQSD 125

Query: 112 INREYFAQNIEGKISGAESLINYGKADSSGR----EMLKKLARTEPYYKRNRPHICSFFV 167
            N+++FA          + ++  G ADS G+    E L +L+R +PYYKRN PH C+F+ 
Sbjct: 126 TNKQWFAGQ-------HDRMVAEGHADSYGKAQINEKLMRLSRAQPYYKRNLPHKCTFYA 178

Query: 168 KGSCTRGDECPYRHEIP--EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSN---IT 222
           KG CTRGD CP+ HE+P    + L++QNIKDR+YG +DPVA+K+L R       +   + 
Sbjct: 179 KGECTRGDRCPFLHEMPTSRSDPLANQNIKDRFYGQDDPVAQKMLGRAASKEKEDQAPLI 238

Query: 223 PPEDKTITSLFITGVEDD-IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQA 281
           PP D  I +L + G+E   + E +++  FY FGE+  V +V     AF+ + TR +AE A
Sbjct: 239 PPTDPEIKTLMVGGMEGGAVTETEMREAFYGFGEVAGVRMVPAKHLAFVEYTTREAAEAA 298

Query: 282 IDKSHSNLNIKEHDLKITW 300
               H+NL ++   L+++W
Sbjct: 299 AKALHNNLTLQGLRLRVSW 317



>gi|237840441|ref|XP_002369518.1| RRM / zinc finger (CCCH type) domain-containing protein [Toxoplasma
           gondii ME49]
 gi|211967182|gb|EEB02378.1| RRM / zinc finger (CCCH type) domain-containing protein [Toxoplasma
           gondii ME49]
 gi|221483211|gb|EEE21535.1| lysine-specific histone demethylase, putative [Toxoplasma gondii
           GT1]
          Length = 400

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 214/341 (62%), Gaps = 18/341 (5%)

Query: 17  ESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAK 76
           +S+FPILCETCLGDNPYVRM R   GKEC++C+RP+T FRW PG   RYK T +CQTCAK
Sbjct: 22  QSDFPILCETCLGDNPYVRMQRNREGKECRICTRPYTAFRWKPGPKARYKSTVVCQTCAK 81

Query: 77  LKNVCQTCLLDLQYNLPVQVRDTAL-NVTNDAPRSEINREYFAQNIEGKISGAESLINYG 135
           LKNVCQTCL DLQY LPVQVRD  L     + P   +NR+Y A  +E     A   + YG
Sbjct: 82  LKNVCQTCLFDLQYGLPVQVRDKLLEGAKVELPDHPLNRDYMADRLE----KAADQLPYG 137

Query: 136 KA-DSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIPEENELSHQN 193
           K  D  GR  L+ +ART+PYY+RN P +C+F+ +G C RGDECPY H E+  +  L++QN
Sbjct: 138 KLEDHEGR--LRAIARTQPYYRRNAPRVCTFWQRGECKRGDECPYLHQEVHHDPALANQN 195

Query: 194 IKDRYYGTNDPVAKKILNRVKGG-NGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYA 252
           ++DRY G +DPVA+KIL       N  ++TPP D T T++F+ G+   + E DL+  FYA
Sbjct: 196 LRDRYSGQDDPVAEKILRLAASKPNADSVTPPADTTNTTVFVGGLTKGVTEQDLRDAFYA 255

Query: 253 FGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPK--- 309
           FGE+ S+ +    + AF+ +A R+SAE+A+ + HSNL IK   L++ W +P     K   
Sbjct: 256 FGELLSIKMYRGQQFAFLCYAERSSAEEAVKQLHSNLVIKGVRLRVAWAKPSDKKKKPDD 315

Query: 310 ---TEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
              T  Q      V+ PPL  +  P+     P  F+  S D
Sbjct: 316 NDVTAAQEDPGVTVIPPPLPGL--PSIRAPVPLPFMLDSAD 354



>gi|221504135|gb|EEE29812.1| RRM / zinc finger (CCCH type) domain-containing protein [Toxoplasma
           gondii VEG]
          Length = 400

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 160/341 (46%), Positives = 213/341 (62%), Gaps = 18/341 (5%)

Query: 17  ESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAK 76
           +S+FPILCETCLGDNPYVRM R   GKEC++C+RP+T FRW PG   RYK T +CQTCAK
Sbjct: 22  QSDFPILCETCLGDNPYVRMQRNREGKECRICTRPYTAFRWKPGPKARYKSTVVCQTCAK 81

Query: 77  LKNVCQTCLLDLQYNLPVQVRDTAL-NVTNDAPRSEINREYFAQNIEGKISGAESLINYG 135
           LKNVCQTCL DLQY LPVQVRD  L     + P   +NR+Y A  +E     A   + YG
Sbjct: 82  LKNVCQTCLFDLQYGLPVQVRDKLLEGAKVELPDHPLNRDYMADRLE----KAADQLPYG 137

Query: 136 KA-DSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIPEENELSHQN 193
           K  D  GR  L+ +ART+PYY+RN P +C+F+ +  C RGDECPY H E+  +  L++QN
Sbjct: 138 KLEDHEGR--LRAIARTQPYYRRNAPRVCTFWQRRECKRGDECPYLHQEVHHDPALANQN 195

Query: 194 IKDRYYGTNDPVAKKILNRVKGG-NGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYA 252
           ++DRY G +DPVA+KIL       N  ++TPP D T T++F+ G+   + E DL+  FYA
Sbjct: 196 LRDRYSGQDDPVAEKILRLAASKPNADSVTPPADTTNTTVFVGGLTKGVTEQDLRDAFYA 255

Query: 253 FGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPK--- 309
           FGE+ S+ +    + AF+ +A R+SAE+A+ + HSNL IK   L++ W +P     K   
Sbjct: 256 FGELLSIKMYRGQQFAFLCYAERSSAEEAVKQLHSNLVIKGVRLRVAWAKPSDKKKKPDD 315

Query: 310 ---TEVQAATTQNVVLPPLESMQIPAPPGEAPSDFLYPSQD 347
              T  Q      V+ PPL  +  P+     P  F+  S D
Sbjct: 316 NDVTAAQEDPGVTVIPPPLPGL--PSIRAPVPLPFMLDSAD 354



>gi|238595509|ref|XP_002393786.1| hypothetical protein MPER_06426 [Moniliophthora perniciosa FA553]
 gi|215461795|gb|EEB94716.1| hypothetical protein MPER_06426 [Moniliophthora perniciosa FA553]
          Length = 257

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 143/247 (57%), Positives = 184/247 (74%), Gaps = 8/247 (3%)

Query: 51  PFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRS 110
           PFT+FRW PG+G RYK T ICQTCAK+KNVCQTCLLDL+Y LP QVRDTAL   ++AP S
Sbjct: 7   PFTVFRWNPGSGSRYKTTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGYQSEAPTS 66

Query: 111 EINREYFAQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGS 170
           +INREY+AQN+E K+ G +S ++ GKA S+G++MLK+LART+PYYKRNRP ICSFFVKG 
Sbjct: 67  DINREYYAQNMESKLEGNKSGLDNGKAQSAGKDMLKQLARTDPYYKRNRPKICSFFVKGD 126

Query: 171 CTRGDECPYRHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTIT 230
           CTRGDECPYRHE P +NEL+HQNI+DRY+G NDPVA KIL +     G  + PPED++I 
Sbjct: 127 CTRGDECPYRHEKPADNELAHQNIQDRYHGRNDPVANKILAQNSENQG--LKPPEDESIM 184

Query: 231 SLFITGVEDDIDEADLKGYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDK 284
           SLF++ +  +  E  ++             ++KSVV V K+RCAFINF  R +A++A   
Sbjct: 185 SLFLSSLAPESTEQSIRARVLQSLPSIDPAKLKSVVHVTKTRCAFINFQDRETAKRAAQA 244

Query: 285 SHSNLNI 291
             + L++
Sbjct: 245 WANGLDV 251



>gi|470319707|gb|EMR11317.1| hypothetical protein PNEG_00346 [Pneumocystis murina B123]
          Length = 343

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 216/370 (58%), Gaps = 50/370 (13%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  K D NK GW  +EFP +CE+CLG NPYVRMT++ +GKECK+C+RPFT+F W PG   
Sbjct: 1   MPPKLDINKSGWESAEFPAICESCLGPNPYVRMTKREYGKECKICTRPFTVFSWHPGKES 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYKKTEIC TC+++KN CQ CLLDLQ+ LP+QVRD AL + N  P+S+INREY+AQN EG
Sbjct: 61  RYKKTEICLTCSRIKNCCQNCLLDLQFGLPIQVRDAALKLVNQGPQSDINREYYAQNNEG 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           K     +   +GK DS+ RE+LKKLAR+EPYYK+                      +  +
Sbjct: 121 KWKDGNTPCEFGKVDSAARELLKKLARSEPYYKK----------------------QIHM 158

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDE 243
            +  ELS  NI +    ++ PV  + ++ +     + + PP+DK ITSLFI G+EDD+ E
Sbjct: 159 AKNPELS--NISNHSTDSSAPVFGRSISHI---TSNQLVPPQDKKITSLFIIGIEDDLPE 213

Query: 244 ADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKS-HSNLNIKEHDLKITWGR 302
             ++ YF  +G IKS+V  H+SRCAF+NF TR +AE A     + ++ I    LK+ WGR
Sbjct: 214 HAIRVYFEKYGPIKSLVCSHRSRCAFVNFTTRVAAETAAKACRNGDILINGCPLKVQWGR 273

Query: 303 PRPTGP-KTEVQAATTQNVVL---------PPLESMQ-----------IPAPPGEAPSDF 341
           PRP G    E Q A     V+         P  ES             +  PPG+   D 
Sbjct: 274 PRPLGGYNQEQQNAKMSRFVMSQSQFATQNPGEESHATSEIKKPEDTVLELPPGQD-GDI 332

Query: 342 LYPSQDPTYQ 351
            Y S  P YQ
Sbjct: 333 AYQSMHPYYQ 342



>gi|281202587|gb|EFA76789.1| CCCH-type zinc finger-containing protein [Polysphondylium pallidum
           PN500]
          Length = 421

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 203/308 (65%), Gaps = 14/308 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K  P  +   + EFPI CE+C G++PY+ MT++ FGKECK+C++PF +FRW PG+G R+K
Sbjct: 7   KGLPQVEEQKQQEFPIACESCFGESPYMTMTKEEFGKECKICAKPFCVFRWKPGSGSRFK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           KTEIC+TCA +KNVCQ C+ DL++ LPVQVRD AL     AP +++NR Y +Q  E  I 
Sbjct: 67  KTEICKTCALVKNVCQVCIHDLEFGLPVQVRDAALQSFEKAPVTDLNRTYVSQQNEIMIE 126

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE 186
             E  INY     +  E+++KLAR+ PYYK+N PHICSFF++G C RGD CPY H+    
Sbjct: 127 NGE--INYDNFQPT--EIIEKLARSTPYYKKNNPHICSFFLRGECNRGDACPYSHDKESA 182

Query: 187 N---ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE-DDID 242
               +   QNIKDRYYG NDPVA K+L +V         PPED++IT+L++  V+ + I 
Sbjct: 183 TGIGKFPKQNIKDRYYGNNDPVAMKMLKQVTP------VPPEDRSITTLYLGNVDPERIT 236

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           E DL+  F++FG IK++ +V  S+CAF+ F +R +AE A+++  + L   +  +++ W +
Sbjct: 237 ENDLRTAFFSFGVIKTLRIVAASKCAFLTFESRDAAETAMNQLFNKLIFDDIPVQMNWSK 296

Query: 303 PRPTGPKT 310
                P T
Sbjct: 297 FNKPQPNT 304



>gi|403356826|gb|EJY78018.1| pre-mRNA-splicing factor RBM22 [Oxytricha trifallax]
          Length = 434

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 201/314 (64%), Gaps = 19/314 (6%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           +  ++   KQGW +S+FPILC+TCLG+NPYVRMT+  F +ECK C RPFT+FRW PG   
Sbjct: 6   LGIRSGATKQGWEKSDFPILCDTCLGENPYVRMTKSEFARECKTCQRPFTVFRWKPGNAC 65

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL--NVTNDAPRSEINREYFAQNI 121
           RYKKTEICQTCAK+KNVCQTCL DL + LPV++RD  L  N     P+  INR+++  ++
Sbjct: 66  RYKKTEICQTCAKVKNVCQTCLFDLDFGLPVELRDKFLDKNELVAMPKDAINRDFWTNSV 125

Query: 122 EGKISGAESLINYGKADSSGREMLKKLART-EPYYKRNRPHICSFFVKGSCTRGDECPYR 180
              I   E  + Y   +   ++ L +++R+  P YKRN+ H+CSF+VKG C RG  CPYR
Sbjct: 126 NQDIEKME--LPYQNPEV--KQALAQMSRSFLPSYKRNQAHVCSFYVKGECNRGKACPYR 181

Query: 181 HEIPEENELS---------HQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITS 231
           H    E +L           + I++R++G NDPVAKKIL+RVK  N    +PPED  IT+
Sbjct: 182 HTNISEEDLESMKKGQGSIDERIRNRFHGVNDPVAKKILDRVKETNIP--SPPEDMNITT 239

Query: 232 LFITGVEDD-IDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLN 290
           +FI GV DD I+E  LK    +FG+IK V ++HK  CAF+ F  R SAE+A++       
Sbjct: 240 IFIGGVNDDSINEETLKEQLESFGKIKGVKLIHKQGCAFVCFHARESAEKAVEAIFDRFF 299

Query: 291 IKEHDLKITWGRPR 304
           +    LK+ W + +
Sbjct: 300 VNNKRLKVLWAKAQ 313



>gi|303279645|ref|XP_003059115.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458951|gb|EEH56247.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 419

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 196/312 (62%), Gaps = 15/312 (4%)

Query: 4   MAAK--ADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA 61
           MAA+   DP+  GW  ++FP++CE CLG NPY+RM +Q +  EC + SRPFT+FRW PG 
Sbjct: 1   MAARLLQDPDADGWERTDFPVVCEDCLGPNPYIRMQKQDYAAECAISSRPFTVFRWRPGN 60

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTND-APRSEINREYFAQN 120
             RYKKT +C+  A  KNVCQ CLLDL Y +PVQ RD  L    +   +S++N E+    
Sbjct: 61  EARYKKTVVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGRERETVAKSDVNIEFHTNE 120

Query: 121 IEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR 180
           I  +I   E +    +A+ +   M++KLAR +PYY++N+  IC+F+++ +C R D CPYR
Sbjct: 121 IAKRIENGEDVQATARAEMNS--MIQKLARKKPYYQKNKAPICTFWLRNACNRPD-CPYR 177

Query: 181 --------HEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSL 232
                    E+    EL  QNIKDRYYG NDPVA+K+L R     G    PPEDK+IT+L
Sbjct: 178 PCNGDTNMPELTSAPELRTQNIKDRYYGINDPVAEKMLKRA-SEKGVACVPPEDKSITTL 236

Query: 233 FITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIK 292
           FI G+++ + E DLK  FYA+GEIKS+  VH   C F+ F  RA AE+A +    +L I 
Sbjct: 237 FIGGMDERVTEGDLKDTFYAYGEIKSIRCVHAKNCGFVTFTDRAGAEKAAEALSGDLVIN 296

Query: 293 EHDLKITWGRPR 304
              LK+ WG+PR
Sbjct: 297 NLRLKLMWGKPR 308



>gi|334187480|ref|NP_001190247.1| MOS4-associated complex subunit 5C [Arabidopsis thaliana]
 gi|332003721|gb|AED91104.1| zinc finger CCCH domain-containing protein 53 [Arabidopsis
           thaliana]
          Length = 355

 Score =  293 bits (749), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 179/257 (69%), Gaps = 7/257 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  ++FPI CE+C GDNPY+RMTR  + KECK+CSRPFT FRW PG   R+KKT
Sbjct: 5   DHGADGWESADFPITCESCFGDNPYMRMTRADYDKECKICSRPFTAFRWRPGRNARFKKT 64

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL + LPVQVRD+ALN+ +    P S +NREYFA   + K  
Sbjct: 65  EICQTCSKLKNVCQVCLLDLGFGLPVQVRDSALNINSHYSVPMSHVNREYFADEHDPKTR 124

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL R  P Y++NRP ICSF+  G C RG EC +RHE+PE
Sbjct: 125 AGLDYESSFGKMQPN--DTILKLQRRTPSYEKNRPKICSFYTIGQCKRGAECSFRHEMPE 182

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELSHQNI+DRYY  NDPVA K+L   K G    + PPED++I +L++ G+   I E D
Sbjct: 183 TGELSHQNIRDRYYSVNDPVAMKLLR--KAGEMGTLEPPEDESIKTLYVGGLNSRIFEQD 240

Query: 246 LKGYFYAFGEIKSVVVV 262
           +  +FYA+GE++S+ V+
Sbjct: 241 IHDHFYAYGEMESIRVM 257



>gi|15240684|ref|NP_196323.1| MOS4-associated complex subunit 5C [Arabidopsis thaliana]
 gi|75334011|sp|Q9FL40.1|C3H53_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 53;
           Short=AtC3H53
 gi|9759562|dbj|BAB11164.1| RNA-binding protein-like [Arabidopsis thaliana]
 gi|91806814|gb|ABE66134.1| zinc finger family protein [Arabidopsis thaliana]
 gi|332003720|gb|AED91103.1| zinc finger CCCH domain-containing protein 53 [Arabidopsis
           thaliana]
          Length = 363

 Score =  293 bits (749), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 179/257 (69%), Gaps = 7/257 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  ++FPI CE+C GDNPY+RMTR  + KECK+CSRPFT FRW PG   R+KKT
Sbjct: 5   DHGADGWESADFPITCESCFGDNPYMRMTRADYDKECKICSRPFTAFRWRPGRNARFKKT 64

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL + LPVQVRD+ALN+ +    P S +NREYFA   + K  
Sbjct: 65  EICQTCSKLKNVCQVCLLDLGFGLPVQVRDSALNINSHYSVPMSHVNREYFADEHDPKTR 124

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL R  P Y++NRP ICSF+  G C RG EC +RHE+PE
Sbjct: 125 AGLDYESSFGKMQPN--DTILKLQRRTPSYEKNRPKICSFYTIGQCKRGAECSFRHEMPE 182

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELSHQNI+DRYY  NDPVA K+L   K G    + PPED++I +L++ G+   I E D
Sbjct: 183 TGELSHQNIRDRYYSVNDPVAMKLLR--KAGEMGTLEPPEDESIKTLYVGGLNSRIFEQD 240

Query: 246 LKGYFYAFGEIKSVVVV 262
           +  +FYA+GE++S+ V+
Sbjct: 241 IHDHFYAYGEMESIRVM 257



>gi|116831459|gb|ABK28682.1| unknown [Arabidopsis thaliana]
          Length = 364

 Score =  293 bits (749), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 179/257 (69%), Gaps = 7/257 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  ++FPI CE+C GDNPY+RMTR  + KECK+CSRPFT FRW PG   R+KKT
Sbjct: 5   DHGADGWESADFPITCESCFGDNPYMRMTRADYDKECKICSRPFTAFRWRPGRNARFKKT 64

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL + LPVQVRD+ALN+ +    P S +NREYFA   + K  
Sbjct: 65  EICQTCSKLKNVCQVCLLDLGFGLPVQVRDSALNINSHYSVPMSHVNREYFADEHDPKTR 124

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   ++GK   +  + + KL R  P Y++NRP ICSF+  G C RG EC +RHE+PE
Sbjct: 125 AGLDYESSFGKMQPN--DTILKLQRRTPSYEKNRPKICSFYTIGQCKRGAECSFRHEMPE 182

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEAD 245
             ELSHQNI+DRYY  NDPVA K+L   K G    + PPED++I +L++ G+   I E D
Sbjct: 183 TGELSHQNIRDRYYSVNDPVAMKLLR--KAGEMGTLEPPEDESIKTLYVGGLNSRIFEQD 240

Query: 246 LKGYFYAFGEIKSVVVV 262
           +  +FYA+GE++S+ V+
Sbjct: 241 IHDHFYAYGEMESIRVM 257



>gi|168040006|ref|XP_001772487.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162676284|gb|EDQ62769.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 428

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 191/294 (64%), Gaps = 27/294 (9%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           GW  S+FPI C+ CLGDNPYVRMT+  F KECK+C RPFT+F W  G   RY+KTE+CQT
Sbjct: 13  GWERSDFPITCDCCLGDNPYVRMTKANFEKECKICIRPFTVFCWRSGRDARYEKTEVCQT 72

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTAL--NVTNDAPRSEINREYFAQNIEGKISGAESL 131
            +KLKNVCQ CLLDL+Y LPVQVRDTAL  N +   P+S+                A++ 
Sbjct: 73  YSKLKNVCQVCLLDLEYGLPVQVRDTALGINTSESIPKSD----------------AKAG 116

Query: 132 INYGKADSSGR--EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENEL 189
           ++Y       R  + + KL RT PYYKRN  HICSF+V+  CTRG ECPYRHE+P   EL
Sbjct: 117 LDYESFFDKARPTDAILKLQRTTPYYKRNCAHICSFYVREECTRGSECPYRHEMPVTGEL 176

Query: 190 SHQNIKDRYYG---TNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           S QNIKDRYYG    NDPVA K+L   K G   ++ PPED +I +L++ G+ D + E DL
Sbjct: 177 SQQNIKDRYYGYVDVNDPVAAKLLR--KAGEMPSLAPPEDMSIKTLYVGGLIDRVTEEDL 234

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           K   Y++GEI+S+ +V +  CAF+ + TR  AE+A D   + L I  + L++ W
Sbjct: 235 KVQSYSYGEIESIRMVRQRACAFVTYTTREGAEEAADHLANKLVI--NGLRLKW 286



>gi|406699966|gb|EKD03159.1| cell wall organization and biogenesis-related protein [Trichosporon
           asahii var. asahii CBS 8904]
          Length = 329

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 195/319 (61%), Gaps = 26/319 (8%)

Query: 7   KADPNKQGWGESEFPIL----------CETCLGDNPYVRMTRQGFGKECKVCSRPFTIFR 56
           K D NK     S+FPIL            T LG NPYVRM     G+ECK+C+RPFT+FR
Sbjct: 5   KQDINKTSSESSDFPILHVRSASTLLRLTTGLGPNPYVRME---MGQECKICNRPFTVFR 61

Query: 57  WLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREY 116
           W PG G R+KKTE+C TC+K+K VCQTCLLDL+Y LPVQVRD AL   N+AP  +IN++Y
Sbjct: 62  WNPGQGGRFKKTEVCTTCSKIKGVCQTCLLDLEYGLPVQVRDAALQRKNEAPTGDINKQY 121

Query: 117 FAQNIEGKI--SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRG 174
           + Q +E ++  SG     +   A++  REMLK LAR +P+YKRNRPH+CSFF KG C RG
Sbjct: 122 YIQQMERQMEESGDGMAYDSQAANAQAREMLKNLARNDPHYKRNRPHVCSFFAKGECKRG 181

Query: 175 DECPYRHEIPEENEL--SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSL 232
           D CP+RHE  E +    S Q+IKDRYYGTND  A+KIL     G    +  PEDK+IT+L
Sbjct: 182 DACPFRHEAAESSASGNSQQSIKDRYYGTNDAGAQKILR--AAGEAKGLKTPEDKSITTL 239

Query: 233 FITGVEDDIDEADLKGYFYAF-----GEIKSVVVVHKSRCAFINFATRASAEQAIDK--S 285
              G+    ++A       A       +++S+ +V  +  AF+NFA RASAE+A      
Sbjct: 240 LFLGLPSVGEDAVRTALHTAVPSVKPTDVRSISLVTANNVAFVNFADRASAEKAAGALGL 299

Query: 286 HSNLNIKEHDLKITWGRPR 304
              + I     K+ WGR R
Sbjct: 300 QDGIEIDGKKCKVVWGRAR 318



>gi|298710981|emb|CBJ32288.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 530

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 199/294 (67%), Gaps = 10/294 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           NK+ W ES+FPI+CETCLGDNPYVRMT++  GK CK+C RP+T+FRW  G   R K T++
Sbjct: 13  NKKAWEESDFPIVCETCLGDNPYVRMTKEPHGKACKICERPYTVFRWKAGTTGRIKSTQL 72

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN--DAPRSEINREYFAQNIEGKISGA 128
           CQTCAKLKN CQTC+LDLQY LPV+VRD  L   +  + P S+ NRE+  Q  E ++  A
Sbjct: 73  CQTCAKLKNACQTCVLDLQYGLPVEVRDKFLAEEDRLEVPGSDANREFMTQVHEKQL--A 130

Query: 129 ESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE-- 186
           E    Y  ++    + L ++AR+ PYYKRN+PH CSF+ KG C RG +CP+ HE+P +  
Sbjct: 131 EGGNPY--SNKPLNQKLLRMARSTPYYKRNQPHKCSFYAKGECNRGAKCPFLHEMPTDRA 188

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+HQNI+DR+YG +DPVA K++ R    +   + PPED+ I+SL++  + D I   DL
Sbjct: 189 DPLAHQNIRDRFYGQDDPVAAKMMARQD--DLPKLEPPEDEGISSLWLGNMADYITPEDL 246

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITW 300
           +  FY+FGE++S+ +V     AF+ F TR +AE A ++ +  L IK   L++ W
Sbjct: 247 RDAFYSFGELRSIRIVPGKDFAFVQFTTRQAAEAAAEQLYKCLVIKGRLLRLNW 300



>gi|507114399|emb|CDF37952.1| unnamed protein product [Chondrus crispus]
          Length = 440

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 194/321 (60%), Gaps = 29/321 (9%)

Query: 3   KMAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLP-GA 61
           K AA  +P        EFPILCETCLG NPY+RMTR  +G  CKVC RPFT FRW P G 
Sbjct: 5   KQAATGNPG------DEFPILCETCLGPNPYIRMTRHAWGNACKVCERPFTSFRWRPAGQ 58

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTND----APRSEINREYF 117
           G R KKTE+CQTCA+ KNVCQTCLLDLQY LPVQVRD +L   +      P+S+  REY 
Sbjct: 59  GTRPKKTEVCQTCARAKNVCQTCLLDLQYGLPVQVRDASLAPGDRQRAVVPQSDGTREYA 118

Query: 118 AQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDEC 177
           A   E  I  A  +++   A  +   + ++  RT P Y+RNR  +CSFF+KG+CTRG  C
Sbjct: 119 AAQSERAI--ATGIVDRVYAAPTVNSIAERAKRTAPKYERNRARVCSFFLKGTCTRGLYC 176

Query: 178 PYRHEIPEENE---LSHQNIKDRYYGTNDPVAKKILNRV------------KGGNGSNIT 222
           PYRHE PE++E   ++ QNI+DRYYG NDPVA KI   +            K G G+   
Sbjct: 177 PYRHEKPEKDEESGMAEQNIRDRYYGVNDPVAAKIFGNLGMSADGKQAVVSKRGGGAAAP 236

Query: 223 P-PEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQA 281
           P PED ++ SLFI GV+  +DE  L+  F     +  + V+     AF++FA RA+AE+A
Sbjct: 237 PVPEDGSVKSLFIGGVKPGVDEESLRQLFSGCARLSRMSVLTSRGIAFVDFADRAAAEEA 296

Query: 282 IDKSHSNLNIKEHDLKITWGR 302
           + + H   ++    + + W R
Sbjct: 297 MQRVHGAQDVNGCRVFVNWAR 317



>gi|399217792|emb|CCF74679.1| unnamed protein product [Babesia microti strain RI]
          Length = 339

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 198/314 (63%), Gaps = 20/314 (6%)

Query: 2   SKMAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA 61
           S     +D +++G   SEFP+LCETCLGDNP++RM ++  GKECK+C+RPFT+FRW PGA
Sbjct: 4   SGFGVISDAHRRGNEISEFPMLCETCLGDNPFIRMMKETCGKECKICARPFTLFRWKPGA 63

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTN-DAPRSEINREYFAQN 120
             RYK+T ICQ+CAK+KNVCQTCL DLQY LPVQVRD  LN    D P S++N +YFA  
Sbjct: 64  KARYKQTIICQSCAKIKNVCQTCLFDLQYGLPVQVRDQVLNHDKLDVPTSKVNSDYFANQ 123

Query: 121 IE-GKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPY 179
           +E      + SLI      +  R  L KLA+  PYY+RN P +C+F++KG C RG ECPY
Sbjct: 124 LEKNSQQNSTSLIK-----AEARSSLNKLAKLAPYYRRNMPRVCTFWLKGECNRGAECPY 178

Query: 180 RHEIPEEN-ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE 238
            HE  E +  +++QNI+DRY G  D +A KIL + +      +  P DKTIT+L ++G+ 
Sbjct: 179 AHEKYEHDPTIANQNIRDRYVGDKDVLADKILRQHEINKA--LQAPSDKTITTLCVSGLA 236

Query: 239 DDID----------EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSN 288
             +           E +L+ +F  +G++ S+ ++ K  CAFI F  R+ AEQA   S   
Sbjct: 237 GKVKDPESSKLIVGEDNLQTHFSKYGKVASIKLIPKLACAFITFDRRSDAEQAAFHSRKG 296

Query: 289 LNIKEHDLKITWGR 302
           L ++   L ITW R
Sbjct: 297 LELESIPLNITWAR 310



>gi|388855259|emb|CCF51153.1| related to Cell cycle control protein cwf5 [Ustilago hordei]
          Length = 330

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 190/305 (62%), Gaps = 12/305 (3%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           G  E+E PILCE CLG NPY+RMT+   GK CKVC+RPFT+FRW  GAG R+KKTEIC T
Sbjct: 16  GAEEAETPILCEACLGPNPYIRMTKDSQGKICKVCTRPFTVFRWNSGAGSRFKKTEICTT 75

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAESLIN 133
           CAK+KNVCQTC+LDLQY LPVQVRD AL + +  P S+ NREYFA+ ++ ++ G  SL+ 
Sbjct: 76  CAKVKNVCQTCILDLQYGLPVQVRDAALGIKSGGPTSDKNREYFAETMDKQLEGPTSLVG 135

Query: 134 YGK--ADSSGREMLKKLARTEPYYKRNRP-HICSFFVKGSCTRGDECPYRHEIPEENELS 190
                A  +G+E+L+K AR E  YKR+RP   CS F +G+C RG+ CP++HE+P E   +
Sbjct: 136 SSSSPAGRAGQELLRKAARKEIGYKRDRPQQYCSAFARGNCPRGESCPFKHELPSEKHFA 195

Query: 191 HQNIKDRYYGTNDPVAKKILNR---VKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK 247
            Q +       +             +   + + + PPED ++ SLF++ + +   E  LK
Sbjct: 196 PQTVASTSTAPSSAATLPAPAAARIISKQSATGLPPPEDTSVISLFVSSLPESATETPLK 255

Query: 248 GYFYAF------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWG 301
            +F +         IKS+ +V  S+CAF+NF TR  AE A       + + + ++++TWG
Sbjct: 256 EWFLSLTPQLHADHIKSITLVTASKCAFVNFRTRQQAELAAKHCSPKMTMGDKEVRLTWG 315

Query: 302 RPRPT 306
           R RP+
Sbjct: 316 RSRPS 320



>gi|452820260|gb|EME27305.1| pre-mRNA-splicing factor RBM22/SLT11 [Galdieria sulphuraria]
          Length = 366

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 140/313 (44%), Positives = 198/313 (63%), Gaps = 19/313 (6%)

Query: 2   SKMAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLP-G 60
           +K     DP K     ++FPILCE+CLG NPY+RM +   G EC++C+RPFT FRW P G
Sbjct: 8   AKGGISGDPKKAATESADFPILCESCLGPNPYIRMLKDSMGAECQICTRPFTCFRWKPGG 67

Query: 61  AGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL----NVTNDAPRSEINREY 116
           AG RYKKTEICQTCA+LKNVCQTCL DL+Y LPVQVRD A+     +    P+S+INREY
Sbjct: 68  AGTRYKKTEICQTCARLKNVCQTCLFDLRYGLPVQVRDQAIAEGDRLATLVPKSDINREY 127

Query: 117 FAQNIEGKISGAESLINYGKADSSGRE-----MLKKLARTEPYYKRNRPHICSFFVKGSC 171
           FA+        A+ L+  G  ++  ++     +++KLAR EP Y RN  H+CSF+ KG C
Sbjct: 128 FAEQ-------ADRLVATGNVEAVYQQPATNPIVEKLARKEPRYHRNLSHVCSFYQKGEC 180

Query: 172 TRGDECPYRHE-IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTIT 230
            RG  CPYRHE  P++ +L+ Q IK+RYYG NDP+A+K+L R+ G   S   PP D    
Sbjct: 181 KRGALCPYRHERAPDDEQLTTQGIKNRYYGVNDPLAEKMLRRL-GEKTSFPEPPTDPKAK 239

Query: 231 SLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLN 290
           +LF+ GV   +   ++   F  +GEI+++ V+ +   AFI F  R +AE+ ++  +  ++
Sbjct: 240 TLFVGGVGSLVSYEEIAQLFEKYGEIENIKVIREKSIAFIEFKERIAAERTMETLYGKVH 299

Query: 291 IKEHDLKITWGRP 303
           +    + + W +P
Sbjct: 300 LGGQKVFLNWAKP 312



>gi|239792619|dbj|BAH72632.1| ACYPI009745 [Acyrthosiphon pisum]
          Length = 233

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 163/205 (79%), Gaps = 5/205 (2%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W +S+FPI+CETCLGD+PY+RM ++ +GKEC+VC+RPFT+FRW PGA MR+KKTEI
Sbjct: 11  NRQNWEDSDFPIVCETCLGDSPYLRMAKEKYGKECEVCARPFTVFRWCPGARMRFKKTEI 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCA+L+N CQTCLLDL+Y LP+QVRD AL +    P+S++N+EYF QN++ +++  + 
Sbjct: 71  CQTCARLRNACQTCLLDLEYGLPLQVRDAALKIKEQIPKSDVNKEYFVQNMDSELAKMDE 130

Query: 131 LINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENE 188
               G    +  ++L K+AR  PYY+RNRPHICSF+VKG C RG+ECPYRHE P   E+ 
Sbjct: 131 A---GGKCQNASDVLAKMARKAPYYERNRPHICSFWVKGECRRGEECPYRHERPTDPEDP 187

Query: 189 LSHQNIKDRYYGTNDPVAKKILNRV 213
           LS+QN KDRYYG NDPVA+K++NR 
Sbjct: 188 LSNQNFKDRYYGVNDPVAEKMMNRA 212



>gi|443896563|dbj|GAC73907.1| predicted RNA-binding protein [Pseudozyma antarctica T-34]
          Length = 372

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 142/311 (45%), Positives = 195/311 (62%), Gaps = 24/311 (7%)

Query: 17  ESEFPILCETCLGDNPYVRMTRQGFGKECK------VCSRPFTIFRWLPGAGMRYKKTEI 70
           ++E PILCE CLG NPY+RMT+   GK CK      +C+RPFT+FRW PGAG R+KKTEI
Sbjct: 63  DAETPILCEPCLGPNPYIRMTKDTQGKICKELVDLQICTRPFTVFRWNPGAGSRFKKTEI 122

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           C TCAK+KNVCQ C+LDLQY LPVQ+RD ALN+ +  P S+ NREY+A+N++ ++ GA S
Sbjct: 123 CTTCAKVKNVCQACILDLQYGLPVQMRDAALNIKSTGPTSDKNREYYAENMDKQLEGATS 182

Query: 131 LINYGK--ADSSGREMLKKLARTEPYYKRNRP-HICSFFVKGSCTRGDECPYRHEIPEEN 187
           L+      A  +G+E+LKK+AR EP YKR+RP   C+ F +G+C RGD+CP+RHE+P E+
Sbjct: 183 LVGASSSPAGRAGQELLKKMARKEPEYKRDRPVQFCAAFARGNCPRGDKCPFRHELPSED 242

Query: 188 ELSHQNIKDRYYGTNDPVA------KKILNRVKGGNGSNITPPEDKTITSLFITGVEDDI 241
            L                A      K+IL+       + + PP D +I SLFI+ +  D 
Sbjct: 243 ALPFAAPATAATPPAPASAAATGTPKRILS---SSTAAGLPPPADTSIVSLFISSLPADT 299

Query: 242 DEADLKGYFYAFG------EIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
            +  L+ +  A         IKS+ +V  SRCAF+NF +R +AE+A       ++     
Sbjct: 300 TQDSLRSWMTALAPELRTEHIKSITLVTASRCAFVNFTSRQNAERAAAHCSPKMDWDNTT 359

Query: 296 LKITWGRPRPT 306
           ++ITWGR RPT
Sbjct: 360 VRITWGRSRPT 370



>gi|401887387|gb|EJT51375.1| cell wall organization and biogenesis-related protein [Trichosporon
           asahii var. asahii CBS 2479]
          Length = 330

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 185/289 (64%), Gaps = 16/289 (5%)

Query: 27  CLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLL 86
           CLG NPYVRM     G+ECK+C+RPFT+FRW PG G R+KKTE+C TC+K+K VCQTCLL
Sbjct: 36  CLGPNPYVRME---MGQECKICNRPFTVFRWNPGQGGRFKKTEVCTTCSKIKGVCQTCLL 92

Query: 87  DLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI--SGAESLINYGKADSSGREM 144
           DL+Y LPVQVRD AL   N+AP  +IN++Y+ Q +E ++  SG     +   A++  REM
Sbjct: 93  DLEYGLPVQVRDAALQRKNEAPTGDINKQYYIQQMERQMEESGDGMAYDSQAANAQAREM 152

Query: 145 LKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENEL--SHQNIKDRYYGTN 202
           LK LAR +P+YKRNRPH+CSFF KG C RGD CP+RHE  E +    S Q+IKDRYYGTN
Sbjct: 153 LKNLARNDPHYKRNRPHVCSFFAKGECKRGDACPFRHEAAETSASGNSQQSIKDRYYGTN 212

Query: 203 DPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAF-----GEIK 257
           D  A+KIL     G    +  PEDK+IT+L   G+    ++A       A       +++
Sbjct: 213 DAGAQKILR--AAGEAKGLKTPEDKSITTLLFLGLPSVGEDAVRTALHTAVPSVKPTDVR 270

Query: 258 SVVVVHKSRCAFINFATRASAEQAIDK--SHSNLNIKEHDLKITWGRPR 304
           SV +V  +  AF+NFA RASAE+A         + I     K+ WGR R
Sbjct: 271 SVSLVTANNVAFVNFADRASAEKAAGALGLQDGIEIDGKKCKVVWGRAR 319



>gi|332028626|gb|EGI68661.1| Pre-mRNA-splicing factor RBM22 [Acromyrmex echinatior]
          Length = 392

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 198/317 (62%), Gaps = 44/317 (13%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+Q W ++EFPILC+TCLGDNPY+RMT                                 
Sbjct: 11  NRQNWEDAEFPILCQTCLGDNPYIRMT--------------------------------- 37

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
              C++LKNVCQTCLLDL+Y LP+QVRD AL + +D PRS++N+EY+ QNI+ +I   + 
Sbjct: 38  ---CSRLKNVCQTCLLDLEYGLPIQVRDAALKIKDDLPRSDVNKEYYVQNIDNEIGKIDP 94

Query: 131 LINYGKA--DSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--E 186
               G     ++  ++L KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P   +
Sbjct: 95  TTPAGAVGKSAAASDLLMKLARTSPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPD 154

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA K++ R        + PPEDK+IT+L+I  + D + E  L
Sbjct: 155 DPLADQNIKDRYYGVNDPVADKLMRRAAA--MPKLDPPEDKSITTLYIGNLGDVLTEKQL 212

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + +FY +GEI+SV +V + +CAFI +  R++AE A +++ + L +    L I WGR +  
Sbjct: 213 RDHFYQYGEIRSVTMVPRQQCAFIQYTQRSAAEAAAERTFNKLILGGRRLTIKWGRSQ-- 270

Query: 307 GPKTEVQAATTQNVVLP 323
           G +T   A  T+ ++ P
Sbjct: 271 GRQTVSAAEATREILEP 287



>gi|308804982|ref|XP_003079803.1| RRM-containing RNA-binding protein-like (ISS) [Ostreococcus tauri]
 gi|116058260|emb|CAL53449.1| RRM-containing RNA-binding protein-like (ISS) [Ostreococcus tauri]
          Length = 380

 Score =  281 bits (718), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 157/377 (41%), Positives = 220/377 (58%), Gaps = 33/377 (8%)

Query: 10  PNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTE 69
           P+ +  G+ +FP++CE CLG NPYVRM +   G EC +  RPF ++RW PG+  RYKKT 
Sbjct: 3   PDDEDAGK-DFPVVCEDCLGPNPYVRMMKIPRGSECAISGRPFDVYRWRPGSDARYKKTV 61

Query: 70  ICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVT--NDAPRSEINREYFAQNIEGKISG 127
           +C+  A  KNVCQ CLLDL Y +PV  RD AL     N  P S +NR++    I  K+  
Sbjct: 62  VCKEIALAKNVCQVCLLDLDYGIPVAARDAALGRAGGNALPSSSVNRDFAVNAIAKKLDE 121

Query: 128 AESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR------- 180
            E    +G+ + +  E+L +LAR +PYY +N+  IC+F+++ +CTR D CPYR       
Sbjct: 122 GEDAYEHGEKERNN-ELLMRLARKKPYYNKNKSPICTFWLRNACTRND-CPYRPCNGDTN 179

Query: 181 -HEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGG-NGSNITPPEDKTITSLFITGVE 238
             E+    EL  QNIKDRY+GTNDPVA ++L R K       +TPPED +IT+LFI  V+
Sbjct: 180 MPELSAAPELRKQNIKDRYFGTNDPVADQMLKRAKEKMENRKLTPPEDTSITTLFIGNVD 239

Query: 239 -DDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLK 297
            + ++E D++G FY +G+IKS+ V+   +CAFI F +RA AE+A + +  NL I     +
Sbjct: 240 PERVNEDDIRGRFYRYGDIKSIRVIGNKKCAFITFTSRAGAEKAAEDAAFNLEINGVQCR 299

Query: 298 ITWGR---PRPTGPK--TEVQAATTQNV---VLPPLES---------MQIPAP-PGEAPS 339
           + WG+    + TG K  T   A T   +   V PP +          M IP P P    +
Sbjct: 300 LQWGKVMEKKSTGDKGPTPSPAPTVMMMAPGVAPPADGTNPADLPSHMAIPMPAPSAVGA 359

Query: 340 DFLYPSQDPTYQGSSTK 356
              YPSQDPT  G+ +K
Sbjct: 360 KVAYPSQDPTAMGAISK 376



>gi|255641757|gb|ACU21149.1| unknown [Glycine max]
          Length = 215

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 161/208 (77%), Gaps = 5/208 (2%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW   +FPI+CE+CLGD+PYVRMTR  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DHEADGWERPDFPIICESCLGDSPYVRMTRAEYDKECKICTRPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKI- 125
           EICQTC+KLKNVCQ CLLDL+Y LPVQVRDTALN+ ++DA P+S++NREYFA+  + +  
Sbjct: 68  EICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALNIDSHDAIPKSDVNREYFAEEHDRRAR 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
           +G +   +YGK   +  + + KL RT PYYKRNR HICSF+++G CTRG ECPYRHE+PE
Sbjct: 128 AGIDYESSYGKVRPN--DTILKLQRTTPYYKRNRAHICSFYIRGECTRGAECPYRHEMPE 185

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRV 213
             EL  QNIKDRYYG NDPVA K+L + 
Sbjct: 186 TGELPQQNIKDRYYGVNDPVALKLLGKA 213



>gi|145347969|ref|XP_001418431.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578660|gb|ABO96724.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 386

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 210/372 (56%), Gaps = 40/372 (10%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           EFP++CE CLG NPYVR+ +   G EC +  RPFT+FRW PG   RYKKT +C+  A+ K
Sbjct: 15  EFPVVCEDCLGPNPYVRVQKMPLGGECAISGRPFTVFRWRPGNEARYKKTVVCKEIAQAK 74

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDA--PRSEINREYFAQNIEGKIS-GAESLINYG 135
           NVCQ CLLDL Y +PV  RD AL     +  P S +NR++    I  K+  G ++    G
Sbjct: 75  NVCQVCLLDLDYGIPVAARDAALGRAGGSALPSSSVNRDFAVNEIAKKLDEGEDAYEKDG 134

Query: 136 KADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR--------HEIPEEN 187
           K  ++  E+L +LAR +PYY +N+  IC+F+++ +CTR D CPYR         E+    
Sbjct: 135 KEKNN--ELLMRLARKKPYYNKNKTPICTFWLRNACTRND-CPYRPCNGDTHMPELSAAP 191

Query: 188 ELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE-DDIDEADL 246
           EL  QNIKDRY+GTNDPVA+++L R K      +TPPED +IT+LF+ GV+ + + E D+
Sbjct: 192 ELRKQNIKDRYFGTNDPVAEQMLKRAKERPSQKLTPPEDASITTLFVGGVDPEKVTEDDI 251

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR---- 302
              FY +GEIK + V+   +CAFI FATR  AE+A + +  NL I     ++ WG+    
Sbjct: 252 NSRFYQYGEIKGIRVIGTKKCAFITFATREGAEKAAEDAAINLEINGERCRLQWGKSAAK 311

Query: 303 -----------PRPT----GPKTEVQAATTQNVVLPP--LESMQIPAP-PGEAPSDFLYP 344
                      P PT     P  E   A      LPP     + IP P P        YP
Sbjct: 312 KASGNQGSAPAPPPTVMMMAPGVE---APANGQALPPDMPAHVAIPMPAPAAVGHATKYP 368

Query: 345 SQDPTYQGSSTK 356
           S DP+  G+ +K
Sbjct: 369 SMDPSQMGAVSK 380



>gi|345569666|gb|EGX52531.1| hypothetical protein AOL_s00043g25 [Arthrobotrys oligospora ATCC
           24927]
          Length = 354

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/364 (40%), Positives = 202/364 (55%), Gaps = 30/364 (8%)

Query: 4   MAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGM 63
           M  KAD N+ G   ++FP +CE CL +NPYV+M ++ +G ECK+C+RPFT+F+WLP    
Sbjct: 1   MPPKADINRSGSESTDFPSVCENCLPENPYVQMIKENYGAECKICTRPFTVFKWLPDRNS 60

Query: 64  RYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEG 123
           RYKKT IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P SEIN++Y+AQN E 
Sbjct: 61  RYKKTNICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKLVAQGPSSEINKQYYAQNTEN 120

Query: 124 KISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEI 183
           K+   +    Y K DS+ R++LK+LA +EPYYKR R +     +      G         
Sbjct: 121 KLIEGQIPEEYEKTDSAARDLLKRLATSEPYYKRPRRNRDDGGIANKIGPGPVRTRGSGG 180

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDE 243
                     I+      N P A ++          +  PP D++ITSLF+ GVEDD+ E
Sbjct: 181 DRGRGGHKGPIR------NFPSAAQL-----PPGPQDTEPPADRSITSLFLLGVEDDLAE 229

Query: 244 ADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRP 303
             ++ +F AFG+I+S+V VH SRCAF+NF TRA AE A +       I    L+I WG+P
Sbjct: 230 HAIRTFFSAFGQIRSIVCVHHSRCAFVNFHTRAGAEAAAESCQGKAIIAGCPLRIMWGKP 289

Query: 304 RPTGP--KTEVQAATTQNVVL----------------PPLESMQIP-APPGEAPSDFLYP 344
           RP G   +T++ A    +                   P   S+    APPG   S FLYP
Sbjct: 290 RPLGSMDRTQIMAIAKASPKASSSSVANNGEPNSDSNPTAMSLNTTLAPPGSEESGFLYP 349

Query: 345 SQDP 348
           SQ P
Sbjct: 350 SQRP 353



>gi|325193318|emb|CCA27661.1| conserved unknown protein putative [Albugo laibachii Nc14]
          Length = 280

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/219 (57%), Positives = 156/219 (71%), Gaps = 20/219 (9%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           KADP K  W   +FP LCETCLGDNPY+RM ++ FG+ CK+C RPFT+FRW PG   RYK
Sbjct: 9   KADPTKSAWESEDFPQLCETCLGDNPYIRMMKESFGQACKICERPFTVFRWKPGKRTRYK 68

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTND-----APRSEINREYFAQN- 120
           KTEICQTCA+LKNVCQTC+LDL YNLPVQVRD  L   N       P SE NRE+FAQ  
Sbjct: 69  KTEICQTCARLKNVCQTCVLDLAYNLPVQVRDAFLASENGQARMAVPESEANREWFAQQH 128

Query: 121 -----IEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGD 175
                 EGK+S  +++       +     L +LAR EP+Y RNRPH+CSFF +G CTRG+
Sbjct: 129 NRMLEQEGKVSAYDTM-------NGTNGTLVQLARKEPHYDRNRPHLCSFFARGECTRGE 181

Query: 176 ECPYRHEIPEE--NELSHQNIKDRYYGTNDPVAKKILNR 212
           ECPY HE+P++  + LSHQNI+DR++G NDPVA+ +LNR
Sbjct: 182 ECPYLHELPKDKNDPLSHQNIRDRFHGQNDPVAESMLNR 220



>gi|255073423|ref|XP_002500386.1| predicted protein [Micromonas sp. RCC299]
 gi|226515649|gb|ACO61644.1| predicted protein, partial [Micromonas sp. RCC299]
          Length = 312

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 191/309 (61%), Gaps = 15/309 (4%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           DP   GW  ++FPI+CE CLG NPY+RM R+ +  EC + SRPFT+FRW PG   RYKKT
Sbjct: 3   DPEADGWERTDFPIVCEDCLGPNPYIRMQREDYAAECAISSRPFTVFRWRPGNEARYKKT 62

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDA-PRSEINREYFAQNIEGKISG 127
            +C+  A  KNVCQ CLLDL Y +PVQ RD  L    +   +S++N EY  + I  ++  
Sbjct: 63  VVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGKEREMIAKSDVNLEYQTEQIARRLEE 122

Query: 128 AESLINYGKADSSGR----EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR--- 180
            + +    +  + G+    E+L+K+AR +PYY +N+  IC+F+++ +CTR D CPYR   
Sbjct: 123 GDEVAIRDQNRAVGKVRAAELLQKMARKKPYYNKNKAPICTFWLRNACTRAD-CPYRPCN 181

Query: 181 ---H--EIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFIT 235
              H  E+    EL  QNIKDRYYG NDPVA ++L +    +  ++ PP D++IT+L++ 
Sbjct: 182 GDTHMPELTSAPELRQQNIKDRYYGINDPVANRMLAKA-NESKQDLAPPADESITTLYVG 240

Query: 236 GVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHD 295
           G++D + E  LK  FY +G+I SV  ++   CAF+ F  RA AE+A ++  S   I   +
Sbjct: 241 GIDDRVTEDALKDAFYQYGQISSVRTLYAKNCAFVTFVDRAGAEKAAEECGSRKAISGIN 300

Query: 296 LKITWGRPR 304
            +I WG+ +
Sbjct: 301 ARIMWGKSK 309



>gi|125557962|gb|EAZ03498.1| hypothetical protein OsI_25637 [Oryza sativa Indica Group]
          Length = 254

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 151/196 (77%), Gaps = 7/196 (3%)

Query: 9   DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKT 68
           D    GW  S+FPI+CE+CLGDNPYVRM R  + KECK+C+RPFT+FRW PG   RYKKT
Sbjct: 8   DAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGRDARYKKT 67

Query: 69  EICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDA-PRSEINREYFAQNIEGKIS 126
           EICQTC KLKNVCQ CLLDL+Y LPVQVRDTAL+  +NDA PRS++NREYFA+  + +  
Sbjct: 68  EICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSTNSNDAIPRSDVNREYFAEEHDRR-- 125

Query: 127 GAESLINYGKADSSGR--EMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIP 184
            A + I+Y  ++   R  + + KL RT PYYKRNR H+CSF+V+G CTRG ECPYRHE+P
Sbjct: 126 -ARAGIDYDSSNGKARANDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYRHEMP 184

Query: 185 EENELSHQNIKDRYYG 200
           E  ELS QNIKDRYYG
Sbjct: 185 ETGELSQQNIKDRYYG 200



>gi|465795589|emb|CCV00079.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 312

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 167/239 (69%), Gaps = 8/239 (3%)

Query: 14  GWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQT 73
           G  +++ P+LCETCLG NPYVRM++Q  GKECKVC RPFT+FRW PG+GMR+KKTEIC T
Sbjct: 47  GTADADTPLLCETCLGPNPYVRMSKQHQGKECKVCGRPFTVFRWNPGSGMRFKKTEICTT 106

Query: 74  CAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISG--AESL 131
           CAKLKNVCQ+C+LDL+Y+LP QVRD AL  +   P S+INR+YF   ++  + G   E+ 
Sbjct: 107 CAKLKNVCQSCILDLEYHLPTQVRDAALGTSVKIPMSDINRQYFVNRMDALLDGTSTEAT 166

Query: 132 INYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEENELSH 191
            +      +G ++LKKLA  EP YKRNRP +CSF+ +G+CTRG+ CPYRH++P       
Sbjct: 167 TSLVGPSRAGHDLLKKLANHEPDYKRNRPLVCSFYARGACTRGEACPYRHDMPSSTT--- 223

Query: 192 QNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYF 250
             ++ RY+G +D  A+ IL +V G    ++ PP +  I SLF +G+  D+DEA L+ + 
Sbjct: 224 STVQSRYHGHDDAGARHILKKVAGAK--HLEPPTNPEIKSLFFSGLP-DMDEAQLRAFL 279



>gi|323508215|emb|CBQ68086.1| related to Cell cycle control protein cwf5 [Sporisorium reilianum
           SRZ2]
          Length = 315

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 182/298 (61%), Gaps = 18/298 (6%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           E PILCE CLG NPY+RMT+   GK CKVC+RPFT+FRW PGAG R+KKTEIC TCAK K
Sbjct: 16  ETPILCEACLGPNPYIRMTKDSQGKICKVCTRPFTVFRWNPGAGSRFKKTEICTTCAKAK 75

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAESLINYGKAD 138
           NVCQTC+LDLQY LPVQVRD AL V    P S+  ++Y A  +E ++ GA S +  G + 
Sbjct: 76  NVCQTCILDLQYGLPVQVRDAALGVKTSTPTSDKVKKYTADVMERQLEGATSSV--GSSS 133

Query: 139 SSGREMLKKLARTEPYYKRNRP-----HICSFFVKGSCTRGDECPYRHEIPEENELSHQN 193
            +G+E+L+K AR E  YKR+RP      +CS F +G C RGD CP++HE+P ++ L    
Sbjct: 134 RAGQELLRKAARKEIEYKRDRPAASSQKLCSAFARGHCERGDACPFKHELPTDDALLGAQ 193

Query: 194 IKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAF 253
                       A      +K  +   + PP+D T+ SLF + +  D  +A L+ +F   
Sbjct: 194 APSPSA-----PAAPSPKPIKPTSPPGLAPPQDTTVLSLFTSSLPADTTDASLRQFFLDL 248

Query: 254 ------GEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
                  +IKS+ +V  S+CAF+NF TR  AE A  +    +   + ++++TWGR RP
Sbjct: 249 TPQLHRDDIKSITLVPASKCAFVNFRTRQHAELAALQCAPKMLWGDSEVRVTWGRSRP 306



>gi|312380972|gb|EFR26830.1| hypothetical protein AND_06808 [Anopheles darlingi]
          Length = 401

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 171/269 (63%), Gaps = 44/269 (16%)

Query: 38  RQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVR 97
           ++ +GKECK+C+RPFTIFRW PGA MR+KKTEICQTC+KLKNVCQTCLLDL+Y LP QVR
Sbjct: 22  KERYGKECKICTRPFTIFRWCPGARMRFKKTEICQTCSKLKNVCQTCLLDLEYGLPTQVR 81

Query: 98  DTALNVTNDAPRSEINREYFAQNIEGKI-SGAESLINYGKADSS--GREMLKKLARTEPY 154
           D AL + +  P S++N+E++ QNIE ++ +G ++ +  G    S    +ML KLART PY
Sbjct: 82  DAALKIQDKIPESDVNKEFYIQNIEAQLKAGGDNTVAAGTVGKSLAASDMLAKLARTAPY 141

Query: 155 YKRNRPHICSFFVKGSCTRGDECPYRHEIPEE--NELSHQNIKDRYYGTNDPVAKKILNR 212
           YKRN PHICSF+VKG C RG+ECPYRH+ P E  + LS QNI+DRYYG NDPV       
Sbjct: 142 YKRNLPHICSFWVKGECKRGEECPYRHDKPVEPDDPLSEQNIRDRYYGRNDPV------- 194

Query: 213 VKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINF 272
                                           D++  FY +GEI+SV +V + +CAF+ +
Sbjct: 195 --------------------------------DIRDNFYHYGEIRSVSLVPRQQCAFVQY 222

Query: 273 ATRASAEQAIDKSHSNLNIKEHDLKITWG 301
             RA+AE A +K+ + L +    L I W 
Sbjct: 223 TKRAAAELAAEKTFNKLVLGGKKLTIKWA 251



>gi|71004296|ref|XP_756814.1| hypothetical protein UM00667.1 [Ustilago maydis 521]
 gi|74704464|sp|Q4PGU6.1|SLT11_USTMA RecName: Full=Pre-mRNA-splicing factor SLT11
 gi|46095602|gb|EAK80835.1| hypothetical protein UM00667.1 [Ustilago maydis 521]
          Length = 324

 Score =  263 bits (673), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 194/307 (63%), Gaps = 24/307 (7%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           E PILCE+CLG NPY+RMT+   GK CKVC+RPFT+FRW PGAG R+KKTEIC TCAK+K
Sbjct: 9   ETPILCESCLGPNPYIRMTKDPRGKSCKVCTRPFTVFRWNPGAGSRFKKTEICATCAKVK 68

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDA--PRSEINREYFAQNIEGKISGAESLINYGK 136
           NVCQTC+LDLQY LPVQVRD AL + +DA    S+  + YFA  +E ++         G 
Sbjct: 69  NVCQTCILDLQYGLPVQVRDAALGIKSDAGPTSSDKAKAYFADTMEKQLEA-----TVGS 123

Query: 137 ADSSGREMLKKLARTEPYYKRNRP----HICSFFVKGSCTRGDECPYRHEIPEENEL--- 189
           +  +G+E+++K AR E  YKR+RP     +CS F +G C RGD CP++H++P +++L   
Sbjct: 124 SSRAGQELVRKAARREIDYKRDRPVQSQKLCSAFARGRCERGDSCPFKHQLPTDDQLPGL 183

Query: 190 -SHQNIKDRYYGTNDPVAKKILNRVKGGNGSNI--TPPEDKTITSLFITGV-EDDIDEAD 245
               NI   Y  T+   +K+ + ++   + S++   PP D ++ SLFI+ +  + ++E  
Sbjct: 184 QPSSNINYPYSPTSSSPSKQAVAKILTSSTSSVGLPPPSDASVRSLFISNLPPEHLEEPS 243

Query: 246 LKGYFYAFG------EIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
           ++ +F          +IKS+ +V  S CAF+NFATR  AE A  +    + + + ++++ 
Sbjct: 244 IRQFFLDLAPPLQAQDIKSITLVRASNCAFVNFATRDHAELAARRCEPKMRLGDKEIRLM 303

Query: 300 WGRPRPT 306
           WGR RP 
Sbjct: 304 WGRSRPV 310



>gi|81177562|ref|XP_723726.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gi|23478116|gb|EAA15291.1| putative RNA-binding protein [Plasmodium yoelii yoelii]
          Length = 393

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 177/295 (60%), Gaps = 13/295 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           + D  KQG+  S+ PILCETCLG+NPYVR+ R+  GKECK+C   FT+FRW PG   RYK
Sbjct: 9   RGDVKKQGYENSDLPILCETCLGENPYVRIIREENGKECKICKNAFTLFRWKPGHNARYK 68

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           +T IC  CAK+KNVCQTCL DL+YNLPVQVRD  L  +   P +E NR +F + +E  IS
Sbjct: 69  QTIICNKCAKVKNVCQTCLFDLEYNLPVQVRDKFLETSITLPENETNRNFFLEQLENNIS 128

Query: 127 -GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIP 184
                 IN+G  D      L KL R +PY+KRN   +CSF+ K +C RGDECPY H EI 
Sbjct: 129 TDTYDKINHGNMD------LSKLKRRDPYFKRNMARVCSFWRKNACNRGDECPYLHKEIH 182

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
               L+ QNIK RY G ND +A+ ILNR K  N       E      + I G+ +     
Sbjct: 183 LNKSLASQNIKSRYTGENDVLAETILNRYKNNNID-----EKNMANKICIQGISNSTRVE 237

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
           ++K  F  FGEIKS  ++ K    FI++AT  +A+ A +K    L +   +L +T
Sbjct: 238 NIKECFKKFGEIKSFKMIPKDSKIFISYATLTAAKNAAEKYKDGLELNGSNLTVT 292



>gi|402579051|gb|EJW73004.1| zinc finger protein [Wuchereria bancrofti]
          Length = 203

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 148/193 (76%), Gaps = 6/193 (3%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N++ W +SEFPILC+TCLG NPY+RM +   G ECK+C RPFT FRW+PG GMRYKKTE+
Sbjct: 11  NRKTWEDSEFPILCQTCLGSNPYIRMLKDRHGAECKICQRPFTCFRWMPGKGMRYKKTEV 70

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAES 130
           CQTCAK+KNVCQTCLLDL++ LPVQVRD AL + +D PR   NR+Y+ QN E +++  + 
Sbjct: 71  CQTCAKMKNVCQTCLLDLEFGLPVQVRDHALQIHDDLPRQGANRDYYIQNQERELALTDG 130

Query: 131 LINYGK----ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE- 185
               G      DS+  ++LKKLAR +PYY+RN+PHICSFFVKG C RG+ECPYRHE P  
Sbjct: 131 TTPGGALAKITDSASNDLLKKLARNQPYYQRNKPHICSFFVKGECRRGEECPYRHEKPSD 190

Query: 186 -ENELSHQNIKDR 197
            ++ LSHQN++DR
Sbjct: 191 PDDPLSHQNMRDR 203



>gi|224001676|ref|XP_002290510.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220973932|gb|EED92262.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
          Length = 301

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 184/303 (60%), Gaps = 32/303 (10%)

Query: 5   AAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMR 64
           A K D NKQ W E+EFP++CETCLGDNPYVRMT++  GK+CK+C  PFT+F W  G   R
Sbjct: 3   AIKKDDNKQKWEETEFPLVCETCLGDNPYVRMTKEAHGKKCKICDVPFTVFAWQAGTRGR 62

Query: 65  YKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL------NVTNDAPRSEINREYFA 118
            KK EIC+TCA+ KNVCQ C+ DLQY LPVQVRD  L      +     P+S+ NR +  
Sbjct: 63  LKKVEICRTCARSKNVCQVCIYDLQYGLPVQVRDRILAEEGSRDAVVAVPQSDANRAWMT 122

Query: 119 QNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECP 178
              E  I   +++      +S+    L+ +AR EP Y+RN P +CSFF KG C RG  CP
Sbjct: 123 AQQERDIELGKNIQGCVPTNSAAAMKLQSMARMEPRYERNLPKLCSFFAKGECNRGSLCP 182

Query: 179 YRHEIPEE--NELSHQNIKDRYYGTNDPVAKKILNRVK-------------GGNGSNITP 223
           +RHE+P++  + L+ QN KDR++GTNDPVA  ++ R K             GG G     
Sbjct: 183 FRHEMPKDRNDPLAKQNTKDRFFGTNDPVAAGMIQRQKDKAEARRAELKARGGEG----- 237

Query: 224 PEDKTITSLFI----TGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAE 279
            +++ +++L++     G +  I EA+++  FY+FGEI S V +H  + AF+ F T  + E
Sbjct: 238 -DERAVSTLYVRFTEEGSQRRITEAEVRDKFYSFGEISS-VRMHADKGAFVEFTTPQATE 295

Query: 280 QAI 282
            AI
Sbjct: 296 HAI 298



>gi|124806921|ref|XP_001350866.1| RNA binding protein, putative [Plasmodium falciparum 3D7]
 gi|75015306|sp|Q8I4V2.1|RBM22_PLAF7 RecName: Full=Pre-mRNA-splicing factor PFL2310w; AltName:
           Full=Pre-mRNA-splicing factor RBM22 homolog
 gi|23496995|gb|AAN36546.1| RNA binding protein, putative [Plasmodium falciparum 3D7]
          Length = 357

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/281 (47%), Positives = 182/281 (64%), Gaps = 14/281 (4%)

Query: 6   AKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRY 65
            ++D  KQG+ +S  PILCETCLG+NPYVR+ R+  GKECK+C   FT FRW PG   RY
Sbjct: 8   VRSDIKKQGYEDSNLPILCETCLGENPYVRIIREENGKECKICKNVFTHFRWKPGENSRY 67

Query: 66  KKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI 125
           K+T IC  CAK+KNVCQTCL DLQYNLPVQVRD  L  +   P +E NR +F + +E  +
Sbjct: 68  KQTVICMKCAKVKNVCQTCLFDLQYNLPVQVRDKFLENSIVLPENETNRNFFLEQMENDM 127

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIP 184
           S     +N    D      L KL R +PY+KRN   +CSF+ K SC RGDECPY H EI 
Sbjct: 128 SSTYDKMNRINMD------LSKLKRRDPYFKRNMARVCSFWRKNSCNRGDECPYLHKEIH 181

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITS-LFITGVEDDIDE 243
            +  LS+QNIK+RY G ND +A+KIL  +K    +N    +DK +++ + I G+ + + +
Sbjct: 182 LDKSLSNQNIKNRYTGENDILAEKIL--LKHNEKNN----DDKNMSNKICIQGISESVSQ 235

Query: 244 ADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDK 284
           A++K  F  FG+IKS+ V+ K    FI+++   +A++A DK
Sbjct: 236 ANIKECFKKFGDIKSIKVIPKDSKMFISYSNSQAAKKASDK 276



>gi|501310661|dbj|GAC99419.1| RNA recognition motif containing protein [Pseudozyma hubeiensis
           SY62]
          Length = 313

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/302 (43%), Positives = 187/302 (61%), Gaps = 20/302 (6%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           E PILCE CLG NPY+RMT+   GK CKVC+RPFT+FRW PGAG R+KKTEIC TCAK+K
Sbjct: 10  ETPILCEPCLGPNPYIRMTKDPQGKLCKVCTRPFTVFRWNPGAGSRFKKTEICSTCAKIK 69

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTNDA--PRSEINREYFAQNIEGKISGAESLINYGK 136
           NVCQTC+LDLQY LPVQVRD AL V +D+    S+  +  +A  +E ++ G       G 
Sbjct: 70  NVCQTCILDLQYGLPVQVRDAALGVKSDSGPTGSDKAKMLYADTMEKQLEG-----QVGS 124

Query: 137 ADSSGREMLKKLARTEPYYKRNRP---HICSFFVKGSCTRGDECPYRHEIPEENELSHQN 193
           +  +G+++L+K AR E  YK++RP    +CS F +G C RGD+CP+RHE+P+ ++LS Q 
Sbjct: 125 SSRAGQDLLRKAARREIEYKKDRPVSDKLCSAFARGKCERGDKCPFRHELPDHDQLSAQQ 184

Query: 194 ----IKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLKGY 249
                     G++ P       ++K    + ++ P D TI SLFI+ +     E+ ++ +
Sbjct: 185 QPATTAPHTNGSSSPAPPPPTLQIKPSTPTGLSAPSDPTIRSLFISHLPPSSSESSIRQF 244

Query: 250 FYAFGE------IKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRP 303
           F    +      IKS+ +V  S CAF+NF TR  AE A     S + +++  +++ WGR 
Sbjct: 245 FLTLTQQLSPHHIKSITLVPSSNCAFVNFDTREHAELAAKHCASKMWLEDRQVRLMWGRG 304

Query: 304 RP 305
           RP
Sbjct: 305 RP 306



>gi|68066426|ref|XP_675196.1| RNA-binding protein [Plasmodium berghei strain ANKA]
 gi|56494240|emb|CAH95787.1| RNA-binding protein, putative [Plasmodium berghei]
          Length = 368

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 177/295 (60%), Gaps = 14/295 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           + D  KQG+  S+ PILCETCLG+NPYVR+ R+  GKECK+C   FT+FRW PG   RYK
Sbjct: 9   RGDVKKQGYENSDLPILCETCLGENPYVRIIREENGKECKICKNAFTLFRWKPGHNARYK 68

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           +T IC  CAK+KNVCQTCL DL+YNLPVQVRD  L  +   P +E NR +F + +E  IS
Sbjct: 69  QTIICNKCAKVKNVCQTCLFDLEYNLPVQVRDKFLETSITLPENETNRNFFLEQLENNIS 128

Query: 127 -GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EIP 184
            G    IN+G  D      L KL R +PY+KRN   +CSF+ K +C RGDECPY H EI 
Sbjct: 129 TGTYDKINHGNMD------LSKLKRRDPYFKRNMARVCSFWRKNACNRGDECPYLHKEIH 182

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEA 244
               L+ QNIK RY G ND +A+ ILNR K  N       E      + I G+ +     
Sbjct: 183 LNKSLASQNIKSRYTGENDVLAETILNRYKNDNID-----EKNMANKICIQGISNSTRVE 237

Query: 245 DLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKIT 299
           ++K  F  FGEIKS  ++ K    FI++AT  +A+ A  K    L +   +L +T
Sbjct: 238 NIKECFKKFGEIKSFKMIPKDSKIFISYATLTAAKNAA-KYKDGLELNGSNLTVT 291



>gi|312079522|ref|XP_003142211.1| Rbm22 protein [Loa loa]
          Length = 376

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 178/282 (63%), Gaps = 28/282 (9%)

Query: 42  GKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTAL 101
           G ECK+C RPFT FRW+PG GMRYKK +  +                   LPVQVRD AL
Sbjct: 28  GAECKICQRPFTCFRWMPGKGMRYKKRKYVR------------------RLPVQVRDHAL 69

Query: 102 NVTNDAPRSEINREYFAQNIEGKISGAESLINYGK----ADSSGREMLKKLARTEPYYKR 157
            + +D PR   NR+Y+ QN E +++  +     G      DS+  ++LKKLAR +PYY+R
Sbjct: 70  QIQDDLPRQGANRDYYIQNQERELALTDGTTPGGALAKITDSASNDLLKKLARNQPYYQR 129

Query: 158 NRPHICSFFVKGSCTRGDECPYRHEIPE--ENELSHQNIKDRYYGTNDPVAKKILNRVKG 215
           N+PHICSFFVKG C RG+ECPYRHE P   ++ LSHQN++DRYYG NDPVA+K+L R K 
Sbjct: 130 NKPHICSFFVKGECRRGEECPYRHEKPSDPDDPLSHQNMRDRYYGNNDPVAEKLLTRAKA 189

Query: 216 GNGSNITPPEDKTITSLFI--TGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFA 273
                +  PED TIT+L++   G    I EA L+ YFY FGEI+S+ ++    CAFI+F 
Sbjct: 190 --LPVLQAPEDTTITTLYVGDLGPAGVIGEAALRDYFYQFGEIRSLNLLPNKGCAFISFT 247

Query: 274 TRASAEQAIDKSHSNLNIKEHDLKITWGRPRPTGPKTEVQAA 315
           TR +AE+A ++S + L ++   LKI WGRP+    + E + A
Sbjct: 248 TRLAAEKAAERSFNKLILQGRRLKIRWGRPQAQNTQEEKKRA 289



>gi|221061969|ref|XP_002262554.1| RNA binding protein [Plasmodium knowlesi strain H]
 gi|193811704|emb|CAQ42432.1| RNA binding protein, putative [Plasmodium knowlesi strain H]
          Length = 390

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 183/308 (59%), Gaps = 15/308 (4%)

Query: 6   AKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRY 65
            +AD  KQG   +E PILCETCLG+NPYVR+ ++  GKECK+C+ PFT+FRW PG   RY
Sbjct: 8   VRADVKKQGAESAELPILCETCLGENPYVRLIKEENGKECKICNNPFTLFRWKPGQKSRY 67

Query: 66  KKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVT-NDAPRSEINREYFAQNIEGK 124
           K+T IC  CAK+KNVCQTCL DLQYNLPVQVRD  L  +    P +E NR +F + +E  
Sbjct: 68  KQTIICNMCAKVKNVCQTCLFDLQYNLPVQVRDKFLETSIVSMPENETNRNFFLEQVEKN 127

Query: 125 ISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-EI 183
           +        Y K D  G   L KL R +PY+KRN   +CSF+ K  C RG ECPY H EI
Sbjct: 128 LDTN----TYNKID-RGNMDLSKLRRRDPYFKRNMARVCSFWRKNECNRGAECPYLHKEI 182

Query: 184 PEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDE 243
             +  LS+QNIK RY G ND +A+KIL R +  N  N          ++ I G+ + + +
Sbjct: 183 HMDKSLSNQNIKSRYTGENDVLAEKILTRYEKQNEDNRF-----MANNICIHGISEAVSQ 237

Query: 244 ADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR- 302
            ++K  F  FGEIKS+ ++ K    FI++A   SA++A +     L +   +L +     
Sbjct: 238 VNVKDCFKKFGEIKSIKMIPKDSKMFISYANSQSAKKAAETYKDGLELNGSNLTVILQEE 297

Query: 303 --PRPTGP 308
             PR + P
Sbjct: 298 VMPRGSAP 305



>gi|195131747|ref|XP_002010307.1| GI14756 [Drosophila mojavensis]
 gi|193908757|gb|EDW07624.1| GI14756 [Drosophila mojavensis]
          Length = 325

 Score =  256 bits (654), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 179/295 (60%), Gaps = 38/295 (12%)

Query: 11  NKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEI 70
           N+  W +S  PILC +CLG+NP VRM ++ + K CK+C+RPFT FRW PG  MR+K+TEI
Sbjct: 10  NRHNWEDSSSPILCPSCLGENPNVRMIKERYDKNCKICTRPFTCFRWCPGMQMRFKRTEI 69

Query: 71  CQTCAKLKNVCQTCLLDLQYNLPVQVRDTA-LNVTNDAPRSEINREYFAQNIEGKISGAE 129
           CQ CA++KNVCQTC+LDL Y LP QVRD A +N    A R+  N+               
Sbjct: 70  CQACARMKNVCQTCVLDLVYGLPTQVRDVAIMNANKSAARAAKNKT-------------- 115

Query: 130 SLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE-NE 188
                          L KL+R  PY    R  ICSF+++G C R + CPYRHE P + NE
Sbjct: 116 ---------------LIKLSRMAPY----RSRICSFWLRGKCRRAEGCPYRHEKPHDPNE 156

Query: 189 -LSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADLK 247
            L  QNI+DRYYG ND +A+K+L+RV  G    +  P DKTI++L++  + + I EA+L 
Sbjct: 157 VLYSQNIRDRYYGNNDLIAEKMLHRV--GLMPKLDVPLDKTISTLYVGNLSEQISEAELL 214

Query: 248 GYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
             FY +GEI+SV +V +   AF+ +  R+ AE A +++ S L++K   L I W R
Sbjct: 215 NVFYPYGEIRSVTLVPRQSYAFVQYFKRSDAELAAERTFSKLSLKGRRLIIKWAR 269



>gi|156095945|ref|XP_001614007.1| RNA binding protein [Plasmodium vivax Sal-1]
 gi|148802881|gb|EDL44280.1| RNA binding protein, putative [Plasmodium vivax]
          Length = 390

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 179/296 (60%), Gaps = 14/296 (4%)

Query: 6   AKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRY 65
            +AD  KQG   +E PILCETCLG+NPYVR+ ++  GKECK+C+ PFT+FRW PG   RY
Sbjct: 8   VRADVKKQGVEGAELPILCETCLGENPYVRLIKEENGKECKICNNPFTLFRWKPGQKSRY 67

Query: 66  KKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVT-NDAPRSEINREYFAQNIEGK 124
           K+T IC  CAK+KNVCQTCL DLQYNLPVQVRD  L  +    P +E NR +F + +E  
Sbjct: 68  KQTIICNMCAKVKNVCQTCLFDLQYNLPVQVRDKFLETSIVSMPENETNRNFFLEQVEKN 127

Query: 125 I-SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRH-E 182
           + +     IN G  D      L KL R +PY+KRN   +CSF+ K  C RG ECPY H E
Sbjct: 128 LDTNTYDKINRGNMD------LSKLRRRDPYFKRNMARVCSFWRKNECNRGAECPYLHKE 181

Query: 183 IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDID 242
           I  +  LS+QNIK RY G ND +A+KIL R +  N  N          ++ I G+ + + 
Sbjct: 182 IHLDKSLSNQNIKSRYTGENDVLAEKILTRYEQQNEGNRF-----MANNICIHGISEAVS 236

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKI 298
           + ++K  F  FGEIKS+ ++ K    FI++A   SA+ A +     L +   +L +
Sbjct: 237 QVNVKDCFKKFGEIKSIKMIPKDSKMFISYANSQSAKNAAEAYKDGLELNGSNLTV 292



>gi|397635517|gb|EJK71891.1| hypothetical protein THAOC_06625 [Thalassiosira oceanica]
          Length = 389

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 143/387 (36%), Positives = 207/387 (53%), Gaps = 41/387 (10%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D +KQ W E+EFP++CETCLGDNPYVRMT++  GK+C+VC  PFT+F W  G   R K
Sbjct: 8   KRDDHKQKWEETEFPLVCETCLGDNPYVRMTKEPHGKKCRVCDVPFTVFAWQAGTRGRLK 67

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTA------LNVTNDAPRSEINREYFAQN 120
           K EIC+TCA+ KNVCQ CL DLQY LPV VRD        L+    AP+S  NR +    
Sbjct: 68  KVEICRTCARAKNVCQVCLYDLQYGLPVAVRDQVLAEEGCLDSVVAAPQSAANRAWATAQ 127

Query: 121 IEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR 180
            E  I    ++      ++S    L  +AR EP Y+RN P +CSFF KG C RG +CP+R
Sbjct: 128 KERAIEQGTAIQQCVPTNASAAAKLASMARMEPRYERNLPKLCSFFAKGECNRGTQCPFR 187

Query: 181 HEIPEE--NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE 238
           HE+P +  + +S  N KDR++G+ND VA+ IL               ++  ++L++   E
Sbjct: 188 HEMPRDRNDPMSKSNTKDRFFGSNDAVARGILRAHLEREKRESKGENERATSTLYVRFRE 247

Query: 239 --DDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDL 296
             + I + D++  FY++GEI S V +H+ + AF+ F +  + + AI  ++ ++ I    +
Sbjct: 248 GQNAITQGDIRDKFYSYGEISS-VRMHQDKGAFVEFTSPQATQHAITSANGSI-ICGRKI 305

Query: 297 KITW--------GRPRPTGPKTEVQAATTQNVVLPP------------------LESMQI 330
           K+ W        G+ +  GPK    AA    +   P                  ++   +
Sbjct: 306 KVNWAMVAKRGAGQTKSAGPKAVKPAAPPGGLKKDPEGFRPNVKVPAPPGGGGPIKRAGV 365

Query: 331 PAPPGEAPSDFLYPSQDPTYQGSSTKG 357
                 AP    YPSQDPT  G+ +K 
Sbjct: 366 SHGTVAAP---YYPSQDPTRLGTQSKA 389



>gi|470393657|ref|XP_004334907.1| RNA recognition motif domain containing protein [Acanthamoeba
           castellanii str. Neff]
 gi|440791656|gb|ELR12894.1| RNA recognition motif domain containing protein [Acanthamoeba
           castellanii str. Neff]
          Length = 381

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 178/306 (58%), Gaps = 37/306 (12%)

Query: 1   RSKMAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPG 60
           R    AK +  + GW +SEFPILCETCLGDNPYVRMT+  F KECK+ +       W  G
Sbjct: 4   RDTGHAKKNQARTGWEQSEFPILCETCLGDNPYVRMTKADFDKECKMEA-------WREG 56

Query: 61  AGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNV-TNDAPRSEINREYFAQ 119
           A                        L     LPVQVRD+ L       P SE NREYFA 
Sbjct: 57  A------------------------LQEDGRLPVQVRDSQLTGDVQQIPLSEANREYFAD 92

Query: 120 NIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPY 179
             E +I+  +  ++     S   + L++L R  PYYKRN  H+CSFF+KG+CTRG  CPY
Sbjct: 93  QAERQIASGQ--LDLQAVHSQVHDTLRRLTRPTPYYKRNEAHVCSFFLKGNCTRGATCPY 150

Query: 180 RHEIPE-ENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVE 238
           RHE+PE + +L+ QN+KDRYYG NDPVA+K+L R     G  + PPEDK + +L++  V+
Sbjct: 151 RHEVPENKGDLNQQNLKDRYYGVNDPVARKMLKRASEMPG--LAPPEDKNVRTLYLGNVQ 208

Query: 239 DDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKI 298
             I + D+   FY +GE++SV V+    CAF+ + TR + E+A + +   L IK   +++
Sbjct: 209 SYITQQDIHDSFYGYGELESVRVLTDKMCAFVTYTTREATEKAAEATFGKLTIKNMPIRV 268

Query: 299 TWGRPR 304
           +WGRP+
Sbjct: 269 SWGRPQ 274



>gi|302840588|ref|XP_002951849.1| hypothetical protein VOLCADRAFT_61843 [Volvox carteri f.
           nagariensis]
 gi|300262750|gb|EFJ46954.1| hypothetical protein VOLCADRAFT_61843 [Volvox carteri f.
           nagariensis]
          Length = 220

 Score =  249 bits (637), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 151/226 (66%), Gaps = 10/226 (4%)

Query: 4   MAAKA--DPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA 61
           MAA+   DP+  GW  S+ PI+CETCLG NP+VRM R  FG  C +  RP+T+FRW PG 
Sbjct: 1   MAARLLRDPDADGWERSDMPIVCETCLGPNPFVRMQRIEFGGTCHISGRPYTVFRWRPGN 60

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVT-NDAPRSEINREYFAQN 120
             RYKKT ICQ  AK KNVCQ CLLDL+Y LPVQVRDTAL +  +D P+S++ +EY  Q 
Sbjct: 61  DARYKKTVICQEVAKAKNVCQVCLLDLEYGLPVQVRDTALGIKPDDEPQSDVGKEYKLQM 120

Query: 121 IEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYR 180
              + S A S        +   EML+KL RT PYYKRN+  +C+FF +G CTRG ECPYR
Sbjct: 121 AVTEGSNASSFTT-----TRPNEMLQKLQRTAPYYKRNQARVCTFFARGQCTRGAECPYR 175

Query: 181 HEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPED 226
           HE+P   EL++QN+KDRYYG NDPVA K+L R        + P ED
Sbjct: 176 HEMPITGELANQNMKDRYYGVNDPVANKMLRRAD--EMGKLNPQED 219



>gi|452989014|gb|EME88769.1| hypothetical protein MYCFIDRAFT_35511 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 393

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/317 (40%), Positives = 179/317 (56%), Gaps = 18/317 (5%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++ P +CE CL DNPYV+M ++ +G ECK+C+RPFT+F+W      R K
Sbjct: 6   KQDLNRSGWETTDLPSVCERCLSDNPYVQMLKEDYGAECKLCTRPFTVFKWKADRTSRQK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           KT IC TCA+LKN CQ C+LDL + LP+ +RD AL +    P+SEINREYFAQN E +I 
Sbjct: 66  KTNICLTCARLKNCCQHCMLDLSFGLPITIRDAALKMVAPGPQSEINREYFAQNNEREIE 125

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRP-HICSFFVKGSCTRGDECPYRHEIPE 185
               L  Y K D   RE+L++LA++EPYYK+ R   +      GS  +  E       P 
Sbjct: 126 EGRGLEGYEKTDEKARELLRRLAQSEPYYKKQRRLELEEAEGSGSGQKLLEGGDGAHTPG 185

Query: 186 ENELSHQNIKDRYYGTNDP---------VAKKILNRVKGGNGS--------NITPPEDKT 228
               +    K  Y  +  P           +      KG   S        +I PP DK 
Sbjct: 186 PIRTTDSRGKSSYGSSYGPPRGGSSASRGGRGGARGGKGFPSSATLPPKPEDIRPPADKN 245

Query: 229 ITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSN 288
           ITSLF+TGVEDD+ E  ++ +F  FG ++S+V  H+S CAF+N+  RA AE+A +     
Sbjct: 246 ITSLFVTGVEDDLPEHAIREHFTQFGALRSLVCSHRSHCAFVNYMERAGAEKAAESCQGR 305

Query: 289 LNIKEHDLKITWGRPRP 305
             +K   L++ WG+P+P
Sbjct: 306 ALVKGVPLRVQWGKPKP 322



>gi|393912251|gb|EFO21859.2| Rbm22 protein [Loa loa]
          Length = 332

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 122/236 (51%), Positives = 164/236 (69%), Gaps = 10/236 (4%)

Query: 77  LKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKISGAESLINYGK 136
           +KNVCQTCLLDL++ LPVQVRD AL + +D PR   NR+Y+ QN E +++  +     G 
Sbjct: 1   MKNVCQTCLLDLEFGLPVQVRDHALQIQDDLPRQGANRDYYIQNQERELALTDGTTPGGA 60

Query: 137 ----ADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE--ENELS 190
                DS+  ++LKKLAR +PYY+RN+PHICSFFVKG C RG+ECPYRHE P   ++ LS
Sbjct: 61  LAKITDSASNDLLKKLARNQPYYQRNKPHICSFFVKGECRRGEECPYRHEKPSDPDDPLS 120

Query: 191 HQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFI--TGVEDDIDEADLKG 248
           HQN++DRYYG NDPVA+K+L R K      +  PED TIT+L++   G    I EA L+ 
Sbjct: 121 HQNMRDRYYGNNDPVAEKLLTRAKA--LPVLQAPEDTTITTLYVGDLGPAGVIGEAALRD 178

Query: 249 YFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPR 304
           YFY FGEI+S+ ++    CAFI+F TR +AE+A ++S + L ++   LKI WGRP+
Sbjct: 179 YFYQFGEIRSLNLLPNKGCAFISFTTRLAAEKAAERSFNKLILQGRRLKIRWGRPQ 234



>gi|407927292|gb|EKG20190.1| hypothetical protein MPH_02547 [Macrophomina phaseolina MS6]
          Length = 387

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/314 (40%), Positives = 186/314 (59%), Gaps = 17/314 (5%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL DNPYV+M ++ +G ECK+C+RPFT+F+W      R K
Sbjct: 6   KHDLNRSGWESTDFPSVCERCLPDNPYVQMLKEDYGSECKICTRPFTVFKWKADRTSRQK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P+S INREY+AQN E +I 
Sbjct: 66  RTTICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPQSNINREYYAQNNEKEIE 125

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   R++L++LA++EPYYK+ R          +   G +     E  +
Sbjct: 126 EGRGAIEEYEKTDEKARDLLRRLAQSEPYYKKQR--RLELEADEANKDGQKALPALEGAD 183

Query: 186 ENELSHQN--IKDRYYGTNDPVAKKILNRV-KGGNG-----------SNITPPEDKTITS 231
                H+   I+ +        A+  L+R  +G  G            +I PP DK ITS
Sbjct: 184 GQLQLHKAGPIRTKDSKAGPAGARGPLSRSGRGARGFPSAAQLAPRPEDILPPADKKITS 243

Query: 232 LFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNI 291
           LFITGVEDD+ E +++ +F  FG+++S+V  H+S CAF+N+  R SAE+A +       +
Sbjct: 244 LFITGVEDDLPEHEIRTFFTKFGQLRSLVCSHRSHCAFVNYVNRNSAEKAAEACQGRAVV 303

Query: 292 KEHDLKITWGRPRP 305
           K   L++ WG+P+P
Sbjct: 304 KGVPLRVQWGKPKP 317



>gi|412993121|emb|CCO16654.1| predicted protein [Bathycoccus prasinos]
          Length = 387

 Score =  246 bits (629), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 150/386 (38%), Positives = 220/386 (56%), Gaps = 42/386 (10%)

Query: 8   ADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKK 67
           ++P + GW +S+FP++C+ CLG NPYVRM ++ +G EC +  RPFT+FRW PG   RYKK
Sbjct: 7   SNPEEDGWEKSDFPVVCDDCLGPNPYVRMQKENYGAECAISGRPFTVFRWRPGHDARYKK 66

Query: 68  TEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTND--APRSEINREYFAQNIE--- 122
           T +C+  A  KNVCQ CLLDL++ +PVQ RD AL   +D   P+S +N EY  + IE   
Sbjct: 67  TVVCKEIALAKNVCQVCLLDLEFGIPVQARDAALGAISDMAVPKSAVNVEYVTKQIEEKL 126

Query: 123 ------------GKISG-AESLINYGKAD--SSGREMLKKLARTEPYYKRNRPHICSFFV 167
                       G ++G AE     GKA       E L ++AR +PYY++N+  IC+F++
Sbjct: 127 EEDATADVTGMLGGVAGNAEDDSVGGKAAIVKDAMEQLTRMARKKPYYQKNKAPICTFWL 186

Query: 168 KGSCTRGDECPYR------H--EIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGS 219
           K +CTR D CP+R      H  E+    +   QNIKDRYYGTNDPVA+ +L R +    S
Sbjct: 187 KDACTRAD-CPFRPCNGDTHMPELSANAKFRKQNIKDRYYGTNDPVAEAMLERDREKKPS 245

Query: 220 NITPPEDKTITSLFITGVE-DDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASA 278
               PED+TI + +I+GV+ +++ E DL+  F  +G +K V V+ + +CAF+ FA R  A
Sbjct: 246 -WQAPEDQTIKTFYISGVDGENVQEGDLRAAFCTYGALKKVHVMKEKKCAFVTFAEREEA 304

Query: 279 EQAIDKSHSNLNIKEHDLKI--TWGRPRPTGPKTEVQAATTQNVV-----LPPLESM-QI 330
           E+A  +    L  + + +K+   WG+ +    K + QA   +        L  +E + Q+
Sbjct: 305 EEAAKQKCGALGFEINGVKMKCMWGKSKSE-SKKKKQAGGEEGKEKKKENLTDVEKLEQM 363

Query: 331 PAPPGEAPSDFLYPSQDPTYQGSSTK 356
           P P G A     Y S D    G++ K
Sbjct: 364 PLPTGGAKKK--YASMDANAMGAAAK 387



>gi|194384782|dbj|BAG59551.1| unnamed protein product [Homo sapiens]
          Length = 371

 Score =  246 bits (627), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 170/260 (65%), Gaps = 17/260 (6%)

Query: 80  VCQTCLLD--------LQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS---GA 128
           +CQTCL +         +Y LP+QVRD  L+  +D P+S++N+EY+ QN+E +IS   G 
Sbjct: 23  LCQTCLGENPYIRMTKEKYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGT 82

Query: 129 ESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPEE-- 186
             +   GKA S+  +ML KLART PYYKRNRPHICSF+VKG C RG+ECPYRHE P +  
Sbjct: 83  RPVGMLGKATSTS-DMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPD 141

Query: 187 NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDIDEADL 246
           + L+ QNIKDRYYG NDPVA K+L R        + PPEDKTIT+L++ G+ D I E DL
Sbjct: 142 DPLADQNIKDRYYGINDPVADKLLKRA--STMPRLDPPEDKTITTLYVGGLGDTITETDL 199

Query: 247 KGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRPRPT 306
           + +FY FGEI+++ VV + +CAFI FATR +AE A +KS + L +    L + WGR +  
Sbjct: 200 RNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAA 259

Query: 307 -GPKTEVQAATTQNVVLPPL 325
            G + E    T   + L P+
Sbjct: 260 RGKEKEKDGTTDSGIKLEPV 279



>gi|449296802|gb|EMC92821.1| hypothetical protein BAUCODRAFT_263218 [Baudoinia compniacensis
           UAMH 10762]
          Length = 386

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 178/319 (55%), Gaps = 24/319 (7%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++ P +CE CL DNPYV+M ++ +G ECK+C+RPFTIF+W      R K
Sbjct: 6   KQDLNRSGWETTDMPSVCERCLPDNPYVQMLKEDYGAECKLCTRPFTIFKWKADRTSRQK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           +T IC TCA+LKN CQ C+LDL + LP+ +RD AL +    P+SEINREYFAQN E +I 
Sbjct: 66  RTGICLTCARLKNCCQCCMLDLSFGLPITIRDAALKMVAPGPQSEINREYFAQNNEREIE 125

Query: 127 GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICS-------FFVKGSCTRGDECPY 179
               L  Y K D   R++L++LA +EPYYK+ R                GS T G     
Sbjct: 126 EGRGLEGYNKTDEKARDLLRRLASSEPYYKKQRRLEAEGAEDGQKLLEGGSSTEGGHT-- 183

Query: 180 RHEIPEENELSHQNIKDRYYG--TNDPVAKKILNRVKGGNG-----------SNITPPED 226
               P     + ++     YG  T+ P ++      + G              +I PP D
Sbjct: 184 --RGPIRTADNKRSAYGSSYGPRTSTPTSRTGKPGARPGKSFPSAAALPPQPRDILPPSD 241

Query: 227 KTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSH 286
             ITSLFITGVEDD+ E +L+ +F  FG ++SVV  H+S CAF+N+  RA AE A     
Sbjct: 242 HNITSLFITGVEDDLPEHELRTHFSQFGALRSVVCSHRSHCAFMNYMDRAGAEAAAAACQ 301

Query: 287 SNLNIKEHDLKITWGRPRP 305
               +K   L++ WGRP+P
Sbjct: 302 GRAVVKGVPLRVQWGRPKP 320



>gi|219112609|ref|XP_002178056.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410941|gb|EEC50870.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 324

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 186/323 (57%), Gaps = 27/323 (8%)

Query: 5   AAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMR 64
           + K D  KQ W E+EFP++CETCLGDNPYVRMT++  GK+C++C  PFT+F W  G   R
Sbjct: 3   SVKRDEVKQAWEETEFPLVCETCLGDNPYVRMTKERHGKKCQICEAPFTVFAWQAGTKGR 62

Query: 65  YKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDA------PRSEINREYF- 117
            K+ EIC++CA+ KNVCQ C+ DLQY LPV+VRD  L     A      P+S  NR ++ 
Sbjct: 63  LKRVEICRSCAQAKNVCQVCIYDLQYGLPVKVRDRVLREAGSASAVSAVPQSMANRSWYT 122

Query: 118 AQNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDEC 177
           AQ       G  +L   G  +      L  ++R EP Y+RN P +CSFF +G C RG +C
Sbjct: 123 AQQNRALEQGNNAL---GDTNELAHAKLNDMSRMEPRYERNLPKLCSFFARGECDRGADC 179

Query: 178 PYRHEIPEE--NELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPE----DKTITS 231
           P+RHE+P +  + +S Q+ KDR+YG++DPVA KIL R +          E    DK   +
Sbjct: 180 PFRHEMPRDRNDPMSKQSTKDRFYGSSDPVANKILGRKRRQEEEQQKQDEEEGYDKAKAT 239

Query: 232 LFITGVED----DIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHS 287
           L++    D    D+ E D++  FY+FGEI S+ +  +   AF+ +    ++E AI    +
Sbjct: 240 LYVRFQGDSPFPDMTEMDVRDQFYSFGEIVSIRIQSERGQAFVEYTQPEASELAI----A 295

Query: 288 NLNIKE---HDLKITWGRPRPTG 307
           ++N KE     + + W R    G
Sbjct: 296 SMNRKELLGRTISVRWARSSKRG 318



>gi|425768261|gb|EKV06791.1| Pre-mRNA-splicing factor slt11 [Penicillium digitatum Pd1]
 gi|425770431|gb|EKV08904.1| Pre-mRNA-splicing factor slt11 [Penicillium digitatum PHI26]
          Length = 383

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 182/324 (56%), Gaps = 39/324 (12%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL +NPYV+M ++  G ECK+C+RPFTIFRW      R K
Sbjct: 6   KHDLNRSGWESTDFPSVCENCLPENPYVQMIKEDHGAECKICTRPFTIFRWKADRTSRQK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           ++ IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQN E +I 
Sbjct: 66  RSIICLTCARLKNCCQCCMLDLSFGLPLAVRDAALKMVAPGPESSINREYYAQNNEKEIE 125

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   RE+L++LA +EPYY++               R  E     E  E
Sbjct: 126 EGRGAIEEYEKTDDKARELLRRLANSEPYYRK--------------PRRIEASIGEENGE 171

Query: 186 ENELSHQNIKDRYYGTN-DPV---AKKILNRVKGG--------------------NGSNI 221
           E+  + Q   +  YG    PV     ++ NR+ G                     + ++I
Sbjct: 172 ESAATDQPRTNSRYGNGPGPVRTSESRVGNRLPGRGGRGGGRGGRPFPSTTQLPPSAADI 231

Query: 222 TPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQA 281
            PP D  +TSLFITGVEDD+ E  L+ +F  FG+++S++  H+S CAFIN+  R  AE A
Sbjct: 232 LPPTDPNVTSLFITGVEDDLPEHALRTFFSEFGQLRSLICSHRSHCAFINYVNRLDAENA 291

Query: 282 IDKSHSNLNIKEHDLKITWGRPRP 305
            ++      I+   L++ WG+P+P
Sbjct: 292 ANRCQGKAIIQGCPLRVRWGKPKP 315



>gi|255933816|ref|XP_002558287.1| Pc12g14830 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582906|emb|CAP81110.1| Pc12g14830 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 383

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 180/324 (55%), Gaps = 39/324 (12%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL +NPYV+M ++  G ECK+C+RPFTIFRW      R K
Sbjct: 6   KHDLNRSGWESTDFPSVCENCLPENPYVQMIKEDHGAECKICTRPFTIFRWKADRTSRQK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           ++ IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQN E  I 
Sbjct: 66  RSIICLTCARLKNCCQCCMLDLSFGLPLAVRDAALKMVAPGPESSINREYYAQNNEKAIE 125

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   RE+L++LA +EPYY++               R  E     +  E
Sbjct: 126 EGRGAIEEYEKTDDKARELLRRLANSEPYYRK--------------PRRIETNAEEDKSE 171

Query: 186 ENELSHQ-NIKDRYYGTNDPV---AKKILNRVKGG--------------------NGSNI 221
           E+  + Q  +  RY     PV     ++ NR+ G                     + ++I
Sbjct: 172 ESTATDQPRMNSRYGNGPGPVRTSESRVGNRLPGRGGRGGGRGGRPFPSTTQLPPSAADI 231

Query: 222 TPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQA 281
            PP D  +TSLFITGVEDD+ E  L+ +F  FG+++S++  H+S CAFIN+  RA AE A
Sbjct: 232 LPPADPNVTSLFITGVEDDLPEHALRTFFTEFGQLRSLICSHRSHCAFINYVNRADAETA 291

Query: 282 IDKSHSNLNIKEHDLKITWGRPRP 305
                    I+   L++ WG+P+P
Sbjct: 292 AKHCQGKAIIQGCPLRVRWGKPKP 315



>gi|330812947|ref|XP_003291377.1| hypothetical protein DICPUDRAFT_38905 [Dictyostelium purpureum]
 gi|325078437|gb|EGC32088.1| hypothetical protein DICPUDRAFT_38905 [Dictyostelium purpureum]
          Length = 368

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 180/271 (66%), Gaps = 16/271 (5%)

Query: 43  KECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALN 102
           KECK+C+RPFT+++W PG   R+KKTEIC+TC+++KNVCQ C+ DL++ LPVQVRD  L+
Sbjct: 6   KECKICARPFTVYKWKPGNSSRWKKTEICKTCSQIKNVCQVCIHDLEFGLPVQVRDAVLS 65

Query: 103 VTND-APRSEINREYFA-QNIEGKISGAESLINYGKADSSGREMLKKLARTEPYYKRNRP 160
              D AP +E   EY A QN     +G  S  N+  +D     +++K+ R+ PY K   P
Sbjct: 66  TQFDSAPVTEKGTEYMATQNQRMIDNGEVSYDNFQPSD-----IIQKVQRSVPYSKNQNP 120

Query: 161 H---ICSFFVKGSCTRGDECPYRHEI--PEENELSH---QNIKDRYYGTNDPVAKKILNR 212
           +   ICSFF+KG C RGD+CP+RH    P EN  SH   Q+IKDRY+GTNDPVA+++L++
Sbjct: 121 NQGRICSFFLKGDCNRGDQCPFRHAQPGPNENVDSHSINQSIKDRYHGTNDPVAQRMLSQ 180

Query: 213 VKGGNGSNITPPEDKTITSLFITGVE-DDIDEADLKGYFYAFGEIKSVVVVHKSRCAFIN 271
           ++  +      P D+++T+LF+  ++ D + E D++  F+ +G +K + +V   +CAF+ 
Sbjct: 181 IENTSSQPPKKPSDESVTTLFLGNLDVDKVKEEDIRNNFFVYGTVKKIKMVPHQKCAFVT 240

Query: 272 FATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           F TR++AE AID  ++N  I + ++K+ W +
Sbjct: 241 FDTRSAAENAIDSLYNNFKIDDCNIKLNWSK 271



>gi|317156711|ref|XP_001825943.2| pre-mRNA-splicing factor slt11 [Aspergillus oryzae RIB40]
          Length = 384

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 178/332 (53%), Gaps = 55/332 (16%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CETCL DNPYV+M ++ +G ECK+C+RPFTIFRW      R K
Sbjct: 7   KQDLNRSGWETTDFPSVCETCLPDNPYVQMLKEDYGAECKICTRPFTIFRWKADRTARTK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQ  E +I 
Sbjct: 67  RTAICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPESTINREYYAQEHEKEIE 126

Query: 127 -GAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   RE+L++LA +EPYY++                    P + E P+
Sbjct: 127 EGRGAVEAYEKTDEKARELLRRLANSEPYYRK--------------------PRQIEAPQ 166

Query: 186 ENELSHQN-----IKDRYYGTNDPVAKKILNRVKGG------------------------ 216
           + E    +     +  RY   N P   +     +G                         
Sbjct: 167 DEESEKPSTDAPVVHSRY--GNGPGPIRTTESRRGTPLPGRGRGNMRGGRGGRPFPGTAQ 224

Query: 217 ---NGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFA 273
              +  +I PP D  +TSLF+TGVEDD+ E  L+ +F  FG+++S+V  H++  AFINFA
Sbjct: 225 LPPSQEDILPPADPNVTSLFVTGVEDDLPEHTLRTFFSQFGQLRSLVCSHRAHSAFINFA 284

Query: 274 TRASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
           TR  AE A         I+   L+I WG+P+P
Sbjct: 285 TREGAEAAAKHCQGKAVIQGCPLRIRWGKPKP 316



>gi|121714491|ref|XP_001274856.1| pre-RNA splicing factor Slt11, putative [Aspergillus clavatus NRRL
           1]
 gi|119403010|gb|EAW13430.1| pre-RNA splicing factor Slt11, putative [Aspergillus clavatus NRRL
           1]
          Length = 383

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 177/327 (54%), Gaps = 44/327 (13%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL DNPYV+M ++  G ECK+C+RPFTIFRW      R K
Sbjct: 7   KQDLNRSGWESTDFPSVCENCLPDNPYVQMLKEDHGAECKICTRPFTIFRWKADRTARTK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQ  E +I 
Sbjct: 67  RTTICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPESSINREYYAQEHEKEIE 126

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   RE+L++LA +EPYY++ R  +     +G      E P     P 
Sbjct: 127 EGRGAVEAYEKTDEKARELLRRLANSEPYYRKPRQRL-----EGPSEESSEAP-----PT 176

Query: 186 ENELSHQNIKDRYYGTNDPVAKKILNRVKGG---------------------------NG 218
           +  + H       YG N P   +     +G                            + 
Sbjct: 177 DAPVVHSR-----YG-NGPGPVRTSESRRGTPLPGRGRGNMRGGRGGRPFPGTAQLPPSP 230

Query: 219 SNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASA 278
            +  PP D  +TSLF+TGVEDD+ E  L+ +F  FG+++S++  H+S CAF+N+ATR  A
Sbjct: 231 EDYLPPADPNVTSLFVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRSHCAFVNYATREGA 290

Query: 279 EQAIDKSHSNLNIKEHDLKITWGRPRP 305
           E A         I+   L++ WG+P+P
Sbjct: 291 EAAAQHCQGKAVIQGCPLRVRWGKPKP 317



>gi|119487176|ref|XP_001262443.1| pre-RNA splicing factor Slt11, putative [Neosartorya fischeri NRRL
           181]
 gi|119410600|gb|EAW20546.1| pre-RNA splicing factor Slt11, putative [Neosartorya fischeri NRRL
           181]
          Length = 383

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/330 (37%), Positives = 175/330 (53%), Gaps = 50/330 (15%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL DNPYV+M ++ +G ECK+C+RPFTIFRW      R K
Sbjct: 7   KQDLNRSGWESTDFPSVCENCLPDNPYVQMLKEDYGAECKICTRPFTIFRWKADRTARTK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQ  E +I 
Sbjct: 67  RTTICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPESSINREYYAQEHEKEIE 126

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPYRHEIPE 185
            G  ++  Y K D   RE+L++LA +EPYY++ R  +                   E P 
Sbjct: 127 EGRGAVEAYEKTDEKARELLRRLANSEPYYRKPRQQL-------------------EGPS 167

Query: 186 ENELSHQN-----IKDRYYGTNDPVAKKILNRVKG------------------------- 215
           ++    Q      ++ RY     P+      R                            
Sbjct: 168 DDSTEAQPTDAPVVQSRYGNGPGPIRTSESRRGTSLPGRGRGNMRGGRAGRPFPGTAQIP 227

Query: 216 GNGSNITPPEDKTITSLFITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATR 275
            +  +  PP D  ITSLF+TGVEDD+ E  L+ +F  FG+++S++  H++ CAFINFATR
Sbjct: 228 PSPEDYLPPADPNITSLFVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRAHCAFINFATR 287

Query: 276 ASAEQAIDKSHSNLNIKEHDLKITWGRPRP 305
             AE A         I+   L++ WG+P+P
Sbjct: 288 EGAEAAAQHCKGKAVIQGCPLRVRWGKPKP 317



>gi|378731886|gb|EHY58345.1| pre-mRNA-splicing factor slt11 [Exophiala dermatitidis NIH/UT8656]
          Length = 377

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 175/303 (57%), Gaps = 7/303 (2%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP  CE CL DNPYV+M ++ +G ECK+C+RPFT+FRW      R K
Sbjct: 6   KQDLNRSGWETTDFPSSCENCLPDNPYVQMLKEDYGAECKICTRPFTVFRWKADRTARTK 65

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P+S INREY+AQ  E ++ 
Sbjct: 66  RTNICLTCARLKNCCQCCMLDLSFGLPITVRDAALKMVAPGPQSTINREYYAQEHEKELE 125

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGD---ECPYRHE 182
            G  ++  Y K D   R++L++LA +EPYYK+ R        K +  +       P R  
Sbjct: 126 EGRGAVEAYEKTDEKARDLLRRLANSEPYYKKQRRLEAEASDKPAEQKQSGYGPGPVRTS 185

Query: 183 IPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVEDDID 242
              ++   +Q    R        A+ + N  +     +  PP D  I SLF+TGVEDD+ 
Sbjct: 186 DTRKSLAGNQQRGARAGPG---AARAVPNAARPPQPEDYLPPADPKIMSLFVTGVEDDLP 242

Query: 243 EADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGR 302
           E  ++ +F  FG+I+S+V  H++ CAFIN+ATR  AE A         I+   L++ WG+
Sbjct: 243 EHAIRTFFSPFGQIRSIVCSHRAHCAFINYATREGAEAAAAHCQGKAIIQGCPLRVRWGK 302

Query: 303 PRP 305
           PRP
Sbjct: 303 PRP 305



>gi|428185581|gb|EKX54433.1| hypothetical protein GUITHDRAFT_99912 [Guillardia theta CCMP2712]
          Length = 439

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 192/346 (55%), Gaps = 63/346 (18%)

Query: 19  EFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYKKTEICQTCAKLK 78
           +FPI+C+ CLG NPY+RM +Q   KECKV  R FT FRW PGAG RYK+T IC   A+ K
Sbjct: 18  DFPIVCDVCLGPNPYIRMIKQVNHKECKVSGRVFTSFRWRPGAGARYKETVICPEVARAK 77

Query: 79  NVCQTCLLDLQYNLPVQVRDTALNVTND----APRSEINREYFAQNIEGKISGAESLINY 134
            VCQ CL+D+++NLPV +RD  L  T++    AP+S +N+ Y    +  K +  +   +Y
Sbjct: 78  GVCQCCLMDMEFNLPVGLRDALLRGTDEGDNFAPQSGVNQTYHYDQV-AKANREDVEASY 136

Query: 135 GKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDE--CPYR------------ 180
           GK      E L K+ART PYY RN P +CSF++KG CTR  E  CP+R            
Sbjct: 137 GKM---ANEKLLKMARTSPYYDRNLPKLCSFWLKGQCTRVVENTCPFRPCCGSYRFPELA 193

Query: 181 ------------------------------HEIPEENELSH-----QNIKDRYYGTNDPV 205
                                          EI E+   S      QNI+DRY+G  D +
Sbjct: 194 GSNPEGMKTLIAALDQLGPLKVMKDNSQEMEEIKEQLRSSQRGSRDQNIRDRYHGV-DTL 252

Query: 206 AKKILNRVKGGNGSNITPPEDKTITSLFITGVEDD-IDEADLKGYFYAFGEIKSVVVVHK 264
            +K L + +      + PPEDK+IT++++  V  + + E D+   FYA+GE+KSV +V  
Sbjct: 253 TQKYLGKAE---QLGLEPPEDKSITTIWVGLVPGNPVTERDVMDQFYAYGEVKSVQIVLD 309

Query: 265 SRCAFINFATRASAEQAIDKSHSNLNIKEHDLKITWGRP-RPTGPK 309
           + CAF+ + TR +AEQA++K H NL I    LKI WG+P R  GP+
Sbjct: 310 ANCAFVTYTTREAAEQAVEKLHGNLTINGLKLKIQWGKPQRARGPE 355



>gi|505755542|gb|EOQ99749.1| Pre-mRNA-splicing factor RBM22 [Wallemia ichthyophaga EXF-994]
          Length = 281

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 176/307 (57%), Gaps = 36/307 (11%)

Query: 2   SKMAAKADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGA 61
           S    K D N  GW ESEFPILC+ CLG NP+VRM ++ FGKECK+C RPFT+F W PGA
Sbjct: 2   SSYGPKRDVNASGWEESEFPILCDDCLGPNPFVRMQKRAFGKECKICVRPFTLFSWCPGA 61

Query: 62  GMRYKKTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNI 121
           G RYKKTEIC TCAK+K+ CQTC+LDL Y +PV +RD AL + + AP   +NR+YFAQN 
Sbjct: 62  GTRYKKTEICNTCAKMKHCCQTCILDLTYKIPVHLRDAALGIQSKAPTDNLNRQYFAQNQ 121

Query: 122 EGKISGAESLIN--YGKADSSGREMLKKLARTEPYYKRNRPHICSFFVKGSCTRGDECPY 179
           E K+ G  ++++   G+A+++G+++LK LA+ EPYYK                       
Sbjct: 122 EDKLKGNSTMVDGGLGRAENAGKKILKDLAKNEPYYK----------------------- 158

Query: 180 RHEIPEENELSHQNIKDRYYGTNDPVAKKILNRVKGGNGSNITPPEDKTITSLFITGVED 239
               P +N+ S  N          PV   I N VK     ++  P+D  I SL+ + + +
Sbjct: 159 ----PTKNQNSTSNHNQSLSQITSPVTPPIKN-VK----LDLKKPDDPEILSLYCSQLPE 209

Query: 240 DIDEADLKGYFYAFGE-IKSVVVVHKSRCAFINFATRASAE-QAIDKSHSNLNIKEHDLK 297
              E  L+  F    + IKS  VV  S+ +F+NF +R +AE  A+  S + L +    + 
Sbjct: 210 GTTENQLRSAFGGSADSIKSATVVPTSKVSFVNFTSRQAAEAAALTISKNGLTVSNEPVS 269

Query: 298 ITWGRPR 304
           + WGR +
Sbjct: 270 VKWGRSK 276



>gi|145248892|ref|XP_001400785.1| pre-mRNA-splicing factor slt11 [Aspergillus niger CBS 513.88]
 gi|134081458|emb|CAK46471.1| unnamed protein product [Aspergillus niger]
          Length = 385

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 176/313 (56%), Gaps = 15/313 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL DNPYV+M ++  G ECK+C+RPFTIFRW      R K
Sbjct: 7   KQDLNRSGWETTDFPSVCENCLPDNPYVQMLKEDHGAECKICTRPFTIFRWKADRTARQK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKI- 125
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQ  E +I 
Sbjct: 67  RTAICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPESTINREYYAQGHEKEIE 126

Query: 126 SGAESLINYGKADSSGREMLKKLARTEPYYKRNRP-HICSFFVKGSCTRGDECPYRHEIP 184
            G  ++  Y K D   RE+L++LA +EPYY++ R         +G+     + P  H   
Sbjct: 127 EGRGAVEEYEKTDEKARELLRRLANSEPYYRKPRQIEAAPQDEEGASAGPSDAPVVHSR- 185

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGG------------NGSNITPPEDKTITSL 232
             N        +   GT  P   +   R   G            +  +I PP D  ITSL
Sbjct: 186 YGNGPGPIRTSESRRGTPLPGRGRGGMRGGRGGRPFPSAAQVPPSAEDILPPADPNITSL 245

Query: 233 FITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIK 292
           F+TGVEDD+ E  L+ +F  FG+++S++  H++  AF+NFATR  AE A  +      I+
Sbjct: 246 FVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRAHSAFVNFATREGAEAAAKQCQGRAVIQ 305

Query: 293 EHDLKITWGRPRP 305
              L++ WG+P+P
Sbjct: 306 GCPLRVRWGKPKP 318



>gi|358370509|dbj|GAA87120.1| pre-RNA splicing factor Slt11 [Aspergillus kawachii IFO 4308]
          Length = 385

 Score =  236 bits (603), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 176/313 (56%), Gaps = 15/313 (4%)

Query: 7   KADPNKQGWGESEFPILCETCLGDNPYVRMTRQGFGKECKVCSRPFTIFRWLPGAGMRYK 66
           K D N+ GW  ++FP +CE CL DNPYV+M ++  G ECK+C+RPFTIFRW      R K
Sbjct: 7   KQDLNRSGWETTDFPSVCENCLPDNPYVQMLKEDHGAECKICTRPFTIFRWKADRTARQK 66

Query: 67  KTEICQTCAKLKNVCQTCLLDLQYNLPVQVRDTALNVTNDAPRSEINREYFAQNIEGKIS 126
           +T IC TCA+LKN CQ C+LDL + LP+ VRD AL +    P S INREY+AQ  E +I 
Sbjct: 67  RTAICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVAPGPESTINREYYAQGHEKEIE 126

Query: 127 -GAESLINYGKADSSGREMLKKLARTEPYYKRNRP-HICSFFVKGSCTRGDECPYRHEIP 184
            G  ++  Y K D   RE+L++LA +EPYY++ R         +G+     + P  H   
Sbjct: 127 EGRGAVEEYEKTDEKARELLRRLANSEPYYRKPRQIEAAPQDEEGASGGPSDAPVVHSR- 185

Query: 185 EENELSHQNIKDRYYGTNDPVAKKILNRVKGG------------NGSNITPPEDKTITSL 232
             N        +   GT  P   +   R   G            +  +I PP D  ITSL
Sbjct: 186 YGNGPGPIRTSESRRGTPLPGRGRGGMRGGRGGRPFPSAAQVPPSAEDILPPADPNITSL 245

Query: 233 FITGVEDDIDEADLKGYFYAFGEIKSVVVVHKSRCAFINFATRASAEQAIDKSHSNLNIK 292
           F+TGVEDD+ E  L+ +F  FG+++S++  H++  AF+NFATR  AE A  +      I+
Sbjct: 246 FVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRAHSAFVNFATREGAEAAAKQCQGRAVIQ 305

Query: 293 EHDLKITWGRPRP 305
              L++ WG+P+P
Sbjct: 306 GCPLRVRWGKPKP 318