BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10006_c0_seq1-m.6 5prime_partial 3-1079(+) 359 (+)
         (358 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|321460304|gb|EFX71347.1| hypothetical protein DAPPUDRAFT_1297...   241   3e-61   Daphnia pulex
gi|384484407|gb|EIE76587.1| hypothetical protein RO3G_01291 [Rhi...   240   5e-61   Rhizopus delemar RA 99-880
gi|315271511|gb|ADU02293.1| RNA helicase [Rhizopus oryzae] >gi|3...   239   6e-61   Rhizopus oryzae
gi|315320905|gb|ADU04733.1| putative RNA helicase [Rhizopus oryzae]   239   6e-61   Rhizopus oryzae
gi|315271515|gb|ADU02296.1| RNA helicase [Rhizopus oryzae]            239   7e-61   Rhizopus oryzae
gi|156352506|ref|XP_001622790.1| hypothetical protein NEMVEDRAFT...   238   2e-60   Nematostella vectensis
gi|315271519|gb|ADU02299.1| RNA helicase [Rhizopus delemar]           233   9e-59   Rhizopus delemar
gi|260834157|ref|XP_002612078.1| hypothetical protein BRAFLDRAFT...   231   2e-58   Branchiostoma floridae
gi|356668399|gb|AET35417.1| RnhA [Syzygites megalocarpus]             231   3e-58   Syzygites megalocarpus
gi|403366003|gb|EJY82794.1| hypothetical protein OXYTRI_19589 [O...   229   7e-58   Oxytricha trifallax
gi|403358026|gb|EJY78648.1| hypothetical protein OXYTRI_24190 [O...   229   1e-57   Oxytricha trifallax
gi|321466807|gb|EFX77800.1| hypothetical protein DAPPUDRAFT_2132...   229   1e-57   Daphnia pulex
gi|260797863|ref|XP_002593920.1| hypothetical protein BRAFLDRAFT...   228   2e-57   Branchiostoma floridae
gi|340378202|ref|XP_003387617.1| PREDICTED: NFX1-type zinc finge...   227   3e-57   Amphimedon queenslandica
gi|260797867|ref|XP_002593922.1| hypothetical protein BRAFLDRAFT...   226   6e-57   Branchiostoma floridae
gi|374921797|gb|AFA26128.1| RNA helicase [Mucor mucedo]               226   6e-57   Mucor mucedo
gi|374921792|gb|AFA26124.1| RNA helicase [Mucor mucedo]               226   7e-57   Mucor mucedo
gi|302797448|ref|XP_002980485.1| hypothetical protein SELMODRAFT...   225   2e-56   Selaginella moellendorffii
gi|321472267|gb|EFX83237.1| hypothetical protein DAPPUDRAFT_3019...   224   3e-56   Daphnia pulex
gi|403353380|gb|EJY76226.1| NFX1-type zinc finger-containing pro...   224   3e-56   Oxytricha trifallax
gi|291222949|ref|XP_002731477.1| PREDICTED: Upf1-like [Saccoglos...   223   5e-56   
gi|511005759|gb|EPB87088.1| hypothetical protein HMPREF1544_0611...   222   1e-55   Mucor circinelloides f. circinelloides 1006PhL
gi|302800058|ref|XP_002981787.1| hypothetical protein SELMODRAFT...   222   1e-55   Selaginella moellendorffii
gi|443719429|gb|ELU09610.1| hypothetical protein CAPTEDRAFT_6201...   222   2e-55   Capitella teleta
gi|403376237|gb|EJY88099.1| NFX1-type zinc finger-containing pro...   221   2e-55   Oxytricha trifallax
gi|459180293|ref|XP_002121871.2| PREDICTED: NFX1-type zinc finge...   219   9e-55   
gi|348537350|ref|XP_003456158.1| PREDICTED: NFX1-type zinc finge...   218   2e-54   Oreochromis niloticus
gi|403349252|gb|EJY74066.1| hypothetical protein OXYTRI_04681 [O...   218   2e-54   Oxytricha trifallax
gi|302768273|ref|XP_002967556.1| hypothetical protein SELMODRAFT...   216   1e-53   Selaginella moellendorffii
gi|326668908|ref|XP_003198892.1| PREDICTED: NFX1-type zinc finge...   215   2e-53   
gi|242790500|ref|XP_002481566.1| DEAD box helicase involved in n...   214   4e-53   Talaromyces stipitatus ATCC 10500
gi|345492959|ref|XP_001601264.2| PREDICTED: NFX1-type zinc finge...   214   4e-53   
gi|291245137|ref|XP_002742448.1| PREDICTED: regulator of nonsens...   214   4e-53   Saccoglossus kowalevskii
gi|198427464|ref|XP_002125363.1| PREDICTED: NFX1-type zinc finge...   213   6e-53   
gi|403334658|gb|EJY66494.1| hypothetical protein OXYTRI_13219 [O...   213   6e-53   Oxytricha trifallax
gi|403351933|gb|EJY75469.1| hypothetical protein OXYTRI_03144 [O...   213   8e-53   Oxytricha trifallax
gi|327288951|ref|XP_003229188.1| PREDICTED: NFX1-type zinc finge...   213   9e-53   
gi|327291388|ref|XP_003230403.1| PREDICTED: NFX1-type zinc finge...   212   1e-52   
gi|330791023|ref|XP_003283594.1| hypothetical protein DICPUDRAFT...   212   1e-52   Dictyostelium purpureum
gi|443725470|gb|ELU13047.1| hypothetical protein CAPTEDRAFT_1031...   210   5e-52   Capitella teleta
gi|498971653|ref|XP_004547697.1| PREDICTED: NFX1-type zinc finge...   210   6e-52   Maylandia zebra
gi|91079006|ref|XP_974779.1| PREDICTED: similar to NFX1-type zin...   209   1e-51   Tribolium castaneum [rust-red flour beetle]
gi|326481435|gb|EGE05445.1| DEAD box helicase [Trichophyton equi...   209   1e-51   Trichophyton equinum CBS 127.97
gi|326468825|gb|EGD92834.1| DEAD box helicase [Trichophyton tons...   209   1e-51   Trichophyton tonsurans CBS 112818
gi|512850381|ref|XP_002938366.2| PREDICTED: NFX1-type zinc finge...   208   2e-51   
gi|260797861|ref|XP_002593919.1| hypothetical protein BRAFLDRAFT...   208   2e-51   Branchiostoma floridae
gi|345492871|ref|XP_003426945.1| PREDICTED: NFX1-type zinc finge...   208   2e-51   Nasonia vitripennis
gi|156554246|ref|XP_001601379.1| PREDICTED: NFX1-type zinc finge...   208   2e-51   Nasonia vitripennis
gi|443733613|gb|ELU17905.1| hypothetical protein CAPTEDRAFT_1939...   207   3e-51   Capitella teleta
gi|351703079|gb|EHB05998.1| NFX1-type zinc finger-containing pro...   207   3e-51   Heterocephalus glaber [naked mole rat]
gi|512859564|ref|XP_004889398.1| PREDICTED: NFX1-type zinc finge...   207   4e-51   
gi|512859568|ref|XP_004889399.1| PREDICTED: NFX1-type zinc finge...   207   4e-51   
gi|119183534|ref|XP_001242798.1| hypothetical protein CIMG_06694...   207   4e-51   
gi|326931889|ref|XP_003212056.1| PREDICTED: NFX1-type zinc finge...   207   4e-51   
gi|201067012|gb|ACH92693.1| RNA helicase [Mucor circinelloides]       207   4e-51   Mucor circinelloides
gi|295666622|ref|XP_002793861.1| helicase required for RNAi-medi...   207   5e-51   
gi|327301147|ref|XP_003235266.1| DEAD box helicase [Trichophyton...   207   5e-51   Trichophyton rubrum CBS 118892
gi|225683441|gb|EEH21725.1| conserved hypothetical protein [Para...   207   5e-51   
gi|321460871|gb|EFX71909.1| hypothetical protein DAPPUDRAFT_2277...   207   5e-51   Daphnia pulex
gi|348563937|ref|XP_003467763.1| PREDICTED: NFX1-type zinc finge...   206   7e-51   Cavia porcellus [guinea pig]
gi|513218036|ref|XP_417395.4| PREDICTED: NFX1-type zinc finger-c...   206   1e-50   
gi|478512167|ref|XP_004430346.1| PREDICTED: NFX1-type zinc finge...   206   1e-50   
gi|201067016|gb|ACH92696.1| RNA helicase [Mucor circinelloides]       206   1e-50   Mucor circinelloides
gi|432858177|ref|XP_004068830.1| PREDICTED: NFX1-type zinc finge...   205   1e-50   
gi|392865705|gb|EAS31518.2| DEAD box helicase [Coccidioides immi...   205   1e-50   
gi|109091643|ref|XP_001098884.1| PREDICTED: NFX1-type zinc finge...   205   2e-50   
gi|47222854|emb|CAF96521.1| unnamed protein product [Tetraodon n...   205   2e-50   Tetraodon nigroviridis
gi|513218033|ref|XP_004947131.1| PREDICTED: NFX1-type zinc finge...   204   2e-50   
gi|507663766|ref|XP_004636105.1| PREDICTED: NFX1-type zinc finge...   204   2e-50   Octodon degus
gi|513218030|ref|XP_004947130.1| PREDICTED: NFX1-type zinc finge...   204   3e-50   
gi|511843684|ref|XP_004746280.1| PREDICTED: NFX1-type zinc finge...   204   3e-50   Mustela putorius furo [black ferret]
gi|291222943|ref|XP_002731474.1| PREDICTED: Upf1-like [Saccoglos...   204   3e-50   
gi|513218027|ref|XP_004947129.1| PREDICTED: NFX1-type zinc finge...   204   3e-50   
gi|320034265|gb|EFW16210.1| DEAD box helicase [Coccidioides posa...   204   3e-50   Coccidioides posadasii str. Silveira
gi|355784406|gb|EHH65257.1| NFX1-type zinc finger-containing pro...   204   3e-50   Macaca fascicularis [crab eating macaque]
gi|426392066|ref|XP_004062381.1| PREDICTED: NFX1-type zinc finge...   204   3e-50   Gorilla gorilla gorilla [lowland gorilla]
gi|355563049|gb|EHH19611.1| NFX1-type zinc finger-containing pro...   204   3e-50   Macaca mulatta [rhesus macaque]
gi|402882293|ref|XP_003904682.1| PREDICTED: NFX1-type zinc finge...   204   4e-50   Papio anubis [Doguera baboon]
gi|10435893|dbj|BAB14696.1| unnamed protein product [Homo sapiens]    204   4e-50   Homo sapiens [man]
gi|488579792|ref|XP_004475354.1| PREDICTED: NFX1-type zinc finge...   204   4e-50   
gi|303319903|ref|XP_003069951.1| hypothetical protein CPC735_031...   204   4e-50   Coccidioides posadasii C735 delta SOWgp
gi|465957167|gb|EMP27284.1| NFX1-type zinc finger-containing pro...   203   5e-50   Chelonia mydas [green seaturtle]
gi|410953572|ref|XP_003983444.1| PREDICTED: NFX1-type zinc finge...   203   5e-50   Felis catus [cat]
gi|327288949|ref|XP_003229187.1| PREDICTED: NFX1-type zinc finge...   203   5e-50   
gi|74178788|dbj|BAE34040.1| unnamed protein product [Mus musculus]    203   5e-50   Mus musculus [mouse]
gi|472386465|ref|XP_004412584.1| PREDICTED: NFX1-type zinc finge...   203   6e-50   Odobenus rosmarus divergens
gi|239612124|gb|EEQ89111.1| DEAD box helicase [Ajellomyces derma...   203   7e-50   
gi|261202204|ref|XP_002628316.1| DEAD box helicase [Ajellomyces ...   203   7e-50   Blastomyces gilchristii SLH14081
gi|327352710|gb|EGE81567.1| DEAD box helicase [Ajellomyces derma...   203   7e-50   
gi|189192076|ref|XP_001932377.1| hypothetical protein PTRG_02044...   203   8e-50   Pyrenophora tritici-repentis Pt-1C-BFP
gi|332207763|ref|XP_003252965.1| PREDICTED: NFX1-type zinc finge...   202   8e-50   Nomascus leucogenys [White-cheeked Gibbon]
gi|255955913|ref|XP_002568709.1| Pc21g17110 [Penicillium chrysog...   202   9e-50   Penicillium rubens Wisconsin 54-1255
gi|119596068|gb|EAW75662.1| zinc finger, NFX1-type containing 1,...   202   9e-50   Homo sapiens [man]
gi|7243189|dbj|BAA92642.1| KIAA1404 protein [Homo sapiens]            202   1e-49   
gi|124487311|ref|NP_001028368.2| NFX1-type zinc finger-containin...   202   1e-49   Mus musculus [mouse]
gi|301754401|ref|XP_002913033.1| PREDICTED: NFX1-type zinc finge...   202   1e-49   Ailuropoda melanoleuca
gi|328716886|ref|XP_001950310.2| PREDICTED: NFX1-type zinc finge...   202   1e-49   
gi|281351105|gb|EFB26689.1| hypothetical protein PANDA_000811 [A...   202   2e-49   Ailuropoda melanoleuca
gi|345790175|ref|XP_534452.3| PREDICTED: NFX1-type zinc finger-c...   202   2e-49   Canis lupus familiaris [dogs]
gi|91079004|ref|XP_974762.1| PREDICTED: similar to Ab1-133 [Trib...   202   2e-49   
gi|28626521|ref|NP_066363.1| NFX1-type zinc finger-containing pr...   201   2e-49   Homo sapiens [man]
gi|270003675|gb|EFA00123.1| hypothetical protein TcasGA2_TC00293...   201   2e-49   
gi|317418761|emb|CBN80799.1| NFX1-type zinc finger-containing pr...   201   2e-49   Dicentrarchus labrax [European sea bass]
gi|145534704|ref|XP_001453096.1| hypothetical protein [Parameciu...   201   2e-49   Paramecium tetraurelia strain d4-2
gi|332858766|ref|XP_003317055.1| PREDICTED: NFX1-type zinc finge...   201   2e-49   Pan troglodytes
gi|330920768|ref|XP_003299143.1| hypothetical protein PTT_10078 ...   201   2e-49   Pyrenophora teres f. teres 0-1
gi|397475809|ref|XP_003809312.1| PREDICTED: NFX1-type zinc finge...   201   3e-49   Pan paniscus [bonobo]
gi|321462829|gb|EFX73849.1| hypothetical protein DAPPUDRAFT_1030...   201   3e-49   Daphnia pulex
gi|114145712|ref|NP_001041325.1| NFX1-type zinc finger-containin...   201   3e-49   Rattus norvegicus [brown rat]
gi|452002703|gb|EMD95161.1| hypothetical protein COCHEDRAFT_1201...   201   3e-49   Bipolaris maydis C5
gi|260797857|ref|XP_002593917.1| hypothetical protein BRAFLDRAFT...   200   4e-49   Branchiostoma floridae
gi|449486364|ref|XP_004177125.1| PREDICTED: LOW QUALITY PROTEIN:...   200   5e-49   
gi|505850720|ref|XP_004618813.1| PREDICTED: NFX1-type zinc finge...   200   6e-49   Sorex araneus [Eurasian shrew]
gi|296200674|ref|XP_002747680.1| PREDICTED: NFX1-type zinc finge...   200   6e-49   Callithrix jacchus [common marmoset]
gi|507560454|ref|XP_004663933.1| PREDICTED: NFX1-type zinc finge...   200   6e-49   Jaculus jaculus
gi|449667493|ref|XP_002169454.2| PREDICTED: NFX1-type zinc finge...   200   6e-49   
gi|240277784|gb|EER41292.1| DEAD box helicase [Ajellomyces capsu...   199   7e-49   Histoplasma capsulatum H143
gi|410920213|ref|XP_003973578.1| PREDICTED: LOW QUALITY PROTEIN:...   199   7e-49   
gi|345566427|gb|EGX49370.1| hypothetical protein AOL_s00078g403 ...   199   7e-49   Arthrobotrys oligospora ATCC 24927
gi|328721154|ref|XP_001947220.2| PREDICTED: NFX1-type zinc finge...   199   1e-48   
gi|291409989|ref|XP_002721251.1| PREDICTED: zinc finger, NFX1-ty...   199   1e-48   
gi|390347001|ref|XP_783430.3| PREDICTED: NFX1-type zinc finger-c...   199   1e-48   
gi|390365793|ref|XP_793245.3| PREDICTED: NFX1-type zinc finger-c...   199   1e-48   
gi|451847004|gb|EMD60312.1| hypothetical protein COCSADRAFT_9922...   199   1e-48   Bipolaris sorokiniana ND90Pr
gi|478255689|gb|ENN75900.1| hypothetical protein YQE_07542, part...   198   2e-48   Dendroctonus ponderosae
gi|344280070|ref|XP_003411808.1| PREDICTED: NFX1-type zinc finge...   198   2e-48   Loxodonta africana [African bush elephant]
gi|321475866|gb|EFX86828.1| hypothetical protein DAPPUDRAFT_2361...   198   2e-48   Daphnia pulex
gi|443703428|gb|ELU00979.1| hypothetical protein CAPTEDRAFT_6201...   198   2e-48   Capitella teleta
gi|390346985|ref|XP_003726678.1| PREDICTED: NFX1-type zinc finge...   197   3e-48   
gi|504147060|ref|XP_004585946.1| PREDICTED: NFX1-type zinc finge...   197   4e-48   Ochotona princeps [southern American pika]
gi|443728243|gb|ELU14669.1| hypothetical protein CAPTEDRAFT_7196...   197   4e-48   Capitella teleta
gi|315048871|ref|XP_003173810.1| helicase [Arthroderma gypseum C...   197   5e-48   Microsporum gypseum CBS 118893
gi|334312683|ref|XP_003339769.1| PREDICTED: NFX1-type zinc finge...   197   5e-48   
gi|507628052|ref|XP_004698372.1| PREDICTED: NFX1-type zinc finge...   197   6e-48   Echinops telfairi [lesser hedgehog tenrec]
gi|329664412|ref|NP_001192645.1| NFX1-type zinc finger-containin...   197   6e-48   Bos taurus [bovine]
gi|440902878|gb|ELR53613.1| NFX1-type zinc finger-containing pro...   196   6e-48   Bos mutus
gi|432110217|gb|ELK33990.1| NFX1-type zinc finger-containing pro...   196   6e-48   Myotis davidii
gi|512873806|ref|XP_002935580.2| PREDICTED: NFX1-type zinc finge...   196   7e-48   
gi|471359481|ref|XP_004370316.1| PREDICTED: NFX1-type zinc finge...   196   7e-48   Trichechus manatus latirostris
gi|403282333|ref|XP_003932606.1| PREDICTED: NFX1-type zinc finge...   196   7e-48   Saimiri boliviensis boliviensis
gi|391337700|ref|XP_003743203.1| PREDICTED: NFX1-type zinc finge...   196   9e-48   Metaseiulus occidentalis
gi|449274100|gb|EMC83383.1| NFX1-type zinc finger-containing pro...   196   1e-47   Columba livia [carrier pigeon]
gi|149733339|ref|XP_001503613.1| PREDICTED: NFX1-type zinc finge...   196   1e-47   Equus caballus [domestic horse]
gi|507962012|ref|XP_004687522.1| PREDICTED: NFX1-type zinc finge...   196   1e-47   Condylura cristata
gi|390367565|ref|XP_798620.3| PREDICTED: NFX1-type zinc finger-c...   196   1e-47   
gi|350597087|ref|XP_003362090.2| PREDICTED: NFX1-type zinc finge...   195   1e-47   
gi|431894477|gb|ELK04277.1| NFX1-type zinc finger-containing pro...   195   1e-47   Pteropus alecto
gi|390365791|ref|XP_784110.3| PREDICTED: NFX1-type zinc finger-c...   195   2e-47   
gi|328716878|ref|XP_001950343.2| PREDICTED: NFX1-type zinc finge...   195   2e-47   
gi|354480651|ref|XP_003502518.1| PREDICTED: NFX1-type zinc finge...   195   2e-47   
gi|444731360|gb|ELW71715.1| NFX1-type zinc finger-containing pro...   194   4e-47   Tupaia chinensis
gi|390363307|ref|XP_001182285.2| PREDICTED: NFX1-type zinc finge...   194   4e-47   
gi|426241601|ref|XP_004014678.1| PREDICTED: NFX1-type zinc finge...   192   1e-46   Ovis aries [domestic sheep]
gi|449664938|ref|XP_002169349.2| PREDICTED: NFX1-type zinc finge...   192   1e-46   
gi|395829167|ref|XP_003787732.1| PREDICTED: NFX1-type zinc finge...   192   1e-46   Otolemur garnettii
gi|212534558|ref|XP_002147435.1| DEAD box helicase involved in n...   191   2e-46   Talaromyces marneffei ATCC 18224
gi|121713068|ref|XP_001274145.1| ATP binding protein, putative [...   191   2e-46   Aspergillus clavatus NRRL 1
gi|317029894|ref|XP_001391481.2| ATP binding protein [Aspergillu...   191   2e-46   Aspergillus niger CBS 513.88
gi|482807600|gb|EOA84533.1| hypothetical protein SETTUDRAFT_2007...   191   2e-46   Setosphaeria turcica Et28A
gi|328721752|ref|XP_001946566.2| PREDICTED: NFX1-type zinc finge...   191   2e-46   Acyrthosiphon pisum
gi|407921970|gb|EKG15103.1| hypothetical protein MPH_07700 [Macr...   191   2e-46   Macrophomina phaseolina MS6
gi|294892293|ref|XP_002773991.1| NFX1-type zinc finger protein-c...   191   2e-46   Perkinsus marinus ATCC 50983
gi|443707031|gb|ELU02825.1| hypothetical protein CAPTEDRAFT_2129...   191   2e-46   Capitella teleta
gi|470637078|ref|XP_004323856.1| PREDICTED: NFX1-type zinc finge...   191   3e-46   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|466073492|ref|XP_004282934.1| PREDICTED: NFX1-type zinc finge...   191   3e-46   Orcinus orca [Orca]
gi|395506865|ref|XP_003757750.1| PREDICTED: NFX1-type zinc finge...   191   3e-46   
gi|378734027|gb|EHY60486.1| hypothetical protein, variant [Exoph...   191   3e-46   Exophiala dermatitidis NIH/UT8656
gi|378734028|gb|EHY60487.1| hypothetical protein HMPREF1120_0844...   191   3e-46   Exophiala dermatitidis NIH/UT8656
gi|294899060|ref|XP_002776476.1| hypothetical protein Pmar_PMAR0...   190   4e-46   Perkinsus marinus ATCC 50983
gi|328716874|ref|XP_003246062.1| PREDICTED: NFX1-type zinc finge...   190   5e-46   Acyrthosiphon pisum
gi|358369609|dbj|GAA86223.1| DEAD box helicase involved in nonse...   190   7e-46   Aspergillus kawachii IFO 4308
gi|296411245|ref|XP_002835344.1| hypothetical protein [Tuber mel...   189   8e-46   Tuber melanosporum Mel28
gi|328716888|ref|XP_001949997.2| PREDICTED: NFX1-type zinc finge...   189   8e-46   
gi|115644464|ref|XP_793206.2| PREDICTED: NFX1-type zinc finger-c...   189   1e-45   
gi|459175983|ref|XP_002125314.2| PREDICTED: NFX1-type zinc finge...   189   1e-45   
gi|390347005|ref|XP_003726682.1| PREDICTED: NFX1-type zinc finge...   189   1e-45   
gi|281203595|gb|EFA77792.1| NF-X1-type zinc finger-containing pr...   189   2e-45   Polysphondylium pallidum PN500
gi|340378128|ref|XP_003387580.1| PREDICTED: NFX1-type zinc finge...   188   2e-45   
gi|392891148|ref|NP_001254205.1| Protein ZK1067.2, isoform a [Ca...   187   5e-45   Caenorhabditis elegans [roundworm]
gi|392891146|ref|NP_001254204.1| Protein ZK1067.2, isoform b [Ca...   187   6e-45   Caenorhabditis elegans [roundworm]
gi|70997992|ref|XP_753728.1| DEAD box helicase involved in nonse...   186   6e-45   Aspergillus fumigatus Af293
gi|159126536|gb|EDP51652.1| ATP binding protein, putative [Asper...   186   6e-45   Aspergillus fumigatus A1163
gi|465959145|gb|EMP28273.1| NFX1-type zinc finger-containing pro...   186   9e-45   Chelonia mydas [green seaturtle]
gi|258564538|ref|XP_002583014.1| predicted protein [Uncinocarpus...   186   9e-45   Uncinocarpus reesii 1704
gi|281203594|gb|EFA77791.1| NF-X1-type Zn finger-containing prot...   186   9e-45   Polysphondylium pallidum PN500
gi|340378122|ref|XP_003387577.1| PREDICTED: NFX1-type zinc finge...   185   2e-44   Amphimedon queenslandica
gi|396462560|ref|XP_003835891.1| similar to NF-X1 finger and hel...   184   3e-44   Leptosphaeria maculans JN3
gi|340378200|ref|XP_003387616.1| PREDICTED: NFX1-type zinc finge...   184   4e-44   
gi|452985446|gb|EME85203.1| hypothetical protein MYCFIDRAFT_1348...   183   8e-44   Cercospora fijiensis CIRAD86
gi|391326567|ref|XP_003737784.1| PREDICTED: NFX1-type zinc finge...   182   1e-43   Metaseiulus occidentalis
gi|409044771|gb|EKM54252.1| hypothetical protein PHACADRAFT_1747...   182   1e-43   Phanerochaete carnosa HHB-10118-sp
gi|443711408|gb|ELU05196.1| hypothetical protein CAPTEDRAFT_1352...   182   2e-43   Capitella teleta
gi|321455284|gb|EFX66421.1| hypothetical protein DAPPUDRAFT_3322...   181   2e-43   Daphnia pulex
gi|170573366|ref|XP_001892441.1| hypothetical protein [Brugia ma...   181   4e-43   Brugia malayi [agent of lymphatic filariasis]
gi|449298169|gb|EMC94186.1| hypothetical protein BAUCODRAFT_1415...   180   5e-43   Baudoinia panamericana UAMH 10762
gi|189238133|ref|XP_001814326.1| PREDICTED: similar to NFX1-type...   179   9e-43   
gi|66821279|ref|XP_644135.1| hypothetical protein DDB_G0274483 [...   179   1e-42   Dictyostelium discoideum AX4
gi|317151632|ref|XP_001824793.2| ATP binding protein [Aspergillu...   179   1e-42   Aspergillus oryzae RIB40
gi|66815813|ref|XP_641923.1| NF-X1-type zinc finger-containing p...   179   1e-42   Dictyostelium discoideum AX4
gi|238505152|ref|XP_002383805.1| DEAD box helicase involved in n...   178   2e-42   Aspergillus flavus NRRL3357
gi|402084911|gb|EJT79929.1| hypothetical protein GGTG_05011 [Gae...   178   2e-42   Gaeumannomyces graminis var. tritici R3-111a-1
gi|340370919|ref|XP_003383993.1| PREDICTED: NFX1-type zinc finge...   178   3e-42   
gi|512206582|gb|EPE35401.1| P-loop containing nucleoside triphos...   177   6e-42   Glarea lozoyensis ATCC 20868
gi|134075955|emb|CAK48149.1| unnamed protein product [Aspergillu...   176   6e-42   Aspergillus niger
gi|350635573|gb|EHA23934.1| hypothetical protein ASPNIDRAFT_1815...   176   8e-42   Aspergillus niger ATCC 1015
gi|296416458|ref|XP_002837896.1| hypothetical protein [Tuber mel...   176   1e-41   Tuber melanosporum Mel28
gi|347841006|emb|CCD55578.1| hypothetical protein BofuT4_P155690...   176   1e-41   Botrytis cinerea T4
gi|472240422|gb|EMR85193.1| putative dead box helicase protein [...   176   1e-41   Botrytis cinerea BcDW1
gi|290981792|ref|XP_002673615.1| Zinc-finger domain-containing p...   175   2e-41   Naegleria gruberi strain NEG-M
gi|258570863|ref|XP_002544235.1| predicted protein [Uncinocarpus...   174   3e-41   Uncinocarpus reesii 1704
gi|395325918|gb|EJF58333.1| hypothetical protein DICSQDRAFT_1102...   174   4e-41   Dichomitus squalens LYAD-421 SS1
gi|393911665|gb|EJD76411.1| NFX1-type zinc finger-containing pro...   174   4e-41   Loa loa
gi|440640027|gb|ELR09946.1| hypothetical protein GMDG_04422 [Geo...   174   4e-41   Pseudogymnoascus destructans 20631-21
gi|477585958|gb|ENI03044.1| hypothetical protein COCC4DRAFT_6285...   173   6e-41   Bipolaris maydis ATCC 48331
gi|451994177|gb|EMD86648.1| hypothetical protein COCHEDRAFT_1185...   173   6e-41   Bipolaris maydis C5
gi|340378126|ref|XP_003387579.1| PREDICTED: NFX1-type zinc finge...   173   6e-41   Amphimedon queenslandica
gi|302501773|ref|XP_003012878.1| hypothetical protein ARB_00760 ...   173   7e-41   Arthroderma benhamiae CBS 112371
gi|169600809|ref|XP_001793827.1| hypothetical protein SNOG_03257...   173   8e-41   Parastagonospora nodorum SN15
gi|302686188|ref|XP_003032774.1| hypothetical protein SCHCODRAFT...   172   1e-40   Schizophyllum commune H4-8
gi|170092415|ref|XP_001877429.1| predicted protein [Laccaria bic...   172   1e-40   Laccaria bicolor S238N-H82
gi|154285632|ref|XP_001543611.1| predicted protein [Ajellomyces ...   172   1e-40   Histoplasma capsulatum NAm1
gi|396500111|ref|XP_003845643.1| similar to helicase required fo...   172   1e-40   Leptosphaeria maculans JN3
gi|328723535|ref|XP_003247867.1| PREDICTED: NFX1-type zinc finge...   172   2e-40   
gi|428181268|gb|EKX50132.1| hypothetical protein GUITHDRAFT_5727...   171   2e-40   Guillardia theta CCMP2712
gi|393214645|gb|EJD00138.1| P-loop containing nucleoside triphos...   171   2e-40   Fomitiporia mediterranea MF3/22
gi|119479501|ref|XP_001259779.1| ATP binding protein, putative [...   171   3e-40   Aspergillus fischeri NRRL 181
gi|452843136|gb|EME45071.1| hypothetical protein DOTSEDRAFT_5245...   171   4e-40   Dothistroma septosporum NZE10
gi|255936813|ref|XP_002559433.1| Pc13g10110 [Penicillium chrysog...   170   7e-40   Penicillium rubens Wisconsin 54-1255
gi|389624197|ref|XP_003709752.1| hypothetical protein MGG_11779 ...   169   1e-39   Magnaporthe oryzae 70-15
gi|307108148|gb|EFN56389.1| hypothetical protein CHLNCDRAFT_1449...   169   1e-39   Chlorella variabilis
gi|225557229|gb|EEH05516.1| helicase required for RNAi-mediated ...   169   1e-39   Histoplasma capsulatum G186AR
gi|494828902|gb|EON65660.1| hypothetical protein W97_04899 [Coni...   168   3e-39   Coniosporium apollinis CBS 100218
gi|341902841|gb|EGT58776.1| hypothetical protein CAEBREN_17840 [...   167   4e-39   Caenorhabditis brenneri
gi|169607895|ref|XP_001797367.1| hypothetical protein SNOG_07011...   167   4e-39   Parastagonospora nodorum SN15
gi|453082493|gb|EMF10540.1| P-loop containing nucleoside triphos...   167   5e-39   Sphaerulina musiva SO2202
gi|440467163|gb|ELQ36401.1| hypothetical protein OOU_Y34scaffold...   167   5e-39   Magnaporthe oryzae Y34
gi|380489050|emb|CCF36962.1| hypothetical protein CH063_00242 [C...   166   8e-39   Colletotrichum higginsianum
gi|345328222|ref|XP_003431252.1| PREDICTED: LOW QUALITY PROTEIN:...   166   8e-39   
gi|302668358|ref|XP_003025751.1| NF-X1 finger and helicase domai...   166   1e-38   Trichophyton verrucosum HKI 0517
gi|118365347|ref|XP_001015894.1| hypothetical protein TTHERM_002...   165   1e-38   
gi|393244936|gb|EJD52447.1| P-loop containing nucleoside triphos...   165   2e-38   Auricularia subglabra TFB-10046 SS5
gi|395752432|ref|XP_002830451.2| PREDICTED: LOW QUALITY PROTEIN:...   165   2e-38   
gi|296817639|ref|XP_002849156.1| helicase required for RNAi-medi...   165   2e-38   Arthroderma otae CBS 113480
gi|471226226|ref|XP_004032160.1| nfx1-type zinc finger protein, ...   164   3e-38   Ichthyophthirius multifiliis
gi|392579889|gb|EIW73016.1| hypothetical protein TREMEDRAFT_5918...   164   3e-38   Tremella mesenterica DSM 1558
gi|348680039|gb|EGZ19855.1| hypothetical protein PHYSODRAFT_2982...   164   4e-38   Phytophthora sojae
gi|327305767|ref|XP_003237575.1| hypothetical protein TERG_02292...   164   4e-38   Trichophyton rubrum CBS 118892
gi|512897300|ref|XP_004924119.1| PREDICTED: NFX1-type zinc finge...   164   5e-38   Bombyx mori [silk moth]
gi|350639341|gb|EHA27695.1| hypothetical protein ASPNIDRAFT_2256...   164   5e-38   Aspergillus niger ATCC 1015
gi|350636678|gb|EHA25037.1| hypothetical protein ASPNIDRAFT_1187...   163   6e-38   Aspergillus niger ATCC 1015
gi|470251700|ref|XP_004358947.1| NF-X1-type zinc finger-containi...   163   6e-38   Dictyostelium fasciculatum
gi|121710124|ref|XP_001272678.1| NF-X1 finger and helicase domai...   163   8e-38   Aspergillus clavatus NRRL 1
gi|367031220|ref|XP_003664893.1| hypothetical protein MYCTH_2066...   162   9e-38   Myceliophthora thermophila ATCC 42464
gi|358383864|gb|EHK21525.1| hypothetical protein TRIVIDRAFT_1921...   162   1e-37   Trichoderma virens Gv29-8
gi|310795000|gb|EFQ30461.1| hypothetical protein GLRG_05605 [Glo...   162   1e-37   Colletotrichum graminicola M1.001
gi|308470136|ref|XP_003097303.1| hypothetical protein CRE_20452 ...   160   4e-37   Caenorhabditis remanei
gi|408395108|gb|EKJ74295.1| hypothetical protein FPSE_05592 [Fus...   160   5e-37   Fusarium pseudograminearum CS3096
gi|320588943|gb|EFX01411.1| nf-x1 finger and helicase domain con...   160   5e-37   Grosmannia clavigera kw1407
gi|477532062|gb|ENH83721.1| nf-x1 finger and helicase domain-con...   160   7e-37   Colletotrichum orbiculare MAFF 240422
gi|402590799|gb|EJW84729.1| hypothetical protein WUBG_04360, par...   160   8e-37   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|395332863|gb|EJF65241.1| P-loop containing nucleoside triphos...   160   8e-37   Dichomitus squalens LYAD-421 SS1
gi|402073487|gb|EJT69065.1| hypothetical protein GGTG_13333 [Gae...   159   8e-37   Gaeumannomyces graminis var. tritici R3-111a-1
gi|459178510|ref|XP_002123903.2| PREDICTED: NFX1-type zinc finge...   159   8e-37   
gi|428167979|gb|EKX36930.1| hypothetical protein GUITHDRAFT_1169...   159   9e-37   Guillardia theta CCMP2712
gi|390602305|gb|EIN11698.1| P-loop containing nucleoside triphos...   159   9e-37   Punctularia strigosozonata HHB-11173 SS5
gi|392561456|gb|EIW54637.1| hypothetical protein TRAVEDRAFT_6018...   159   1e-36   Trametes versicolor FP-101664 SS1
gi|449546546|gb|EMD37515.1| hypothetical protein CERSUDRAFT_1141...   159   1e-36   Gelatoporia subvermispora B
gi|83773533|dbj|BAE63660.1| unnamed protein product [Aspergillus...   159   1e-36   Aspergillus oryzae RIB40
gi|302884285|ref|XP_003041039.1| hypothetical protein NECHADRAFT...   159   1e-36   Nectria haematococca mpVI 77-13-4
gi|391867177|gb|EIT76427.1| helicase [Aspergillus oryzae 3.042]       159   1e-36   Aspergillus oryzae 3.042
gi|358371255|dbj|GAA87864.1| NF-X1 finger and helicase domain pr...   159   2e-36   Aspergillus kawachii IFO 4308
gi|302758358|ref|XP_002962602.1| hypothetical protein SELMODRAFT...   159   2e-36   Selaginella moellendorffii
gi|470272193|ref|XP_004363057.1| NF-X1-type zinc finger-containi...   158   2e-36   Dictyostelium fasciculatum
gi|452978788|gb|EME78551.1| hypothetical protein MYCFIDRAFT_3711...   158   2e-36   Cercospora fijiensis CIRAD86
gi|242803834|ref|XP_002484253.1| DNA-binding protein smubp-2, pu...   158   2e-36   Talaromyces stipitatus ATCC 10500
gi|367048625|ref|XP_003654692.1| hypothetical protein THITE_5144...   158   3e-36   Thielavia terrestris NRRL 8126
gi|226287063|gb|EEH42576.1| helicase required for RNAi-mediated ...   158   3e-36   
gi|330845645|ref|XP_003294687.1| hypothetical protein DICPUDRAFT...   157   4e-36   Dictyostelium purpureum
gi|353239548|emb|CCA71455.1| related to ECM32-DNA dependent ATPa...   157   4e-36   Serendipita indica DSM 11827
gi|301106330|ref|XP_002902248.1| conserved hypothetical protein ...   157   5e-36   
gi|46111837|ref|XP_382976.1| hypothetical protein FG02800.1 [Fus...   157   6e-36   
gi|29150104|emb|CAD79665.1| conserved hypothetical protein [Neur...   157   6e-36   
gi|296804048|ref|XP_002842876.1| Ab1-133 [Arthroderma otae CBS 1...   156   7e-36   
gi|367020988|ref|XP_003659779.1| hypothetical protein MYCTH_2115...   156   8e-36   
gi|242759801|ref|XP_002339861.1| NF-X1 finger and helicase domai...   156   9e-36   
gi|118365349|ref|XP_001015895.1| hypothetical protein TTHERM_002...   156   9e-36   
gi|392570407|gb|EIW63580.1| P-loop containing nucleoside triphos...   155   1e-35   
gi|401885664|gb|EJT49765.1| hypothetical protein A1Q1_01079 [Tri...   155   2e-35   
gi|398397913|ref|XP_003852414.1| hypothetical protein MYCGRDRAFT...   155   2e-35   
gi|70989597|ref|XP_749648.1| NF-X1 finger and helicase domain pr...   154   3e-35   
gi|119480227|ref|XP_001260142.1| NF-X1 finger and helicase prote...   154   3e-35   
gi|357628086|gb|EHJ77536.1| putative NFX1-type zinc finger-conta...   154   3e-35   
gi|159129055|gb|EDP54169.1| NF-X1 finger and helicase domain pro...   154   3e-35   
gi|342887113|gb|EGU86743.1| hypothetical protein FOXB_02752 [Fus...   154   4e-35   
gi|224003229|ref|XP_002291286.1| predicted protein [Thalassiosir...   154   4e-35   
gi|340519506|gb|EGR49744.1| predicted protein [Trichoderma reese...   154   6e-35   
gi|145514259|ref|XP_001443040.1| hypothetical protein [Parameciu...   153   6e-35   
gi|350296190|gb|EGZ77167.1| hypothetical protein NEUTE2DRAFT_537...   153   9e-35   
gi|482804916|gb|EOA82015.1| hypothetical protein SETTUDRAFT_9693...   152   1e-34   
gi|388858009|emb|CCF48454.1| uncharacterized protein [Ustilago h...   152   2e-34   
gi|171684203|ref|XP_001907043.1| hypothetical protein [Podospora...   151   2e-34   
gi|315046896|ref|XP_003172823.1| NFX1-type zinc finger-containin...   151   3e-34   
gi|157109279|ref|XP_001650601.1| DNA-binding protein smubp-2 [Ae...   151   3e-34   
gi|336467815|gb|EGO55979.1| hypothetical protein NEUTE1DRAFT_680...   150   4e-34   
gi|389745692|gb|EIM86873.1| hypothetical protein STEHIDRAFT_1473...   150   5e-34   
gi|393230557|gb|EJD38161.1| P-loop containing nucleoside triphos...   150   7e-34   
gi|440635071|gb|ELR04990.1| hypothetical protein GMDG_00247 [Geo...   149   1e-33   
gi|400593482|gb|EJP61427.1| NFX1-type zinc finger-containing pro...   149   1e-33   
gi|212539724|ref|XP_002150017.1| NF-X1 finger and helicase domai...   149   1e-33   
gi|268529120|ref|XP_002629686.1| Hypothetical protein CBG00906 [...   149   2e-33   
gi|170052247|ref|XP_001862135.1| NFX1-type zinc finger-containin...   149   2e-33   
gi|348680030|gb|EGZ19846.1| hypothetical protein PHYSODRAFT_5434...   148   2e-33   
gi|340521039|gb|EGR51274.1| predicted protein [Trichoderma reese...   148   2e-33   
gi|449303759|gb|EMC99766.1| hypothetical protein BAUCODRAFT_3485...   148   3e-33   
gi|323454482|gb|EGB10352.1| hypothetical protein AURANDRAFT_7119...   147   5e-33   
gi|85094279|ref|XP_959852.1| hypothetical protein NCU05861 [Neur...   146   7e-33   
gi|367043012|ref|XP_003651886.1| hypothetical protein THITE_2149...   146   8e-33   
gi|453080632|gb|EMF08682.1| hypothetical protein SEPMUDRAFT_1663...   146   9e-33   
gi|325093864|gb|EGC47174.1| helicase required for RNAi-mediated ...   145   1e-32   
gi|472241452|gb|EMR86172.1| putative nf-x1 finger and helicase d...   145   1e-32   
gi|134081514|emb|CAK41950.1| unnamed protein product [Aspergillu...   145   1e-32   
gi|345569592|gb|EGX52458.1| hypothetical protein AOL_s00043g247 ...   145   1e-32   
gi|398405274|ref|XP_003854103.1| DNA2/NAM7 helicase, partial [Zy...   145   2e-32   
gi|390597913|gb|EIN07312.1| P-loop containing nucleoside triphos...   145   2e-32   
gi|429848647|gb|ELA24105.1| nf-x1 finger and helicase domain-con...   145   2e-32   
gi|347827199|emb|CCD42896.1| similar to NF-X1 finger and helicas...   145   3e-32   
gi|145514213|ref|XP_001443017.1| hypothetical protein [Parameciu...   144   3e-32   
gi|313229973|emb|CBY07678.1| unnamed protein product [Oikopleura...   144   3e-32   
gi|312079817|ref|XP_003142336.1| hypothetical protein LOAG_06752...   144   3e-32   
gi|344249400|gb|EGW05504.1| NFX1-type zinc finger-containing pro...   144   3e-32   
gi|389745412|gb|EIM86593.1| hypothetical protein STEHIDRAFT_1110...   143   8e-32   
gi|336260000|ref|XP_003344798.1| hypothetical protein SMAC_09205...   142   1e-31   
gi|116192731|ref|XP_001222178.1| hypothetical protein CHGG_06083...   142   1e-31   
gi|390356781|ref|XP_797977.2| PREDICTED: NFX1-type zinc finger-c...   142   2e-31   
gi|345562128|gb|EGX45200.1| hypothetical protein AOL_s00173g301 ...   142   2e-31   
gi|134080835|emb|CAK41395.1| unnamed protein product [Aspergillu...   141   3e-31   
gi|313220481|emb|CBY31333.1| unnamed protein product [Oikopleura...   141   3e-31   
gi|477512675|gb|ENH65209.1| NFX1-type zinc finger-containing pro...   140   6e-31   
gi|171678507|ref|XP_001904203.1| hypothetical protein [Podospora...   139   1e-30   
gi|429239285|ref|NP_588411.2| Helicase Required for RNAi-mediate...   139   2e-30   
gi|242221149|ref|XP_002476329.1| predicted protein [Postia place...   137   6e-30   
gi|389744089|gb|EIM85272.1| hypothetical protein STEHIDRAFT_1118...   137   6e-30   
gi|299470278|emb|CBN79582.1| NF-X1 finger and helicase domain pr...   137   7e-30   
gi|409043423|gb|EKM52906.1| hypothetical protein PHACADRAFT_1869...   136   8e-30   
gi|156042127|ref|XP_001587621.1| hypothetical protein SS1G_11614...   136   8e-30   
gi|328716524|ref|XP_003245970.1| PREDICTED: NFX1-type zinc finge...   136   1e-29   
gi|478255694|gb|ENN75905.1| hypothetical protein YQE_07547, part...   136   1e-29   
gi|242826500|ref|XP_002488654.1| nonsense-mediated mRNA decay pr...   135   2e-29   
gi|407916894|gb|EKG10223.1| CbxX/CfqX [Macrophomina phaseolina MS6]   135   2e-29   
gi|475663248|gb|EMT61043.1| NFX1-type zinc finger-containing pro...   135   2e-29   
gi|317034143|ref|XP_001396094.2| NF-X1 finger and helicase domai...   135   2e-29   
gi|315051110|ref|XP_003174929.1| NFX1-type zinc finger-containin...   135   2e-29   
gi|313242270|emb|CBY34431.1| unnamed protein product [Oikopleura...   134   3e-29   
gi|313231756|emb|CBY08869.1| unnamed protein product [Oikopleura...   133   8e-29   
gi|341038711|gb|EGS23703.1| helicase-like protein [Chaetomium th...   133   1e-28   
gi|402220379|gb|EJU00451.1| NFX1-type zinc finger-containing pro...   132   1e-28   
gi|392586148|gb|EIW75485.1| P-loop containing nucleoside triphos...   132   2e-28   
gi|409046743|gb|EKM56223.1| hypothetical protein PHACADRAFT_2096...   132   2e-28   
gi|451999056|gb|EMD91519.1| hypothetical protein COCHEDRAFT_1030...   132   2e-28   
gi|189189838|ref|XP_001931258.1| NFX1-type zinc finger-containin...   132   2e-28   
gi|470326737|ref|XP_004364776.1| hypothetical protein CAOG_01908...   131   3e-28   
gi|392593727|gb|EIW83052.1| hypothetical protein CONPUDRAFT_8904...   131   4e-28   
gi|296808033|ref|XP_002844355.1| NFX1-type zinc finger-containin...   130   4e-28   
gi|242210963|ref|XP_002471322.1| predicted protein [Postia place...   130   4e-28   
gi|317158514|ref|XP_001826977.2| NF-X1 finger and helicase domai...   130   4e-28   
gi|320591685|gb|EFX04124.1| aaa family ATPase [Grosmannia clavig...   130   5e-28   
gi|328713866|ref|XP_001943586.2| PREDICTED: NFX1-type zinc finge...   130   7e-28   
gi|116204371|ref|XP_001227996.1| hypothetical protein CHGG_10069...   130   7e-28   
gi|343415967|emb|CCD20499.1| hypothetical protein, conserved (fr...   130   8e-28   
gi|302898482|ref|XP_003047858.1| hypothetical protein NECHADRAFT...   129   9e-28   
gi|195108477|ref|XP_001998819.1| GI23421 [Drosophila mojavensis]...   129   1e-27   
gi|299745186|ref|XP_002910884.1| CbxX/CfqX family protein [Copri...   129   2e-27   
gi|406864534|gb|EKD17579.1| NFX1-type zinc finger-containing pro...   128   2e-27   
gi|328857801|gb|EGG06916.1| hypothetical protein MELLADRAFT_8628...   128   2e-27   
gi|242766202|ref|XP_002341125.1| conserved hypothetical protein ...   128   3e-27   
gi|400592834|gb|EJP60885.1| ATPase protein [Beauveria bassiana A...   128   3e-27   
gi|336273762|ref|XP_003351635.1| hypothetical protein SMAC_00177...   128   3e-27   
gi|330906131|ref|XP_003295365.1| hypothetical protein PTT_00581 ...   127   3e-27   
gi|406864311|gb|EKD17356.1| helicase [Marssonina brunnea f. sp. ...   127   4e-27   
gi|408396914|gb|EKJ76067.1| hypothetical protein FPSE_03839 [Fus...   127   5e-27   
gi|336464111|gb|EGO52351.1| hypothetical protein NEUTE1DRAFT_114...   127   5e-27   
gi|322703789|gb|EFY95393.1| NF-X1 finger and helicase domain pro...   127   6e-27   
gi|482814831|gb|EOA91506.1| hypothetical protein SETTUDRAFT_1780...   126   8e-27   
gi|358400741|gb|EHK50067.1| hypothetical protein TRIATDRAFT_2125...   125   1e-26   
gi|358030257|tpg|DAA34977.1| TPA_inf: suppressor of ascus domina...   125   2e-26   
gi|170086888|ref|XP_001874667.1| predicted protein [Laccaria bic...   125   2e-26   
gi|322693974|gb|EFY85817.1| NF-X1 finger and helicase domain pro...   125   2e-26   
gi|46110813|ref|XP_382464.1| hypothetical protein FG02288.1 [Fus...   125   2e-26   
gi|336388064|gb|EGO29208.1| hypothetical protein SERLADRAFT_4332...   125   2e-26   
gi|336375110|gb|EGO03446.1| hypothetical protein SERLA73DRAFT_16...   125   2e-26   
gi|145514558|ref|XP_001443184.1| hypothetical protein [Parameciu...   125   2e-26   
gi|512188534|gb|EPE04305.1| hypothetical protein F503_01309 [Oph...   125   2e-26   
gi|403419792|emb|CCM06492.1| predicted protein [Fibroporia radic...   125   2e-26   
gi|443922896|gb|ELU42248.1| NF-X1 finger and helicase domain-con...   124   4e-26   
gi|159491124|ref|XP_001703523.1| predicted protein [Chlamydomona...   124   4e-26   
gi|392588185|gb|EIW77517.1| P-loop containing nucleoside triphos...   124   5e-26   
gi|471873679|emb|CCO36196.1| NFX1-type zinc finger-containing pr...   124   5e-26   
gi|195400034|ref|XP_002058623.1| GJ14524 [Drosophila virilis] >g...   123   7e-26   
gi|83775724|dbj|BAE65844.1| unnamed protein product [Aspergillus...   123   8e-26   
gi|453083283|gb|EMF11329.1| AAA family ATPase [Mycosphaerella po...   123   1e-25   
gi|389747912|gb|EIM89090.1| P-loop containing nucleoside triphos...   122   1e-25   
gi|512188132|gb|EPE03906.1| aaa family ATPase [Ophiostoma piceae...   122   1e-25   
gi|390178226|ref|XP_003736600.1| GA19438 [Drosophila pseudoobscu...   122   2e-25   
gi|403417579|emb|CCM04279.1| predicted protein [Fibroporia radic...   121   3e-25   
gi|353236417|emb|CCA68412.1| related to ECM32-DNA dependent ATPa...   121   3e-25   
gi|471573057|gb|EMR71302.1| putative atp binding protein [Eutypa...   121   4e-25   
gi|302674952|ref|XP_003027160.1| hypothetical protein SCHCODRAFT...   121   4e-25   
gi|159467975|ref|XP_001692158.1| hypothetical protein CHLREDRAFT...   120   5e-25   
gi|451846511|gb|EMD59821.1| hypothetical protein COCSADRAFT_1524...   120   5e-25   
gi|154303448|ref|XP_001552131.1| hypothetical protein BC1G_09295...   120   5e-25   
gi|213407166|ref|XP_002174354.1| helicase required for RNAi-medi...   120   5e-25   
gi|195144876|ref|XP_002013422.1| GL23416 [Drosophila persimilis]...   120   6e-25   
gi|472245649|gb|EMR90210.1| putative nfx1-type zinc finger-conta...   120   8e-25   
gi|116205539|ref|XP_001228580.1| hypothetical protein CHGG_10653...   120   8e-25   
gi|299115979|emb|CBN75980.1| conserved unknown protein [Ectocarp...   118   2e-24   
gi|340515995|gb|EGR46246.1| predicted protein [Trichoderma reese...   118   3e-24   
gi|195504885|ref|XP_002099271.1| GE23459 [Drosophila yakuba] >gi...   118   3e-24   
gi|500254637|gb|EON98222.1| putative atp binding protein [Tognin...   117   4e-24   
gi|409039040|gb|EKM48784.1| hypothetical protein PHACADRAFT_2024...   117   4e-24   
gi|390359949|ref|XP_003729597.1| PREDICTED: NFX1-type zinc finge...   117   4e-24   
gi|194909855|ref|XP_001982024.1| GG11267 [Drosophila erecta] >gi...   117   4e-24   
gi|195331558|ref|XP_002032468.1| GM26572 [Drosophila sechellia] ...   117   4e-24   
gi|402076918|gb|EJT72267.1| hypothetical protein GGTG_09133 [Gae...   117   6e-24   
gi|477534353|gb|ENH85904.1| nfx1-type zinc finger-containing pro...   117   7e-24   
gi|302835992|ref|XP_002949557.1| hypothetical protein VOLCADRAFT...   116   8e-24   
gi|429847859|gb|ELA23409.1| dead box helicase [Colletotrichum gl...   116   9e-24   
gi|121717079|ref|XP_001276002.1| AAA family ATPase, putative [As...   116   1e-23   
gi|348680033|gb|EGZ19849.1| hypothetical protein PHYSODRAFT_2982...   116   1e-23   
gi|358379539|gb|EHK17219.1| hypothetical protein TRIVIDRAFT_2105...   116   1e-23   
gi|201066019|gb|ACH92419.1| FI07760p [Drosophila melanogaster]        116   1e-23   
gi|425768772|gb|EKV07288.1| hypothetical protein PDIG_73630 [Pen...   116   1e-23   
gi|24649577|ref|NP_651229.2| CG6204 [Drosophila melanogaster] >g...   115   1e-23   
gi|195036422|ref|XP_001989669.1| GH18666 [Drosophila grimshawi] ...   115   2e-23   
gi|345563128|gb|EGX46132.1| hypothetical protein AOL_s00110g296 ...   115   2e-23   
gi|459186757|ref|XP_004227546.1| PREDICTED: NFX1-type zinc finge...   115   3e-23   
gi|195108479|ref|XP_001998820.1| GI24178 [Drosophila mojavensis]...   114   3e-23   
gi|380483884|emb|CCF40348.1| hypothetical protein CH063_10938, p...   114   3e-23   
gi|342890119|gb|EGU88984.1| hypothetical protein FOXB_00496 [Fus...   114   3e-23   
gi|336259998|ref|XP_003344797.1| hypothetical protein SMAC_09204...   114   4e-23   
gi|16183177|gb|AAL13650.1| GH20028p [Drosophila melanogaster]         114   4e-23   
gi|390359951|ref|XP_003729598.1| PREDICTED: NFX1-type zinc finge...   114   5e-23   
gi|158295594|ref|XP_316302.4| AGAP006235-PA [Anopheles gambiae s...   114   6e-23   
gi|242221135|ref|XP_002476322.1| predicted protein [Postia place...   114   6e-23   
gi|429856683|gb|ELA31580.1| AAA family [Colletotrichum gloeospor...   113   7e-23   
gi|238583279|ref|XP_002390191.1| hypothetical protein MPER_10574...   113   7e-23   
gi|440468543|gb|ELQ37700.1| hypothetical protein OOU_Y34scaffold...   113   7e-23   
gi|85091508|ref|XP_958936.1| hypothetical protein NCU09357 [Neur...   113   8e-23   
gi|67900518|ref|XP_680515.1| hypothetical protein AN7246.2 [Aspe...   113   9e-23   
gi|511009842|gb|EPB91075.1| hypothetical protein HMPREF1544_0214...   112   2e-22   
gi|336264969|ref|XP_003347259.1| hypothetical protein SMAC_08696...   112   2e-22   
gi|195573399|ref|XP_002104681.1| GD21076 [Drosophila simulans] >...   111   2e-22   
gi|398398655|ref|XP_003852785.1| hypothetical protein MYCGRDRAFT...   111   3e-22   
gi|507108357|emb|CDF32339.1| unnamed protein product [Chondrus c...   111   3e-22   
gi|390360610|ref|XP_003729730.1| PREDICTED: NFX1-type zinc finge...   111   4e-22   
gi|512205381|gb|EPE34203.1| P-loop containing nucleoside triphos...   111   4e-22   
gi|498951400|ref|XP_004523170.1| PREDICTED: NFX1-type zinc finge...   111   4e-22   
gi|255931053|ref|XP_002557083.1| Pc12g01880 [Penicillium chrysog...   110   4e-22   
gi|392592126|gb|EIW81453.1| hypothetical protein CONPUDRAFT_1245...   110   4e-22   
gi|336467930|gb|EGO56093.1| hypothetical protein NEUTE1DRAFT_146...   110   6e-22   
gi|346319467|gb|EGX89068.1| DEAD box helicase [Cordyceps militar...   110   7e-22   
gi|195400032|ref|XP_002058622.1| GJ14213 [Drosophila virilis] >g...   109   1e-21   
gi|322695791|gb|EFY87593.1| AAA family ATPase, putative [Metarhi...   109   1e-21   
gi|389602090|ref|XP_001566550.2| conserved hypothetical protein ...   109   1e-21   
gi|327356243|gb|EGE85100.1| hypothetical protein BDDG_08045 [Aje...   109   1e-21   
gi|317145220|ref|XP_001820601.2| AAA family ATPase [Aspergillus ...   108   2e-21   
gi|46110497|ref|XP_382306.1| hypothetical protein FG02130.1 [Fus...   108   2e-21   
gi|358374871|dbj|GAA91460.1| AAA family ATPase [Aspergillus kawa...   108   3e-21   
gi|358398308|gb|EHK47666.1| hypothetical protein TRIATDRAFT_3166...   108   3e-21   
gi|485646079|gb|EOD39631.1| hypothetical protein EMIHUDRAFT_4621...   107   5e-21   
gi|485622737|gb|EOD19063.1| hypothetical protein EMIHUDRAFT_4701...   107   5e-21   
gi|399168486|emb|CCE30747.1| related to NAM7-nonsense-mediated m...   107   5e-21   
gi|408400160|gb|EKJ79245.1| hypothetical protein FPSE_00556 [Fus...   107   8e-21   
gi|452981612|gb|EME81372.1| hypothetical protein MYCFIDRAFT_1398...   106   8e-21   
gi|477514512|gb|ENH66890.1| NFX1-type zinc finger-containing pro...   106   8e-21   
gi|451994631|gb|EMD87101.1| hypothetical protein COCHEDRAFT_1197...   106   9e-21   
gi|470405719|ref|XP_004335884.1| mRNA decay factorlike protein [...   106   1e-20   
gi|428184252|gb|EKX53108.1| hypothetical protein GUITHDRAFT_6472...   106   1e-20   
gi|348669304|gb|EGZ09127.1| hypothetical protein PHYSODRAFT_5245...   106   1e-20   
gi|390355660|ref|XP_003728602.1| PREDICTED: NFX1-type zinc finge...   105   1e-20   
gi|470236732|ref|XP_004350319.1| helicase [Dictyostelium fascicu...   105   2e-20   
gi|330906206|ref|XP_003295390.1| hypothetical protein PTT_00729 ...   105   2e-20   
gi|194746440|ref|XP_001955688.1| GF16115 [Drosophila ananassae] ...   105   2e-20   
gi|156345413|ref|XP_001621356.1| hypothetical protein NEMVEDRAFT...   104   3e-20   
gi|389594087|ref|XP_003722292.1| conserved hypothetical protein ...   104   4e-20   
gi|399171425|emb|CCE27615.1| related to ECM32-DNA dependent ATPa...   104   4e-20   
gi|85091955|ref|XP_959155.1| hypothetical protein NCU09211 [Neur...   104   4e-20   
gi|401415706|ref|XP_003872348.1| conserved hypothetical protein ...   104   5e-20   
gi|310790313|gb|EFQ25846.1| ATPase [Glomerella graminicola M1.001]    104   5e-20   
gi|400598415|gb|EJP66132.1| ATP binding protein [Beauveria bassi...   103   6e-20   
gi|167516626|ref|XP_001742654.1| hypothetical protein [Monosiga ...   103   7e-20   
gi|350289832|gb|EGZ71057.1| P-loop containing nucleoside triphos...   103   1e-19   
gi|340053974|emb|CCC48268.1| conserved hypothetical protein, fra...   103   1e-19   
gi|261200711|ref|XP_002626756.1| NF-X1 finger and helicase domai...   103   1e-19   
gi|384486429|gb|EIE78609.1| hypothetical protein RO3G_03313 [Rhi...   102   2e-19   
gi|388852346|emb|CCF53961.1| probable NAM7-nonsense-mediated mRN...   102   2e-19   
gi|340721323|ref|XP_003399072.1| PREDICTED: regulator of nonsens...   102   2e-19   
gi|350406741|ref|XP_003487867.1| PREDICTED: regulator of nonsens...   102   2e-19   
gi|383847285|ref|XP_003699285.1| PREDICTED: regulator of nonsens...   102   2e-19   
gi|301108854|ref|XP_002903508.1| conserved hypothetical protein ...   102   2e-19   
gi|383847287|ref|XP_003699286.1| PREDICTED: regulator of nonsens...   102   2e-19   


>gi|321460304|gb|EFX71347.1| hypothetical protein DAPPUDRAFT_129702 [Daphnia pulex]
          Length = 914

 Score =  241 bits (615), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 185/356 (51%), Gaps = 12/356 (3%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+ P  +  L +H  V  YPDV G+  N+FF  H E E  + +  S  N +E  
Sbjct: 150 RPEIARLIVPSIYPTLENHSSVLEYPDVRGMASNVFFLAHTEQEVEDNEGKSHLNPYEVD 209

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           +   LA +L+M G    +ITIL+ YSGQ    +K  R  S     ++ +R+S VD FQGE
Sbjct: 210 LSLALARHLIMQGYTPEQITILTTYSGQLLHFFKVRRSHS----AVQSVRISVVDNFQGE 265

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDIIILSLVRS+  +  IGFL I NR+CVALSRAKHG Y+ GN   L+ +S LW  +  
Sbjct: 266 ENDIIILSLVRSN-VDENIGFLRIENRICVALSRAKHGFYMIGNMQNLQGKSRLWNGISR 324

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHLSS 240
           IL+   +      L C  H    TQ     DFP EGGC   C  KM CGHIC  +CH   
Sbjct: 325 ILDNDGQIGPDFGLRCDVH-GVVTQAHKVTDFPPEGGCMNKCSSKMPCGHICPKMCHADD 383

Query: 241 HDK--IFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDNFRC 297
            D   + C E C R  P GHP            V+ +I  P CGH   + C  +     C
Sbjct: 384 RDHALVKCQELCTRFCPVGHPCPKKCFAVCNPCVKRMI--PECGHEVDLPCSTEPTRALC 441

Query: 298 KERCSKKLKCGHQCREECSSPWCTAMCLTQ-TEVKYPGCGHIDLCLCHDIRNKLQD 352
           K+ C+ +L CGH C+++C  P   A C+   T +K   CGH     C D      D
Sbjct: 442 KKMCASELPCGHLCKKKCCEPCNQADCVEPLTTIKVNLCGHHVTLSCKDFHEATLD 497



>gi|384484407|gb|EIE76587.1| hypothetical protein RO3G_01291 [Rhizopus delemar RA 99-880]
          Length = 1186

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 171/264 (64%), Gaps = 7/264 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR+L+ PIY D  L DH +V  YP + G+  +LFF  H E E    D+ S+ N  EA
Sbjct: 869  RPEIRQLINPIYRDPPLQDHPDVIKYPAIRGVAQSLFFLSHNEDEHNLPDSASKVNEHEA 928

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +  AKL+ YL+  G   ++ITI++MYSGQ+  + K+LREE R       I+VSSVDG+QG
Sbjct: 929  KFAAKLSFYLMQQGYSANKITIITMYSGQKTLLKKFLREERRPNMDTDTIQVSSVDGYQG 988

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+IIILSLVRS+   + IGFL  +NRVCVALSRAKHG+YI GNAS L  +S LW E++
Sbjct: 989  EENEIIILSLVRSNTQGQ-IGFLKAANRVCVALSRAKHGMYILGNASLLCEKSELWNEII 1047

Query: 180  SILEKSKK--CDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSI 235
            + LE+ ++      + L C KH    TQV   +DF    EGGCSR C EK+DCGH C   
Sbjct: 1048 AGLEERQENMIGTSLPLKCVKH-NTVTQVQWASDFVEVAEGGCSRPCGEKLDCGHECLLN 1106

Query: 236  CHLSSHDKIFCPENCIRTLPCGHP 259
            CH   HD I C ++C + L C HP
Sbjct: 1107 CHPYEHDDILCKQSCGKILECKHP 1130



>gi|315271511|gb|ADU02293.1| RNA helicase [Rhizopus oryzae]
 gi|315271523|gb|ADU02302.1| putative RNA helicase [Rhizopus oryzae]
          Length = 1079

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 135/265 (50%), Positives = 170/265 (64%), Gaps = 9/265 (3%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR+L+ PIY D  L DH +V  YP + G+  +LFF  H E E    D+ S+ N  EA
Sbjct: 807  RPEIRQLINPIYRDPPLQDHPDVIRYPAIRGVAQSLFFLSHNEDEHNLPDSASKVNEHEA 866

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +  AKL+ YL+  G   S+ITI++MYSGQ+  + K+LRE  R       I+VSSVDG+QG
Sbjct: 867  KFAAKLSFYLMQQGYSASKITIITMYSGQKTLLKKFLREARRPNMDTDTIQVSSVDGYQG 926

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+IIILSLVRS+   + IGFL  +NRVCVALSRAKHG+YI GNAS L  +S LW E++
Sbjct: 927  EENEIIILSLVRSNTQGQ-IGFLKAANRVCVALSRAKHGMYILGNASLLCEKSELWNEII 985

Query: 180  SILE--KSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQS 234
            + LE  + K     + L C KH    TQV   +DF   P EGGCSR C EK+DCGH C  
Sbjct: 986  AGLEERQEKMIGTSLPLKCVKH-NTVTQVQWASDFVEVP-EGGCSRPCGEKLDCGHECLL 1043

Query: 235  ICHLSSHDKIFCPENCIRTLPCGHP 259
             CH   HD I C ++C + L C HP
Sbjct: 1044 NCHPYEHDDILCKQSCGKILECKHP 1068



>gi|315320905|gb|ADU04733.1| putative RNA helicase [Rhizopus oryzae]
          Length = 1085

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 169/264 (64%), Gaps = 7/264 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR+L+ PIY D  L DH +V  YP + G+  +LFF  H E E    D+ S+ N  EA
Sbjct: 791  RPEIRQLINPIYRDPPLQDHPDVIRYPAIRGVAQSLFFLSHNEDEHNLPDSASKVNEHEA 850

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +  AKL+ YL+  G   S+ITI++MYSGQ+  + K+LRE  R       I+VSSVDG+QG
Sbjct: 851  KFAAKLSFYLMQQGYSASKITIITMYSGQKTLLKKFLREARRPNMDTDTIQVSSVDGYQG 910

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+IIILSLVRS+   + IGFL  +NRVCVALSRAKHG+YI GNAS L  +S LW E++
Sbjct: 911  EENEIIILSLVRSNTQGQ-IGFLKAANRVCVALSRAKHGMYILGNASLLCEKSELWNEII 969

Query: 180  SILE--KSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSI 235
            + LE  + K     + L C KH    TQV   +DF    EGGCSR C EK+DCGH C   
Sbjct: 970  AGLEERQEKMIGTSLPLKCVKH-NTVTQVQWASDFVEVPEGGCSRPCGEKLDCGHECLLN 1028

Query: 236  CHLSSHDKIFCPENCIRTLPCGHP 259
            CH   HD I C ++C + L C HP
Sbjct: 1029 CHPYEHDDILCKQSCGKILECKHP 1052



>gi|315271515|gb|ADU02296.1| RNA helicase [Rhizopus oryzae]
          Length = 1100

 Score =  239 bits (611), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 169/264 (64%), Gaps = 7/264 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR+L+ PIY D  L DH +V  YP + G+  +LFF  H E E    D+ S+ N  EA
Sbjct: 807  RPEIRQLINPIYRDPPLQDHPDVIRYPAIRGVAQSLFFLSHNEDEHNLPDSASKVNEHEA 866

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +  AKL+ YL+  G   S+ITI++MYSGQ+  + K+LRE  R       I+VSSVDG+QG
Sbjct: 867  KFAAKLSFYLMQQGYSASKITIITMYSGQKTLLKKFLREARRPNMDTDTIQVSSVDGYQG 926

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+IIILSLVRS+   + IGFL  +NRVCVALSRAKHG+YI GNAS L  +S LW E++
Sbjct: 927  EENEIIILSLVRSNTQGQ-IGFLKAANRVCVALSRAKHGMYILGNASLLCEKSELWNEII 985

Query: 180  SILE--KSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSI 235
            + LE  + K     + L C KH    TQV   +DF    EGGCSR C EK+DCGH C   
Sbjct: 986  AGLEERQEKMIGTSLPLKCVKH-NTVTQVQWASDFVEVPEGGCSRPCGEKLDCGHECLLN 1044

Query: 236  CHLSSHDKIFCPENCIRTLPCGHP 259
            CH   HD I C ++C + L C HP
Sbjct: 1045 CHPYEHDDILCKQSCGKILECKHP 1068



>gi|156352506|ref|XP_001622790.1| hypothetical protein NEMVEDRAFT_v1g139805 [Nematostella vectensis]
 gi|156209407|gb|EDO30690.1| predicted protein [Nematostella vectensis]
          Length = 1761

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/351 (39%), Positives = 198/351 (56%), Gaps = 16/351 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI ++L  IY D L +HE V ++ ++ G++ N+FF DHQE E+   +  SR+N  EA+
Sbjct: 905  RPEISQMLQHIYPD-LENHESVLNFDNIKGVSTNIFFIDHQEREEFIEEGRSRSNIHEAK 963

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A L  YL++ G E S+IT+L+MY+GQ  ++ K + ++         +RVS+VD FQGE
Sbjct: 964  FVAALCRYLILQGYERSKITVLTMYTGQLLQLKKEMPKD-----FFNGVRVSAVDNFQGE 1018

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++    IGFL ISNRVCVALSRA+ G Y  GN   +  +  LW+++L 
Sbjct: 1019 ENDIILLSLVRSNDDG-NIGFLRISNRVCVALSRARKGFYCIGNMGLMEEKEELWKKILD 1077

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L + KK  Q + L CQ HP+        +DF    EGGC   C  +++CGH+C+ +CH 
Sbjct: 1078 DLRQKKKVGQNLVLACQNHPKTLIHASKDSDFKAAPEGGCMVPCATRLECGHVCEKVCHP 1137

Query: 239  SSHDKI--FCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVD 293
               D +   C + C + L   GH              V    + P C H + + C  + +
Sbjct: 1138 GDPDHVEYECRKPCPKKLCDLGHDCPRRCFQKCEPCKVLVAKVIPKCQHEQQIPCHVEPE 1197

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
             F+C+E C K LKCGHQC  +C    CT  C+   E   P CGH     CH
Sbjct: 1198 KFKCQEPCPKTLKCGHQCAAKCGDD-CTKECMVMIERTLP-CGHKHTLKCH 1246



>gi|315271519|gb|ADU02299.1| RNA helicase [Rhizopus delemar]
          Length = 1054

 Score =  233 bits (593), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 167/259 (64%), Gaps = 7/259 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR+L+ PIY D  L DH +V  YP + G+  +LFF  H E E    D+ S+ N  EA
Sbjct: 797  RPEIRQLINPIYRDPPLQDHPDVIKYPTIRGVAQSLFFLSHNEDEHNLPDSASKVNEHEA 856

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +  AKL+ YL+  G   S+ITI++MYSGQ+  + K+LRE  R       I+VSSVDG+QG
Sbjct: 857  KFAAKLSXYLMQQGYSASKITIITMYSGQKTLLKKFLREARRPNMDTDTIQVSSVDGYQG 916

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+IIILSLVRS+   + IGFL  +NRVCVALSRAKHG+YI GNAS L  +S LW E++
Sbjct: 917  EENEIIILSLVRSNTQGQ-IGFLKAANRVCVALSRAKHGMYILGNASLLCEKSELWNEII 975

Query: 180  SILEKSKK--CDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSI 235
            + LE+ ++      + L C KH    TQV   +DF    EGGCSR C EK+DCGH C   
Sbjct: 976  AGLEERQENMIGTSLPLKCVKH-NTVTQVQWASDFVEVAEGGCSRPCGEKLDCGHECLLN 1034

Query: 236  CHLSSHDKIFCPENCIRTL 254
            CH   HD I C ++C + L
Sbjct: 1035 CHPYEHDDILCKQSCGKIL 1053



>gi|260834157|ref|XP_002612078.1| hypothetical protein BRAFLDRAFT_94166 [Branchiostoma floridae]
 gi|229297451|gb|EEN68087.1| hypothetical protein BRAFLDRAFT_94166 [Branchiostoma floridae]
          Length = 1015

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 199/361 (55%), Gaps = 17/361 (4%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI  L+  IYH+ L DHE V  Y  + G+  N+FF DH + E    + +S  N  EA 
Sbjct: 611 RPEISVLMKHIYHNLL-DHESVRSYERIHGIDKNIFFIDHNKDEVHNEELLSHANDHEAD 669

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               L  YL+  G ++SRITIL+ Y GQ   +YK LR + +K    + +RV+ VD FQGE
Sbjct: 670 YIVALCRYLIQQGYDKSRITILTTYKGQ---LYK-LRGKMKKD-FFEGVRVTVVDNFQGE 724

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDI++LSLVRS+     IGFLSISNRVCVALSRA+ G Y  GN S L  ++ +WR + +
Sbjct: 725 ENDIVLLSLVRSNREG-SIGFLSISNRVCVALSRARMGFYCIGNISMLARKTEIWRNIKA 783

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            +E+       + L CQ HP+ E    +  DF    EGGC+R+C+ ++ CGH C+  CH 
Sbjct: 784 DMEERGCIGSHLMLRCQNHPDTEVDARSSKDFAAAPEGGCTRDCDVRLKCGHRCRLSCHP 843

Query: 239 SS--HDKIFCPENCIRTLPCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDN 294
           +   H +  C E+C +    GH              V    + P CGH ++V C  D  +
Sbjct: 844 ADPEHKEYKCYEDCPKKCEEGHACRKRCWADCGPCMVRVPKIIPGCGHEQMVPCGIDPKD 903

Query: 295 FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGC 354
           F C+E C K L+CGH+C+  C S  CT  C  Q   ++P CGH     CH     +Q  C
Sbjct: 904 FCCREPCEKILQCGHRCQTNCGS-QCTKACREQVTKQWP-CGHNVTTDCHRRPKNVQ--C 959

Query: 355 P 355
           P
Sbjct: 960 P 960



>gi|356668399|gb|AET35417.1| RnhA [Syzygites megalocarpus]
          Length = 1226

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/264 (48%), Positives = 171/264 (64%), Gaps = 7/264 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            R EIR+L+ PIY D  L DH  V +YP + G++ +LFF  H E E    D+ S+ N  EA
Sbjct: 910  RAEIRQLINPIYRDPPLQDHPMVANYPTIKGMSQSLFFLSHNEEETNLLDSASKINEHEA 969

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            ++ AKL+ YL+  G   S ITI++MYSGQ+  + K LREE +     ++I++SSVDG+QG
Sbjct: 970  KIAAKLSIYLIQQGYLASEITIITMYSGQKSILKKVLREEKKSLIDTEKIQISSVDGYQG 1029

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN IIILSLVRS+ ++  IGFL  +NRVCVALSRAKHG+YI GNA+ L  RS LW E++
Sbjct: 1030 EENKIIILSLVRSN-THGQIGFLKAANRVCVALSRAKHGMYILGNANLLCDRSELWNEIV 1088

Query: 180  SILEK--SKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSI 235
            + LE+   K     + L C KH +  TQ+    DF    EGGCSR C+E++DCGH C   
Sbjct: 1089 ANLEERPEKMIGSRLPLKCAKH-DFVTQIQWAVDFVEVEEGGCSRFCKERLDCGHECILK 1147

Query: 236  CHLSSHDKIFCPENCIRTLPCGHP 259
            CH   HD + C + C + L C HP
Sbjct: 1148 CHPYDHDDVSCKQPCGKILVCQHP 1171



>gi|403366003|gb|EJY82794.1| hypothetical protein OXYTRI_19589 [Oxytricha trifallax]
          Length = 2001

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 198/366 (54%), Gaps = 33/366 (9%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  ++  IY + L D E+V +YP + G+  +L+FFDH+  E  +   MS+ N FE+ 
Sbjct: 1202 RPEISSIVKLIYPN-LVDGEKVLNYPVIRGIDKSLYFFDHENQEDRDEGLMSKFNKFESN 1260

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  +   YL+    +  RITILS+Y  Q   I + + E+  +   ++ ++V +VD FQGE
Sbjct: 1261 MIERFTKYLLQQNYKPERITILSLYMAQSLHIKRQIMEKYPRDHEMRNVKVITVDNFQGE 1320

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNAS-------------- 166
            ENDIIILSLVRS++SN+ IG+L +SNRVCVALSRAKHG+YIFGNA+              
Sbjct: 1321 ENDIIILSLVRSNQSNQ-IGYLKVSNRVCVALSRAKHGMYIFGNATCLYKHVDRQMNQQH 1379

Query: 167  -QLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKET--QVFTFADFPLEGGCSRNCE 223
             Q+  +  LW EVL+ L++ +   + +NL C+KH    T      F + P EGGC   C 
Sbjct: 1380 AQVEEQQQLWLEVLNYLKEKQFIGETLNLCCEKHKNVTTIKNPEDFQNVP-EGGCKLPCN 1438

Query: 224  EKMDCGHICQSICHL--------SSHDKIFCPENCIRTLPCGHPXXXX--XXXXXXXXVE 273
             +++CGH C+SICH         S H K  C + C R  PCGHP               +
Sbjct: 1439 ARLNCGHSCESICHYYEITPQDSSGHKKTKCLKQCERENPCGHPCSFKCFECIDKLQPCQ 1498

Query: 274  TII--MCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVK 331
            T+I      CGHS  V C   D  +C ++C K   CGH C++ C        C      +
Sbjct: 1499 TMIDKTFDICGHSTRVKCHLFDTAKCYDQCQKVKPCGHNCQKYCHVDCSQQKCGVNVLKR 1558

Query: 332  YPGCGH 337
             P CGH
Sbjct: 1559 LP-CGH 1563



>gi|403358026|gb|EJY78648.1| hypothetical protein OXYTRI_24190 [Oxytricha trifallax]
          Length = 2021

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 198/366 (54%), Gaps = 33/366 (9%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  ++  IY + L D E+V +YP + G+  +L+FFDH+  E  +   MS+ N FE+ 
Sbjct: 1200 RPEISSIVKLIYPN-LVDGEKVLNYPVIRGIDKSLYFFDHENQEDRDEGLMSKFNKFESN 1258

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  +   YL+    +  RITILS+Y  Q   I + + E+  +   ++ ++V +VD FQGE
Sbjct: 1259 MIERFTKYLLQQNYKPERITILSLYMAQSLHIKRQIMEKYPRDHEMRNVKVITVDNFQGE 1318

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNA--------------- 165
            ENDIIILSLVRS++SN+ IG+L +SNRVCVALSRAKHG+YIFGNA               
Sbjct: 1319 ENDIIILSLVRSNQSNQ-IGYLKVSNRVCVALSRAKHGMYIFGNATCLYKHVDRQMNQQH 1377

Query: 166  SQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKET--QVFTFADFPLEGGCSRNCE 223
            +Q+  +  LW EVL+ L++ +   + +NL C+KH    T      F + P EGGC   C 
Sbjct: 1378 AQVEEQQQLWLEVLNYLKEKQFIGETLNLCCEKHKNVTTIKNPEDFQNVP-EGGCKLPCN 1436

Query: 224  EKMDCGHICQSICHL--------SSHDKIFCPENCIRTLPCGHPXXXX--XXXXXXXXVE 273
             +++CGH C+SICH         S H K  C + C R  PCGHP               +
Sbjct: 1437 ARLNCGHSCESICHYYEITPQDSSGHKKTKCLKQCERENPCGHPCSFKCFECIDKLQPCQ 1496

Query: 274  TII--MCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVK 331
            T+I      CGHS  V C   D  +C ++C K   CGH C++ C        C      +
Sbjct: 1497 TMIDKTFDICGHSTRVKCHLFDTAKCYDQCQKVKPCGHNCQKYCHVDCSQQKCGVNVLKR 1556

Query: 332  YPGCGH 337
             P CGH
Sbjct: 1557 LP-CGH 1561



>gi|321466807|gb|EFX77800.1| hypothetical protein DAPPUDRAFT_213228 [Daphnia pulex]
          Length = 1583

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 196/358 (54%), Gaps = 23/358 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEK---LERDTMSRTNTF 57
            RP++ +L+ P  +  L +HE V  Y DVPG+ +N+FF  H E EK    ++++ S  N +
Sbjct: 746  RPDVARLIVPSIYPHLENHESVLRYWDVPGMAENVFFLSHLEREKGDQSDQESRSHLNPY 805

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA M   LA +L+M G+E S+ITIL+ YSGQ    +K LR   R   +L+ +R+S VD F
Sbjct: 806  EADMALALARHLLMQGLEPSQITILTTYSGQLLH-FKKLR---RSHAILQGVRISIVDNF 861

Query: 118  QGEENDIIILSLVRS-DESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            QGEENDIIILSLVRS DE+N  +GFL   NRVCVALSRAK G Y+ GN   L   S LWR
Sbjct: 862  QGEENDIIILSLVRSNDEAN--VGFLKTENRVCVALSRAKKGFYLIGNMGNLAGSSKLWR 919

Query: 177  EVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSIC 236
            EV  +L  +K+     +L C+ H     +    + FP EGGC   C   M CGH C  IC
Sbjct: 920  EVNKVLTSNKQIGPHFDLQCEVH-HTVIKANKVSHFPPEGGCFVKCLTPMPCGHTCPKIC 978

Query: 237  HLSS--HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETI-IMCPPCGHSEVVLC-PDV 292
            H+    H +  C E C+R+   GHP            +  I  +  PC H+++  C  D 
Sbjct: 979  HVEDREHRRQKCHEACLRSCSVGHPCPKRCYQDCNPCLTKIPKILIPCNHTQITECYKDP 1038

Query: 293  DNFRCKER-CSKKLKCGHQ----CREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHD 345
            +   C  + C K + CGHQ    CRE CS   C  +  T    K   CGH  +  C+D
Sbjct: 1039 EKEYCFTKPCVKIMSCGHQCKRKCRETCSPLVCQELVRTS---KLSPCGHPVMKTCND 1093



>gi|260797863|ref|XP_002593920.1| hypothetical protein BRAFLDRAFT_154218 [Branchiostoma floridae]
 gi|229279152|gb|EEN49931.1| hypothetical protein BRAFLDRAFT_154218 [Branchiostoma floridae]
          Length = 1321

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 195/352 (55%), Gaps = 19/352 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  +LLTP  +D+L +HE V +Y ++ G++ NLFF DH   E   +DT SR+N  EA+
Sbjct: 735  RPEFARLLTPHIYDSLDNHESVLNYENIKGVSSNLFFLDHSYKEAHAKDTKSRSNMHEAQ 794

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A    YL+  G   S+ITIL+ Y+GQ   ++ +     R+  V + +RV +VD FQGE
Sbjct: 795  FLASFCRYLLQQGYSPSQITILTTYTGQ---LFNFKDVMPRQ--VFQGVRVCTVDNFQGE 849

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++ N   GFL + NRVCVALSRAK G Y  GN + L   STLW+E++ 
Sbjct: 850  ENDIILLSLVRSNDENIA-GFLKVENRVCVALSRAKKGFYAIGNLTMLAEASTLWKEIIQ 908

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +       + L CQ HP+ +  V T  DF     GGC R C  ++ CGH+C   CHL
Sbjct: 909  ELRRQGSIGTSLTLSCQNHPDSKILVSTADDFKETPNGGCMRPCGFRLQCGHLCGMRCHL 968

Query: 239  SS--HDKIFCPENCIRTL-PCGH---PXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPD- 291
            +   H++  CP+ C + L   GH                VE  I  P C H + V C + 
Sbjct: 969  TDPEHEEYECPKPCAKVLCDLGHRCPDLCYQDCGKCEVLVEKTI--PICQHKQKVRCHEK 1026

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
               F+C+  C K L C H+C+ +C+   C+  C+   + ++P CGH     C
Sbjct: 1027 ARPFQCQMPCEKVLPCRHRCKNKCNQE-CSVPCMEMVQHQFP-CGHTIQAAC 1076



>gi|340378202|ref|XP_003387617.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1835

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 194/356 (54%), Gaps = 32/356 (8%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQ--ESEKLERDTMSRTNTFE 58
            RPEI  ++    +D L +HE V  Y +V G+  NLFF DH+  E+E    D  S  NTFE
Sbjct: 968  RPEIASIVGNHIYDRLDNHESVYAYGNVKGIGKNLFFIDHRQPENENPTGDVRSHANTFE 1027

Query: 59   ARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQ 118
            A+    L  YL+  G + S +TIL+MY GQ  EI + +R++         +RV++VD FQ
Sbjct: 1028 AKYVVALTRYLLKQGYQRSDVTILTMYRGQLFEIRQNMRKDE-----FDGVRVAAVDDFQ 1082

Query: 119  GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYR-STLWRE 177
            GEEN+IIILSLVRS+   R IGFL + NRVCVALSRAK GL++ GN S LR + +T W  
Sbjct: 1083 GEENEIIILSLVRSNNEER-IGFLKVENRVCVALSRAKAGLFVIGNLSMLRSKDTTKWPA 1141

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
            +L+ +++  +    + L CQ HP++ T      DF    EGGC + C  ++DCGH+C+S 
Sbjct: 1142 ILNQMDREGRVGDGLPLCCQVHPKEVTIAKEAEDFSKCPEGGCLQKCGFRLDCGHVCRSP 1201

Query: 236  CHL--SSHDKIF-CPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPP----------CG 282
            CH     H  I+ C +NC + LPCGH              E +  C P          CG
Sbjct: 1202 CHPIDQEHKSIYKCQQNCSKRLPCGH-------RCIRKCFECLDGCLPCQTIEQKLLDCG 1254

Query: 283  HSEVVLC-PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            H   V C  D     C   CS+ L CGHQC ++CS P  ++      + K   CGH
Sbjct: 1255 HLVNVKCHKDPSEVSCNNECSRILDCGHQCWKKCSEPCGSSSTCKTKKSKRLLCGH 1310



>gi|260797867|ref|XP_002593922.1| hypothetical protein BRAFLDRAFT_234820 [Branchiostoma floridae]
 gi|229279154|gb|EEN49933.1| hypothetical protein BRAFLDRAFT_234820 [Branchiostoma floridae]
          Length = 1771

 Score =  226 bits (577), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 141/362 (38%), Positives = 195/362 (53%), Gaps = 40/362 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  +LLTP  +D+L +HE V ++ ++ G++ N+FF DH   E  + DT SR+N  EA+
Sbjct: 919  RPEFARLLTPHIYDSLDNHESVLNFENIKGVSSNMFFVDHSYWEAHDGDTKSRSNMHEAK 978

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A    YL+  G   S+ITIL+ Y+GQ   ++ + +   R+  V   +RV +VD FQGE
Sbjct: 979  FMASFCRYLLQQGYSPSQITILTTYTGQ---LFNFKKVMPRQ--VFDGVRVCAVDNFQGE 1033

Query: 121  ENDIIILSLVRS-DESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            ENDII+LSLVRS DE N  +GFL + NRVCVALSRAK G Y  GN + L   S LW +++
Sbjct: 1034 ENDIILLSLVRSNDEGN--VGFLKVENRVCVALSRAKKGFYAIGNLTMLAEASPLWSKII 1091

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICH 237
              L + +     +NL CQ HP+      T  DF    EGGC R CE +  CGH+C S+CH
Sbjct: 1092 KELREQRCVGTHLNLCCQNHPDSVIAAATEKDFNKAPEGGCMRPCEFRQ-CGHVCTSVCH 1150

Query: 238  LSS--HDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCG 282
             +   H++  C + C + L             PCG              VE II  P C 
Sbjct: 1151 PTDPEHEEYMCKKECPKVLCSLGHKCTKLCSQPCGD---------CKVPVEKII--PRCQ 1199

Query: 283  HSEVVLCPDVDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLC 341
            H + + C    N F+C+  C K L C H+C+ +CS   C+  C+     + P CGH    
Sbjct: 1200 HKQKIPCATSPNLFKCQAPCDKTLPCNHRCKNKCSQE-CSVPCMEMVAHRLP-CGHTIQA 1257

Query: 342  LC 343
             C
Sbjct: 1258 AC 1259



>gi|374921797|gb|AFA26128.1| RNA helicase [Mucor mucedo]
          Length = 1236

 Score =  226 bits (577), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 177/320 (55%), Gaps = 33/320 (10%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR L+ PIY D  L+DH +V +YP + G+  +LFF  H E E    ++ S+ N  EA
Sbjct: 921  RPEIRSLINPIYIDPPLNDHPDVFNYPPIKGMAQSLFFLSHTEDETHLSESASKVNEHEA 980

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +M AKL+ YL++ G     ITI++MY+GQ+  I K LREE R     + I+VSSVDGFQG
Sbjct: 981  KMAAKLSVYLLLQGYRTEDITIITMYAGQKSLIKKSLREERRPHTDPEPIQVSSVDGFQG 1040

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN IIILSLVRS+ + + IGFL + NRVCV+LSRAKHG YI GNA  L  RS LW E++
Sbjct: 1041 EENKIIILSLVRSNTTGQ-IGFLKVVNRVCVSLSRAKHGFYILGNAGLLCERSDLWNEII 1099

Query: 180  SILEKS--KKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
              LE    K     + L C+KH    T+V    DF    EGGC+R C E++ CGH C   
Sbjct: 1100 GNLENQPVKMIGCKLPLKCKKH-NAITEVQWPVDFTEVEEGGCTRPCGEELPCGHKCSFK 1158

Query: 236  CHLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
            CH   H  I C   C + L C HP                  C PCG             
Sbjct: 1159 CHPFDHMDIRCNLQCEKVLSCKHPCLRR-------------CCEPCGS------------ 1193

Query: 296  RCKERCSKKLKCGHQCREEC 315
             C  R S +L CGH    EC
Sbjct: 1194 -CIYRISVRLPCGHTMENEC 1212



>gi|374921792|gb|AFA26124.1| RNA helicase [Mucor mucedo]
          Length = 1236

 Score =  226 bits (576), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 177/320 (55%), Gaps = 33/320 (10%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR L+ PIY D  L+DH +V +YP + G+  +LFF  H E E    ++ S+ N  EA
Sbjct: 921  RPEIRSLINPIYIDPPLNDHPDVFNYPPIKGMAQSLFFLSHTEDETHLSESASKVNEHEA 980

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +M AKL+ YL++ G     ITI++MY+GQ+  I K LREE R     + I+VSSVDGFQG
Sbjct: 981  KMAAKLSVYLLLQGYRTEDITIITMYAGQKSLIKKSLREERRPHTDPEPIQVSSVDGFQG 1040

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN IIILSLVRS+ + + IGFL + NRVCV+LSRAKHG YI GNA  L  RS LW E++
Sbjct: 1041 EENKIIILSLVRSNTTGQ-IGFLKVVNRVCVSLSRAKHGFYILGNAGLLCERSDLWNEII 1099

Query: 180  SILEKS--KKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
              LE    K     + L C+KH    T+V    DF    EGGC+R C E++ CGH C   
Sbjct: 1100 GNLENQPVKMIGCKLPLKCKKH-NAITEVQWPVDFTEVEEGGCTRPCGEELPCGHKCSFK 1158

Query: 236  CHLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
            CH   H  I C   C + L C HP                  C PCG             
Sbjct: 1159 CHPFDHMDIRCNLQCEKVLSCKHPCLRR-------------CCEPCGS------------ 1193

Query: 296  RCKERCSKKLKCGHQCREEC 315
             C  R S +L CGH    EC
Sbjct: 1194 -CIYRISVRLPCGHTMENEC 1212



>gi|302797448|ref|XP_002980485.1| hypothetical protein SELMODRAFT_315 [Selaginella moellendorffii]
 gi|300152101|gb|EFJ18745.1| hypothetical protein SELMODRAFT_315 [Selaginella moellendorffii]
          Length = 942

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 192/354 (54%), Gaps = 31/354 (8%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKL----ERDTMSRTNT 56
           +P I KL++   + +L DH   + Y D+ G+  +LFF DH+  E+     E D  ++ N 
Sbjct: 156 KPCISKLISGTIYPSLKDHARASEYEDIKGMKSSLFFLDHKALEQQDCGDEEDGATKINP 215

Query: 57  FEARMCAKLANYLVMGGMEESR-ITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVD 115
            EA +  +L  YL+     +++ +TIL+MY GQ KEI + L             RVSSVD
Sbjct: 216 IEAGLVVELCVYLLNQACYDAKDVTILAMYKGQVKEIQRSLP------------RVSSVD 263

Query: 116 GFQGEENDIIILSLVRSD-----ESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRY 170
            FQGEEN II+LSLVRS+     ES   IGFL+I+NR+ VALSRA+ GLY+FGNA  L  
Sbjct: 264 EFQGEENTIILLSLVRSNIIPDKESAGKIGFLNIANRINVALSRARQGLYMFGNAELLTR 323

Query: 171 RSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDC 228
           +S LWR++L IL++       + L CQ HP+ ET V    DF L  +GGC+R CE +++C
Sbjct: 324 KSDLWRKILEILQEQHSIGDALVLRCQNHPDTETPVRKIQDFRLVGDGGCNRPCEFQLEC 383

Query: 229 GHICQSICHLSSHDKIFCPENCIRTL-PCGHPXXXXXXXXXXXXVETIIMC---PPCGHS 284
           GH C   CH  SHD + CP+ C +    CGH                I++    P CGH 
Sbjct: 384 GHACPRRCHPGSHDAVICPKQCEKIREECGHSCANLCHGDRPCRPCQILVAKINPSCGHE 443

Query: 285 EVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
           + + C   V+   C   C + L CGH C   C  P  T  C  ++ V+   CGH
Sbjct: 444 QRIPCATKVEEVACSSPCPRPLPCGHPCPSSCGRPCETKCC--ESVVRELPCGH 495



>gi|321472267|gb|EFX83237.1| hypothetical protein DAPPUDRAFT_301907 [Daphnia pulex]
          Length = 1581

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 200/369 (54%), Gaps = 29/369 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEK---LERDTMSRTNTF 57
            RP++ +L+ P  +  L +H+ V  Y DVPG+ +++FF  H E EK    ++++ S  N F
Sbjct: 749  RPDVARLIVPSIYPHLENHQSVLRYWDVPGMVESVFFLSHLEREKGDQSDQESRSHLNPF 808

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA M   LA +L+M G+E S+ITIL+ YSGQ    +K LR   R   +L+ +R+S VD F
Sbjct: 809  EADMALALARHLLMQGLEPSQITILTTYSGQLLH-FKKLR---RSHAILQGVRISIVDNF 864

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEENDIIILSLVRS++  + +GFL   NRVCVALSRAK G Y+ GN S L   S LWRE
Sbjct: 865  QGEENDIIILSLVRSNDEAK-VGFLKTENRVCVALSRAKKGFYLIGNMSNLAGSSKLWRE 923

Query: 178  VLSILEKSKKCDQFINLYCQKHPE-----KETQVFTFADFPLEGGCSRNCEEKMDCGHIC 232
            V  +L  + +     +L C+ H       K+T VF+  +   E  C   C   +DC HIC
Sbjct: 924  VNKVLTSNGQIGPHFDLQCEVHHTVIKVLKQTNVFSSVE---EIKCPEQCGMHLDCDHIC 980

Query: 233  QSICHL-SSHDKIFCPENCIR-TLPCGHPXXXXXXXX----XXXXVETIIMCPPCGHSEV 286
              ICH+ SSH K+ C + C R T P  HP                   ++  P CGH   
Sbjct: 981  NRICHMRSSHAKMPCTQPCRRFTCPEKHPCPKQCYEECGKCLVDVFPKVVTLPDCGHKVE 1040

Query: 287  VLCPD-VDNFRCKERCSKKLKCGHQCREECSSPWCTA---MCLTQTEVKYPGCGHIDLCL 342
            + C D  +   C + C  +L CGHQC E C    C     +C+T+   + P CGH  +  
Sbjct: 1041 IACSDNPETAFCPKPCDTRLDCGHQCTELCHK--CHEDCDLCITKINRQLP-CGHSQVAE 1097

Query: 343  CHDIRNKLQ 351
            C  +  + Q
Sbjct: 1098 CSPVVEQAQ 1106



>gi|403353380|gb|EJY76226.1| NFX1-type zinc finger-containing protein 1 [Oxytricha trifallax]
          Length = 1792

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 142/368 (38%), Positives = 197/368 (53%), Gaps = 38/368 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +++  +Y + L D + V  YPD+ G+  +++FFDHQ  E  +   MS+ N FEA 
Sbjct: 972  RPEISEMIRFLYPN-LEDDQRVKKYPDIKGIEKSVYFFDHQNEEDYDEGNMSKMNNFEAE 1030

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  K + YL+  G +  +IT+LS+Y  Q   I K L+    + P+ ++I+V +VD FQGE
Sbjct: 1031 MIEKFSFYLLQQGYDPEKITVLSLYMAQSSLIKKKLQNFPNEHPI-RKIKVITVDNFQGE 1089

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNAS-------------- 166
            ENDIIILSLVRS++ N  IG+L +SNRVCVALSRAKHG++IFGN+S              
Sbjct: 1090 ENDIIILSLVRSNQRN-DIGYLKVSNRVCVALSRAKHGMFIFGNSSCLYKYVDQQTKKQF 1148

Query: 167  -QLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCE 223
              L  +S LW +VL  L+K++   Q +NL C  H +  T+V    DF    EGGC   C 
Sbjct: 1149 VTLDEQSMLWEKVLEYLKKNEFIGQTLNLCCVNH-KIVTKVKVPKDFQEVPEGGCKLACN 1207

Query: 224  EKMDCGHICQSICHL--------SSHDKIFCPENCIRTLPCGHPXXXX------XXXXXX 269
             +M+CGH CQS+CH         + H K  C ++C R   CGH                 
Sbjct: 1208 IRMECGHTCQSLCHYYEQTILDSTGHSKYKCLKSCEREHKCGHKCNYKCFQCKGQLQPCR 1267

Query: 270  XXVETIIMCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTE 329
              VE I     C H++ V C + +  +CK  C     CGH+C ++C        C    E
Sbjct: 1268 QIVEKIF--DKCQHNQNVQCSEFEKAQCKSPCEIVKPCGHKCTKDCYVDCEKQKCGVNVE 1325

Query: 330  VKYPGCGH 337
               P CGH
Sbjct: 1326 KTLP-CGH 1332



>gi|291222949|ref|XP_002731477.1| PREDICTED: Upf1-like [Saccoglossus kowalevskii]
          Length = 1943

 Score =  223 bits (569), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 185/324 (57%), Gaps = 15/324 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +++   Y D LS+HE V ++  + G++ N+FF +H   E+  +DT S++N  EA+
Sbjct: 1079 RPEIAEMMKHFY-DNLSNHESVMNFDKIRGVSSNIFFLEHDFKEENVKDTKSKSNIHEAK 1137

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A L  Y ++ G   S+IT+L+ Y+GQ       LR E  K  + + +RV  VD FQGE
Sbjct: 1138 FLAGLCKYFLLQGYSPSQITVLTTYTGQ----LFALRNEMPKR-LFEGVRVCVVDNFQGE 1192

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + IGFL ISNR+CVALSRAK G Y  GN  QL     LW +++ 
Sbjct: 1193 ENDIILLSLVRSNEEGK-IGFLKISNRICVALSRAKQGFYCIGNFDQLAKEGDLWSKIIH 1251

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             + KS +  + + L CQ HP+    V  ++DF    EGGC+R CE ++DCGH C+ +CH 
Sbjct: 1252 DMRKSGRVGKHLKLTCQNHPQNVIPVSKYSDFSAAPEGGCTRPCEYRLDCGHKCEMVCHP 1311

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXXXXXXX--XXXXXVETIIMCPPCGHSEVVLC-PDV 292
                H +  C + C + +   GH               V    + P CGHS+V+ C  D 
Sbjct: 1312 RDQDHKEYKCRKPCEKVICEFGHKCAKYCYQPCESSCSVAVKKLLPKCGHSQVMPCHKDP 1371

Query: 293  DNFRCKERCSKKLKCGHQCREECS 316
                CK RC+KKL CGH C + C 
Sbjct: 1372 IYAECKSRCAKKLPCGHSCLKLCG 1395



>gi|511005759|gb|EPB87088.1| hypothetical protein HMPREF1544_06112 [Mucor circinelloides f.
            circinelloides 1006PhL]
          Length = 1251

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 163/263 (61%), Gaps = 7/263 (2%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR L+ PIY D  L DH +V  YP + G+  +LFF  H E E    ++ S+ N  EA
Sbjct: 937  RPEIRSLINPIYKDPPLMDHPDVAAYPPILGMDQSLFFLAHNEDETNMSESASKVNEHEA 996

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +M AKLA YL++ G +   ITI++MYSGQ+  I + LREE R     + I+VSSVDG+QG
Sbjct: 997  KMAAKLAVYLILQGYQPEEITIITMYSGQKTMIKRALREERRPDINPEPIQVSSVDGYQG 1056

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN I+ILSLVRS+ + + IGFL + NRVCV+LSRA+HG YI GNA  L  +S LW E++
Sbjct: 1057 EENKIVILSLVRSNAAGQ-IGFLKVVNRVCVSLSRAQHGFYILGNARLLCEKSDLWNEIV 1115

Query: 180  SILEK--SKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
              LE+         + L CQ+H +  T++    DF    EGGC + C E + CGH C   
Sbjct: 1116 GNLEEQNGNMIGTKLVLKCQRHGQP-TEIQWPVDFTTVEEGGCQQQCNEVLPCGHRCTLK 1174

Query: 236  CHLSSHDKIFCPENCIRTLPCGH 258
            CH  SHD+  C + C + L C H
Sbjct: 1175 CHPYSHDEYRCKQQCEKILDCNH 1197



>gi|302800058|ref|XP_002981787.1| hypothetical protein SELMODRAFT_115022 [Selaginella moellendorffii]
 gi|300150619|gb|EFJ17269.1| hypothetical protein SELMODRAFT_115022 [Selaginella moellendorffii]
          Length = 972

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 185/358 (51%), Gaps = 23/358 (6%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           +P I KL++ IY   L +H  V  Y DV G+  +LFF DH   E+   +  S+ N  EA+
Sbjct: 156 KPCIAKLISSIY-PQLRNHPSVLEYEDVKGVKSSLFFLDHNAPEEAGHEAGSKVNLAEAK 214

Query: 61  MCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
           +  +L +YL+         ITIL+MY GQ +EI + L++     P     RVSSVD FQG
Sbjct: 215 LVVELCSYLLKQEAYAPGDITILTMYKGQVQEISRRLKDRFHWMP-----RVSSVDDFQG 269

Query: 120 EENDIIILSLVRSD-----ESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTL 174
           EENDII+LSLVRS+     E    IGFL   NRVCVALSRA+ GLYIFGNA  L  +S L
Sbjct: 270 EENDIILLSLVRSNLVPGKEDEGTIGFLKTGNRVCVALSRARKGLYIFGNAQLLALKSPL 329

Query: 175 WREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHIC 232
           W+ +L  L +       + L CQ HP  ET V    DF    +GGCSR CE +++CGH C
Sbjct: 330 WKGILHGLHQDGLMGSKLVLCCQNHPGVETSVQHPEDFLQVGDGGCSRPCEYQLECGHAC 389

Query: 233 QSICHLSSHDKIFCPENCIR-----TLPCGHPXXXXXXXXXXXXVETII-MCPPCGHSEV 286
              CH  SHD   CP+ C++     T  C                E ++   P CGH + 
Sbjct: 390 PRRCHPESHDTFICPKMCLKPYDGCTHRCVKSCHGREDPACPPCKEPVLKTLPTCGHEQS 449

Query: 287 VLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
           V C  D     C+  C K L CGH C E C  P C   C      + P CGH    +C
Sbjct: 450 VPCSTDPAKLTCRSPCKKLLSCGHACPEPCGLP-CAKSCRQVVHKELP-CGHATKMMC 505



>gi|443719429|gb|ELU09610.1| hypothetical protein CAPTEDRAFT_62017, partial [Capitella teleta]
          Length = 1119

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 191/352 (54%), Gaps = 15/352 (4%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+TP  +  L +H  V    ++ G++ N+ F DHQE E    DTMS++N  EA 
Sbjct: 558 RPEIAQLITPHIYKQLYNHPSVFDRDNILGISGNILFVDHQEMESTVEDTMSKSNEHEAL 617

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              KL  YL+  G E S+IT+L+MY GQ   I K + + ++       +RV+ VD FQGE
Sbjct: 618 FIIKLIRYLLHQGYEASQITVLTMYLGQMFLIKKKMADFAKD----DMVRVTPVDNFQGE 673

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+II+LS VRS+  ++ IGFL++SNRVCVALSRA+ G Y  GN S LR +S LW  + S
Sbjct: 674 ENEIILLSCVRSNADDK-IGFLNVSNRVCVALSRARKGFYCIGNISLLRKKSPLWENICS 732

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
            L+K +     I   CQ H + +      ADF   PL GGC   C  +++CGH CQ +CH
Sbjct: 733 ELDKDENVVDGIPCVCQNHSDSKFVARFPADFDQAPL-GGCRLPCSFRLECGHTCQWLCH 791

Query: 238 L--SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII-MCPPCGHSEVVLC-PDVD 293
                HD+  C + C ++   GHP             + +  + P CGH ++V C  D  
Sbjct: 792 PFDKKHDEYKCKKPCTKSCLNGHPCTSPCYKDCPPCKKLMAKVIPECGHEQMVPCYLDPA 851

Query: 294 NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHD 345
            F CK  C+++  CGH C++ C  P     C        P CGH    LC D
Sbjct: 852 QFLCKVICNREKPCGHICKKSCGDP--CLPCQQPVLKTLPSCGHEQKVLCSD 901



>gi|403376237|gb|EJY88099.1| NFX1-type zinc finger-containing protein 1 [Oxytricha trifallax]
          Length = 1878

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 195/366 (53%), Gaps = 33/366 (9%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  ++  IY + L D E+V +YP V G   NLFFFDH+  E  +   +S  N FE  
Sbjct: 1057 RPEISSIVKLIYPN-LEDGEKVLNYPIVRGTDKNLFFFDHENQEDKDEKLLSTYNKFEGS 1115

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  +   YL+       RITILS+Y  Q   I + + E+  K   ++Q++V +VD FQGE
Sbjct: 1116 MIERFTKYLLQQNYRPERITILSLYMAQSLHIKRLIMEKYPKFHEMRQVKVITVDNFQGE 1175

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNAS-------------- 166
            ENDIIILSLVRS+ SN+ IG+L +SNRVCVALSRAKHG++IFGNAS              
Sbjct: 1176 ENDIIILSLVRSNASNQ-IGYLKVSNRVCVALSRAKHGMFIFGNASCLYKFVDGQKQKQF 1234

Query: 167  -QLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCE 223
             Q+  +  LW EVL+ L++ +   Q +NL C++H +  TQ+    DF    EGGC   C 
Sbjct: 1235 AQVEEQQQLWLEVLNYLKEGQYIGQSLNLCCERH-KIITQIQKPEDFQNVPEGGCKLPCN 1293

Query: 224  EKMDCGHICQSICH--------LSSHDKIFCPENCIRTLPCGHPXXXX--XXXXXXXXVE 273
             ++ CGH C++ICH         + H    C   C +  PCGHP               +
Sbjct: 1294 ARLTCGHSCKNICHSYELTLEDSTGHKNFKCLNKCEKENPCGHPCSFKCHECTDKLRPCQ 1353

Query: 274  TII--MCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVK 331
            T+I  +   C H   V C   D+ +C ++C     CGH+C++ C+    T  C      K
Sbjct: 1354 TMIDKVFEQCKHVGRVKCHQKDSSKCYDQCQIIKPCGHKCQKFCNVDCSTEKCGVNVLKK 1413

Query: 332  YPGCGH 337
             P CGH
Sbjct: 1414 LP-CGH 1418



>gi|459180293|ref|XP_002121871.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Ciona
            intestinalis]
          Length = 1965

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 195/361 (54%), Gaps = 15/361 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            +P I  L+ P  +  L DHE V  Y ++ G++ ++FF  H++ E    D  ++ N +EAR
Sbjct: 1110 KPSIANLIRPEIYKNLLDHESVLKYEEISGVSKSVFFISHEQKEDTVLDGRTKVNNYEAR 1169

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  +L++   + S+ITIL+ Y+GQ    +K + E++    + + +RV++VD +QGE
Sbjct: 1170 YMVALCKHLMLQDYKPSQITILTTYTGQLF-AFKRIMEQT----LYRGVRVTAVDNYQGE 1224

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFLS+ NRVCVALSRAK GLY  GN   L+ +S LW+ +++
Sbjct: 1225 ENDIILLSLVRSNDEGR-IGFLSVRNRVCVALSRAKKGLYCIGNLELLKEKSDLWQTIVA 1283

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFT---FADFPLEGGCSRNCEEKMDCGHICQSICH 237
             L+        + L C+ HPE   +V +   F  FP EGGC + CE ++ CGH+C   CH
Sbjct: 1284 KLQHENMTGTALTLQCKNHPETTVKVESPEDFEKFP-EGGCGKVCEVRLPCGHVCPRSCH 1342

Query: 238  LSSHD--KIFCPENCIRTLPCGHPXXXXXXXXXXXXVETI-IMCPPCGHSEVVLCP-DVD 293
                D  K  C + C ++   GH              E +  M P C H E + C  D  
Sbjct: 1343 PDDQDHTKFKCRKPCPKSCSKGHRCKKKCSDDCGPCTERMEKMVPSCCHIEKMYCSKDPS 1402

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
               C + CSK L CGH+C   C  P    +C  + +V    CGH    LC D  N  +D 
Sbjct: 1403 EHICLKPCSKTLACGHKCTSVCGRPCKAELCTEKIKVDL-SCGHESKILCRDSANPDKDK 1461

Query: 354  C 354
            C
Sbjct: 1462 C 1462



>gi|348537350|ref|XP_003456158.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Oreochromis
            niloticus]
          Length = 1953

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 197/367 (53%), Gaps = 23/367 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ GL  NL+F DH   E+  RD  S  N  EA 
Sbjct: 1108 RPEIARLLTPHIYKELENHPSVLEYENIKGLKTNLYFVDHNHLEEEIRDGKSHQNRHEAM 1167

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  Y ++   +  +ITIL+ Y+GQ   + K +  +         ++V  VD +QGE
Sbjct: 1168 FVVALCRYFLLQDYKPEQITILTTYTGQLHCLRKQMPAKE-----FAGVKVHVVDKYQGE 1222

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS+  ++ +GFLSISNRVCVALSRAK GLY  GN+  L  +  LW ++  
Sbjct: 1223 ENDIVLLSLVRSNRQSK-VGFLSISNRVCVALSRAKKGLYCIGNSVMLD-QVKLWSKIFH 1280

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +  +  + + L CQ HP++E +V    DF    EGGC++ C+ ++DCGH+C S+CH 
Sbjct: 1281 TLREKDQVGKALTLCCQNHPDREVKVSNAEDFRQAPEGGCTQPCQFRLDCGHVCASVCHP 1340

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXX----XXXXXXXXXXVETIIMCPPCGHSEVVLC-P 290
                H K  C + C + L   GH                 VE II  P C H++++ C  
Sbjct: 1341 YDPEHKKYKCVKKCEKILCDLGHKCTLVCHKECPNKCPVKVEKII--PKCQHTQMIPCHQ 1398

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHI--DLCLCHDIRN 348
            D + F C+E C + L CGH C   C  P CT+ C  +  +K  GCGH   D C   D  +
Sbjct: 1399 DPNTFTCQEPCQRLLSCGHPCESVCGLP-CTSQCKVKVILKL-GCGHTQEDACFYKDCID 1456

Query: 349  KLQDGCP 355
            K +   P
Sbjct: 1457 KAECKAP 1463



>gi|403349252|gb|EJY74066.1| hypothetical protein OXYTRI_04681 [Oxytricha trifallax]
          Length = 2036

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 137/363 (37%), Positives = 190/363 (52%), Gaps = 30/363 (8%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +++  IY + L D E V  YP + G+  +L+FFDHQ  E  +   MS+ N FE  
Sbjct: 1221 RPEISQIVKLIYPN-LVDGENVKKYPIIRGVDKSLYFFDHQHEEDRDEGLMSKYNRFEGA 1279

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  +   YL+    +  +ITILS+Y  Q   I + + ++  K   +++++V +VD FQGE
Sbjct: 1280 MIERFTVYLLKQNYKPEKITILSLYMAQSMLIKREIMDKYPKEHEMRKVKVITVDNFQGE 1339

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNAS-------------- 166
            ENDIIILSLVRS++SN  IG+L +SNRVCVALSRAKHG++IFGNAS              
Sbjct: 1340 ENDIIILSLVRSNQSN-SIGYLDVSNRVCVALSRAKHGMFIFGNASCLDNHAERQKNQNK 1398

Query: 167  -QLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCE 223
              +  +  LW EVL  L K+K     +NL C+KH +  T +    DF    EGGC + C 
Sbjct: 1399 NNIEGQQQLWFEVLDYLRKNKLLGPALNLCCEKH-KNATAIQNPEDFQNVPEGGCKQLCN 1457

Query: 224  EKMDCGHICQSICHL-----SSHDKIFCPENCIRTLPCGHPXXXX----XXXXXXXXVET 274
             +++CGH C+ +CH      + H K  C + C R   CGHP                   
Sbjct: 1458 ARLNCGHACKIVCHYYEQASTGHSKFKCLQECGRKHLCGHPCSYKCFQCSDKPQPCQTMI 1517

Query: 275  IIMCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPG 334
             I    CGH++ V C    + +C E+C     CGH C++ C        C     VK   
Sbjct: 1518 DITFQSCGHTKNVQCNLKKSSKCNEQCKIVKPCGHSCKQPCHIDCSNLKCGVNV-VKTLP 1576

Query: 335  CGH 337
            CGH
Sbjct: 1577 CGH 1579



>gi|302768273|ref|XP_002967556.1| hypothetical protein SELMODRAFT_408664 [Selaginella moellendorffii]
 gi|300164294|gb|EFJ30903.1| hypothetical protein SELMODRAFT_408664 [Selaginella moellendorffii]
          Length = 1778

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 187/388 (48%), Gaps = 62/388 (15%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            +P I KL++ IY   L +H  V  Y DV G+  +LFF DH   E+   +  S+ N  EA+
Sbjct: 1007 KPCIAKLISSIYPQ-LRNHPSVLEYEDVKGVKSSLFFLDHNAPEEAGHEAGSKVNLAEAK 1065

Query: 61   MCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYLRE----------------ESRKT 103
            +  +L +YL+         +TIL+MY GQ +EI + L++                E+ + 
Sbjct: 1066 LVVELCSYLLKQEAYAPGDMTILTMYKGQVQEISRRLKDRFQCRRVTGRPLGPEAENSEA 1125

Query: 104  PVLKQIRVSSVDGFQGEENDIIILSLVRSD-----ESNRGIGFLSISNRVCVALSRAKHG 158
                  RVSSVD FQGEENDII+LSLVRS+     E    IGFL   NRVCVALSRA+ G
Sbjct: 1126 TDSWMPRVSSVDDFQGEENDIILLSLVRSNLVPGKEDEGTIGFLKTGNRVCVALSRARKG 1185

Query: 159  LYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EG 216
            LYIFGNA  L  +S LW+ +L  L +       + L CQ HP  ET V    DF    +G
Sbjct: 1186 LYIFGNAQLLALKSPLWKGILHGLHQDGLMGSKLVLCCQNHPGVETSVQHAEDFLQVGDG 1245

Query: 217  GCSRNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTL--------------------PC 256
            GCSR CE +++CGH C   CH  SHD   CP+ C++                      PC
Sbjct: 1246 GCSRPCEYQLECGHACPRRCHPESHDTFICPKMCLKPYDGCTHRCVKSCHGREDPACPPC 1305

Query: 257  GHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDNFRCKERCSKKLKCGHQCREEC 315
              P               +   P CGH + V C  D     C+  C K L CGH C E C
Sbjct: 1306 KEP--------------VLKTFPTCGHEQSVPCSTDPAKLTCRSPCKKLLSCGHACPEPC 1351

Query: 316  SSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
              P C  +C      + P CGH    +C
Sbjct: 1352 GLP-CAKLCRQVVRKELP-CGHATKMMC 1377



>gi|326668908|ref|XP_003198892.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Danio
            rerio]
          Length = 1947

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 188/347 (54%), Gaps = 20/347 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP I +LLTP  + +L +H  V  Y +V G+  NLFF DH + E+  +D  S  N  EAR
Sbjct: 1097 RPSIARLLTPHIYSSLENHPSVLKYDNVKGVLTNLFFVDHIQPEEEIKDGRSHQNPHEAR 1156

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  YL+    + S+ITIL+ Y+GQ   + K +      +P    ++V  VD +QGE
Sbjct: 1157 FVVELCQYLLFQDYKPSQITILTTYTGQLHCLRKLM-----PSPKFSGVKVHVVDKYQGE 1211

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS+   R +GFL+I NRVCVALSRAK GLY  GN   L    TLW  ++ 
Sbjct: 1212 ENDIIILSLVRSNPQRR-VGFLNIPNRVCVALSRAKMGLYCIGNMDMLS-SVTLWSNIIH 1269

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +  +    + L CQ HP+K+       DF    EGGC + C+ ++DCGH+C  +CH 
Sbjct: 1270 TLREHDQVGPALTLSCQNHPDKQIHASCGNDFKGAPEGGCDQPCQYRLDCGHVCTRMCHP 1329

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXXX---XXXXXXXXXVETIIMCPPCGHSEVVLC-PD 291
              + H +  C ++C + L   GH                V+ II  P C H++ V C  D
Sbjct: 1330 YDAEHKEYKCMKDCSKVLCELGHKCTRRCHQECGKCMVSVDKII--PSCQHNQKVPCHKD 1387

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHI 338
               F C+ RC K L CGH C+  C    CT+ C+ +  ++   CGH+
Sbjct: 1388 PAEFVCQVRCEKTLPCGHPCKATCGES-CTSQCMVRVPIEL-KCGHM 1432



>gi|242790500|ref|XP_002481566.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218718154|gb|EED17574.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 1121

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/267 (44%), Positives = 159/267 (59%), Gaps = 20/267 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR+LLTPIY D + DHE VN    VP + +   FFF H   E  +    S+ N  EA 
Sbjct: 686 PEIRRLLTPIY-DNIEDHETVNKLAKVPAMGEVRAFFFSHHWRENSD-SLFSKYNHNEAL 743

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M A    YLV+ G++ + IT+L+ Y+GQRK+I   L+  S K    + ++V +VD +QGE
Sbjct: 744 MVATFFLYLVLAGLDSAHITVLTFYNGQRKKILSLLK--SNKHLQGRHLKVYTVDSYQGE 801

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN++++LSLVRS++ N GIGFL I NRVCVALSRA+ G Y+FGNA  L   S LW +V+S
Sbjct: 802 ENEVVLLSLVRSNDQN-GIGFLKIENRVCVALSRARRGFYMFGNAEHLASESPLWMKVIS 860

Query: 181 ILEKSKKCD----QFINLYCQKHPEKETQVFTFADFP-----LEGGCSRNCEEKMDCGHI 231
           ++           ++I L C+KH  KE     F + P     L GGCS  C + +DCGH 
Sbjct: 861 VIGSGNATTTCIARYIQLTCEKHGNKE-----FVEMPQDLVELTGGCSVPCTQTLDCGHT 915

Query: 232 CQSICHLSSHDKIFCPENCIRTLPCGH 258
           C   CH   H +I C   C RTL CGH
Sbjct: 916 CALRCHNFDHSQIECQATCERTLSCGH 942



>gi|345492959|ref|XP_001601264.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Nasonia
            vitripennis]
          Length = 1933

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 184/350 (52%), Gaps = 11/350 (3%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP+  KLLTP  ++ L + + V + P+V GL  NLFF +H   E+   +  S  N  E  
Sbjct: 901  RPQFAKLLTPSIYEQLYNDKTVFNRPNVLGLNKNLFFLNHSNREQSHNNEESWVNKHEVE 960

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +LV+ G +   ITIL  Y+GQ   ++ ++RE+ R   +L+ +R+++VD FQGE
Sbjct: 961  FLVAFARHLVLQGYKPMDITILCTYTGQ---LFAFMREKDRYISILRYVRITTVDNFQGE 1017

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            EN II+LSLVR++     +GFL   NRVCVALSRAK GLYI GN   L  ++ +W ++  
Sbjct: 1018 ENKIILLSLVRNNGEG-NVGFLKQENRVCVALSRAKEGLYIMGNMDDLLVKNDIWPKIKG 1076

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            +LE+ K     + L CQ HP++   V   +DF    EGGCS+ CE  M CGH C S+CH 
Sbjct: 1077 VLEEEKAIGDVLELRCQIHPDQLILVKDASDFQKSPEGGCSKMCEVDMPCGHRCLSVCHT 1136

Query: 239  SS--HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDNF 295
                H +  C + C++T P  HP               +     CGH+  +LC  D D F
Sbjct: 1137 RDREHKEFECRKKCLKTCPHNHPCTLICYEGCKACEVKVERELKCGHTVQMLCSDDPDKF 1196

Query: 296  RCKERCSKKL-KCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
            +CK      L  C H+  + C        C    +V+  GCGH     CH
Sbjct: 1197 KCKTLIKVILPACKHETEKPCHVEIEECRCTHPCDVRL-GCGHTCTLTCH 1245



>gi|291245137|ref|XP_002742448.1| PREDICTED: regulator of nonsense transcripts 1-like [Saccoglossus
            kowalevskii]
          Length = 2081

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 180/335 (53%), Gaps = 17/335 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +L+  IY + LS+H+ V +Y D+ G+  N+FF  H + E+   +T SR+N+ EA 
Sbjct: 1070 RPEIAELMKHIYTN-LSNHDSVKYYEDIQGVNKNIFFIKHDKEEEFMEETRSRSNSHEAE 1128

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL+  G    +ITIL+MY+ Q  E  K +++          +RV  VD FQGE
Sbjct: 1129 FIVALCRYLLQQGYNPPQITILTMYTAQLFEFKKLMKQRD-----FFGVRVCPVDNFQGE 1183

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+ +   IGFLSI+NRVCVALSRA+ G +  GN   L  ++ LW+++  
Sbjct: 1184 ENDIILLSLVRSNLAG-NIGFLSIANRVCVALSRARKGFFCIGNFKLLAEKNKLWKQITL 1242

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             LE +      + L+C+ HP  +       DF    EGGC   C ++MDCGHIC+  CH 
Sbjct: 1243 DLETNSNIGTSLQLHCRNHPTSKINATCAIDFKAAPEGGCKLQCNKRMDCGHICKRFCHP 1302

Query: 239  SS--HDKIFCPENCIRTLPCGHP---XXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDV 292
                H ++ C   C+   P  H                VE +I  P C H+++V C  D 
Sbjct: 1303 KDPEHKEVTCRAPCLSRCPNDHACPLRCYEKCSNCIVKVEKLI--PDCQHTQLVPCYLDP 1360

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQ 327
            + F+CK  C + L CGH    +C     T  CL Q
Sbjct: 1361 NKFKCKVPCDRLLPCGHMRTLDCYIDVATFKCLEQ 1395



>gi|198427464|ref|XP_002125363.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Ciona
            intestinalis]
          Length = 1576

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 182/354 (51%), Gaps = 21/354 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            +P I  L+ P  +  L+DHE V  Y D+PG+  +L+F  H + E    D+ S+ N  EA 
Sbjct: 1191 KPRIADLIRPHIYKTLTDHEVVKKYEDIPGVEKSLYFISHGKMEDKVTDSKSKKNQHEAE 1250

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  Y ++   +  +ITIL+ Y+GQ  E+   +R  + +   LK + V++VD FQGE
Sbjct: 1251 FMVALCKYFLLHEFKPEQITILTTYTGQLLELKNIIRSSANE---LKGVYVTAVDNFQGE 1307

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + IGFL I NRVCVALSRAK GL+  GN   LR  S +W  ++S
Sbjct: 1308 ENDIILLSLVRSNE-QKSIGFLKIHNRVCVALSRAKRGLFCIGNLQLLRSESKIWESIVS 1366

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             LE+ +     + L C+ HPE    V +  DF     G C+  C  ++DCGH+C   CHL
Sbjct: 1367 DLERDQLIGPALKLQCKNHPETCVLVESAKDFQKFPGGSCNVPCNYRLDCGHVCTRTCHL 1426

Query: 239  --SSHDKIFCPENCIRTLP-CGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVD 293
              S H K  C + C +  P  GH              V      P C H + + C    +
Sbjct: 1427 DDSDHSKFICKKPCTKACPDLGHKCLKQCWKDCGSCPVLVDKTMPVCQHIQTMKCGIKPE 1486

Query: 294  NFRCKERCSKKLKCGHQCR----EECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
            +F CK  C K   CGHQC+    EEC        C  + E K P CGH     C
Sbjct: 1487 DFVCKMPCPKMFSCGHQCQLYCGEECKP------CGVKVEKKIPKCGHTQEMAC 1534



>gi|403334658|gb|EJY66494.1| hypothetical protein OXYTRI_13219 [Oxytricha trifallax]
          Length = 1780

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 193/368 (52%), Gaps = 38/368 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +++  +Y + L D   V  YP + G+  +++FFDH+  E  +   MS+ N FEA 
Sbjct: 956  RPEISEMIRFLYPN-LEDDARVKTYPSIKGIEKSVYFFDHENEEVTDEGNMSKMNKFEAE 1014

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M  K   YL+    +  +ITILS+Y  Q   I + ++   ++ P  ++++V +VD FQGE
Sbjct: 1015 MIEKFIIYLLQQSYDPEKITILSLYMAQSSFIKRNIQRYPKEHPA-RKVKVITVDNFQGE 1073

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNAS-------------- 166
            ENDIIILSLVRS++ N  IG+L +SNRVCVALSRAKHG++IFGNAS              
Sbjct: 1074 ENDIIILSLVRSNQRNE-IGYLKVSNRVCVALSRAKHGMFIFGNASCLYKYVDQQNKRQF 1132

Query: 167  -QLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCE 223
              L  +S LW +VL  L+K+    Q +NL C  H +  T+V   +DF    EGGC   C 
Sbjct: 1133 ANLEDQSQLWVKVLEYLKKNDFIGQTLNLCCVNH-KAITKVKVPSDFQNVPEGGCKLPCG 1191

Query: 224  EKMDCGHICQSICHL--------SSHDKIFCPENCIRTLPCGHPXXXX------XXXXXX 269
             +M+CGH C+S+CH         + H+K  C ++C R   CGH                 
Sbjct: 1192 IRMECGHTCESLCHYYEQTLLDKTGHNKYKCLKSCERVHKCGHDCSYKCFECRFEQQPCR 1251

Query: 270  XXVETIIMCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTE 329
              VE +     C H + VLC D +  +C   C     CGH+C + C     +  C    E
Sbjct: 1252 QTVEKVF--ARCQHKQKVLCYDQETSKCMSSCKIVKPCGHKCPKYCHQDCSSDRCGENME 1309

Query: 330  VKYPGCGH 337
               P CGH
Sbjct: 1310 KTLP-CGH 1316



>gi|403351933|gb|EJY75469.1| hypothetical protein OXYTRI_03144 [Oxytricha trifallax]
          Length = 2557

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 194/368 (52%), Gaps = 35/368 (9%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  ++  +Y D L+D   V+ YPD+ G   N+FF +HQ  E  +   MS+ N +EA+
Sbjct: 1654 RPEISGMIKFLYPD-LTDGANVHLYPDIRGTKQNVFFMNHQRLEDKDEGMMSKLNKYEAQ 1712

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREE--SRKTPVLKQIRVSSVDGFQ 118
            M  K   YL+  G +   I+ILS+Y  Q   I K + ++  + +   + +++V +VD FQ
Sbjct: 1713 MIIKFTFYLIQQGYQSKNISILSLYMAQSNYIKKQIIQQYGANRLHEINKVKVVTVDNFQ 1772

Query: 119  GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQL-RY------- 170
            GEE+DIIILSLVRS+  N+ IG+L +SNRVCVALSRAK GL+IFGNA+ L +Y       
Sbjct: 1773 GEESDIIILSLVRSNTENQ-IGYLKVSNRVCVALSRAKQGLFIFGNATCLYKYQEQLQRR 1831

Query: 171  -------RSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRN 221
                   +S LWR VL  LE+++     + L C +H +  T++    DF    EGGCSR 
Sbjct: 1832 QQVQLDEQSQLWRLVLEYLERNQFIGDKLQLECSQH-QFVTEIKNPEDFQNVPEGGCSRI 1890

Query: 222  CEEKMDCGHICQSICH--------LSSHDKIFCPENCIRTLPCGHPXXXX----XXXXXX 269
            C+  + CGH C+ ICH         S H    C + CIR   CGHP              
Sbjct: 1891 CDAGLVCGHTCEKICHPFRPNDKDPSGHKIDRCTKICIREHDCGHPCTYKCYQCVISQQP 1950

Query: 270  XXVETIIMCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTE 329
                  + C    H   ++C   + F+C ++C K   CGHQC++ C    C  +  T   
Sbjct: 1951 CQATITVSCLAFNHQSEIICHTKNRFKCLQQCEKIKACGHQCQKSCHID-CALLPCTHQV 2009

Query: 330  VKYPGCGH 337
             K   CGH
Sbjct: 2010 PKTLSCGH 2017



>gi|327288951|ref|XP_003229188.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Anolis
            carolinensis]
          Length = 1876

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 137/373 (36%), Positives = 194/373 (52%), Gaps = 39/373 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA+
Sbjct: 1024 RPEIARLLTPHIYAELENHPSVLEYESIKGVSSNLFFVEHNVPEQSLQEGKSHQNQHEAQ 1083

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  YL+  G + S+ITIL+ Y+GQ   + K L  ++      + ++V  VD +QGE
Sbjct: 1084 FLVRLCQYLLCQGYQPSQITILTTYTGQLFCLRKLLPAKT-----FQGVKVHVVDKYQGE 1138

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS+   R +GFL  +NRVCVALSRAK GL+  GN   L  +  LW ++  
Sbjct: 1139 ENDIVLLSLVRSNLEGR-VGFLQAANRVCVALSRAKKGLFCIGNLGML-SQVPLWSKIAH 1196

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L + ++  + + L CQ HPE  T+V    DF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 1197 TLREKRQVGRAMVLSCQNHPETHTEVAQAEDFASVPEGGCSRPCEARLGCGHVCPRACHP 1256

Query: 239  SS--HDKIFCPENCIRT-------------LPCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H +  C + C +T              PCG              V+     P CGH
Sbjct: 1257 YDPFHREFKCMKPCQKTRCADGHRCPRLCSQPCGE-----------CQVKVPKTLPGCGH 1305

Query: 284  SEVVLCPD-VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
             + V C    + F C+E CS+ L CGH+CR  C    CT  C  + ++    CGH     
Sbjct: 1306 LQQVPCATPAEEFSCQEPCSRDLSCGHKCRMTCGQ-VCTQRCPEKVQITL-KCGHSQELS 1363

Query: 343  CHDIRNKLQDGCP 355
            C  I  +++DG P
Sbjct: 1364 C-SIAEEVRDGRP 1375



>gi|327291388|ref|XP_003230403.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like, partial
           [Anolis carolinensis]
          Length = 1082

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 137/374 (36%), Positives = 193/374 (51%), Gaps = 39/374 (10%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA+
Sbjct: 230 RPEIARLLTPHIYAELENHPSVLEYESIKGVSSNLFFVEHNVPEQSLQEGKSHQNQHEAQ 289

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  YL+  G + S+ITIL+ Y+GQ   + K L  ++      + ++V  VD +QGE
Sbjct: 290 FLVRLCQYLLCQGYQPSQITILTTYTGQLFCLRKLLPAKT-----FQGVKVHVVDKYQGE 344

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDI++LSLVRS+   R +GFL  +NRVCVALSRAK GL+  GN   L  +  LW ++  
Sbjct: 345 ENDIVLLSLVRSNLEGR-VGFLQAANRVCVALSRAKKGLFCIGNLGMLS-QVPLWSKIAH 402

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            L +  +  + + L CQ HPE  T+V    DF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 403 TLREKGQVGRAMVLSCQNHPETHTEVAQAEDFASVPEGGCSRPCEARLGCGHVCPRACHP 462

Query: 239 SS--HDKIFCPENCIRT-------------LPCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
               H +  C + C +T              PCG              V+     P CGH
Sbjct: 463 YDPFHREFKCMKPCQKTRCADGHRCPRLCSQPCGE-----------CQVKVPKTLPGCGH 511

Query: 284 SEVVLCPD-VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
            + V C    + F C+E CS+ L CGH+CR  C    CT  C  + ++    CGH     
Sbjct: 512 LQQVPCATPAEEFSCQEPCSRDLSCGHKCRMTCGQ-VCTQRCPEKVQITL-KCGHSQKLS 569

Query: 343 CHDIRNKLQDGCPF 356
           C  I  +++DG P 
Sbjct: 570 C-SIAEEVRDGRPV 582



>gi|330791023|ref|XP_003283594.1| hypothetical protein DICPUDRAFT_147315 [Dictyostelium purpureum]
 gi|325086454|gb|EGC39843.1| hypothetical protein DICPUDRAFT_147315 [Dictyostelium purpureum]
          Length = 1705

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 190/347 (54%), Gaps = 17/347 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEV----NHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTF 57
            P I + +TPIY++ L +H EV       P V G+  NLFF  H+E E  + +  S+ N +
Sbjct: 1040 PNISRFITPIYNN-LKNHPEVKIRFQQNPGVLGMPSNLFFITHKELENCDSNGSSKFNVY 1098

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA+  + LA +L+  G E + + IL+ Y+GQ  +I   +R  +   P L ++++ +VD F
Sbjct: 1099 EAKFISNLALFLLKQGYEANNLVILTPYTGQLLKIRSQVR--NINNPTLTKVQIRTVDQF 1156

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE DI++LSLVRS+ +N   GF+ I NR+ VA+SRAK+G++I GN   L    TLW  
Sbjct: 1157 QGEERDIVLLSLVRSNPNNDS-GFVKIQNRINVAISRAKNGMFIIGNRQLLEKAHTLWSN 1215

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVF---TFADFPLEGGCSRNCEEKMDCGHICQS 234
            + SILE+ K      ++ C+ HP++ T +     F + P EGGC R CE ++ CGH C  
Sbjct: 1216 MFSILEQEKLIGPSFSIVCRNHPQQVTVISCPDDFKNVP-EGGCLRKCEYRLHCGHTCGQ 1274

Query: 235  ICHL--SSHDKIFCPENCIRTLP-CGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-P 290
             CHL  + H++I C + C +    CGH                +     CGH+E + C  
Sbjct: 1275 ACHLIDTDHERIQCTKRCEKVREGCGHQCTKLCGGDCGQCTVEVEARLRCGHTEFIACHK 1334

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            DV  ++CK+ C++  KCGH C   C     +  C  + E   P CGH
Sbjct: 1335 DVSTYKCKQPCTRTRKCGHPCNALCGDNCESIKCPVEVERILP-CGH 1380



>gi|443725470|gb|ELU13047.1| hypothetical protein CAPTEDRAFT_103161, partial [Capitella teleta]
          Length = 1016

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 190/361 (52%), Gaps = 15/361 (4%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+TP  +  L +H  V    ++ G++ N+ F DHQE E    DTMS++N  EA 
Sbjct: 455 RPEIAQLITPHIYKQLYNHPSVFDRDNILGISGNVLFVDHQEMESTVEDTMSKSNEHEAL 514

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              KL  YL+  G E S+IT+L+MY GQ   I K + + ++       +RV+ VD FQGE
Sbjct: 515 FIIKLIRYLLHQGYEASQITVLTMYLGQMFLIKKKMADFAKD----DMMRVTPVDNFQGE 570

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+II+LS VRS+  ++ IGFL++SNRVCVALSRA+ G Y  GN S LR +S LW  + S
Sbjct: 571 ENEIILLSCVRSNADDK-IGFLNVSNRVCVALSRARKGFYCIGNISLLRKKSPLWENICS 629

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
            L+K +     I   CQ H + +      ADF   PL GGC   C  ++ CGH C+ +CH
Sbjct: 630 ELDKDENVVDGIPCVCQNHSDSKFVARFPADFDQAPL-GGCHLPCSFRLQCGHTCEWLCH 688

Query: 238 L--SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII-MCPPCGHSEVVLC-PDVD 293
                HD+  C + C ++   GH              + +  + P CGH ++V C  D  
Sbjct: 689 PFDKKHDEYKCKKPCTKSCLNGHLCTSLCYKDCPPCKKLMAKVIPECGHDQMVPCYLDPA 748

Query: 294 NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
            + C++ C ++  CGH C++ C  P     C        P CGH     C D   K    
Sbjct: 749 LYPCQDICDREKPCGHICKKRCGDP--CLPCRQPVLKTLPSCGHEQKVQCSDEIKKCTQP 806

Query: 354 C 354
           C
Sbjct: 807 C 807



>gi|498971653|ref|XP_004547697.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Maylandia
            zebra]
          Length = 1955

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 137/367 (37%), Positives = 195/367 (53%), Gaps = 23/367 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ GL  NL+F DH   E+  RD  S  N  EA 
Sbjct: 1110 RPEIARLLTPHIYTELENHPSVLEYENIKGLKTNLYFVDHNHLEEEIRDGKSHQNRHEAM 1169

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  Y ++   +  +ITIL+ Y+GQ   + K++  +         ++V  VD +QGE
Sbjct: 1170 FVVALCRYFLLQDYKPEQITILTTYTGQLHCLRKHMPAKE-----FAGVKVHVVDKYQGE 1224

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS+  ++ +GFL+ISNRVCVALSRAK GLY  GN+  L  +  LW ++  
Sbjct: 1225 ENDIVLLSLVRSNRQSK-VGFLNISNRVCVALSRAKKGLYCIGNSVMLD-QVKLWSKIFH 1282

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +  +  + + L CQ HP++E +V    DF    EGGC++ C+ ++DCGH+C  +CH 
Sbjct: 1283 TLREKDQVGKALTLCCQNHPDREVKVSNADDFSQAPEGGCTQPCQFRLDCGHVCTRVCHP 1342

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXXXXXX----XXXXXXVETIIMCPPCGHSEVVLC-P 290
                H K  C + C + L   GH                 VE II  P C H++++ C  
Sbjct: 1343 YDPEHKKYKCVKKCEKILCDMGHKCTLLCHIECPKNCPVKVEKII--PKCQHTQMIPCHQ 1400

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHI--DLCLCHDIRN 348
            D + F C+E C K L C H C   C  P CT+ C  +  +K   CGH   D C   D  +
Sbjct: 1401 DPNTFTCQEPCQKLLSCEHPCESVCGLP-CTSKCKVKVILKL-RCGHTQEDACFYKDCID 1458

Query: 349  KLQDGCP 355
            K +   P
Sbjct: 1459 KAECKAP 1465



>gi|91079006|ref|XP_974779.1| PREDICTED: similar to NFX1-type zinc finger-containing protein 1
            [Tribolium castaneum]
 gi|270003674|gb|EFA00122.1| hypothetical protein TcasGA2_TC002938 [Tribolium castaneum]
          Length = 1970

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/355 (36%), Positives = 193/355 (54%), Gaps = 19/355 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+ P  +D L DH  V + P + G+ + +FF DH  +E+ E + +S+TN  E  
Sbjct: 944  RPEISSLIRPTIYDFLEDHPSVYNRPKISGVDNCVFFIDHTHAEE-ECEGLSKTNLHEVS 1002

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                LA +L++ G   + ITIL+ Y GQ    + + RE+     +LK +RV+ +D +QGE
Sbjct: 1003 FFIYLARHLILNGYNPANITILAAYLGQ---FFAFQREKREHKDLLKDVRVAVLDNYQGE 1059

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVR++  N+ IGFL I NRVCVALSRA++GLYI GN +QL + + LWR++ +
Sbjct: 1060 ESDIILLSLVRNNNENK-IGFLKIENRVCVALSRARNGLYIMGNMTQLCFENKLWRKIKA 1118

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             LE+ K     + L CQ H ++ T V + +DF    EGGC++ C  ++ CGH C  +CH+
Sbjct: 1119 SLEQQKALGTELPLRCQIHQDQVTHVKSESDFFSVSEGGCNKKCGAELKCGHNCNYLCHI 1178

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXX------XXXXXVETIIMCPPCGHSEVVLCP 290
               SH    C   C + L    P                  V  ++    CGH   + C 
Sbjct: 1179 RDRSHMIYKCQAECKKNLCDKDPAHLCKKMCFEDCGLCDYLVHRVL---ACGHEANIQCH 1235

Query: 291  -DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
             D + ++C+   S +L CGH   + C S   T  C    +V+   CGH    LCH
Sbjct: 1236 IDPEIYKCEILVSTELPCGHMADKPCFSNPVTFRCPHICDVQVQPCGHACELLCH 1290



>gi|326481435|gb|EGE05445.1| DEAD box helicase [Trichophyton equinum CBS 127.97]
          Length = 1125

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 163/265 (61%), Gaps = 19/265 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR++L+PIY+D L+DH  V    DVPG+   N +FF H+ +E    D++S R N  EA
Sbjct: 723 PEIRRILSPIYND-LNDHPSVLDRKDVPGMGGINSYFFTHEWTES--SDSLSSRYNQKEA 779

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
           +M      YL M G+    ITIL+ Y+GQRK I K L+E   K    +  +V +VD +QG
Sbjct: 780 KMIVGFYVYLHMNGVPLEDITILTFYNGQRKLILKALKEN--KLFQGQYTKVVTVDSYQG 837

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+++ILSLVRS+E++  IGFL+  NRVCVALSRAK G YIFGNA  L   + LW +V 
Sbjct: 838 EENEVVILSLVRSNEAD-NIGFLANENRVCVALSRAKRGFYIFGNAESLAITNGLWWQVS 896

Query: 180 SILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHICQ 233
            I+ K+ K+   F+ L C+KH  K     T    P E     GGCS+ C E++ CGH C 
Sbjct: 897 QIMRKTPKRLGYFLPLMCKKHGTK-----TLISNPDEWSKNDGGCSQRCGEELKCGHTCP 951

Query: 234 SICHLSSHDKIFCPENCIRTLPCGH 258
            +CH   H K+ C  NC R LPCGH
Sbjct: 952 LLCHAIPHSKLQCQVNCDRMLPCGH 976



>gi|326468825|gb|EGD92834.1| DEAD box helicase [Trichophyton tonsurans CBS 112818]
          Length = 1125

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 163/265 (61%), Gaps = 19/265 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR++L+PIY+D L+DH  V    DVPG+   N +FF H+ +E    D++S R N  EA
Sbjct: 723 PEIRRILSPIYND-LNDHPSVLDRKDVPGMGGINSYFFTHEWTES--SDSLSSRYNQKEA 779

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
           +M      YL M G+    ITIL+ Y+GQRK I K L+E   K    +  +V +VD +QG
Sbjct: 780 KMIVGFYVYLHMNGVPLEDITILTFYNGQRKLILKALKEN--KLFQGQYTKVVTVDSYQG 837

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+++ILSLVRS+E++  IGFL+  NRVCVALSRAK G YIFGNA  L   + LW +V 
Sbjct: 838 EENEVVILSLVRSNEAD-NIGFLANENRVCVALSRAKRGFYIFGNAESLAITNGLWWQVS 896

Query: 180 SILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHICQ 233
            I+ K+ K+   F+ L C+KH  K     T    P E     GGCS+ C E++ CGH C 
Sbjct: 897 QIMRKTPKRLGYFLPLMCKKHGTK-----TLISNPDEWSKNDGGCSQRCGEELKCGHTCP 951

Query: 234 SICHLSSHDKIFCPENCIRTLPCGH 258
            +CH   H K+ C  NC R LPCGH
Sbjct: 952 LLCHAIPHSKLQCQVNCDRMLPCGH 976



>gi|512850381|ref|XP_002938366.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Xenopus
            (Silurana) tropicalis]
          Length = 2035

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 190/372 (51%), Gaps = 40/372 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +D L +HE V H+ ++ G+  +LFF DH   E   ++  S  N+ EA 
Sbjct: 1246 RPEIATLLTPNIYDKLENHESVKHFENIKGVGSSLFFIDHNHQEDHIKEGKSYQNSHEAV 1305

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L +YL+  G   S+ITIL+ YSGQ   + K + +        + +RV  VD +QGE
Sbjct: 1306 FVKCLCSYLLNQGYNPSQITILTTYSGQLHCLQKLMPKSK-----FQGVRVCVVDKYQGE 1360

Query: 121  ENDIIILSLVRSDESNRG-IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            ENDIIILSLVRS+E  RG +GFL I NR+CVALSRAK GL+  GN  QL     LW ++ 
Sbjct: 1361 ENDIIILSLVRSNE--RGNVGFLKIPNRICVALSRAKKGLFCVGNM-QLLSSVPLWNKIN 1417

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICH 237
             +L+ +++    + LYCQ HPEK T V    DF    EGGC   C+ ++ CGH+C   CH
Sbjct: 1418 DVLKANRQLGSQLPLYCQNHPEKVTYVSKAEDFTAVPEGGCMYPCDFRLPCGHVCTLNCH 1477

Query: 238  L--SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCG 282
               S H    C + C + +             PCG              +E       CG
Sbjct: 1478 PYDSEHKDYVCNKPCHKVICENGHTCKNKCSEPCG-----KCKQPVPKQIEK------CG 1526

Query: 283  HSEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLC 341
            H + + C    D F CK  C++ L+CGH+C   C    CT  C  +  V    CGH    
Sbjct: 1527 HIQDIPCSQSADTFVCKVHCAQFLQCGHKCVRWCGQT-CTINCPEKVIVTLE-CGHTMKT 1584

Query: 342  LCHDIRNKLQDG 353
            LCH      +DG
Sbjct: 1585 LCHLKSKAEKDG 1596



>gi|260797861|ref|XP_002593919.1| hypothetical protein BRAFLDRAFT_154067 [Branchiostoma floridae]
 gi|229279151|gb|EEN49930.1| hypothetical protein BRAFLDRAFT_154067 [Branchiostoma floridae]
          Length = 1592

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 194/363 (53%), Gaps = 28/363 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  +LLTP  +++L + E V +Y  + G++ NLFF +H   E  + +  S +N  EA+
Sbjct: 790  RPEFARLLTPHIYESLDNDESVLNYEHIKGVSSNLFFVEHSHLEVQDNEMRSHSNMHEAQ 849

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A    YL+  G   S+ITIL+ YSGQ   I K ++  +      + +RV +VD FQGE
Sbjct: 850  FLASFCRYLLQQGYSPSQITILTTYSGQHFNIEKVMKSNN-----CEGVRVCTVDNFQGE 904

Query: 121  ENDIIILSLVRS-DESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            ENDII+LSLVRS DE N  +GFL + NRVCVALSRAK G Y  GN + L   STLW +++
Sbjct: 905  ENDIILLSLVRSNDEGN--VGFLKVENRVCVALSRAKKGFYAIGNLTMLAKTSTLWTKII 962

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICH 237
              L +       + L CQ HP+ E    T  DF    EGGC R C  ++ CGH+C+  CH
Sbjct: 963  QELREQGSVGTNLKLSCQNHPDSEILATTDDDFKKAPEGGCMRPCGIRLQCGHVCERRCH 1022

Query: 238  LSS--HDKIFCPENCIRTL-PCGHPXXXXXXX---XXXXXVETIIMCPPCGHSEVVLC-- 289
             +   H++  C + C++ L   GH                VE  I  P C H +++ C  
Sbjct: 1023 PTDPEHEEYKCQKPCVKVLCDLGHKCPKLCYEYCGNCEVLVEKTI--PRCQHKQMIPCFV 1080

Query: 290  -PDVDNFRCKERCSK-KLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIR 347
             P +  F+C+E C K KL CGH C+++C     T  C T+    +  CGH    +C    
Sbjct: 1081 QPSL--FQCEEPCVKRKLSCGHICKKKCGQ---TCTC-TEILTYHLSCGHAVQVVCRATD 1134

Query: 348  NKL 350
            + L
Sbjct: 1135 DNL 1137



>gi|345492871|ref|XP_003426945.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform 2
            [Nasonia vitripennis]
          Length = 2132

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 180/350 (51%), Gaps = 11/350 (3%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  KL+TP  +D L +HE V +  ++ G+  NLFF  H+  E    +  S  N  E  
Sbjct: 1130 RPEFAKLITPSIYDTLYNHESVFNRDNIKGVVKNLFFLHHENHESSHNNEESYANQHECV 1189

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A YL+  G   S ITIL  Y+GQ   ++  ++E  R T +LKQ+RV++VD +QGE
Sbjct: 1190 FLVAFATYLIKQGYNPSEITILCTYTGQ---LFALMKETGRYT-ILKQMRVTTVDNYQGE 1245

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            EN II+LSLVR++      GFL   NRVCVALSRA+ G+YI GN + L  ++T+W ++  
Sbjct: 1246 ENKIILLSLVRNNGEG-NTGFLKEENRVCVALSRARDGMYIMGNMNDLVVKNTIWPKIKK 1304

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            +LE+       + L CQ HP++ TQ+    DF    EGGCS+ C+  + CGHIC S+CH+
Sbjct: 1305 VLEEENAIGNALELRCQIHPQQITQIKDLQDFQKCPEGGCSKKCDLPLSCGHICTSVCHI 1364

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDNF 295
                H +  C + C    P  H                +     CGH+  +LC  D + F
Sbjct: 1365 LDREHKEYSCKQPCTIKCPNNHLCPLRCYQGCKPCKVKVRRKLRCGHTMEMLCSTDPETF 1424

Query: 296  RCKERCSKKL-KCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
             C       L  C H  ++ C  P   A+C    E     CGH+    CH
Sbjct: 1425 ACTFVIDAILPDCNHAIKKPCYLPIKDAVCTHPCEENRLPCGHVCELKCH 1474



>gi|156554246|ref|XP_001601379.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform 1
            [Nasonia vitripennis]
          Length = 2077

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 180/350 (51%), Gaps = 11/350 (3%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  KL+TP  +D L +HE V +  ++ G+  NLFF  H+  E    +  S  N  E  
Sbjct: 1075 RPEFAKLITPSIYDTLYNHESVFNRDNIKGVVKNLFFLHHENHESSHNNEESYANQHECV 1134

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A YL+  G   S ITIL  Y+GQ   ++  ++E  R T +LKQ+RV++VD +QGE
Sbjct: 1135 FLVAFATYLIKQGYNPSEITILCTYTGQ---LFALMKETGRYT-ILKQMRVTTVDNYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            EN II+LSLVR++      GFL   NRVCVALSRA+ G+YI GN + L  ++T+W ++  
Sbjct: 1191 ENKIILLSLVRNNGEG-NTGFLKEENRVCVALSRARDGMYIMGNMNDLVVKNTIWPKIKK 1249

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            +LE+       + L CQ HP++ TQ+    DF    EGGCS+ C+  + CGHIC S+CH+
Sbjct: 1250 VLEEENAIGNALELRCQIHPQQITQIKDLQDFQKCPEGGCSKKCDLPLSCGHICTSVCHI 1309

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVDNF 295
                H +  C + C    P  H                +     CGH+  +LC  D + F
Sbjct: 1310 LDREHKEYSCKQPCTIKCPNNHLCPLRCYQGCKPCKVKVRRKLRCGHTMEMLCSTDPETF 1369

Query: 296  RCKERCSKKL-KCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
             C       L  C H  ++ C  P   A+C    E     CGH+    CH
Sbjct: 1370 ACTFVIDAILPDCNHAIKKPCYLPIKDAVCTHPCEENRLPCGHVCELKCH 1419



>gi|443733613|gb|ELU17905.1| hypothetical protein CAPTEDRAFT_193995 [Capitella teleta]
          Length = 959

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 185/351 (52%), Gaps = 21/351 (5%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI  L+TP  +  L +H  V    ++ G++ N+ F DHQE E    DTMS++N  EA 
Sbjct: 82  RPEIAHLITPHIYKKLYNHPSVFGRDNILGMSGNVLFIDHQEMESTVEDTMSKSNEHEAL 141

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  Y +  G + S+IT+L+MY GQ   I   + + ++       +RV+ VD FQGE
Sbjct: 142 FIIRLIRYFLCQGYKASQITVLTMYVGQMFLIQNKMADFAKD----DMVRVTPVDNFQGE 197

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDIIILS VRS+  ++ IGFL++SNRVCVALSRA+ G Y  GN + LR  S LW ++  
Sbjct: 198 ENDIIILSCVRSNADDK-IGFLNVSNRVCVALSRARKGFYCIGNITLLRKVSPLWEKICC 256

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
            L+K       I   CQ HP+ +    +  DF   PL GGC+  C  ++ CGH CQ  CH
Sbjct: 257 ELDKDGNVVDGIPCICQYHPDTKFVARSSIDFDKAPL-GGCTLPCSFRLKCGHTCQLKCH 315

Query: 238 L--SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII-MCPPCGHSEVV-LCPDVD 293
                H +  C + C ++ P GH              + +    P CGH ++V  C D  
Sbjct: 316 PYDKEHIEYECIKPCTKSCPSGHACASLCYIKCPPCKKLVAKTIPDCGHEQMVSCCLDPG 375

Query: 294 NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEV---KYPGCGHIDLC 341
           NF C+  C ++  CGH C + C        CL  T++     P CGH+  C
Sbjct: 376 NFTCQVICKREKPCGHICTKACGE-----KCLPCTQLVKKTLPDCGHMVPC 421



>gi|351703079|gb|EHB05998.1| NFX1-type zinc finger-containing protein 1 [Heterocephalus glaber]
          Length = 1917

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 191/354 (53%), Gaps = 18/354 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIAHLLTPHIYQDLENHPSVLKYENIKGVSSNLFFIEHNFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L NY +      S+ITIL+ Y+GQ   + K +  ++        I+V  VD +QGE
Sbjct: 1136 FVVELCNYFLNQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGIKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGQMLQLCCQNHPDTYTLVSKASDFQKVPEGGCSLPCEFRLACGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + + P GH              V+     P CGH ++V C  P+ 
Sbjct: 1309 YDSSHKEFQCMKPCQKVICPDGHRCPLVCFEECKPCQVKVPKTIPQCGHKQMVPCSMPES 1368

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
            D F C+E C K L+CGH+C   C    C  +C     VK   CGH     C ++
Sbjct: 1369 D-FCCQEPCPKVLRCGHRCSHACGE-GCVQLCPEMVTVKL-KCGHNQQVKCGNV 1419



>gi|512859564|ref|XP_004889398.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X1
            [Heterocephalus glaber]
 gi|512992987|ref|XP_004858132.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X1
            [Heterocephalus glaber]
 gi|512992989|ref|XP_004858133.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X2
            [Heterocephalus glaber]
          Length = 1925

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 191/354 (53%), Gaps = 18/354 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1084 RPEIAHLLTPHIYQDLENHPSVLKYENIKGVSSNLFFIEHNFPEQEIQEGKSHQNQHEAH 1143

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L NY +      S+ITIL+ Y+GQ   + K +  ++        I+V  VD +QGE
Sbjct: 1144 FVVELCNYFLNQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGIKVHVVDKYQGE 1198

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1199 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1256

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1257 TLRENNQIGQMLQLCCQNHPDTYTLVSKASDFQKVPEGGCSLPCEFRLACGHVCTRACHP 1316

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + + P GH              V+     P CGH ++V C  P+ 
Sbjct: 1317 YDSSHKEFQCMKPCQKVICPDGHRCPLVCFEECKPCQVKVPKTIPQCGHKQMVPCSMPES 1376

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
            D F C+E C K L+CGH+C   C    C  +C     VK   CGH     C ++
Sbjct: 1377 D-FCCQEPCPKVLRCGHRCSHACGE-GCVQLCPEMVTVKL-KCGHNQQVKCGNV 1427



>gi|512859568|ref|XP_004889399.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X2
            [Heterocephalus glaber]
          Length = 1927

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 191/354 (53%), Gaps = 18/354 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1086 RPEIAHLLTPHIYQDLENHPSVLKYENIKGVSSNLFFIEHNFPEQEIQEGKSHQNQHEAH 1145

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L NY +      S+ITIL+ Y+GQ   + K +  ++        I+V  VD +QGE
Sbjct: 1146 FVVELCNYFLNQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGIKVHVVDKYQGE 1200

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1201 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1258

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1259 TLRENNQIGQMLQLCCQNHPDTYTLVSKASDFQKVPEGGCSLPCEFRLACGHVCTRACHP 1318

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + + P GH              V+     P CGH ++V C  P+ 
Sbjct: 1319 YDSSHKEFQCMKPCQKVICPDGHRCPLVCFEECKPCQVKVPKTIPQCGHKQMVPCSMPES 1378

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
            D F C+E C K L+CGH+C   C    C  +C     VK   CGH     C ++
Sbjct: 1379 D-FCCQEPCPKVLRCGHRCSHACGE-GCVQLCPEMVTVKL-KCGHNQQVKCGNV 1429



>gi|119183534|ref|XP_001242798.1| hypothetical protein CIMG_06694 [Coccidioides immitis RS]
          Length = 1106

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 159/261 (60%), Gaps = 14/261 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++LTPIY D L DHE+V + P VPG+ + + +FF H   E  +   +S+ N  EA+
Sbjct: 714 PEIRRILTPIY-DNLEDHEDVLNRPGVPGMGNVSSYFFCHSWPESSD-SLLSKYNESEAK 771

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQ 118
           M      YL M G+    IT+L+ Y+GQRK+I K L+E     P+L+    +V++VD +Q
Sbjct: 772 MVVGFYLYLYMNGIPAEDITVLTFYNGQRKKILKALKE----VPLLQGQYSKVATVDSYQ 827

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS    R IGFLSI NRVCVALSRAK G YIFGNA  L   + LW E+
Sbjct: 828 GEENEIVLLSLVRS--GGRNIGFLSIENRVCVALSRAKRGFYIFGNAEALSIHNGLWWEI 885

Query: 179 LSILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICH 237
           + I+ K  K+   +I + C  H +K     T+    L+GGC   C   +DCGH C   CH
Sbjct: 886 VQIMRKEPKRLGYYIPVTCAGHDKKTLVRETWKK--LDGGCLSPCGASLDCGHKCPLRCH 943

Query: 238 LSSHDKIFCPENCIRTLPCGH 258
              H  + C   C++ LPCGH
Sbjct: 944 AFPHKAVKCERPCLKLLPCGH 964



>gi|326931889|ref|XP_003212056.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Meleagris
            gallopavo]
          Length = 2025

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 139/362 (38%), Positives = 187/362 (51%), Gaps = 40/362 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y ++ G+  NLFF +H   E++ ++  S  N  EA+
Sbjct: 1188 RPEIAQLLSPHIYQNLENHPSVLKYENIKGVLSNLFFVEHDFPEQVIQEGRSHQNIHEAQ 1247

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +            ++V  VD +QGE
Sbjct: 1248 FVVELCKYFLHQDYQPSQITILTTYTGQLFCLRKLM-----PAKTFAGVKVYVVDKYQGE 1302

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFL ISNR+CVALSRAK GLY  GN S +  +  LW +++ 
Sbjct: 1303 ENDIILLSLVRSNKEER-IGFLQISNRICVALSRAKKGLYCIGNMSMMG-KVPLWSKIIH 1360

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HP+  T V T ADF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1361 TLREKGNIGRSLTLCCQNHPQTMTLVSTAADFSKVPEGGCSHPCEFRLDCGHVCTRACHP 1420

Query: 239  --SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE I+    CGH
Sbjct: 1421 YDVQHKKYQCLKPCQKVLCTEGHRCQQLCYEPCG---------PCMVIVEKIV--SKCGH 1469

Query: 284  SEVV--LCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLC 341
             +++   CPD   F C+E C KKL CGH C + C    CT  C     V  P CGH    
Sbjct: 1470 LQMMPCSCPD-SKFICQEPCHKKLNCGHTCNKYCGQE-CTTRCPELVTVFLP-CGHSQKV 1526

Query: 342  LC 343
             C
Sbjct: 1527 QC 1528



>gi|201067012|gb|ACH92693.1| RNA helicase [Mucor circinelloides]
          Length = 1231

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 162/263 (61%), Gaps = 10/263 (3%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR L+ PIY D  L DH +V  YP + G+  +LFF  H E E    ++ S+ N  EA
Sbjct: 945  RPEIRSLINPIYKDPPLMDHPDVASYPPILGMDQSLFFLAHNEDETNMSESASKVNEHEA 1004

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +M AKLA YL++ G +   ITI++MYSGQ+  I + LREE R     + I+VSSVDG+QG
Sbjct: 1005 KMAAKLAVYLLLQGYQPEEITIITMYSGQKTMIKRALREERRPDIDPEPIQVSSVDGYQG 1064

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN IIILSLVRS+ + + IGFL + NRVCV+LSRAKHG YI GNA  L  +S LW E++
Sbjct: 1065 EENKIIILSLVRSNAAGQ-IGFLKVVNRVCVSLSRAKHGFYILGNARLLCEKSDLWNEIV 1123

Query: 180  SILEK--SKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
              LE+         + L CQ+H ++ T+V    DF    EGGC + C+ ++ CGH C   
Sbjct: 1124 GNLEEQNGNMIGTKLVLKCQRH-KQLTEVQWPVDFTTVEEGGCQQACDAQLPCGHKCMRR 1182

Query: 236  CHLSSHDKIFCPENCIRTLPCGH 258
            C   +      P +C   LPCGH
Sbjct: 1183 C-CEACGPCIKPLSC--KLPCGH 1202



>gi|295666622|ref|XP_002793861.1| helicase required for RNAi-mediated heterochromatin assembly 1
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226277514|gb|EEH33080.1| helicase required for RNAi-mediated heterochromatin assembly 1
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 1081

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 161/266 (60%), Gaps = 20/266 (7%)

Query: 3   EIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEARM 61
           EIR++L PIY D L DH  VN  P+VPG+   N FF+ H   E  +   +S+ N  EA+M
Sbjct: 688 EIRRVLAPIY-DNLDDHPSVNDKPEVPGMGGINSFFYCHGWPESSD-SLLSKYNYNEAQM 745

Query: 62  CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQG 119
                 YL +  +    ITIL+ Y+GQRK+I K LR+     P+L+   ++VS+VD +QG
Sbjct: 746 IVGFFLYLHLNKVPVEDITILTFYNGQRKKILKGLRD----NPLLQGQYLKVSTVDSYQG 801

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+I+ILSLVRS+E+   +GFLSI NRVCVALSRAK G YIFGNA  L   S LW EV+
Sbjct: 802 EENEIVILSLVRSNENTGNVGFLSIENRVCVALSRAKRGFYIFGNAEFLALASPLWWEVV 861

Query: 180 SILE-KSKKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHICQ 233
            I+    K+    + L C  H     Q  T+   P E     GGCS  C +K+ CGH C 
Sbjct: 862 QIVSCGPKRIGYHVPLTCDNH-----QTRTYLKEPGEWSSTDGGCSLKCGQKLTCGHNCP 916

Query: 234 SICHLSSHDKIFCPENCIRTLPCGHP 259
             CH+  H ++ C ++C++ LPCGHP
Sbjct: 917 LFCHVIPHSQVKCLQSCLQHLPCGHP 942



>gi|327301147|ref|XP_003235266.1| DEAD box helicase [Trichophyton rubrum CBS 118892]
 gi|326462618|gb|EGD88071.1| DEAD box helicase [Trichophyton rubrum CBS 118892]
          Length = 1125

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 161/264 (60%), Gaps = 17/264 (6%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L+PIY+D L+DH  V    DVPG+   N +FF H+ +E  +    SR N  EA+
Sbjct: 723 PEIRRILSPIYND-LNDHPSVLDRQDVPGMGGINSYFFTHEWTESPD-SLSSRYNQKEAK 780

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL M G+    ITIL+ Y+GQRK I + L+E   K    +  +V +VD +QGE
Sbjct: 781 MIVGFYVYLHMNGVPLEDITILTFYNGQRKLILRALKEN--KLFQGQYTKVVTVDSYQGE 838

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+++ILSLVRS+E++  IGFL+  NRVCVALSRAK G YIFGNA  L   + LW EV  
Sbjct: 839 ENEVVILSLVRSNEAD-NIGFLANENRVCVALSRAKRGFYIFGNAESLAITNGLWWEVSR 897

Query: 181 ILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHICQS 234
           I+ K+ K+   F+ L C+KH  K     T    P +     GGCS+ C E++ CGH C  
Sbjct: 898 IMRKTPKRLGYFLPLMCKKHGTK-----TLISNPDQWSNNDGGCSQRCGEELQCGHTCPL 952

Query: 235 ICHLSSHDKIFCPENCIRTLPCGH 258
           +CH   H K+ C  NC R LPCGH
Sbjct: 953 LCHAIHHSKLQCQVNCDRMLPCGH 976



>gi|225683441|gb|EEH21725.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 1063

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 160/267 (59%), Gaps = 20/267 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PE+R++L PIY D L DH  VN  P+VPG+   N FFF H   E  +   +S+ N  EA+
Sbjct: 679 PEVRRVLAPIY-DNLDDHPSVNDKPEVPGMDGINSFFFCHGWPESSD-SLLSKYNYTEAQ 736

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQ 118
           M      YL +  +    ITIL+ Y+GQRK+I K LR+     P+L+   ++VS+VD +Q
Sbjct: 737 MIVGFFLYLHLNKVPVEDITILTFYNGQRKKILKGLRD----IPLLQGQYLKVSTVDSYQ 792

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I+ILSLVRS+E+   +GFLSI NRVCVALSRAK G YI GNA  L   S LW EV
Sbjct: 793 GEENEIVILSLVRSNENIGNVGFLSIENRVCVALSRAKRGFYILGNAEFLALASPLWWEV 852

Query: 179 LSILE-KSKKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHIC 232
           + I+    K+    + L C  H     Q  T+   P E     GGCS  C +K+ CGH C
Sbjct: 853 VQIVSCGPKRIGYHVPLACDNH-----QTRTYLAEPGEWSSTDGGCSLKCGQKLTCGHNC 907

Query: 233 QSICHLSSHDKIFCPENCIRTLPCGHP 259
              CH+  H ++ C ++C+  LPCGHP
Sbjct: 908 PLFCHVMPHSQVKCLQSCLEHLPCGHP 934



>gi|321460871|gb|EFX71909.1| hypothetical protein DAPPUDRAFT_227744 [Daphnia pulex]
          Length = 2342

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 181/353 (51%), Gaps = 19/353 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E+ +L+ P  +  L +H  V  +P VPG+  ++FF  H   EK   D  S  N  E  
Sbjct: 1039 RAEVARLIVPAVYAQLENHSSVYDHPHVPGMLHDVFFHHHTHPEK--EDGSSFYNLHEVG 1096

Query: 61   MCAKLANYLVMGG-MEESRITILSMYSGQRKEIYKYLREESRKT---PVLKQIRVSSVDG 116
            M   LA YLV    +   RITIL+ Y+ Q  ++      ESRK      L  +R++ VD 
Sbjct: 1097 MALNLARYLVRDQQVSPHRITILATYTAQLHQLL-----ESRKQLKCTELTHVRMTVVDN 1151

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            FQGEEND+IILSLVR+++ N  +GFL I NRVCVALSRA++GLYI GN   L   S LW 
Sbjct: 1152 FQGEENDVIILSLVRNNKRN-SVGFLRIDNRVCVALSRARNGLYILGNIRMLSTASPLWA 1210

Query: 177  EVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSIC 236
             +  +L ++ +  + I L C +H +   +V    DFP++  C   C   + CGH+C+ +C
Sbjct: 1211 HMEKVLTENGEIGEGIPLQCDRHHQTVHKVMGPEDFPVDHFCRELCGADLPCGHVCKLVC 1270

Query: 237  HLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXV--ETI-IMCPPCGHSEVVLCPDVD 293
            H        C E  I+ L CGH             V  E + +M  PC H   ++C  + 
Sbjct: 1271 HKDGPHTRSCLEKVIKVLNCGHNHFMSCSTSVYEAVCNELVPVMKKPCMHQYEIICSQLQ 1330

Query: 294  NFR---CKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
             F    C    SKKL CGH  R  CS+P  +A+C   TE K   C HI    C
Sbjct: 1331 TFAKTPCPVLVSKKLTCGHLQRIPCSAPPDSALCKALTEYKL-ACSHIATIPC 1382



>gi|348563937|ref|XP_003467763.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Cavia
            porcellus]
          Length = 1917

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 191/356 (53%), Gaps = 18/356 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y +V G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYENVKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGQTLQLCCQNHPETYTLVSKASDFQRVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + + P GH              V+     P CGH ++V C  P+ 
Sbjct: 1309 YDSSHIEFQCMKPCQKVICPDGHRCPLVCFQECEPCQVKVPKTIPQCGHKQMVPCSMPES 1368

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
            D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++ +
Sbjct: 1369 D-FCCQEPCPKVLKCGHRCSHPCGE-GCVQLCPEMVSVKL-KCGHNQQVKCGNVED 1421



>gi|513218036|ref|XP_417395.4| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X4
            [Gallus gallus]
          Length = 1798

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 185/355 (52%), Gaps = 38/355 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y +V G+  NLFF +H   E++ ++  S  N  EA+
Sbjct: 960  RPEIAQLLSPHIYQDLENHPSVLKYENVKGVLSNLFFVEHDFPEQVIQEGRSHQNIHEAQ 1019

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1020 FVVELCKYFLCQDYQPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVYVVDKYQGE 1074

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1075 ENDIILLSLVRSNKEER-IGFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWSKIIH 1132

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HPE  T V T ADF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1133 TLREKGNIGRSLTLCCQNHPETITSVSTAADFSKVPEGGCSHPCEFRLDCGHVCTRACHP 1192

Query: 239  S--SHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE I+  P CGH
Sbjct: 1193 YDLQHKKYQCLKPCQKVLCTEGHRCPLLCYEPCG---------PCMVIVEKIV--PKCGH 1241

Query: 284  SEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             +++ C      F C+E C KKL CGH C  +C    CT  C     V +  CGH
Sbjct: 1242 LQMIPCSCPGSKFICQEPCKKKLNCGHTCN-KCCGQECTTRCPELVTV-FLQCGH 1294



>gi|478512167|ref|XP_004430346.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Ceratotherium
            simum simum]
          Length = 1916

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 194/361 (53%), Gaps = 20/361 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1076 RPEIARLLTPNIYQHLENHPSVLEYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN   L  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNTRML-AKVPLWSKIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGQTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCESRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C  +
Sbjct: 1309 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKIIL--RCGHKQMVPCSML 1366

Query: 293  D-NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
            + +F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++ + + 
Sbjct: 1367 ESDFCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHSQQVKCGNVEDVMY 1424

Query: 352  D 352
            D
Sbjct: 1425 D 1425



>gi|201067016|gb|ACH92696.1| RNA helicase [Mucor circinelloides]
          Length = 1231

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 161/263 (61%), Gaps = 10/263 (3%)

Query: 1    RPEIRKLLTPIYHDA-LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR L+ PIY D  L DH +V  YP + G+  +LFF  H E E    ++ S  N  EA
Sbjct: 945  RPEIRSLINPIYKDPPLMDHPDVASYPPILGMDQSLFFLAHNEDETNMSESASTVNEHEA 1004

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +M AKLA YL++ G +   ITI++MYSGQ+  I + LREE R     + I+VSSVDG+QG
Sbjct: 1005 KMAAKLAVYLLLQGYQPEEITIITMYSGQKTMIKRALREERRPDIDPEPIQVSSVDGYQG 1064

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN IIILSLVRS+ + + IGFL + NRVCV+LSRAKHG YI GNA  L  +S LW E++
Sbjct: 1065 EENKIIILSLVRSNAAGQ-IGFLKVVNRVCVSLSRAKHGFYILGNARLLCEKSDLWNEIV 1123

Query: 180  SILEK--SKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSI 235
              LE+         + L CQ+H ++ T+V    DF    EGGC + C+ ++ CGH C   
Sbjct: 1124 GNLEEQNGNMIGTKLVLKCQRH-KQLTEVQWPVDFTTVEEGGCQQACDAQLPCGHKCMRR 1182

Query: 236  CHLSSHDKIFCPENCIRTLPCGH 258
            C   +      P +C   LPCGH
Sbjct: 1183 C-CEACGPCIKPLSC--KLPCGH 1202



>gi|432858177|ref|XP_004068830.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Oryzias
            latipes]
          Length = 1906

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 187/364 (51%), Gaps = 21/364 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ GL  NLFF +H   E+  +D  S  N  EA+
Sbjct: 1063 RPEIACLLTPHIYSELENHPSVLEYENIKGLNTNLFFVEHSYPEEQIKDGRSHQNIHEAK 1122

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL+    +  +ITIL+ Y+GQ       LR+E   +     ++V  VD +QGE
Sbjct: 1123 FVVALCRYLLFQDYKPEQITILTTYTGQ----LHCLRKEMPASE-FSGVKVHVVDKYQGE 1177

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS+   + +GFLSI NRVCVALSRAK GLY  GN+S L  R  LW  +  
Sbjct: 1178 ENDIVLLSLVRSNLEGK-VGFLSIPNRVCVALSRAKKGLYCIGNSSILS-RVPLWSNIFH 1235

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L    +  + + L CQ H ++  +    ADF    EGGC++ C+ ++DCGH+C  +CH 
Sbjct: 1236 TLRGKDQIGEALTLCCQNHSDRRVKASCAADFKQAPEGGCNQPCQYRLDCGHVCSRVCHP 1295

Query: 239  SS--HDKIFCPENCIRTL-PCGHPXX----XXXXXXXXXXVETIIMCPPCGHSEVVLC-P 290
            S   H K  C + C + L   GH                 VE I+  P C HS+++ C  
Sbjct: 1296 SDLEHKKFKCSKKCEKILCDLGHRCTLVCHQECPKKCPMKVEKIV--PKCQHSQMIPCHQ 1353

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
                F C+E C K L CGH C   C +P CT  C+    +    CGH     C   + + 
Sbjct: 1354 SPQTFECREPCQKLLSCGHPCGSTCGAP-CTTKCMVVVTLALE-CGHSQQGACFYKKERD 1411

Query: 351  QDGC 354
            Q  C
Sbjct: 1412 QLKC 1415



>gi|392865705|gb|EAS31518.2| DEAD box helicase [Coccidioides immitis RS]
          Length = 1108

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 161/262 (61%), Gaps = 14/262 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++LTPIY D L DHE+V + P VPG+ + + +FF H   E  +   +S+ N  EA+
Sbjct: 714 PEIRRILTPIY-DNLEDHEDVLNRPGVPGMGNVSSYFFCHSWPESSD-SLLSKYNESEAK 771

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQ 118
           M      YL M G+    IT+L+ Y+GQRK+I K L+E     P+L+    +V++VD +Q
Sbjct: 772 MVVGFYLYLYMNGIPAEDITVLTFYNGQRKKILKALKE----VPLLQGQYSKVATVDSYQ 827

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS    R IGFLSI NRVCVALSRAK G YIFGNA  L   + LW E+
Sbjct: 828 GEENEIVLLSLVRS--GGRNIGFLSIENRVCVALSRAKRGFYIFGNAEALSIHNGLWWEI 885

Query: 179 LSILEKS-KKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQSIC 236
           + I+ K  K+   +I + C  H +K+T V     +  L+GGC   C   +DCGH C   C
Sbjct: 886 VQIMRKEPKRLGYYIPVTCAGH-DKKTLVRDPETWKKLDGGCLSPCGASLDCGHKCPLRC 944

Query: 237 HLSSHDKIFCPENCIRTLPCGH 258
           H   H  + C   C++ LPCGH
Sbjct: 945 HAFPHKAVKCERPCLKLLPCGH 966



>gi|109091643|ref|XP_001098884.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform 1
            [Macaca mulatta]
          Length = 1918

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 193/362 (53%), Gaps = 18/362 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V +Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLNYEKIKGVSSNLFFVEHSFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+   + P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKIIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  + + +  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGHVEDLMYGG 1426

Query: 354  CP 355
             P
Sbjct: 1427 LP 1428



>gi|47222854|emb|CAF96521.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1452

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 189/366 (51%), Gaps = 20/366 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP+I  LLTP  +  L +H  V  Y ++ GL+ N+FF +H   E+  +D  S  N  EA+
Sbjct: 746  RPDIASLLTPHIYSELENHPSVFEYDNIKGLSTNVFFVEHDHREEDIKDGKSHQNKHEAK 805

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL++   +  +ITIL+ Y+GQ   + K +            ++V  VD +QGE
Sbjct: 806  FVVALCRYLLLQDYQPHQITILTTYTGQLHCLRKLMPASQ-----FTGVKVHVVDKYQGE 860

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+   + +GFL+I NRVCVALSRAK GL+  G+++ L+ +  LW  +  
Sbjct: 861  ENDIILLSLVRSNLQGK-VGFLNIPNRVCVALSRAKKGLFCIGDSAMLQ-QVKLWSNIFH 918

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +  +  + + L C  HP ++       DF    EGGC++ CE ++DCGH C S+CH 
Sbjct: 919  TLREKNQIGKALTLCCYNHPNRQVAASCSEDFDQAPEGGCTQPCEFRLDCGHACASVCHP 978

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVD 293
                H K  C + C + L   GH  P            V+   + P C H ++V C    
Sbjct: 979  YDPEHKKYKCLKKCQKILCDLGHKCPLVCHRPCPEKCQVKVEKIIPQCKHKQLVPCHQEP 1038

Query: 294  N-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQD 352
            N F C+E C K L CGH C   C    CT+MC     +K  GCGH     C     + ++
Sbjct: 1039 NEFICQEPCQKLLVCGHPCDSLCGKD-CTSMCKVTISLKL-GCGHTQSAACF---YRTEE 1093

Query: 353  GCPFCR 358
              P CR
Sbjct: 1094 EAPVCR 1099



>gi|513218033|ref|XP_004947131.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X7
            [Gallus gallus]
          Length = 2025

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 185/355 (52%), Gaps = 38/355 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y +V G+  NLFF +H   E++ ++  S  N  EA+
Sbjct: 1187 RPEIAQLLSPHIYQDLENHPSVLKYENVKGVLSNLFFVEHDFPEQVIQEGRSHQNIHEAQ 1246

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1247 FVVELCKYFLCQDYQPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVYVVDKYQGE 1301

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1302 ENDIILLSLVRSNKEER-IGFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWSKIIH 1359

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HPE  T V T ADF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1360 TLREKGNIGRSLTLCCQNHPETITSVSTAADFSKVPEGGCSHPCEFRLDCGHVCTRACHP 1419

Query: 239  S--SHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE I+  P CGH
Sbjct: 1420 YDLQHKKYQCLKPCQKVLCTEGHRCPLLCYEPCG---------PCMVIVEKIV--PKCGH 1468

Query: 284  SEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             +++ C      F C+E C KKL CGH C  +C    CT  C     V +  CGH
Sbjct: 1469 LQMIPCSCPGSKFICQEPCKKKLNCGHTC-NKCCGQECTTRCPELVTV-FLQCGH 1521



>gi|507663766|ref|XP_004636105.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Octodon degus]
          Length = 1917

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/356 (37%), Positives = 189/356 (53%), Gaps = 18/356 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYENIKGVSSNLFFIEHNFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN   L  +  LW  ++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNMHML-AKVPLWSRIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGQTLQLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + + P GH              V+     P CGH ++V C  P+ 
Sbjct: 1309 YDSSHKQFQCMKPCQKVICPDGHRCPLICYQECEPCQVKVPKTIPQCGHKQLVPCSMPES 1368

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
            D F C+E C K L CGH+C   C    C  +C     VK   CGH     C ++ +
Sbjct: 1369 D-FCCQEPCPKVLSCGHRCSHPCGE-GCVQLCPEMVTVKL-KCGHNQQVKCGNVED 1421



>gi|513218030|ref|XP_004947130.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X6
            [Gallus gallus]
          Length = 2106

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 185/355 (52%), Gaps = 38/355 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y +V G+  NLFF +H   E++ ++  S  N  EA+
Sbjct: 1268 RPEIAQLLSPHIYQDLENHPSVLKYENVKGVLSNLFFVEHDFPEQVIQEGRSHQNIHEAQ 1327

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1328 FVVELCKYFLCQDYQPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVYVVDKYQGE 1382

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1383 ENDIILLSLVRSNKEER-IGFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWSKIIH 1440

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HPE  T V T ADF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1441 TLREKGNIGRSLTLCCQNHPETITSVSTAADFSKVPEGGCSHPCEFRLDCGHVCTRACHP 1500

Query: 239  S--SHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE I+  P CGH
Sbjct: 1501 YDLQHKKYQCLKPCQKVLCTEGHRCPLLCYEPCG---------PCMVIVEKIV--PKCGH 1549

Query: 284  SEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             +++ C      F C+E C KKL CGH C  +C    CT  C     V +  CGH
Sbjct: 1550 LQMIPCSCPGSKFICQEPCKKKLNCGHTC-NKCCGQECTTRCPELVTV-FLQCGH 1602



>gi|511843684|ref|XP_004746280.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Mustela
            putorius furo]
 gi|511933534|ref|XP_004785744.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Mustela
            putorius furo]
          Length = 1921

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 196/362 (54%), Gaps = 22/362 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1080 RPEIARLLTPYIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1139

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1140 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1194

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1195 ENDIILLSLVRSNEEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1252

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  + + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1253 TLRENNQIGRTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1312

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C  P
Sbjct: 1313 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKIIL--RCGHEQMVPCSMP 1370

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++++ +
Sbjct: 1371 ESD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHSQQVKCGNVQDLM 1427

Query: 351  QD 352
             D
Sbjct: 1428 YD 1429



>gi|291222943|ref|XP_002731474.1| PREDICTED: Upf1-like [Saccoglossus kowalevskii]
          Length = 2873

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 194/366 (53%), Gaps = 23/366 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+  IY   L DHE V  Y +V G+  N+FF +H+  E    + +S  N  EA 
Sbjct: 2009 RPEISVLMDHIYV-GLKDHESVFEYENVKGVGSNVFFINHKYPEIENEELLSHANEHEAM 2067

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A L  Y+++ G + SR+T+L+ Y GQ   ++K L+   +K  +   + V++VD FQGE
Sbjct: 2068 YVAALCRYILLQGYDPSRVTVLTTYKGQ---LFK-LKGIMKKMSIFGGVHVTAVDNFQGE 2123

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS+   + IGFL++ NRVCVALSRAK G Y  GN S L   S LW+++ +
Sbjct: 2124 ENDIIILSLVRSNSQGK-IGFLAVENRVCVALSRAKIGFYCVGNISFLADHSELWKKIQA 2182

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             +E+       + L CQ HP    +  T  DF    EGGC + CE ++ CGH+C   CH 
Sbjct: 2183 DMERRDCIGTSLLLRCQNHPGTTIEAKTEKDFHSAPEGGCMKPCEARLKCGHVCVLTCHP 2242

Query: 239  SSHD-KIF-CPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP- 290
            +  + KI+ C + C+R +     PC  P             + I   P C H + V C  
Sbjct: 2243 ADPEHKIYKCRKPCVRKICDQKHPCLKPCFEECGNCMTKIPKII---PRCDHLQDVPCSV 2299

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            D ++F C E+C K L+CGHQC   C           +   +   CGH    +C   RNK 
Sbjct: 2300 DPEDFVCLEKCKKTLECGHQCTNVCGVRCVLPKNCREYISRIWPCGHEVETMC---RNKP 2356

Query: 351  QD-GCP 355
            +D  CP
Sbjct: 2357 EDYPCP 2362



>gi|513218027|ref|XP_004947129.1| PREDICTED: NFX1-type zinc finger-containing protein 1 isoform X5
            [Gallus gallus]
          Length = 2111

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 185/355 (52%), Gaps = 38/355 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y +V G+  NLFF +H   E++ ++  S  N  EA+
Sbjct: 1273 RPEIAQLLSPHIYQDLENHPSVLKYENVKGVLSNLFFVEHDFPEQVIQEGRSHQNIHEAQ 1332

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1333 FVVELCKYFLCQDYQPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVYVVDKYQGE 1387

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R IGFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1388 ENDIILLSLVRSNKEER-IGFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWSKIIH 1445

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HPE  T V T ADF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1446 TLREKGNIGRSLTLCCQNHPETITSVSTAADFSKVPEGGCSHPCEFRLDCGHVCTRACHP 1505

Query: 239  S--SHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE I+  P CGH
Sbjct: 1506 YDLQHKKYQCLKPCQKVLCTEGHRCPLLCYEPCG---------PCMVIVEKIV--PKCGH 1554

Query: 284  SEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             +++ C      F C+E C KKL CGH C  +C    CT  C     V +  CGH
Sbjct: 1555 LQMIPCSCPGSKFICQEPCKKKLNCGHTC-NKCCGQECTTRCPELVTV-FLQCGH 1607



>gi|320034265|gb|EFW16210.1| DEAD box helicase [Coccidioides posadasii str. Silveira]
          Length = 1103

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 117/261 (44%), Positives = 156/261 (59%), Gaps = 12/261 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++LTPIY D L DHE+V + P VPG+ + + +FF H   E  +   +S+ N  EA+
Sbjct: 714 PEIRRILTPIY-DNLEDHEDVLNRPGVPGMGNVSSYFFCHSWPESSD-SLLSKYNESEAK 771

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGFQ 118
           M      YL M G+    IT+L+ Y+GQRK+I K L+E     P+L+    +V +VD +Q
Sbjct: 772 MVVGFYLYLYMNGIPAEDITVLTFYNGQRKKILKALKE----VPLLQGQYSKVVTVDSYQ 827

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS    R IGFLSI NRVCVALSRAK G YIFGNA  L   + LW E+
Sbjct: 828 GEENEIVLLSLVRS--GGRNIGFLSIENRVCVALSRAKRGFYIFGNAEALSIHNGLWWEI 885

Query: 179 LSILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICH 237
           + I+ K  K+   +I + C  H +K           L+GGC   C   +DCGH C   CH
Sbjct: 886 VQIMRKEPKRLGYYIPVTCAGHDKKTLVRDPDTWKKLDGGCLSPCGASLDCGHKCPLRCH 945

Query: 238 LSSHDKIFCPENCIRTLPCGH 258
              H  + C   C++ LPCGH
Sbjct: 946 AFPHKAVKCERPCLKLLPCGH 966



>gi|355784406|gb|EHH65257.1| NFX1-type zinc finger-containing protein 1 [Macaca fascicularis]
          Length = 1918

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 192/362 (53%), Gaps = 18/362 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V +Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLNYEKIKGVSSNLFFVEHSFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  + + +  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGHVEDLMYGG 1426

Query: 354  CP 355
             P
Sbjct: 1427 LP 1428



>gi|426392066|ref|XP_004062381.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Gorilla
           gorilla gorilla]
          Length = 1200

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 135/360 (37%), Positives = 189/360 (52%), Gaps = 18/360 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
           PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 359 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 418

Query: 62  CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
             +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 419 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 473

Query: 122 NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
           NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 474 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 531

Query: 182 LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
           L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 532 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 591

Query: 239 -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
            SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 592 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 651

Query: 294 NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
            F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  +   L  G
Sbjct: 652 -FCCQESCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKLK-CGHSQPVKCGHVEGLLYGG 708



>gi|355563049|gb|EHH19611.1| NFX1-type zinc finger-containing protein 1 [Macaca mulatta]
          Length = 1918

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 192/362 (53%), Gaps = 18/362 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V +Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLNYEKIKGVSSNLFFVEHSFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  + + +  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGHVEDLMYGG 1426

Query: 354  CP 355
             P
Sbjct: 1427 LP 1428



>gi|402882293|ref|XP_003904682.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Papio anubis]
          Length = 1918

 Score =  204 bits (519), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 192/362 (53%), Gaps = 18/362 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V +Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLNYEKIKGVSSNLFFVEHSFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  + + +  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGHVEDLMYGG 1426

Query: 354  CP 355
             P
Sbjct: 1427 LP 1428



>gi|10435893|dbj|BAB14696.1| unnamed protein product [Homo sapiens]
          Length = 1137

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 190/360 (52%), Gaps = 18/360 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
           PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 369 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 428

Query: 62  CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
             +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 429 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 483

Query: 122 NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
           NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 484 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 541

Query: 182 LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
           L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 542 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 601

Query: 239 -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
            SSH +  C + C + +   GH              V+   + P CGH ++V C  P+ D
Sbjct: 602 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKIIPRCGHEQMVPCSVPESD 661

Query: 294 NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
            F C+E CSK L+CGH+C   C    C  +C     +K   CGH     C  +   L  G
Sbjct: 662 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTIKL-KCGHSQPVKCGHVEGLLYGG 718



>gi|488579792|ref|XP_004475354.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Dasypus
            novemcinctus]
          Length = 1833

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 192/363 (52%), Gaps = 32/363 (8%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 993  RPEIAQLLTPHIYQDLENHPSVLKYENIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1052

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1053 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1107

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1108 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1165

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1166 TLRENNQIGPTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1225

Query: 239  --SSHDKIFCPENCIRT---------LPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVV 287
              SSH +  C + C +          L C  P            V+     P CGH ++V
Sbjct: 1226 YDSSHKEFQCIKPCQKVICEDGHRCPLVCFQP-------CQPCQVKVPKTIPQCGHEQMV 1278

Query: 288  LC--PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHD 345
             C  P+ D F C+E CSK LKCGH+C   C    C  +C     VK   CGH     C +
Sbjct: 1279 PCSMPESD-FCCQEPCSKLLKCGHRCSHLCGED-CVRLCSEMVTVKL-KCGHSQQVKCGN 1335

Query: 346  IRN 348
            + +
Sbjct: 1336 VED 1338



>gi|303319903|ref|XP_003069951.1| hypothetical protein CPC735_031420 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240109637|gb|EER27806.1| hypothetical protein CPC735_031420 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 1108

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 117/261 (44%), Positives = 156/261 (59%), Gaps = 12/261 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++LTPIY D L DHE+V + P VPG+ + + +FF H   E  +   +S+ N  EA+
Sbjct: 714 PEIRRILTPIY-DNLEDHEDVLNRPGVPGMGNVSSYFFCHSWPESSD-SLLSKYNESEAK 771

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGFQ 118
           M      YL M G+    IT+L+ Y+GQRK+I K L+E     P+L+    +V +VD +Q
Sbjct: 772 MVVGFYLYLYMNGIPAEDITVLTFYNGQRKKILKALKE----VPLLQGQYSKVVTVDSYQ 827

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS    R IGFLSI NRVCVALSRAK G YIFGNA  L   + LW E+
Sbjct: 828 GEENEIVLLSLVRS--GGRNIGFLSIENRVCVALSRAKRGFYIFGNAEALSIHNGLWWEI 885

Query: 179 LSILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICH 237
           + I+ K  K+   +I + C  H +K           L+GGC   C   +DCGH C   CH
Sbjct: 886 VQIMRKEPKRLGYYIPVTCAGHDKKTLVRDPDTWKKLDGGCLSPCGASLDCGHKCPLRCH 945

Query: 238 LSSHDKIFCPENCIRTLPCGH 258
              H  + C   C++ LPCGH
Sbjct: 946 AFPHKAVKCERPCLKLLPCGH 966



>gi|465957167|gb|EMP27284.1| NFX1-type zinc finger-containing protein 1 [Chelonia mydas]
          Length = 2002

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 126/365 (34%), Positives = 184/365 (50%), Gaps = 41/365 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL P+++  L DH  V  Y  + G+  ++FF  H  +E    D+ S  N FEA 
Sbjct: 906  RPEISRLLVPLFYKQLKDHNAVAEYEKIKGVESSVFFIQHTAAESHSADSESYRNEFEAS 965

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L+ YL+  G ++S++T+L+ Y GQ  +I   +R        + ++ V +VD FQGE
Sbjct: 966  FLVSLSRYLLDQGYDQSQVTVLTPYHGQVLKIRTLMRCRD-----MGEVAVHAVDDFQGE 1020

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRY--RSTLWREV 178
            ENDII+LSLVRS+   R IGFL   NR+CVALSRA+ G Y  GN + +     S LW+++
Sbjct: 1021 ENDIILLSLVRSNREGR-IGFLQDKNRLCVALSRARKGFYCIGNLAGIAAGSNSKLWKDI 1079

Query: 179  LSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSIC 236
            L +L+++K   + + L CQ HP+ +T V   +DF    +GGC+  C+ +++CGH C   C
Sbjct: 1080 LRLLKRNKLTGEGLTLVCQNHPDTKTVVKESSDFSKIPDGGCTLQCQTRLECGHPCVRRC 1139

Query: 237  HLSSHDKIF----------------CPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPP 280
            H    D                   CP  C    PC               VE   + P 
Sbjct: 1140 HPHDRDHGLYVCQFPCSKLCELNHRCPRKCKE--PC-----------EPCSVEVEKVIPK 1186

Query: 281  CGHSEVVLC-PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHID 339
            CGH + V C    D++ C+E C + L+C H C   C     T  C    +V  P C H+ 
Sbjct: 1187 CGHLQTVPCHMPADHWLCQEPCKQLLECKHPCTRRCGEACSTCRCKEMIDVTLP-CSHVM 1245

Query: 340  LCLCH 344
               C+
Sbjct: 1246 RTECY 1250



>gi|410953572|ref|XP_003983444.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Felis catus]
          Length = 1918

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 192/360 (53%), Gaps = 18/360 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G+  NLFF +H   E+  ++  S  N  EAR
Sbjct: 1077 RPEIARLLTPYIYQDLENHPSVLKYEKIKGVASNLFFVEHNFPEQEIQEGKSHQNQHEAR 1136

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1137 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1191

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1192 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1249

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  + + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1250 TLRENNQIGRTLQLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1309

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + +   GH              V+   + P CGH ++V C  P+ 
Sbjct: 1310 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKIIPRCGHEQMVPCSMPES 1369

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQD 352
            D F C+E C K LKCGH+C   C    C   C     VK   CGH     C ++ + + D
Sbjct: 1370 D-FCCQEPCPKVLKCGHRCSHPCGED-CVRFCSEMVTVKL-KCGHSQQVKCGNVEDLVYD 1426



>gi|327288949|ref|XP_003229187.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Anolis
            carolinensis]
          Length = 1859

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 133/373 (35%), Positives = 192/373 (51%), Gaps = 39/373 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA+
Sbjct: 1039 RPEIARLLTPHIYAELENHPSVLEYESIKGVSSNLFFVEHNVPEQSLQEGKSHQNQHEAQ 1098

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  YL+  G + S+ITIL+ Y+GQ   ++  L  ++      + ++V  VD +QGE
Sbjct: 1099 FLVRLCQYLLCQGYQPSQITILTTYTGQLFCLHNLLPAKT-----FQGVKVHVVDKYQGE 1153

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS+   R +GFL  +NRVCVALSRAK GL+  GN   L  +  LW ++  
Sbjct: 1154 ENDIVLLSLVRSNLEGR-VGFLQAANRVCVALSRAKKGLFCIGNLGMLS-QVPLWSKIAQ 1211

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +  +  + + L CQ HPE  T+V    DF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 1212 TLREKGQVGRAMVLSCQNHPETHTEVAKAEDFASVPEGGCSRPCEARLGCGHVCPLACHP 1271

Query: 239  SS--HDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H +  C + C +T              PCG              V+     P CGH
Sbjct: 1272 YDPLHREFKCMKPCQKTWCTDGHRCPKVCSEPCGE-----------CQVKVPKTLPRCGH 1320

Query: 284  SEVVLCPD-VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
             + V C    + F C+E C +  +CGH+CR  C    C+  C  + ++    CGH     
Sbjct: 1321 LQQVPCATPAEKFCCQEPCPRDPRCGHKCRMTCGQV-CSQRCPEKFQITL-KCGHSQELS 1378

Query: 343  CHDIRNKLQDGCP 355
            C  I  +++DG P
Sbjct: 1379 C-SIAEEVRDGRP 1390



>gi|74178788|dbj|BAE34040.1| unnamed protein product [Mus musculus]
          Length = 1045

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 194/365 (53%), Gaps = 21/365 (5%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 205 RPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 264

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  YL+      S+ITIL+ Y+GQ   + K +            I+V  VD +QGE
Sbjct: 265 FLVELCQYLLCQEYLPSQITILTTYTGQLFCLRKLM-----PVKTFAGIKVHVVDKYQGE 319

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 320 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 377

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 378 TLRENNQIGPSLRLCCQNHPETHTLVSKASDFQKVPEGGCSRPCEFRLACGHVCTRACHP 437

Query: 239 --SSHDKIFCPENCIRTL-PCGH---PXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
             SSH +  C + C + L   GH                V  II+   CGH ++V C   
Sbjct: 438 YDSSHKEFQCMKPCQKVLCQDGHRCPNVCFQECQPCQVKVPKIIL--KCGHKQMVPCSMS 495

Query: 293 DN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
           ++ F C+E CSK L+CGH+C   C    C  +C  +  V+   CGH  L  C ++ + ++
Sbjct: 496 ESEFCCQEPCSKILRCGHRCSHLCGED-CVRLCSERVTVEL-KCGHSQLVKCGNVED-IK 552

Query: 352 DGCPF 356
            G P 
Sbjct: 553 YGLPV 557



>gi|472386465|ref|XP_004412584.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Odobenus
            rosmarus divergens]
          Length = 1918

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 194/362 (53%), Gaps = 22/362 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1077 RPEIARLLTPYVYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1136

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1137 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1191

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1192 ENDIILLSLVRSNEEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1249

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  + + L CQ HP+  T V    DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1250 TLRENNQIGRTLRLCCQNHPDTHTLVSKACDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1309

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C  P
Sbjct: 1310 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKIIL--RCGHEQMVPCSMP 1367

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++++  
Sbjct: 1368 EAD-FCCQEPCPKVLKCGHRCSRPCGED-CVRLCSEMVTVKL-KCGHSQRVKCGNVQDLT 1424

Query: 351  QD 352
             D
Sbjct: 1425 YD 1426



>gi|239612124|gb|EEQ89111.1| DEAD box helicase [Ajellomyces dermatitidis ER-3]
          Length = 1089

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 115/264 (43%), Positives = 160/264 (60%), Gaps = 14/264 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIY D L DH  V     VPG+   N FFF H   E  +   +S+ N  EAR
Sbjct: 704 PEIRRILAPIYDD-LEDHPSVVDRHAVPGMGGVNSFFFCHDWPESSD-SLLSKYNDREAR 761

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL + G+E   IT+L+ Y+GQRK+I K LR+   +    + I+VS+VD +QGE
Sbjct: 762 MVVGFFIYLHLNGVEVQDITVLTFYNGQRKKILKALRD--IRLLQGQYIKVSTVDSYQGE 819

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+I++LSLVRS+E++  +GFL++ NRVCVALSRAK G YIFGNA  L   + LW EV+ 
Sbjct: 820 ENEIVLLSLVRSNENSGNMGFLAVENRVCVALSRAKRGFYIFGNAEFLAVSNPLWWEVVQ 879

Query: 181 ILE-KSKKCDQFINLYCQKHPEK----ETQVFTFADFPLEGGCSRNCEEKMDCGHICQSI 235
           I+    ++    +   C  H  K    + + ++  D    GGCS  C++K+ CGH C   
Sbjct: 880 IVNCSPRRIGYHVPATCANHQTKMYIAQAEKWSLTD----GGCSLKCDQKLKCGHDCPLR 935

Query: 236 CHLSSHDKIFCPENCIRTLPCGHP 259
           CH+ SH ++ C + C + LPCGHP
Sbjct: 936 CHVVSHSQVKCQQPCSQLLPCGHP 959



>gi|261202204|ref|XP_002628316.1| DEAD box helicase [Ajellomyces dermatitidis SLH14081]
 gi|239590413|gb|EEQ72994.1| DEAD box helicase [Ajellomyces dermatitidis SLH14081]
          Length = 1089

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 115/264 (43%), Positives = 160/264 (60%), Gaps = 14/264 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIY D L DH  V     VPG+   N FFF H   E  +   +S+ N  EAR
Sbjct: 704 PEIRRILAPIYDD-LEDHPSVVDRHAVPGMGGVNSFFFCHDWPESSD-SLLSKYNDREAR 761

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL + G+E   IT+L+ Y+GQRK+I K LR+   +    + I+VS+VD +QGE
Sbjct: 762 MVVGFFIYLHLNGVEVQDITVLTFYNGQRKKILKALRD--IRLLQGQYIKVSTVDSYQGE 819

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+I++LSLVRS+E++  +GFL++ NRVCVALSRAK G YIFGNA  L   + LW EV+ 
Sbjct: 820 ENEIVLLSLVRSNENSGNMGFLAVENRVCVALSRAKRGFYIFGNAEFLAVSNPLWWEVVQ 879

Query: 181 ILE-KSKKCDQFINLYCQKHPEK----ETQVFTFADFPLEGGCSRNCEEKMDCGHICQSI 235
           I+    ++    +   C  H  K    + + ++  D    GGCS  C++K+ CGH C   
Sbjct: 880 IVNCSPRRIGYHVPATCANHQTKMYIAQAEKWSLTD----GGCSLKCDQKLKCGHDCPLR 935

Query: 236 CHLSSHDKIFCPENCIRTLPCGHP 259
           CH+ SH ++ C + C + LPCGHP
Sbjct: 936 CHVVSHSQVKCQQPCSQLLPCGHP 959



>gi|327352710|gb|EGE81567.1| DEAD box helicase [Ajellomyces dermatitidis ATCC 18188]
          Length = 1089

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 115/264 (43%), Positives = 160/264 (60%), Gaps = 14/264 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIY D L DH  V     VPG+   N FFF H   E  +   +S+ N  EAR
Sbjct: 704 PEIRRILAPIYDD-LEDHPSVVDRHAVPGMGGVNSFFFCHDWPESSD-SLLSKYNDREAR 761

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL + G+E   IT+L+ Y+GQRK+I K LR+   +    + I+VS+VD +QGE
Sbjct: 762 MVVGFFIYLHLNGVEVQDITVLTFYNGQRKKILKALRD--IRLLQGQYIKVSTVDSYQGE 819

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+I++LSLVRS+E++  +GFL++ NRVCVALSRAK G YIFGNA  L   + LW EV+ 
Sbjct: 820 ENEIVLLSLVRSNENSGNMGFLAVENRVCVALSRAKRGFYIFGNAEFLAVSNPLWWEVVQ 879

Query: 181 ILE-KSKKCDQFINLYCQKHPEK----ETQVFTFADFPLEGGCSRNCEEKMDCGHICQSI 235
           I+    ++    +   C  H  K    + + ++  D    GGCS  C++K+ CGH C   
Sbjct: 880 IVNCSPRRIGYHVPATCANHQTKMYIAQAEKWSLTD----GGCSLKCDQKLKCGHDCPLR 935

Query: 236 CHLSSHDKIFCPENCIRTLPCGHP 259
           CH+ SH ++ C + C + LPCGHP
Sbjct: 936 CHVVSHSQVKCQQPCSQLLPCGHP 959



>gi|189192076|ref|XP_001932377.1| hypothetical protein PTRG_02044 [Pyrenophora tritici-repentis
            Pt-1C-BFP]
 gi|187973983|gb|EDU41482.1| hypothetical protein PTRG_02044 [Pyrenophora tritici-repentis
            Pt-1C-BFP]
          Length = 1256

 Score =  203 bits (516), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 164/277 (59%), Gaps = 26/277 (9%)

Query: 2    PEIRKLLTPIYHDALSDHE---EVNHYPDVPGLT-DNLFFFDHQESEKLERDTMSRTNTF 57
            PEIR+LL PIY D L DH+   +V++ P V G+  +N FFF H+  E  + + MS  NT 
Sbjct: 804  PEIRRLLYPIYEDTLKDHKMVKDVSNRPPVEGMGGNNSFFFCHEWPESRDAN-MSAVNTM 862

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ---IRVSSV 114
            EA+M  +  NYLV+ G++ ++IT+L+ Y+GQRK I + LR    K P L+    I+V +V
Sbjct: 863  EAQMLVQFLNYLVLNGVDATKITVLTFYNGQRKHINRELR----KLPDLRTVAGIQVVTV 918

Query: 115  DGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTL 174
            D +QGEENDI++LSLVRS+  N  IGFLS  NR CVALSRAK G YIFGNA  L   S  
Sbjct: 919  DSYQGEENDIVLLSLVRSNR-NHSIGFLSSENRACVALSRAKRGFYIFGNAELLACESGT 977

Query: 175  WREVLSILEKSKKC----------DQFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCE 223
            W  V+ I+ ++KK              + L C  H +K    +  +DF L +GGC + CE
Sbjct: 978  WASVVDIMYRNKKSPVTTGQERRLGYRLPLVCSNHGQKIWCEYP-SDFDLIKGGCDKKCE 1036

Query: 224  EKMDCGHICQSICHLSSHDKIFCPENCI-RTLPCGHP 259
              + CGH C   CH   HD I C + C  R   CGHP
Sbjct: 1037 GSLPCGHRCPFTCHPFEHDMINCTQKCSKRVEACGHP 1073



>gi|332207763|ref|XP_003252965.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Nomascus
            leucogenys]
          Length = 1917

 Score =  202 bits (515), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 135/360 (37%), Positives = 189/360 (52%), Gaps = 18/360 (5%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1076 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1135

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1136 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1190

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1191 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1248

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1249 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1308

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1309 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1368

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     VK   CGH     C  +   L  G
Sbjct: 1369 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGHVEGLLYGG 1425



>gi|255955913|ref|XP_002568709.1| Pc21g17110 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590420|emb|CAP96608.1| Pc21g17110 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1177

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 157/255 (61%), Gaps = 12/255 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNL-FFFDHQESEKLERDTMSRTNTFEAR 60
           PEIRKL+ PIY D L DH  V ++P VPG+ D   FFFDH   E  +   +S+ N FEA 
Sbjct: 710 PEIRKLVAPIYGDLLRDHPSVGNHPLVPGMGDKRSFFFDHTAHESND-SLLSKVNDFEAS 768

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ-IRVSSVDGFQG 119
           M      YLVM  +  S IT+L+ Y+GQRK I   +R++S+   V    + + +VD +QG
Sbjct: 769 MVVNFLAYLVMNKVPASSITVLTFYNGQRKLI---MRKKSQNHNVSNSYVNILTVDSYQG 825

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EENDIIILSLVRS++ +RGIGFL+  NRVCVALSRAK+GLYIFGNA  +   S  W  V 
Sbjct: 826 EENDIIILSLVRSND-HRGIGFLAQDNRVCVALSRAKYGLYIFGNAQCVSKHSNFWYSVT 884

Query: 180 SILEKS---KKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQSI 235
           +++ ++    +    + LYC +H  +ET +    D+  +  GC++ C+  + CGH C   
Sbjct: 885 NVMSENPEDPRIGPALPLYCTRH-NQETLIEILKDWNNITDGCNKPCDRDLPCGHPCPRK 943

Query: 236 CHLSSHDKIFCPENC 250
           CH S HD + C + C
Sbjct: 944 CHGSEHDWVSCKQRC 958



>gi|119596068|gb|EAW75662.1| zinc finger, NFX1-type containing 1, isoform CRA_b [Homo sapiens]
 gi|119596069|gb|EAW75663.1| zinc finger, NFX1-type containing 1, isoform CRA_b [Homo sapiens]
 gi|119596070|gb|EAW75664.1| zinc finger, NFX1-type containing 1, isoform CRA_b [Homo sapiens]
 gi|168273234|dbj|BAG10456.1| NFX1-type zinc finger-containing protein 1 [synthetic construct]
          Length = 1918

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 190/360 (52%), Gaps = 18/360 (5%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+   + P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKIIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     +K   CGH     C  +   L  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTIKL-KCGHSQPVKCGHVEGLLYGG 1426



>gi|7243189|dbj|BAA92642.1| KIAA1404 protein [Homo sapiens]
          Length = 1925

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 190/360 (52%), Gaps = 18/360 (5%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1084 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1143

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1144 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1198

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1199 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1256

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1257 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1316

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+   + P CGH ++V C  P+ D
Sbjct: 1317 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKIIPRCGHEQMVPCSVPESD 1376

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     +K   CGH     C  +   L  G
Sbjct: 1377 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTIKL-KCGHSQPVKCGHVEGLLYGG 1433



>gi|124487311|ref|NP_001028368.2| NFX1-type zinc finger-containing protein 1 [Mus musculus]
 gi|342187367|sp|Q8R151.3|ZNFX1_MOUSE RecName: Full=NFX1-type zinc finger-containing protein 1
 gi|148674549|gb|EDL06496.1| mCG14615 [Mus musculus]
          Length = 1909

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 195/364 (53%), Gaps = 21/364 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1069 RPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1128

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  YL+      S+ITIL+ Y+GQ   + K +            I+V  VD +QGE
Sbjct: 1129 FVVELCQYLLCQEYLPSQITILTTYTGQLFCLRKLM-----PVKTFAGIKVHVVDKYQGE 1183

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1184 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1241

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HPE  T V   +DF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 1242 TLRENNQIGPSLRLCCQNHPETHTLVSKASDFQKVPEGGCSRPCEFRLACGHVCTRACHP 1301

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              SSH +  C + C + L   GH  P             V  II+   CGH ++V C   
Sbjct: 1302 YDSSHKEFQCMKPCQKVLCQDGHRCPNVCFQECQPCQVKVPKIIL--KCGHKQMVPCSMS 1359

Query: 293  DN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
            ++ F C+E CSK L+CGH+C   C    C  +C  +  V+   CGH  L  C ++ + ++
Sbjct: 1360 ESEFCCQEPCSKILRCGHRCSHLCGED-CVRLCSERVTVEL-KCGHSQLVKCGNVED-IK 1416

Query: 352  DGCP 355
             G P
Sbjct: 1417 YGLP 1420



>gi|301754401|ref|XP_002913033.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Ailuropoda melanoleuca]
          Length = 1919

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 195/362 (53%), Gaps = 22/362 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1078 RPEIARLLTPYIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1137

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1138 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1192

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1193 ENDIILLSLVRSNEEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1250

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1251 TLRENNQIGCMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1310

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  +I+   CGH ++V C  P
Sbjct: 1311 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKLIL--RCGHEQMVPCSMP 1368

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++++ +
Sbjct: 1369 ESD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHSQQVKCGNVQDLM 1425

Query: 351  QD 352
             D
Sbjct: 1426 YD 1427



>gi|328716886|ref|XP_001950310.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Acyrthosiphon pisum]
          Length = 1870

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 128/347 (36%), Positives = 185/347 (53%), Gaps = 22/347 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+TP  +D L +H  V++   + G+T ++FF +H   EK   +  S++N  EAR
Sbjct: 842  RPEIASLITPSIYDELKNHISVHNREHIRGVTKDVFFLNHNMYEKEVDEISSKSNEHEAR 901

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               + A +L++ G +  ++TIL+ YSGQ       +R   +K  +L+ ++++ VD +QGE
Sbjct: 902  FLVRFARHLILQGYKTDQVTILTTYSGQ----LFLIRSLRKKYSILEGMKITVVDNYQGE 957

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E    +GFL   NRVCVALSRAK+GLYI GN   L    +LW+++  
Sbjct: 958  ESDIILLSLVRSNEMG-NVGFLKTENRVCVALSRAKYGLYIMGNMDNLYNSGSLWKKIKE 1016

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L         + L C  H    T+V    DF   +EGGCS  C+  + CGH C SICH 
Sbjct: 1017 TLVNLGSYGDELTLECAVHSGITTKVAKDDDFNTIMEGGCSMMCKSLLLCGHYCSSICH- 1075

Query: 239  SSHDK----IFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVD 293
             SHD+    + C E C ++    HP              ++I   PCGH   + C  DV 
Sbjct: 1076 -SHDRDHLELKCREPCNKSCVYNHPCKKICYMDCGKCTVSMIKELPCGHQLTLPCFVDVL 1134

Query: 294  NFRCKERCSKKL-KCGHQCREEC--SSPWCTAMCLTQTEVKYPGCGH 337
             F C+E     L KCGH     C   +P C+  C+ + +     CGH
Sbjct: 1135 TFPCEEMVVSVLEKCGHTTLNRCHDKNPICSHKCIDRLD-----CGH 1176



>gi|281351105|gb|EFB26689.1| hypothetical protein PANDA_000811 [Ailuropoda melanoleuca]
          Length = 1899

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 195/362 (53%), Gaps = 22/362 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1058 RPEIARLLTPYIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1117

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1118 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1172

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1173 ENDIILLSLVRSNEEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1230

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1231 TLRENNQIGCMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1290

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  +I+   CGH ++V C  P
Sbjct: 1291 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKLIL--RCGHEQMVPCSMP 1348

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++++ +
Sbjct: 1349 ESD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHSQQVKCGNVQDLM 1405

Query: 351  QD 352
             D
Sbjct: 1406 YD 1407



>gi|345790175|ref|XP_534452.3| PREDICTED: NFX1-type zinc finger-containing protein 1 [Canis lupus
            familiaris]
          Length = 1918

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 195/362 (53%), Gaps = 22/362 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1077 RPEIARLLTPYIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1136

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1137 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1191

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1192 ENDIVLLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1249

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  + + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1250 TLRENNQIGRTLQLCCQNHPDTHTFVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1309

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C  P
Sbjct: 1310 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVRKIIV--RCGHEQMVPCSMP 1367

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKL 350
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++ + +
Sbjct: 1368 ESD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHSQQVKCGNVEDLM 1424

Query: 351  QD 352
             D
Sbjct: 1425 YD 1426



>gi|91079004|ref|XP_974762.1| PREDICTED: similar to Ab1-133 [Tribolium castaneum]
          Length = 1990

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 177/355 (49%), Gaps = 47/355 (13%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L++P  +  L DH  VN  PD+ G+ + LFF DH+  E    +  S+ N  E  
Sbjct: 960  RPEIASLVSPTIYPTLQDHPSVNDRPDIKGVDNCLFFIDHKHPEA-NCEGKSKKNYHEVD 1018

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++ G E   ITIL+ Y GQ  E+ K   E  +   +L  +R++ +D +QGE
Sbjct: 1019 FLIYFARHLILNGYEPGNITILAAYLGQMFELQK---ERRKHNELLANVRIAVLDNYQGE 1075

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E DII+LSLVR++E N+ IGFLSI NRVCVALSRA++G Y+ GN  QL   S LWRE+  
Sbjct: 1076 ECDIILLSLVRNNEENK-IGFLSIENRVCVALSRARNGFYLMGNMDQLCAASQLWREIYK 1134

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
              E+       + L CQ HP+K T V +  DF    EGGC++ C   ++CGH C S+CH+
Sbjct: 1135 TFERQNAIGPHLALRCQVHPDKVTYVASGKDFLNISEGGCNQKCGADLNCGHQCTSLCHV 1194

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNFR 296
                H    C E C + L                          C  +E+ LC      R
Sbjct: 1195 LNRDHASYRCLETCGKKL--------------------------CDKNELHLC----QRR 1224

Query: 297  CKERC-------SKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
            C + C       S+ LKCGH    EC     T  C      + P CGH     CH
Sbjct: 1225 CYQECGPCTYKVSRTLKCGHVVNLECHLDPATYSCEELVPTQLP-CGHNADKPCH 1278



>gi|28626521|ref|NP_066363.1| NFX1-type zinc finger-containing protein 1 [Homo sapiens]
 gi|23821814|sp|Q9P2E3.2|ZNFX1_HUMAN RecName: Full=NFX1-type zinc finger-containing protein 1
 gi|162318542|gb|AAI56358.1| Zinc finger, NFX1-type containing 1 [synthetic construct]
 gi|225000862|gb|AAI72478.1| Zinc finger, NFX1-type containing 1 [synthetic construct]
          Length = 1918

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 189/360 (52%), Gaps = 18/360 (5%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+E CSK L+CGH+C   C    C  +C     +K   CGH     C  +   L  G
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTIKL-KCGHSQPVKCGHVEGLLYGG 1426



>gi|270003675|gb|EFA00123.1| hypothetical protein TcasGA2_TC002939 [Tribolium castaneum]
          Length = 2951

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 177/355 (49%), Gaps = 47/355 (13%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L++P  +  L DH  VN  PD+ G+ + LFF DH+  E    +  S+ N  E  
Sbjct: 1921 RPEIASLVSPTIYPTLQDHPSVNDRPDIKGVDNCLFFIDHKHPEA-NCEGKSKKNYHEVD 1979

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++ G E   ITIL+ Y GQ  E+ K   E  +   +L  +R++ +D +QGE
Sbjct: 1980 FLIYFARHLILNGYEPGNITILAAYLGQMFELQK---ERRKHNELLANVRIAVLDNYQGE 2036

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E DII+LSLVR++E N+ IGFLSI NRVCVALSRA++G Y+ GN  QL   S LWRE+  
Sbjct: 2037 ECDIILLSLVRNNEENK-IGFLSIENRVCVALSRARNGFYLMGNMDQLCAASQLWREIYK 2095

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
              E+       + L CQ HP+K T V +  DF    EGGC++ C   ++CGH C S+CH+
Sbjct: 2096 TFERQNAIGPHLALRCQVHPDKVTYVASGKDFLNISEGGCNQKCGADLNCGHQCTSLCHV 2155

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNFR 296
                H    C E C + L                          C  +E+ LC      R
Sbjct: 2156 LNRDHASYRCLETCGKKL--------------------------CDKNELHLCQR----R 2185

Query: 297  CKERC-------SKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
            C + C       S+ LKCGH    EC     T  C      + P CGH     CH
Sbjct: 2186 CYQECGPCTYKVSRTLKCGHVVNLECHLDPATYSCEELVPTQLP-CGHNADKPCH 2239



>gi|317418761|emb|CBN80799.1| NFX1-type zinc finger-containing protein 1 [Dicentrarchus labrax]
          Length = 1990

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 180/347 (51%), Gaps = 21/347 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ GL  NLFF +H   E+  +D  S  N  EA 
Sbjct: 1145 RPEIACLLTPHIYSELENHPSVFDYDNIKGLNTNLFFVEHNHPEEEIKDGRSHQNRHEAM 1204

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL+    +  +ITIL+ Y+GQ   + K +            ++V  VD +QGE
Sbjct: 1205 FVVALCRYLLFQDYKPEQITILTTYTGQLHCLRKLM-----PASEFTGVKVHVVDKYQGE 1259

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS++  R +GFL+I NRVCVALSRAK GLY  GN++ L  +  LW  +  
Sbjct: 1260 ENDIVLLSLVRSNQ-QRKVGFLNIPNRVCVALSRAKKGLYCIGNSAMLG-QVKLWSNIFY 1317

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +  +    + L CQ HP+++ +     DF    EGGC++ C  ++DCGH+C S+CH 
Sbjct: 1318 TLREKNQIGDALTLCCQNHPDRQIRASCAEDFKQAPEGGCTQPCNFRLDCGHVCSSVCHP 1377

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXX----XXXXXXXXXXVETIIMCPPCGHSEVVLC-P 290
                H K  C + C + L   GH                 VE II  P C H+++V C  
Sbjct: 1378 YDPEHKKYKCVKKCQKILCKLGHRCTLVCHRACPEKCAVKVEKII--PQCQHTQMVPCHQ 1435

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            D   F C+E C K L C H C   C  P CT  C  +  +K   CGH
Sbjct: 1436 DPKTFTCQEPCQKLLHCEHPCDSVCGEP-CTIKCKVKVNLKL-RCGH 1480



>gi|145534704|ref|XP_001453096.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420796|emb|CAK85699.1| unnamed protein product [Paramecium tetraurelia]
          Length = 2103

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 182/345 (52%), Gaps = 21/345 (6%)

Query: 11   IYHDALSDHEEVNHYPDV--PGLTDNLFFFDHQESEKLERDTMSRTNTFEARMCAKLANY 68
            IY D   DH  +     +   G   +L FFDH++SE  +  + S+ N FEARM  K+ +Y
Sbjct: 1375 IYKD-YKDHSSIEEQNKIHLEGFNSDLLFFDHRKSEDKKLYSSSKQNQFEARMIVKMVDY 1433

Query: 69   LVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEENDIIILS 128
            L+  G    +ITIL+ Y  Q      Y+++E       + I+V ++D +QGEENDII+LS
Sbjct: 1434 LLKNGHTNQQITILTTYVRQAL----YIQKECGN----RNIKVQAIDNYQGEENDIILLS 1485

Query: 129  LVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYR---STLWREVLSILEKS 185
            LVRS++  + +GF++I NRVCVALSRA+ GLY+FG+   ++     + LW +++ + E+ 
Sbjct: 1486 LVRSNDEYK-LGFVAIDNRVCVALSRARLGLYVFGDFDFIKVTPDVTGLWLKIIDLAEQK 1544

Query: 186  KKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHLSSHDK 243
                  I L C  H +  T+++   D+     GGC   C  +  CGHICQ  CH S+H +
Sbjct: 1545 GVIKNHIELKCSSHNQI-TKIYDVKDWDQVKGGGCQNTCGAEFPCGHICQLRCHKSNHLQ 1603

Query: 244  IFCPENCIRTLPCGHPXXXXXXXXXXXXVETII--MCPPCGHSEVVLCPDV-DNFRCKER 300
              CPENC + L CGH               T++      CGH+  + C D     +C+ER
Sbjct: 1604 NDCPENCEKILTCGHQCYGRCKQYPCPPCRTMVQKQIQECGHTTSIQCSDQHKKTKCRER 1663

Query: 301  CSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHD 345
            C K L CGHQC  +C        CL Q +   P C H+    C D
Sbjct: 1664 CEKILNCGHQCALQCIDDCKMNKCLIQIQYTLPLCKHVMSIGCDD 1708



>gi|332858766|ref|XP_003317055.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Pan
            troglodytes]
          Length = 1918

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 136/368 (36%), Positives = 192/368 (52%), Gaps = 24/368 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYP-------GCGHIDLCLCHDI 346
             F C+E CSK L+CGH+C   C    C  +C     VK          CGH++  L  D+
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKLKCGHSQPVKCGHVEGLLYGDL 1427

Query: 347  RNKLQDGC 354
              K    C
Sbjct: 1428 LVKCTTKC 1435



>gi|330920768|ref|XP_003299143.1| hypothetical protein PTT_10078 [Pyrenophora teres f. teres 0-1]
 gi|311327295|gb|EFQ92756.1| hypothetical protein PTT_10078 [Pyrenophora teres f. teres 0-1]
          Length = 1201

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 164/275 (59%), Gaps = 22/275 (8%)

Query: 2    PEIRKLLTPIYHDALSDHE---EVNHYPDVPGLT-DNLFFFDHQESEKLERDTMSRTNTF 57
            PEIR+LL PIY D L DH+   +V++ P V G+  +N +FF H+  E  + + MS  NT 
Sbjct: 749  PEIRRLLYPIYEDTLKDHKMVKDVSNRPPVEGMGGNNSYFFCHEWPESRDAN-MSAVNTM 807

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA+M  +  NYLV+ G++ ++IT+L+ Y+GQRK+I + LR++     ++  I+V +VD +
Sbjct: 808  EAQMLVQFFNYLVLNGVDATKITVLTFYNGQRKQILRELRKQP-DLRIIPGIQVVTVDSY 866

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEENDI++LSLVRS+  N  IGFLS  NR CVALSRAK G YIFGNA  L   S  W  
Sbjct: 867  QGEENDIVLLSLVRSNR-NHSIGFLSSENRACVALSRAKRGFYIFGNAELLACESGTWAS 925

Query: 178  VLSILEKSKKCD-----------QFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCEEK 225
            V+ I+ ++KK             QF  L C  H  K       +DF L +GGC   CE  
Sbjct: 926  VVDIMFRNKKSKVTTGQERRVGYQF-PLVCSNHGRK-IWCEEPSDFELIKGGCDMKCEGS 983

Query: 226  MDCGHICQSICHLSSHDKIFCPENCI-RTLPCGHP 259
            + CGH C  +CH   HD I C + C  R   CGHP
Sbjct: 984  LPCGHRCAFMCHPFEHDMINCTQKCSKRVEACGHP 1018



>gi|397475809|ref|XP_003809312.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Pan paniscus]
          Length = 1918

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 136/368 (36%), Positives = 192/368 (52%), Gaps = 24/368 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA  
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCVGNM-QMLAKVPLWSKIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDVD 293
             SSH +  C + C + +   GH              V+     P CGH ++V C  P+ D
Sbjct: 1310 DSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESD 1369

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYP-------GCGHIDLCLCHDI 346
             F C+E CSK L+CGH+C   C    C  +C     VK          CGH++  L  D+
Sbjct: 1370 -FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVKLKCGHSQPVKCGHVEGLLYGDL 1427

Query: 347  RNKLQDGC 354
              K    C
Sbjct: 1428 LVKCTTKC 1435



>gi|321462829|gb|EFX73849.1| hypothetical protein DAPPUDRAFT_10306 [Daphnia pulex]
          Length = 1020

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 179/341 (52%), Gaps = 29/341 (8%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+ P  ++ L +H  V  +P VPG+  ++FF+ H   EK   D  S  N  E  
Sbjct: 620 RPEIVRLIVPAIYEELENHSTVYDHPHVPGMQHDVFFYHHNYPEK--EDGSSFYNRHEVD 677

Query: 61  MCAKLANYLVM-GGMEESRITILSMYSGQRKEIYKYLREESRKT-PVLKQIRVSSVDGFQ 118
           M  +LA YL+    +   +ITIL+ Y+ Q  + +      SRK+  +L  +R++ VD FQ
Sbjct: 678 MSLRLAIYLIREQKVAPQQITILATYTAQLHQFFN-----SRKSYELLADVRITVVDNFQ 732

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEND+IILSLVR++  N  +GFL  +NR+CVALSRA++GLYI GN   L   S +W ++
Sbjct: 733 GEENDVIILSLVRNNSRN-SVGFLRTANRICVALSRARNGLYILGNIHMLANASPVWADM 791

Query: 179 LSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHL 238
             +L++  +  + I L C +H E   +V    DFP+   C   C  ++DCGH+C+ +CH 
Sbjct: 792 EKVLKEHGQIGEEIPLRCDRHHEIVRKVKRSIDFPIGSFCRELCGAELDCGHVCKLVCHQ 851

Query: 239 SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCG-HSEVVLCPDVDNFRC 297
                  CPE   + L CGH                     PC  +SE V CP++    C
Sbjct: 852 DELHTSSCPEIITKLLDCGHD-----------------YSGPCSRNSENVFCPELLAAYC 894

Query: 298 KERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHI 338
            E   KKL CGH  R +C+       C    E +   CGH+
Sbjct: 895 TELVRKKLLCGHPKRMKCNEDPTEFDCGVADE-RLLDCGHL 934



>gi|114145712|ref|NP_001041325.1| NFX1-type zinc finger-containing protein 1 [Rattus norvegicus]
 gi|33086460|gb|AAP92542.1| Ab1-133 [Rattus norvegicus]
          Length = 2018

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 193/364 (53%), Gaps = 21/364 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1180 RPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1239

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  YL+      S+ITIL+ Y+GQ   + K +            I+V  VD +QGE
Sbjct: 1240 FVVELCQYLLCQEYLPSQITILTTYTGQLFCLRKLM-----PVKTFAGIKVHVVDKYQGE 1294

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            END+I+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1295 ENDVILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1352

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1353 TLRENHQIGPSLRLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLACGHVCTRACHP 1412

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C   
Sbjct: 1413 YDSSHKEFQCMKPCQKVICQDGHRCPNVCFQECQPCQVKVPKIIL--KCGHKQMVPCSVS 1470

Query: 293  D-NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
            + +F C+E CSK L+CGH+C   C    C  +C  +  VK   CGH  L  C  + + L+
Sbjct: 1471 ESDFCCQEPCSKVLRCGHRCSHLCGEN-CVRLCPEKVTVKL-NCGHSQLVKCGQVED-LK 1527

Query: 352  DGCP 355
             G P
Sbjct: 1528 YGLP 1531



>gi|452002703|gb|EMD95161.1| hypothetical protein COCHEDRAFT_1201587 [Bipolaris maydis C5]
 gi|477583851|gb|ENI00947.1| hypothetical protein COCC4DRAFT_84245 [Bipolaris maydis ATCC 48331]
          Length = 1224

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/275 (44%), Positives = 160/275 (58%), Gaps = 22/275 (8%)

Query: 2    PEIRKLLTPIYHDALSDH---EEVNHYPDVPGLT-DNLFFFDHQESEKLERDT-MSRTNT 56
            PEIR+LL PIY D L DH   E   H P V G+  +N FFF H+  E   RD  MS  N 
Sbjct: 774  PEIRRLLCPIYEDKLKDHPNVENAGHRPPVEGMGGNNSFFFCHEWPEG--RDIHMSSFNA 831

Query: 57   FEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDG 116
             EA M  +  +YLV+ G++ ++ TIL+ Y+GQR++I K +R       V + I+V +VD 
Sbjct: 832  READMVVRFLDYLVLNGVDATKTTILTFYNGQRRQITKLIRAHP-NLGVYRGIQVVTVDS 890

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            +QGEENDI++LSLVRS+E N  IGFLS  NR CVALSRAK G YIFGNA  L  +S++W 
Sbjct: 891  YQGEENDIVLLSLVRSNEKN-SIGFLSSENRACVALSRAKRGFYIFGNAELLASQSSIWG 949

Query: 177  EVLSILEKSKK----------CDQFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCEEK 225
             V+ I+ K+KK             ++ L C  H  K        DF L +GGC   C+  
Sbjct: 950  SVVEIMFKNKKPKVKAGQERRVGYYLPLVCTNHGHK-VWCEDPDDFDLIKGGCDIKCDGV 1008

Query: 226  MDCGHICQSICHLSSHDKIFCPENCIRTLP-CGHP 259
            + CGH C   CH   HD+I C + C R +  CGHP
Sbjct: 1009 LPCGHRCPYTCHPFEHDRINCTQKCARRVERCGHP 1043



>gi|260797857|ref|XP_002593917.1| hypothetical protein BRAFLDRAFT_234854 [Branchiostoma floridae]
 gi|229279149|gb|EEN49928.1| hypothetical protein BRAFLDRAFT_234854 [Branchiostoma floridae]
          Length = 1553

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 179/335 (53%), Gaps = 23/335 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  +LLTP  +++L +HE V +Y ++ G++ N+FF DH   E  + DT SR+N  EA+
Sbjct: 959  RPEFARLLTPHIYESLDNHESVLNYENIKGVSSNMFFVDHSYWEAHDGDTKSRSNMHEAK 1018

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A    YL+  G   S+ITIL+ Y+GQ   ++ + +   R+  V + +RV +VD FQGE
Sbjct: 1019 FMASFCRYLLKQGYSPSQITILTTYTGQ---LFNFKKVMPRQ--VFEGVRVCNVDNFQGE 1073

Query: 121  ENDIIILSLVRSD-ESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            E+DII+LSLVRS+ E N  +GFL + NRVCVALSRAK G Y  GN + L   STLW +++
Sbjct: 1074 ESDIILLSLVRSNVEGN--VGFLKVENRVCVALSRAKKGFYAIGNLTMLSQTSTLWSKII 1131

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICH 237
              L +     + + L CQ HP+      T  DF     GGC R C+ +  CGH C S CH
Sbjct: 1132 QELREQGCVGRHLKLCCQNHPDTSIMAVTEKDFEKAPAGGCMRPCDFRR-CGHACASACH 1190

Query: 238  L--SSHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC- 289
                 H++  C + C   L      C  P             +TI   P C H + V C 
Sbjct: 1191 PIDPEHEEYKCKKPCKNVLCDLGHKCPKPCHETCDDCKIRVEKTI---PDCQHKQKVACY 1247

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMC 324
                 F C+  C K L C H+C+ +C    CT  C
Sbjct: 1248 VPPSEFVCQIPCEKTLPCNHKCKNKCGE-RCTQYC 1281



>gi|449486364|ref|XP_004177125.1| PREDICTED: LOW QUALITY PROTEIN: NFX1-type zinc finger-containing
            protein 1-like [Taeniopygia guttata]
          Length = 2097

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 134/356 (37%), Positives = 183/356 (51%), Gaps = 40/356 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +L++P  +  L +H  V  Y ++ G++ N+FF +H+  E+  ++  S  N  EA 
Sbjct: 1260 RPEIAQLISPHIYQKLENHPSVLEYENIKGVSTNVFFVEHEVPEQEIQEGKSHQNPHEAH 1319

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +  G E S+ITIL+ Y+GQ   + K +        + + ++V  VD +QGE
Sbjct: 1320 XVVELCKYFLCQGYEPSQITILTTYTGQLFCLRKLM-----PAKIFQGVKVHVVDKYQGE 1374

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R  GFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1375 ENDIILLSLVRSNDEGRP-GFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWNKIIE 1432

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L K+    Q + L CQ HP  +T+V T  DF    EGGC+  CE ++ CGH C  +CH 
Sbjct: 1433 TLGKNGHIGQSLELCCQNHPGTKTKVSTGEDFNSVPEGGCTLPCEFRLSCGHACTRVCHP 1492

Query: 239  --SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
                H K  C + C + L             PCG              VE  I    CGH
Sbjct: 1493 YDPEHKKYQCLKPCQKVLCADGHRCPKSCYEPCG---------KCMVKVEKTI--SKCGH 1541

Query: 284  SEVVLC--PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             ++V C  P  +   C E C KKLKCGH C+  C    C   C  Q  V    CGH
Sbjct: 1542 IQMVPCHIPSWE-IVCLEPCQKKLKCGHTCKRSCGEE-CKMWCFEQVTVTLK-CGH 1594



>gi|505850720|ref|XP_004618813.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Sorex araneus]
          Length = 1917

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 132/358 (36%), Positives = 188/358 (52%), Gaps = 16/358 (4%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR 
Sbjct: 1077 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEARF 1136

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGEE
Sbjct: 1137 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGEE 1191

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  R  LW  ++  
Sbjct: 1192 NDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLARVPLWSRIIHT 1249

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L +S +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1250 LRESAQIGPSLRLCCQNHPETHTSVSKASDFQKVPEGGCSLPCEFRLSCGHVCTRACHPY 1309

Query: 239  -SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDN- 294
             S H +  C + C + + P GH              V+   +   CGH ++V C   ++ 
Sbjct: 1310 DSLHKEFQCMKPCQKIICPDGHRCPRVCFQECQPCQVKVPKVISRCGHEQMVPCSMPESK 1369

Query: 295  FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQD 352
            F C+E C K LKCGH C   C    C  +C  +  VK   CGH     C ++ + + D
Sbjct: 1370 FCCQEPCPKVLKCGHDCSHLCGEE-CVRLCSVKVSVKL-KCGHSQQVKCGNVEDLMYD 1425



>gi|296200674|ref|XP_002747680.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Callithrix
            jacchus]
          Length = 1918

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 133/362 (36%), Positives = 191/362 (52%), Gaps = 17/362 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVD- 293
              SSH +  C + C + +   GH              V+     P CGH ++V C   + 
Sbjct: 1309 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTIPQCGHEQMVPCSVAES 1368

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
            +F C+E C K L+CGH+C   C    C  +C     VK   CGH     C  +++ L  G
Sbjct: 1369 DFCCQEPCPKFLRCGHRCNHPCGED-CVQLCSEMVTVKL-KCGHSQQVKCGYVKD-LMYG 1425

Query: 354  CP 355
             P
Sbjct: 1426 LP 1427



>gi|507560454|ref|XP_004663933.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Jaculus
            jaculus]
          Length = 1916

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 195/367 (53%), Gaps = 25/367 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHSFPEQEIQEGRSHQNWHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        I+V  VD +QGE
Sbjct: 1136 FLVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGIKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  R  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-MGFLQIPNRICVALSRAKKGMYCIGNM-QMLAREPLWSKIMH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++++    + L CQ HP+  T V T +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENEQLGPSLRLCCQNHPDTHTSVSTASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPD 291
              SSH +  C + C + +      C                +TI++   CGH ++V C  
Sbjct: 1309 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTILL---CGHKQMVPCSK 1365

Query: 292  VDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH---IDLCLCHDIR 347
             ++ F C+E C K L+CGH+C   C   +C  +C  +  VK   CGH   +  C   DI+
Sbjct: 1366 PESEFCCQEPCPKVLRCGHRCSNPCGD-FCVRLCSEKVTVKL-KCGHSQQVKCCNVEDIK 1423

Query: 348  NKLQDGC 354
              L   C
Sbjct: 1424 YGLPVKC 1430



>gi|449667493|ref|XP_002169454.2| PREDICTED: NFX1-type zinc finger-containing protein 1 [Hydra
           magnipapillata]
          Length = 1157

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 138/367 (37%), Positives = 181/367 (49%), Gaps = 44/367 (11%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RP I   L  IY + L DH  V  YP V G+  N+FF +H E E   R   S+ N  EA+
Sbjct: 197 RPLISSNLKYIYPN-LIDHVSVKAYPHVLGVEKNMFFINHSEPESF-RKLGSKANLHEAK 254

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                  YL+  G + S+ITIL+ YS Q  E+ K +        + + ++V++VD FQGE
Sbjct: 255 FIKSFCFYLLQQGYQPSQITILTGYSAQLLELQKCMPR-----VMFEGVKVTTVDNFQGE 309

Query: 121 ENDIIILSLVRSDESNRG-IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           ENDIIILSLVRS+E  RG IGFL+I NRVCVALSRAKHGLY+ GN   L   + LW++++
Sbjct: 310 ENDIIILSLVRSNE--RGSIGFLNIENRVCVALSRAKHGLYVIGNFQLLSENNLLWKKII 367

Query: 180 SILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICH 237
           + +  S     F+ L CQ HPE +  V    DF    EGGC   C   + CGH+C + CH
Sbjct: 368 NDVRDSGYYGDFLLLCCQNHPETKIAVRNEIDFENAPEGGCQLMCGFILQCGHVCDTFCH 427

Query: 238 LSS--HDKIFCPENCIRTL------PCGHPXXXXXXXXXXXXVETIIMCPP--------- 280
                H +  C E C++ +       C H                 I C P         
Sbjct: 428 PYDKFHKEYDCQERCLKQMCKNKEHLCLHKCHFG------------IECNPCDNLVEKKF 475

Query: 281 --CGHSEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             CGH   V C        C+E CSK + CGHQC  +C       +  T    K   CGH
Sbjct: 476 ELCGHISQVPCSVSTSEAVCQETCSKLISCGHQCSNKCGEKCLDKINCTVLVSKVLKCGH 535

Query: 338 IDLCLCH 344
           +    C+
Sbjct: 536 VQSVFCN 542



>gi|240277784|gb|EER41292.1| DEAD box helicase [Ajellomyces capsulatus H143]
          Length = 975

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 114/262 (43%), Positives = 160/262 (61%), Gaps = 12/262 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIY D L DH  V   P VPG+   N FFF H   E  +   +S+ N  EAR
Sbjct: 569 PEIRRILAPIYDD-LEDHPSVVARPAVPGMGGVNSFFFCHDWPESSD-SLLSKYNDREAR 626

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQ 118
           M      YL + G+    ITIL+ Y+GQRK+I K LR+ +    +L+   ++VS+VD +Q
Sbjct: 627 MIVGFFIYLHLNGVPVQDITILTFYNGQRKKILKALRDNN----ILQGQYLKVSTVDSYQ 682

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS+E++  +GFL++ NRVCVALSRAK G YIFGNA  L   + LW EV
Sbjct: 683 GEENEIVLLSLVRSNENSGNMGFLAVENRVCVALSRAKRGFYIFGNAEFLAVSNPLWWEV 742

Query: 179 LSILE-KSKKCDQFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCEEKMDCGHICQSIC 236
           + I+    ++    + + C  H + +T +     + L  GGC+  C++K+ CGH C   C
Sbjct: 743 VQIVNCGPRRIGYRVPITCGNH-QAKTYIAEPDHWSLTNGGCTLKCDQKLKCGHDCPLRC 801

Query: 237 HLSSHDKIFCPENCIRTLPCGH 258
           H  SH ++ C + C   LPCGH
Sbjct: 802 HAVSHSQVKCQQPCTELLPCGH 823



>gi|410920213|ref|XP_003973578.1| PREDICTED: LOW QUALITY PROTEIN: NFX1-type zinc finger-containing
            protein 1-like [Takifugu rubripes]
          Length = 1793

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 184/378 (48%), Gaps = 44/378 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  LLTP  +  L +H  V  Y ++ GL  N+FF +H   E+  +D  S  N  EA 
Sbjct: 949  RPEIATLLTPHIYTELENHPSVFEYDNIKGLNTNVFFVEHNHREEEIKDGKSHQNRHEAT 1008

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL++   +  +ITIL+ Y+GQ      Y             ++V  VD +QGE
Sbjct: 1009 YVVALCRYLLLQDYQPHQITILTTYTGQL-----YCLRNLMPAKQFTGVKVHVVDKYQGE 1063

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+   + +GFLSI NRVCVALSRAK GLY  G+++ L+ +  LW ++  
Sbjct: 1064 ENDIILLSLVRSNPEGK-VGFLSIPNRVCVALSRAKKGLYCIGDSAMLK-QVKLWSDIFH 1121

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +  +    + L CQ HP+++       DF    EGGC++ CE ++DCGH+C  +CH 
Sbjct: 1122 TLREKNQIGNALTLCCQNHPDRKVTASCAKDFEQAPEGGCTQPCEFRLDCGHVCTIVCHP 1181

Query: 239  SSHDKIF-----------------CPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPC 281
               +                    CP  C R  P   P            VE II  P C
Sbjct: 1182 YDPEHKKYKCPKKCPKTLCTLGHKCPLLCYRECPEKCP----------VGVEKII--PQC 1229

Query: 282  GHSEVVLC-PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDL 340
             H ++V C  D + F+C+E C K L CGH C   C    CT+ C     +K   CGH   
Sbjct: 1230 QHKQMVPCHQDPNEFKCQEPCQKLLDCGHLCNSLCGEE-CTSKCKVNIILKL-RCGHTQK 1287

Query: 341  CLCHDIRNKLQDGCPFCR 358
              C       Q+  P CR
Sbjct: 1288 AACF---YTTQEEGPVCR 1302



>gi|345566427|gb|EGX49370.1| hypothetical protein AOL_s00078g403 [Arthrobotrys oligospora ATCC
            24927]
          Length = 1622

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 156/263 (59%), Gaps = 8/263 (3%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEIR++L PIY D   D + +N  P + G+ + NLFFF H+  E  E+D +S+ N+ EA
Sbjct: 832  RPEIRRILMPIYPDLDDDLQVLNMKP-IQGMGNTNLFFFAHEVPE--EQDELSKKNSHEA 888

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK-QIRVSSVDGFQ 118
            +M     NYLV  G+ +  ITIL+ Y+GQ +E+ + L    R     K +IRV++VD FQ
Sbjct: 889  QMIVGFCNYLVENGIMQKEITILTFYNGQARELRRLLFRSDRLNKEAKDRIRVATVDSFQ 948

Query: 119  GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
            GEEN+++ILSL RS+ +   IGFL++ NRVCV+LSRAK G Y+FGNA+ L   S LW ++
Sbjct: 949  GEENEVVILSLCRSN-AQGTIGFLNVPNRVCVSLSRAKRGFYMFGNANMLSQASGLWWDI 1007

Query: 179  LSILEK--SKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSIC 236
            L I  +         + + CQ+H       +      + GGC   C E + CGH C   C
Sbjct: 1008 LQITNERTPPAIGTKLPITCQRHKSVTYMQYVSDWHEINGGCKSPCGEYLACGHRCTLTC 1067

Query: 237  HLSSHDKIFCPENCIRTLPCGHP 259
            H   HD + C + C R+L CGHP
Sbjct: 1068 HPYDHDSVKCADQCRRSLSCGHP 1090



>gi|328721154|ref|XP_001947220.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Acyrthosiphon pisum]
          Length = 1744

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 186/353 (52%), Gaps = 19/353 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE+  L+TP+ +  L +H  V + P + G+T ++FF +H   E    +  S++N  EA 
Sbjct: 689  RPEVSSLITPVIYPDLLNHSSVLNRPHIRGVTKDIFFINHTSFETEVEEISSKSNDHEAS 748

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++      ++TIL+ YSGQ   ++K LR   ++   L  +++  VD +QGE
Sbjct: 749  FLIMFARHLILQDYRPDQVTILTTYSGQ---MFK-LRSLQKQYSNLDGMKIQVVDNYQGE 804

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E N  +GFL   NRVCVALSRA+ GLYI GN   L     LW+E+  
Sbjct: 805  ESDIILLSLVRSNE-NGNVGFLKTENRVCVALSRARDGLYIMGNMENLYNSGNLWKEIKQ 863

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF-PL-EGGCSRNCEEKMDCGHICQSICHL 238
             L         + L C+ H +  T+V    DF P+ EGGC+  C + M+CGH C S+CH+
Sbjct: 864  KLVDQDAYGNELTLKCEVHRDTMTKVSKCEDFKPISEGGCTALCNDLMECGHYCSSVCHV 923

Query: 239  --SSHDK-IFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVDN 294
                H+K I C + C R     HP               ++   PCGH   + C  D + 
Sbjct: 924  YDRKHEKFIICQQLCNRVCENNHPCEKQCAENCGKCEVPMVKTLPCGHQTTLPCVVDTEK 983

Query: 295  FRCKERCSKKLK-CGHQCREEC--SSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
            F+C E+    L+ CGH+  ++C    P CT  C  + +     CGH  +  CH
Sbjct: 984  FKCVEKVEILLETCGHKTIKKCYEKKPKCTTKCTDRLQ-----CGHACVLDCH 1031



>gi|291409989|ref|XP_002721251.1| PREDICTED: zinc finger, NFX1-type containing 1 [Oryctolagus
            cuniculus]
          Length = 1917

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 191/362 (52%), Gaps = 17/362 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYENIKGVSSNLFFIEHTFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +      T     +RV  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLM-----PTKTFAGVRVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI++LSLVRS++  + +GFL I+NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1191 ENDIVLLSLVRSNQEGK-VGFLQIANRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++DCGH+C   CH 
Sbjct: 1249 TLRENNQIGPALRLCCQNHPETHTSVSKASDFQKVPEGGCSLPCEFRLDCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVD- 293
              S+H +  C + C + L   GH              V+       CGH ++V C   + 
Sbjct: 1309 YDSAHKEFQCMKPCQKVLCQDGHRCPLVCFQECQPCQVKVPKTISRCGHQQMVPCSMSEA 1368

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
            +F C+E C K L+CGH+C   C    C  +C     VK   CGH     C ++ + ++ G
Sbjct: 1369 DFCCQEPCPKVLRCGHRCTHSCGED-CVRLCSEMVTVKL-KCGHSQKEKCGNVED-IKYG 1425

Query: 354  CP 355
             P
Sbjct: 1426 LP 1427



>gi|390347001|ref|XP_783430.3| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Strongylocentrotus purpuratus]
          Length = 2677

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 128/359 (35%), Positives = 185/359 (51%), Gaps = 37/359 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E+  L+   ++D L DH+ V  Y  V  +  ++FF DH E E    DT S  N  E+R
Sbjct: 1296 RIELSDLMRRHFYDNLQDHDTVKQYESVKAVQKDIFFLDHAEPEDEMDDTQSHYNLHESR 1355

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            +   L  Y +  G E  ++TIL+ Y+GQ  +I K + ++S+     + ++V+S+D +QGE
Sbjct: 1356 LVVALCYYFLQQGYEPDKVTILTAYTGQLLKI-KQMMDQSK----FEGVKVTSIDNYQGE 1410

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LS VRS+   R IGFL ISNRVCV+LSRAK G++  GN +    +S LW+ ++ 
Sbjct: 1411 ENDIILLSFVRSNNHGR-IGFLGISNRVCVSLSRAKKGIFCVGNFTLFAEKSELWKGIVK 1469

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
             LE +      + L C  HPE+ T V T  DF   PL GGC+R+C+ ++DCGH+C+  CH
Sbjct: 1470 DLEGTGSIGDSLTLQCTNHPEERTAVKTADDFKKVPL-GGCNRDCDTRLDCGHVCRLKCH 1528

Query: 238  LSS--HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
             +   H    C   C + +                  E    CP        LC D+ + 
Sbjct: 1529 PTDLKHLVYKCKAPCSKVI-----------------CEKNHKCPK-------LCSDLCST 1564

Query: 296  RCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGC 354
             C     K L C H C+ EC +     MC  + + K  GC H+ L  CH     L+  C
Sbjct: 1565 SCSVIVEKLLPCLHVCKRECKTDIRYIMCEEKVD-KTLGCSHVHLLPCHMPTKGLEKEC 1622



>gi|390365793|ref|XP_793245.3| PREDICTED: NFX1-type zinc finger-containing protein 1-like
           [Strongylocentrotus purpuratus]
          Length = 2412

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 178/349 (51%), Gaps = 37/349 (10%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           R E+  L+   ++D L DH+ V  Y  V  +  ++FF DH E E    DT S  N  EAR
Sbjct: 94  RIELSDLMRRNFYDNLRDHDTVKRYGSVKAVQKDIFFLDHAEPEDEMDDTQSHYNLHEAR 153

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           +   L NY +  G E  ++TIL+ Y+GQ  +I + +          + ++V+S+D +QGE
Sbjct: 154 LIVALCNYFLQQGYEPDKVTILTAYTGQLLKIKQMMDRSQ-----FEGVKVTSIDNYQGE 208

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDII+LS VRS+ S+  IGFL ISNRVCV+LSRAK GLY  GN +    +S LW+ ++ 
Sbjct: 209 ENDIILLSFVRSN-SHGQIGFLEISNRVCVSLSRAKIGLYCVGNFTLFAEKSELWKGIVK 267

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
            LE        + L C  HPE+ T V T  DF   PL GGCSR+C+ ++DCGH+C+  CH
Sbjct: 268 DLEAMGSIGDSLTLQCTNHPEEGTAVKTADDFKKVPL-GGCSRDCDTRLDCGHVCRLKCH 326

Query: 238 LSSHDKIF--CPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
            +    +   C   C + +                  E    CP       +LC DV + 
Sbjct: 327 PTDLKHLVHKCKAPCSKVI-----------------CERNHKCP-------MLCSDVCSA 362

Query: 296 RCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
            C     K L C H C+ EC +   +  C  + + K   C H+    CH
Sbjct: 363 SCSVIVEKILPCRHVCKRECKTDILSIKCEEKVD-KTLSCSHVQSLPCH 410



 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 178/349 (51%), Gaps = 19/349 (5%)

Query: 1    RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEI +L+     + +L D + V  + D+ G+T N+FF  H+  E    +  S +N  EA
Sbjct: 1578 RPEISRLMRMDRLYPSLKDDDCVKGFDDIQGVTKNIFFIHHEIEEDYVDEMKSHSNIHEA 1637

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +    L  Y +  G    +ITIL+ YSGQ       +     K    + +RV++VD FQG
Sbjct: 1638 KFLVGLCRYFLQQGYLPEQITILTTYSGQLFAFKGLM-----KKIDFEGVRVATVDNFQG 1692

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGN----ASQLRYRSTLW 175
            EENDII+LSLVRS+E     GFL I NR+CVALSRA+ GLY  GN    A Q      LW
Sbjct: 1693 EENDIILLSLVRSNEEG-STGFLKIDNRICVALSRARKGLYCIGNFKLLAQQNPSGPNLW 1751

Query: 176  REVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQ 233
            RE++   E      + + L C+ H   + +V + ADF    EGGCS  CE ++ CGH+C+
Sbjct: 1752 REIVKDAEIYGTIGKSLVLQCRNHIGTKHEVSSEADFSKVPEGGCSLPCEARLTCGHVCR 1811

Query: 234  SICHLSS--HDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC 289
              CH +   H+   C + C RT+ P GH               +++    PCGH + V C
Sbjct: 1812 MPCHTTDMEHENYKCRQKCTRTICPLGHRCMKQCYQPCDTQCKKSVDKTMPCGHVQKVPC 1871

Query: 290  PDVD-NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
               +    C+  C ++L CGHQC+E C    CT +C          CGH
Sbjct: 1872 YKSNAEVICESPCRRRLDCGHQCKELCGKS-CTMLCEEIIRRSDFPCGH 1919



>gi|451847004|gb|EMD60312.1| hypothetical protein COCSADRAFT_99224 [Bipolaris sorokiniana ND90Pr]
          Length = 1237

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 160/275 (58%), Gaps = 22/275 (8%)

Query: 2    PEIRKLLTPIYHDALSDH---EEVNHYPDVPGLT-DNLFFFDHQESEKLERDT-MSRTNT 56
            PEIR+LL PIY D L DH   E   H P V G+  +N FFF H   E  +RD  MS  N 
Sbjct: 784  PEIRRLLCPIYEDKLKDHPNVENTGHRPPVEGMGGNNSFFFCHAWPE--DRDAYMSSFNA 841

Query: 57   FEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDG 116
            +EA M  +  +YL++ G++ ++ TIL+ Y+GQR++I + +R       V + I+V +VD 
Sbjct: 842  WEADMVVRFLDYLILNGVDATKTTILTFYNGQRRQITQRIRNHP-NLGVYRGIQVVTVDS 900

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            +QGEENDI++LSLVRS++ N  IGFLS  NR CVALSRAK G YIFGNA  L  +S++W 
Sbjct: 901  YQGEENDIVLLSLVRSNKKN-SIGFLSSENRACVALSRAKRGFYIFGNAELLASQSSIWG 959

Query: 177  EVLSILEKSKK----------CDQFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCEEK 225
             V+ I+ K+KK              + L C  H  K        DF L +GGC   C+  
Sbjct: 960  SVVEIMFKNKKPKVKAGQERRVGYHLPLVCSNHGRK-MWCEDPGDFELIKGGCDVKCDGV 1018

Query: 226  MDCGHICQSICHLSSHDKIFCPENCIRTLP-CGHP 259
            + CGH C   CH   HD+I C + C R +  CGHP
Sbjct: 1019 LPCGHRCPYTCHPFEHDRINCTQKCARRVERCGHP 1053



>gi|478255689|gb|ENN75900.1| hypothetical protein YQE_07542, partial [Dendroctonus ponderosae]
          Length = 357

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/325 (36%), Positives = 179/325 (55%), Gaps = 14/325 (4%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           +P I KL+ P  +  L+DHE     P + G+   L+F DHQ+ E+L +D  S+ N  E+ 
Sbjct: 18  KPNICKLIRPHIYPQLTDHESTLSRPPILGVEGCLYFIDHQQPEELCQDE-SQKNVHEST 76

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPV--LKQIRVSSVDGFQ 118
                A YL++ G +  +ITIL+ Y GQ   +++ L E+++ T V  LK +R+S +D +Q
Sbjct: 77  FMIAFARYLILNGYKADQITILATYLGQ---MFEMLHEKNKPTNVDLLKDVRISVLDNYQ 133

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRST---LW 175
           GEE+DI++LSLVRS+  N+ +GFL   NRVCVALSRA++GL+I GN S L   ++   +W
Sbjct: 134 GEESDIVLLSLVRSNTENK-VGFLRTQNRVCVALSRARNGLFIIGNMSLLLSSNSENEIW 192

Query: 176 REVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQ 233
           ++V ++LE+       + L CQ HP K T+V   +DF    EGGC   C  ++ CGH C+
Sbjct: 193 KKVNTVLEEQNAIGSHLLLKCQIHPVKLTKVSKSSDFDKLSEGGCDMICNAELGCGHTCK 252

Query: 234 SICHLSS--HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPD 291
            +CH+    H +  C E C++      P               +  C     +      D
Sbjct: 253 RLCHIQDREHTQYRCTEECLKYAKNHVPKVKSDAAKIQMRNTFVQDCVIKTVTNASTNLD 312

Query: 292 VDNFRCKERCSKKLKCGHQCREECS 316
           V+   C++ C  KL CGH+C   CS
Sbjct: 313 VEEVDCQKPCKLKLPCGHECANSCS 337



>gi|344280070|ref|XP_003411808.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Loxodonta
            africana]
          Length = 1917

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 131/358 (36%), Positives = 188/358 (52%), Gaps = 26/358 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  R+  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYEEINGVSSNLFFVEHNFPEQEIREGRSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYSPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGPALRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLSCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTLPCGHPXX---XXXXXXXXXXVETIIMCPPCGHSEVVLC--PD 291
              SSH +  C + C + + CG                 V+       CGH ++V C  P+
Sbjct: 1309 YDSSHKEFQCMKPCQKII-CGDGHRCPLVCFQQCQPCEVKVPKTISRCGHEQMVPCSVPE 1367

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSP---WCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
             D F C+E C K L CGH+C   C      WC+ M  T+ +     CGH     C  +
Sbjct: 1368 SD-FCCQEPCPKFLTCGHRCSHPCGEKCVQWCSEMVTTELK-----CGHSQQVECAQV 1419



>gi|321475866|gb|EFX86828.1| hypothetical protein DAPPUDRAFT_236160 [Daphnia pulex]
          Length = 2002

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 190/365 (52%), Gaps = 20/365 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE+ +L+ P  ++ L +H  V  +P VPG+  ++FF+ H   E  + D  S  N  E  
Sbjct: 768  RPEVVRLIVPAIYEELENHSTVYDHPHVPGMQHDVFFYHHNYPE--QEDGSSFYNRHEVD 825

Query: 61   MCAKLANYLVM-GGMEESRITILSMYSGQRKEIYKYLREESRKT-PVLKQIRVSSVDGFQ 118
            M  +LA YL+    +   +ITIL+ Y+ Q   ++++L   SRK+  +L  +R++ VD FQ
Sbjct: 826  MSLRLAIYLIREQKISPQKITILATYTAQ---LHQFL--NSRKSYELLADVRITVVDNFQ 880

Query: 119  GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
            GEEND+IILSLVR++  N  +GFL  +NRVCVALSRA++GLYI GN   L   S +W ++
Sbjct: 881  GEENDVIILSLVRNNSRN-SVGFLRTANRVCVALSRARNGLYILGNIRMLATASPVWADM 939

Query: 179  LSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHL 238
              +L++  +  + I L C +H +   +V   +DFP+   C   C  ++ CGH+C+ ICH 
Sbjct: 940  EKVLKEHDQIGEEIPLRCDRHNDIVRKVKRSSDFPIGSFCRELCGAELQCGHLCKFICHP 999

Query: 239  SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXV---ETIIMCPPCGHSEVVLCPDVDNF 295
                   CPE   + L CGH                   I+   PC H   + C  +   
Sbjct: 1000 DELHTSSCPEIITKLLACGHSYSGPCSRNSENVSCPEFVIVTKEPCMHVFKIPCSKLQKG 1059

Query: 296  R---CKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC---HDIRNK 349
                C     KKL CGH  +  CS+P   ++C TQ E +   C H+    C    D R K
Sbjct: 1060 EFPGCPFPEMKKLPCGHIQQLPCSTPLDASLCDTQVEFEM-SCLHLKTIRCGLPADDRQK 1118

Query: 350  LQDGC 354
            L D C
Sbjct: 1119 LADYC 1123



>gi|443703428|gb|ELU00979.1| hypothetical protein CAPTEDRAFT_62018, partial [Capitella teleta]
          Length = 1121

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 139/369 (37%), Positives = 190/369 (51%), Gaps = 25/369 (6%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+TP  +  L +H  V    ++ G++ N+ F DH + E    DTMS++N  EA 
Sbjct: 553 RPEISQLITPHIYKTLYNHPSVLGRDNILGISGNVLFVDHCKVESTVADTMSKSNEHEAM 612

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  YL+    + S+IT+L+MY GQ   I K +        V    RV+ VD FQGE
Sbjct: 613 FIVRLVCYLLNQDYQASQITVLTMYLGQMFLIKKKMASFKEDDIV----RVTPVDNFQGE 668

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDIIILS VRS+  ++ IGFL++SNRVCVALSRA+ G +  GN S LR  S LW ++  
Sbjct: 669 ENDIIILSCVRSNADDK-IGFLNVSNRVCVALSRARKGFFCIGNISLLRKASPLWSKICC 727

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
            L+K +K    I   CQ HP  +       DF   PL GGC+  C  +++CGH C+  CH
Sbjct: 728 DLDKDEKIVDGIPCICQNHPGTKFVARLPVDFDEAPL-GGCTLPCAFRLECGHACRLQCH 786

Query: 238 L--SSHDKIFCPENCIRTLPCGHP---XXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PD 291
                H +  C + C +  P GHP               V  II  P CGH ++V C  D
Sbjct: 787 PFDKDHVRYACMKPCTKFCPEGHPCIDQCYKVCSPCQTLVAKII--PECGHEQMVPCHQD 844

Query: 292 VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLT--QTEVK-YPGCGHIDLCLCHDIRN 348
            + F C+  C+++  CGH C   C        CL   Q  VK    CGH    LC +  +
Sbjct: 845 PEKFTCQILCNREKPCGHTCVRPCGDE-----CLPCHQPVVKTLSKCGHKQRVLCFEEID 899

Query: 349 KLQDGCPFC 357
            ++   P C
Sbjct: 900 DIECTSPKC 908



>gi|390346985|ref|XP_003726678.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Strongylocentrotus purpuratus]
          Length = 2004

 Score =  197 bits (502), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 181/359 (50%), Gaps = 37/359 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E+  L+   ++D L DH+ V  Y  V  +  ++FF DH E E    DT S  N  EA 
Sbjct: 1006 RIELSGLMRRHFYDNLHDHDTVKQYGSVKAVQKDIFFLDHAEPEDEMEDTQSHYNLHEAG 1065

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            +   L  Y +  G E  +ITIL+ Y+GQ  +I K + + S+     + ++V+S+D +QGE
Sbjct: 1066 LVVALCYYFMQQGYEPDKITILTAYTGQLLKI-KRMMDRSK----FEGVKVTSIDNYQGE 1120

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LS VRS+   R IGFL ISNRVCV+LSRAK GLY  GN +    +S LW+ ++ 
Sbjct: 1121 ENDIILLSFVRSNNHGR-IGFLGISNRVCVSLSRAKKGLYCVGNFTLFAEKSELWKGIVR 1179

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
             LE +      + L C  HPE  T V T  DF   PL GGCSR+C+ ++DCGH+C+  CH
Sbjct: 1180 DLEGTGSIRDSLTLQCTNHPEMRTAVKTADDFKKVPL-GGCSRDCDTRLDCGHVCRLKCH 1238

Query: 238  LS--SHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
             +   H    C   C + +                  E    CP        LC D+ + 
Sbjct: 1239 PTDLKHLVYKCKAPCSKVI-----------------CERNHKCPK-------LCSDLCST 1274

Query: 296  RCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGC 354
             C     K L C H C+ EC +   +  C  + + K   C H+ L  CH     L+  C
Sbjct: 1275 SCSVIVEKILPCRHVCKTECKTDIWSITCEEKVD-KTLSCSHVHLLPCHMPTEGLEKKC 1332



>gi|504147060|ref|XP_004585946.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Ochotona
            princeps]
          Length = 1910

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 191/363 (52%), Gaps = 19/363 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1069 RPEIARLLTPHIYQDLENHPSVLTYEKIKGVSSNLFFIEHTFPEQEIQEGKSHQNQHEAH 1128

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +      +     ++V  VD +QGE
Sbjct: 1129 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLM-----PSKTFAGVKVHVVDKYQGE 1183

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I+NR+CVALSRAK G+Y  GN  Q+  R  LW  ++ 
Sbjct: 1184 ENDIILLSLVRSNQEGK-VGFLQIANRICVALSRAKKGMYCIGNM-QMLARVPLWSRIIH 1241

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1242 TLRENNQIGSTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1301

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC--PDV 292
              SSH +  C + C + +   GH              V+   +   CGH ++V C  P+ 
Sbjct: 1302 YDSSHKEFQCMKPCQKVICQDGHQCPLVCFKECQPCQVKVPKIISRCGHEQMVPCSVPES 1361

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQD 352
            D F C+E C K L+CGH+C   C    C  +C     VK   CGH     C ++ + L+ 
Sbjct: 1362 D-FCCQEPCPKFLRCGHRCSHPCGED-CAQLCSEMVTVKL-KCGHSQQVKCGNVED-LKY 1417

Query: 353  GCP 355
            G P
Sbjct: 1418 GLP 1420



>gi|443728243|gb|ELU14669.1| hypothetical protein CAPTEDRAFT_71969, partial [Capitella teleta]
          Length = 1122

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 132/367 (35%), Positives = 186/367 (50%), Gaps = 47/367 (12%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI +L+TP  +  L +H  V    ++ G++ N+ F DH E E    DT S++N  EA 
Sbjct: 551 RPEISQLITPHIYKTLYNHPSVLGRDNILGISGNVLFVDHHEVESKVADTTSKSNEHEAM 610

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  YL+    + S+IT+L+MY GQ   + K +    R+  +   +RV+ VD FQGE
Sbjct: 611 FIVRLVRYLLCQEYQASQITVLTMYQGQTSLVKKKM-ANFREDEI---VRVTPVDNFQGE 666

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           ENDII+LS VRS+  N  IGFL +SNRVCVALSRA+ G Y  GN   LR  S LW ++  
Sbjct: 667 ENDIILLSCVRSNADN-NIGFLKVSNRVCVALSRARKGFYCVGNIGLLRKVSPLWSKICC 725

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLE------GGCSRNCEEKMDCGHICQS 234
            L+K K+    I   CQ HP+ +      A FP++      GGC+  C  ++ CGH+C+ 
Sbjct: 726 DLDKDKRVVDGIPCLCQNHPDTK----FIARFPVDFDKAPFGGCTIPCSFRLQCGHVCRL 781

Query: 235 ICHL--SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPP-----------C 281
            CH     H K  C E+C +    GH              +  ++CPP           C
Sbjct: 782 ECHPFDKDHVKYDCLESCTKFCLQGH----------MCTAQCYMVCPPCQRLMAKVIPKC 831

Query: 282 GHSEVVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEV---KYPGCGH 337
           GH ++V C  D + F C+  C ++  CGH C + C        CL   E+       CGH
Sbjct: 832 GHKQMVACHLDPEKFICQITCYREKPCGHICTKACGEE-----CLPCHELVVKTLSKCGH 886

Query: 338 IDLCLCH 344
             +  CH
Sbjct: 887 DQMVPCH 893



>gi|315048871|ref|XP_003173810.1| helicase [Arthroderma gypseum CBS 118893]
 gi|311341777|gb|EFR00980.1| helicase [Arthroderma gypseum CBS 118893]
          Length = 1102

 Score =  197 bits (500), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 119/267 (44%), Positives = 157/267 (58%), Gaps = 14/267 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIY+D L DH+ V    DVPG+   N +FF H   E  +    S+ N  EAR
Sbjct: 720 PEIRRILLPIYND-LEDHQSVLARGDVPGMGGINSYFFTHDWPESPD-SLSSKYNQKEAR 777

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL M G+    ITIL+ Y+GQRK I K L+E        +  +V +VD +QGE
Sbjct: 778 MIVGFYVYLHMNGVPLGNITILTFYNGQRKHILKSLKENQLFQG--QYTKVVTVDSYQGE 835

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+I+ILSLVRS+ES+R IGFL+  NRVCVALSRAK G YIFGNA  L   + LW +VL 
Sbjct: 836 ENEIVILSLVRSNESDR-IGFLANENRVCVALSRAKRGFYIFGNAESLAIANGLWWQVLQ 894

Query: 181 ILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHLS 239
           I+ K+ K+   F+ L C+KH  K       A    +GGC++ C E++ CGH C  +CH  
Sbjct: 895 IMRKAPKRLGYFLPLMCKKHGTKTLISNPDAWSSNDGGCAQRCGEELQCGHKCPLLCHAI 954

Query: 240 SHDKIFCPENC-------IRTLPCGHP 259
            H K+ C  +C       + +LP   P
Sbjct: 955 PHSKLQCQLSCDPASRQVLTSLPKNRP 981



>gi|334312683|ref|XP_003339769.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Monodelphis
            domestica]
          Length = 1907

 Score =  197 bits (500), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 134/373 (35%), Positives = 192/373 (51%), Gaps = 39/373 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1067 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFIEHDFPEQEIQEGKSHQNQHEAR 1126

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1127 FLVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1181

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN   L  +  LW ++L 
Sbjct: 1182 ENDIILLSLVRSNKEEK-VGFLKIKNRICVALSRAKKGMYCIGNMGML-AKVPLWSKILH 1239

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+ +T V    DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1240 TLRENGQIGNALMLCCQNHPDTQTLVSKATDFHQVPEGGCSLPCEFRLSCGHVCTRACHP 1299

Query: 239  --SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
              + H +  C + C + L             PCG               +TI+    CGH
Sbjct: 1300 YDAKHTEFQCMKPCQKILCADGHRCPSVCFQPCG--------PCQVKVPKTILR---CGH 1348

Query: 284  SEVVLCPDVDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
             ++V C   ++ F C+E C K LKCGH+C   C   +C  +C     V    CGH     
Sbjct: 1349 QQMVPCSMPESEFCCQEPCPKFLKCGHRCSHSCGE-YCVRLCSEMVTVSL-KCGHDQQVK 1406

Query: 343  CHDIRNKLQDGCP 355
            C ++ + LQ G P
Sbjct: 1407 CGNVED-LQYGLP 1418



>gi|507628052|ref|XP_004698372.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Echinops
            telfairi]
          Length = 1865

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 130/367 (35%), Positives = 193/367 (52%), Gaps = 27/367 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G++ N+FF +H   E+  ++  S  N  EA 
Sbjct: 1024 RPEIARLLTPHIYQDLENHPSVLKYEEIKGVSSNIFFIEHNFPEQKIQEGKSHQNQHEAH 1083

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1084 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1138

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1139 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1196

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP   T V   +DF    EGGC+  CE ++ CGH+C   CH 
Sbjct: 1197 TLRENHQIGPELRLCCQNHPNTHTMVSKASDFQKVPEGGCNLPCEFRLSCGHVCTRACHP 1256

Query: 239  --SSHDKIFCPENCIRTLPCGHPXX---XXXXXXXXXXVETIIMCPPCGHSEVVLC--PD 291
              +SH +  C + C + + CG                 V+     P CGH ++V C  P+
Sbjct: 1257 YDASHKEFQCMKPCQKVI-CGDGHRCPLVCFQPCRPCEVKVPKTIPQCGHEQMVPCSVPE 1315

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSP---WCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
             D F C+E C K L CGH+C   C      WC+ M  T+ +     CGH     C  + +
Sbjct: 1316 SD-FCCQEPCPKFLACGHRCSHPCGEKCVQWCSEMVTTELK-----CGHRQQVECGQV-D 1368

Query: 349  KLQDGCP 355
             ++ G P
Sbjct: 1369 DIKFGLP 1375



>gi|329664412|ref|NP_001192645.1| NFX1-type zinc finger-containing protein 1 [Bos taurus]
 gi|296480971|tpg|DAA23086.1| TPA: regulator of nonsense transcripts 1-like [Bos taurus]
          Length = 1918

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 193/366 (52%), Gaps = 25/366 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1078 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHTFPEQEIQEGRSHQNQHEAR 1137

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1138 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1192

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1193 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1250

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1251 TLRENDQIGCALRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1310

Query: 239  --SSHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-- 289
              SSH +  C + C + +      C                +TI+    CGH ++V C  
Sbjct: 1311 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTILR---CGHKQMVPCSV 1367

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNK 349
            P+ D F C+E C K LKCGH C   C    C  +C     VK   CGH     C ++ + 
Sbjct: 1368 PESD-FCCQEPCPKVLKCGHTCSHPCGED-CVWLCSEMVTVKL-KCGHRQQMKCGNVED- 1423

Query: 350  LQDGCP 355
            L+ G P
Sbjct: 1424 LKHGLP 1429



>gi|440902878|gb|ELR53613.1| NFX1-type zinc finger-containing protein 1 [Bos grunniens mutus]
          Length = 1918

 Score =  196 bits (499), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 193/366 (52%), Gaps = 25/366 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1078 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHTFPEQEIQEGRSHQNQHEAR 1137

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1138 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1192

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1193 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1250

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1251 TLRENDQIGCALRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1310

Query: 239  --SSHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-- 289
              SSH +  C + C + +      C                +TI+    CGH ++V C  
Sbjct: 1311 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTILR---CGHKQMVPCSV 1367

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNK 349
            P+ D F C+E C K LKCGH C   C    C  +C     VK   CGH     C ++ + 
Sbjct: 1368 PESD-FCCQEPCPKVLKCGHTCSHPCGED-CVWLCSEMVTVKL-KCGHRQQMKCGNVED- 1423

Query: 350  LQDGCP 355
            L+ G P
Sbjct: 1424 LKHGLP 1429



>gi|432110217|gb|ELK33990.1| NFX1-type zinc finger-containing protein 1 [Myotis davidii]
          Length = 1920

 Score =  196 bits (499), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 192/364 (52%), Gaps = 21/364 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G+  NLFF +H   E+  ++  S  N  EA 
Sbjct: 1079 RPEIARLLTPHIYQELENHPSVLKYEKIKGVASNLFFIEHNFPEQEIQEGKSHQNQHEAH 1138

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1139 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1193

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1194 ENDIIILSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMMAKVPLWSKIIH 1251

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1252 TLRENNEIGQALQLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1311

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              S H +  C + C + +   GH  P             V  II+   CGH ++V C   
Sbjct: 1312 YDSLHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKIIL--RCGHEQMVPCSMP 1369

Query: 293  DN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
            ++ F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++ + L+
Sbjct: 1370 ESEFCCQEPCPKVLKCGHRCSHPCGE-LCVQLCSEMVTVKL-KCGHNQQVKCGNVED-LK 1426

Query: 352  DGCP 355
             G P
Sbjct: 1427 YGLP 1430



>gi|512873806|ref|XP_002935580.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Xenopus
            (Silurana) tropicalis]
          Length = 1891

 Score =  196 bits (499), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 193/366 (52%), Gaps = 18/366 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V +Y  + G++ NLFF +H   E+  +D  S  N  EA+
Sbjct: 1043 RPEIARLLTPHIYKELDNHPSVLNYESIKGVSTNLFFVEHNFLEQEIKDGKSHQNMHEAK 1102

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +    + S+ITIL+ Y+GQ   + K +  +         ++V  VD +QGE
Sbjct: 1103 FIVELCKYFLCQEYKPSQITILTTYTGQLFCLRKLMPAKK-----FSGVKVHVVDKYQGE 1157

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R +GFL ISNR+CVALSRAK GL+  GN   L  +  LW  +  
Sbjct: 1158 ENDIILLSLVRSNKEGR-VGFLQISNRICVALSRAKKGLFCIGNMGMLG-KVNLWSCINL 1215

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +  +    + L CQ HP+  T V T  DF    EGGC++ CE ++DCGH+C  +CH 
Sbjct: 1216 TLRQRNQIGDCLMLCCQNHPDVRTPVRTADDFKKVPEGGCTKKCEFRLDCGHVCTRVCHP 1275

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXXXXXXXXXXXXVETIIM-CPPCGHSEVVLCP-DVD 293
                H +  C + C + L   GH             +E +    P CGH ++V C   V 
Sbjct: 1276 YDPEHKEYQCNKPCQKILCEEGHRCKKTCFKPCGPCMELVPKNMPLCGHVQMVPCSIPVR 1335

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDG 353
             F C+  C+K L CGHQC + C    C   C+   E +   CGHI    C   R+ ++ G
Sbjct: 1336 TFCCEIPCTKFLSCGHQCGKLCGEE-CEDHCIQDVEAELK-CGHIQKIKCWKKRD-IEFG 1392

Query: 354  CPF-CR 358
             P  CR
Sbjct: 1393 MPVQCR 1398



>gi|471359481|ref|XP_004370316.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Trichechus
            manatus latirostris]
          Length = 1926

 Score =  196 bits (499), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 131/367 (35%), Positives = 192/367 (52%), Gaps = 27/367 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP I +LLTP  +  L +H  V  Y ++ G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1085 RPAIARLLTPHIYQDLENHPSVLKYEEINGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1144

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1145 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1199

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1200 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1257

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1258 TLRENNQIGPALRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLSCGHVCTRACHP 1317

Query: 239  --SSHDKIFCPENCIRTLPCGHPX---XXXXXXXXXXXVETIIMCPPCGHSEVVLC--PD 291
              SSH +  C + C + + CG                 V+     P CGH ++V C  P+
Sbjct: 1318 YDSSHKEFQCMKPCQKII-CGDGHRCPLVCFQQCRPCEVKVPKTIPQCGHEQMVPCSVPE 1376

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSP---WCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
             D F C+E C K L CGH+C   C      WC+ M   + +     CGH     C  + +
Sbjct: 1377 SD-FCCQEPCPKFLPCGHRCSHPCGEKCVQWCSEMVTAELK-----CGHSQQVECGQV-D 1429

Query: 349  KLQDGCP 355
             ++ G P
Sbjct: 1430 AIKYGLP 1436



>gi|403282333|ref|XP_003932606.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Saimiri
            boliviensis boliviensis]
          Length = 1919

 Score =  196 bits (499), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 188/355 (52%), Gaps = 16/355 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGPMLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDN 294
              SSH +  C + C + +   GH              V+     P CGH ++V C   ++
Sbjct: 1309 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPES 1368

Query: 295  -FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
             F C+E C K L+CGH+C   C    C  +C     VK   CGH     C  +++
Sbjct: 1369 EFCCQEPCPKFLRCGHRCNHPCGED-CMQLCSEMVTVKL-KCGHSQQVKCGYVKD 1421



>gi|391337700|ref|XP_003743203.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Metaseiulus occidentalis]
          Length = 1806

 Score =  196 bits (498), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 189/363 (52%), Gaps = 18/363 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE  +LL P  +  L     V  YP V G++ +L    H   E  + +  S+TN FE  
Sbjct: 978  RPEFVRLLVPHIYQRLDCGPSVYAYPSVKGMSADLQLMSHSHFESNDGENRSKTNVFECD 1037

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            M   L  YL + G    +IT+L+MYSGQ+  I   +R+      +   +RV+SVD +QGE
Sbjct: 1038 MIVGLVRYLFVHGYTPDQITVLAMYSGQQFLIKHRMRQ------LNFSLRVTSVDNYQGE 1091

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI+ILS VRS+E  + IGFL   NR+CVA SRA+ GL+  GN   +  R  +++ +L 
Sbjct: 1092 ENDIVILSFVRSNEEGQ-IGFLRTMNRLCVAFSRARLGLFCVGNFQMIAQRQPIFKNMLE 1150

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             +  S + D F    C+ H + ET+V+  +DF    EGGC   C +++DCGH+C  +CH 
Sbjct: 1151 SVADSVR-DHF-RFQCKAH-KTETKVYKPSDFVQVAEGGCYMPCADRLDCGHMCPKLCHE 1207

Query: 239  SSHD--KIFCPENCIRTLP-CGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
             S++  +  C   C++  P CGHP             E I     CGH+   LC   +  
Sbjct: 1208 YSNEQTRFKCIRPCLKKYPECGHPCKKQCGEDCDICGEKIHSVLDCGHTVERLCGKREKP 1267

Query: 296  RCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGCP 355
             C+++C K L CGH C  +C+   C  +C  + EV    CGH     CH IR+  +    
Sbjct: 1268 TCEKKCEKLLPCGHPCDMKCTQ-ICQKLCKAEVEV-VSICGHRVKVACH-IRSDARGVAS 1324

Query: 356  FCR 358
             CR
Sbjct: 1325 LCR 1327



>gi|449274100|gb|EMC83383.1| NFX1-type zinc finger-containing protein 1, partial [Columba livia]
          Length = 1774

 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 189/373 (50%), Gaps = 47/373 (12%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL+P  +  L +H  V  Y +V G+  NLFF +H+  E+  ++  S  N  EA+
Sbjct: 990  RPEIAQLLSPHIYQELENHPSVLTYENVKGVLSNLFFVEHEFPEQEIQEGKSHQNPHEAQ 1049

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1050 FVVELCKYFLCQDYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1104

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  +  GFL I NR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1105 ENDIILLSLVRSNKEEKS-GFLQIPNRICVALSRAKKGLYCIGNMRMLG-KVPLWSKIIH 1162

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L +       + L CQ HPE +T V T ADF    EGGCSR CE ++ CGH+C   CH 
Sbjct: 1163 TLREKGHIGPSLMLSCQNHPETKTLVSTAADFSKVPEGGCSRPCECRLSCGHVCTRACHP 1222

Query: 239  --SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
              + H +  C + C + L             PCG              VE  I    CGH
Sbjct: 1223 YDTQHKEYQCLKPCQKVLCADGHRCLRLCYEPCG---------PCMVRVEKTI--SKCGH 1271

Query: 284  SEVVLCPDVDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
             ++V C   D+ F C+E C KKL CGH C     + WC  +     +     CGH     
Sbjct: 1272 LQMVPCSTPDSEFLCQEPCQKKLNCGHTC-----TTWCPELVPVTLK-----CGHKQKVK 1321

Query: 343  CHDIRNKLQDGCP 355
            C  I  +++ G P
Sbjct: 1322 CW-ITEEMKRGKP 1333



>gi|149733339|ref|XP_001503613.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Equus
            caballus]
          Length = 1917

 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 190/358 (53%), Gaps = 22/358 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1076 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1135

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1136 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1190

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL  SNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1191 ENDIILLSLVRSNQEGK-VGFLQTSNRICVALSRAKKGMYCIGNL-QMLAKVPLWSKIMH 1248

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1249 TLRENNQIGHTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1308

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              SSH +  C + C + +   GH  P             V  II+   CGH ++V C  P
Sbjct: 1309 YDSSHKEFQCVKPCQKVICQDGHRCPLVCFQECQPCQVKVPKIIL--RCGHKQMVPCSMP 1366

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
            + D F C+E C K LKCGH+C   C    C  +C      K   CGH     C ++ +
Sbjct: 1367 ESD-FCCQEPCPKVLKCGHRCSHPCGED-CVRVCSEMVTAKL-KCGHSQQVKCGNVED 1421



>gi|507962012|ref|XP_004687522.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Condylura
            cristata]
          Length = 1912

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 189/364 (51%), Gaps = 21/364 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LL P  +  L +H  V  Y  + G+  NLFF +H   E+  ++  S  N  EA 
Sbjct: 1071 RPEIARLLVPHIYQGLENHPSVLKYETIKGVASNLFFVEHNLPEQEIQEGKSHQNQHEAH 1130

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  E+        +RV  VD +QGE
Sbjct: 1131 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPSET-----FAGVRVHVVDKYQGE 1185

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS++  + +GFL I+NR+CVALSRAK G+Y  GN  Q+  +  LW +V+ 
Sbjct: 1186 ENDIIILSLVRSNQEGK-VGFLQIANRICVALSRAKKGMYCIGNM-QMLAKVPLWSKVIH 1243

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HPE  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1244 TLRENNQIGHALQLCCQNHPETHTLVSRASDFQKVPEGGCSLPCEFRLSCGHVCTRACHP 1303

Query: 239  --SSHDKIFCPENCIRTL-PCGH---PXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              S H +  C + C + +   GH                V  II+   CGH ++V C   
Sbjct: 1304 YDSLHQEFQCMKPCQKVICQDGHRCPALCFQECEPCQVKVPKIIL--RCGHEQMVPCSVP 1361

Query: 293  DN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQ 351
            ++ F C+E C K LKCGH+C   C    C  +C      K   CGH     C ++ + ++
Sbjct: 1362 ESQFCCQEPCPKVLKCGHKCSHLCGED-CVRVCSVMVTKKL-KCGHSQQVKCGNVED-IK 1418

Query: 352  DGCP 355
             G P
Sbjct: 1419 HGLP 1422



>gi|390367565|ref|XP_798620.3| PREDICTED: NFX1-type zinc finger-containing protein 1-like, partial
            [Strongylocentrotus purpuratus]
          Length = 1921

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/357 (35%), Positives = 180/357 (50%), Gaps = 36/357 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E+  L+   ++D L DHE V  Y  +  +  ++FF DH E E    DT S  N  EAR
Sbjct: 1200 RIELSDLMRRNFYDNLRDHETVKRYESLKAVQKDIFFLDHAEPEDEMEDTQSHYNLHEAR 1259

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            +   L  Y +  G +  +ITIL+ Y+GQ  +I + +          + ++V+S+D +QGE
Sbjct: 1260 LVVALCYYFLQQGYKSDKITILTAYTGQLLKIMQIMDHSK-----FEGVKVTSIDNYQGE 1314

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LS VRS+   R IGFL ISNRVCV+LSRAK GLY  GN +    +S LW+ +++
Sbjct: 1315 ENDIILLSFVRSNNHGR-IGFLGISNRVCVSLSRAKKGLYCVGNFTLFAEKSELWKGIVT 1373

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
             LE        + L C  HPE+ T V T  DF   PL GGCSR+C+ ++DCGH+C+  CH
Sbjct: 1374 DLESMGSIGYSLRLQCTNHPEEMTAVKTVDDFKKVPL-GGCSRDCDTRLDCGHVCRLKCH 1432

Query: 238  LSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNFRC 297
             +     +    C    PC                 + ++C    H    LC +     C
Sbjct: 1433 PT-----YIIHKC--KAPC-----------------SKVICER-NHKCPKLCSETCLTSC 1467

Query: 298  KERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGC 354
                 + L C H C+ EC +   +  C  + E K  GC H+ L  CH     L+  C
Sbjct: 1468 SVIVERILPCRHVCKRECKADIRSIECEEKVE-KTLGCSHVHLLPCHMPTKGLEKKC 1523



>gi|350597087|ref|XP_003362090.2| PREDICTED: NFX1-type zinc finger-containing protein 1 [Sus scrofa]
          Length = 1846

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 134/356 (37%), Positives = 185/356 (51%), Gaps = 22/356 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1007 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAR 1066

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        +RV  VD +QGE
Sbjct: 1067 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVRVHVVDKYQGE 1121

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1122 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCVGNM-QMLAKVPLWSRIIH 1179

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1180 TLRENNQIGSALRLCCQNHPDTHTLVSKASDFQTVPEGGCSLPCEFRLGCGHVCTRACHP 1239

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              S H +  C + C + +   GH  P             V  II+   CGH ++V C  P
Sbjct: 1240 YDSLHKEFQCMKPCQKVVCQDGHRCPLVCFQECQPCQVKVPKIIL--RCGHEQMVPCSMP 1297

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
            + D F C+E C K LKCGHQC   C    C   C     V    CGH     C  +
Sbjct: 1298 ESD-FCCQEPCPKVLKCGHQCSNPCGED-CVRFCSEMVTVNL-KCGHRQQVKCSSV 1350



>gi|431894477|gb|ELK04277.1| NFX1-type zinc finger-containing protein 1 [Pteropus alecto]
          Length = 1934

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 191/358 (53%), Gaps = 22/358 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  +++ S  N  EAR
Sbjct: 1077 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFIEHNFPEQEIQESKSHQNQHEAR 1136

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K++  ++        ++V  VD +QGE
Sbjct: 1137 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKFMPAKT-----FAGVKVHVVDKYQGE 1191

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1192 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1249

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1250 TLRENNQIGQTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLSCGHVCTRACHP 1309

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--P 290
              S H +  C + C + +   GH  P             V  II+   C H + V C  P
Sbjct: 1310 YDSLHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKIIL--RCRHEQKVPCSMP 1367

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRN 348
            + D F C+E C K LKCGH+C   C    C  +C     VK   CGH     C ++ +
Sbjct: 1368 ESD-FCCQEPCPKILKCGHRCSHLCGED-CVRLCSEMVTVKL-KCGHNQQVKCGNVED 1422



>gi|390365791|ref|XP_784110.3| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Strongylocentrotus purpuratus]
          Length = 2617

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 155/266 (58%), Gaps = 14/266 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E+  L+   ++D L DH+ V  Y +V  +  ++FF DH E E    DT S  N  EAR
Sbjct: 1541 RIELSDLMRRNFYDNLQDHDTVKRYGNVKAVQKDIFFLDHAEPEDEMDDTQSHYNLHEAR 1600

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            +   L  Y +  G E  ++TIL+ Y+GQ  +I K + + SR     + ++V+S+D +QGE
Sbjct: 1601 LVVALCYYFLQQGYEPDKVTILTAYTGQLLKI-KQMMDRSR----FEGVKVTSIDNYQGE 1655

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LS VRS+ S+  IGFL ISNRVCV+LSRAK GLY  GN +    +S LW+ ++ 
Sbjct: 1656 ENDIILLSFVRSN-SHGQIGFLGISNRVCVSLSRAKIGLYCVGNFTLFAEKSDLWKGIVK 1714

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICH 237
             LE        + L C  H E+ T V T  DF   PL GGCSR+C+ +MDCGH+C+  CH
Sbjct: 1715 DLEAMGSIGDSLTLQCTNHSEEGTAVKTADDFKKVPL-GGCSRDCDTRMDCGHVCRIKCH 1773

Query: 238  LSSHDKIF----CPENCIRTLPCGHP 259
             +    +     C E C +   CGHP
Sbjct: 1774 PTDLKHLVYKPPCNEPCSKKRKCGHP 1799



 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 153/291 (52%), Gaps = 18/291 (6%)

Query: 64   KLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEEND 123
            + A Y +  G   ++ITIL+ YSGQ   +Y + R    K    + +RV++VD FQGEEND
Sbjct: 1831 QTARYFLQQGYHPAQITILTTYSGQ---LYAFKR--LMKKSDFEGVRVATVDNFQGEEND 1885

Query: 124  IIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGN----ASQLRYRSTLWREVL 179
            II+LSLVRS++    +GFL I NR+CVALSRA+ GLY  GN    A Q     +LWRE++
Sbjct: 1886 IILLSLVRSNKQG-SVGFLKIDNRICVALSRARMGLYCIGNFKLLAQQNPTGPSLWREIV 1944

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICH 237
               E      + + L C+ H   + +V + ADF    EGGCS  CE ++ CGH+C+  CH
Sbjct: 1945 KDAEIYGTIGKSLKLQCRNHTGTQNEVSSEADFSKVPEGGCSVPCEARLTCGHVCRMPCH 2004

Query: 238  LSS--HDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDV 292
             +   H+   C   C +T+ P GH               +++    PCGH + V C    
Sbjct: 2005 PTDMKHEYYKCRRKCTQTICPLGHGCMKQCYQPCDTQCKKSVDKTLPCGHVQKVPCYKSS 2064

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
                C+ +C ++L CGHQC+E C    CT +C          CGH  L  C
Sbjct: 2065 SEVICESQCRRRLDCGHQCKELCGKG-CTVVCQEMIRHSDWPCGHNVLAKC 2114



>gi|328716878|ref|XP_001950343.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Acyrthosiphon pisum]
          Length = 1999

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 177/346 (51%), Gaps = 18/346 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+TP  +D L +H  V++   + G+T ++FF +H   E    +T S++N  EAR
Sbjct: 994  RPEIASLITPSIYDELKNHISVHNREHIRGVTKDVFFLNHNLYENEVEETTSKSNDHEAR 1053

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                LA +L++ G +  ++TIL+ YS Q  +     R   +K  +L+ ++++ VD +QGE
Sbjct: 1054 FLIMLARHLILQGYKTDQVTILTTYSAQLLQ----FRSLRKKHSILEGMKITVVDNYQGE 1109

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E    +GFL   NR+CVALSRAK+GLYI GN   L    +LW+++  
Sbjct: 1110 ESDIILLSLVRSNEKG-NVGFLKTENRICVALSRAKYGLYIMGNMDNLYNSGSLWKQIKE 1168

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L         + L C  H    T V    DF   +EGGCS  C+  + CGH C SICH 
Sbjct: 1169 TLVNQGSYGDELTLECAVHSGIMTNVVKSEDFNTIMEGGCSMLCKSLLLCGHYCSSICHS 1228

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVDNF 295
                H +  C E C +     HP               +I   PCGH   + C  DV  F
Sbjct: 1229 YDREHLEFKCTEPCDKFCDYNHPCEKTCFMDCGKCTFPLIKELPCGHQLTLPCFVDVLTF 1288

Query: 296  RCKERCSKKL-KCGHQCREEC--SSPWCTAMCLTQTEVKYPGCGHI 338
             C+E     L +CGH   ++C    P C+  C  +       C H+
Sbjct: 1289 LCEEMVESVLEECGHTILKKCHDEQPTCSYKCFYRL-----NCSHV 1329



>gi|354480651|ref|XP_003502518.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Cricetulus
            griseus]
          Length = 1916

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 192/366 (52%), Gaps = 23/366 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1075 RPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNLFFVEHNFPEQDIQEGKSHQNQHEAH 1134

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        I+V  VD +QGE
Sbjct: 1135 FVVELCQYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGIKVHVVDKYQGE 1189

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+   + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1190 ENDIILLSLVRSNPEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1247

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1248 TLRENNQIGPSLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLACGHVCTRACHP 1307

Query: 239  --SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              SSH +  C + C + + P GH  P             V  II+   CGH ++V C   
Sbjct: 1308 YDSSHKEFQCMKPCQKVICPDGHRCPLVCFQECQSCQVKVPKIIL--RCGHKQMVPCSVP 1365

Query: 293  DN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC---HDIRN 348
            ++ F C+E C K L+CGH+C   C    C  +C  +  VK   CGH     C    D++ 
Sbjct: 1366 ESEFCCQEPCPKVLRCGHKCSHLCGED-CVQLCSEKVTVKL-KCGHSQQVKCGNAEDVKY 1423

Query: 349  KLQDGC 354
             L   C
Sbjct: 1424 GLSVKC 1429



>gi|444731360|gb|ELW71715.1| NFX1-type zinc finger-containing protein 1 [Tupaia chinensis]
          Length = 1973

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 134/368 (36%), Positives = 188/368 (51%), Gaps = 27/368 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1132 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAH 1191

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1192 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1246

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1247 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1304

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +  Q + L CQ HP+  T V   ADF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1305 TLRENDQIGQTLRLCCQNHPDTHTLVSKAADFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1364

Query: 239  SS--HDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-- 289
                H +  C + C + +      C                +TI+    CGH ++V C  
Sbjct: 1365 YDPLHKEFQCMKPCQKVICQDGHRCPRVCFQECQPCQVKVPKTILR---CGHEQMVPCSM 1421

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC---HDI 346
            P+ D F C+E C K L+CGH+C   C    C  +C     VK   CGH     C    DI
Sbjct: 1422 PESD-FCCQEPCPKILRCGHRCSHPCGED-CVRLCSEMVTVKL-KCGHNQQVKCGHVEDI 1478

Query: 347  RNKLQDGC 354
            R  L   C
Sbjct: 1479 RYDLPVKC 1486



>gi|390363307|ref|XP_001182285.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Strongylocentrotus purpuratus]
          Length = 2499

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 184/355 (51%), Gaps = 19/355 (5%)

Query: 1    RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            RPEI +L+     + +L D + V  + D+ G+T N+FF  H+  E    +  S +N  EA
Sbjct: 1427 RPEISRLMRMDRLYPSLKDDDSVKGFDDILGVTKNIFFLHHEMEEDSVDEMKSHSNIHEA 1486

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            +    L  Y +  G   ++ITIL+ YSGQ   ++ + R    K    + +RV++VD FQG
Sbjct: 1487 KFLVGLCRYFLQQGYLPNQITILTTYSGQ---LFAFKRR--MKKIDFEGVRVATVDNFQG 1541

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGN----ASQLRYRSTLW 175
            EENDII+LSLVRS++     GFL I NR+CVALSRA+ GLY  GN    A Q     +LW
Sbjct: 1542 EENDIILLSLVRSNKEGSA-GFLKIDNRICVALSRARKGLYCIGNFKLLAQQNPTGPSLW 1600

Query: 176  REVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQ 233
            RE++   EK     + + L C+ H   + +V + ADF    EGGCS  CE ++ CGH+C+
Sbjct: 1601 REIVKDAEKQDTIGKSLVLQCRNHIRTQNEVSSEADFAKVPEGGCSVPCEARLTCGHVCR 1660

Query: 234  SICHLS--SHDKIFCPENCIRTL-PCGHPXXXXXXXXXXXXVETII-MCPPCGHSEVVLC 289
              CH +   H+K  C + C +T+ P GH              +  +     CGH + V C
Sbjct: 1661 MPCHPADMKHEKYKCCKKCTQTICPLGHLCMKQCYQPCDTQCKNPVDKTLSCGHFQKVPC 1720

Query: 290  -PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
                    C+  CS++L CGHQC+E C    CT  C          CGH  L  C
Sbjct: 1721 YKSSSEVVCESPCSRRLNCGHQCKEPCGKS-CTTACDEMIRRSDFPCGHNVLAKC 1774



>gi|426241601|ref|XP_004014678.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Ovis aries]
          Length = 1918

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 186/348 (53%), Gaps = 24/348 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR
Sbjct: 1078 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHTFPEQEIQEGKSHQNQHEAR 1137

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1138 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1192

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+Y  GN  Q+  +  LW +++ 
Sbjct: 1193 ENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIH 1250

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1251 TLRENDQIGCALRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1310

Query: 239  --SSHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-- 289
              SSH +  C + C + +      C                +TI+    CGH ++V C  
Sbjct: 1311 YDSSHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKTILR---CGHIQMVPCSV 1367

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            P+ D F C+E C K LKCGH+C   C    C  +C     V+   CGH
Sbjct: 1368 PESD-FCCQEPCPKVLKCGHRCSHPCGED-CVWLCSEMVTVEL-RCGH 1412



>gi|449664938|ref|XP_002169349.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Hydra
            magnipapillata]
          Length = 1722

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 133/369 (36%), Positives = 186/369 (50%), Gaps = 41/369 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP+I  L+  IY + L DH  V  Y  + G+  N+FF  H   E+ + +  S++N  EA+
Sbjct: 985  RPQISNLMLNIYPE-LKDHNSVLMYESIKGVQSNIFFITHNFLEESDTEIKSKSNDHEAK 1043

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              A L  YL++ G +  +ITIL+ Y+GQ  ++ KY+ +E       + +RV++VD FQGE
Sbjct: 1044 YVAALCKYLMLQGYKPDQITILTPYTGQLIKLKKYMPKEK-----YEGVRVTAVDNFQGE 1098

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            EN+II+LSLVRS+   + IGFL   NRVCVALSRAK G YI GN   L   S LW+++  
Sbjct: 1099 ENEIILLSLVRSNNEGK-IGFLGEDNRVCVALSRAKKGFYIIGNIDFLAKYSALWKKIKI 1157

Query: 181  ILEKSKKCDQFINLYCQKHPE----KETQVFTFADFPLEGGCSRNCEEKMDCGHICQSIC 236
             LEK       + L CQ H      + ++   F + P EGGC + CE ++ CGH C   C
Sbjct: 1158 SLEKVNCVGPALQLCCQNHSSDPGIRASKSEDFLNAP-EGGCQKPCEARLVCGHACTLAC 1216

Query: 237  HLSSHD-KIF-CPENCIRT-------------LPCGHPXXXXXXXXXXXXVETIIMCPPC 281
            H    + KI+ C + C R              L CG+             V      P C
Sbjct: 1217 HAYDKEHKIYKCQKTCNRIICDFGHFCKKKCFLECGN-----------CTVLQPKKLPKC 1265

Query: 282  GHSEVVLCPDV-DNFRCKER-CSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHID 339
            GH++ V C     +F C  R C+ KL CGH C   C     T  C T     +P C H +
Sbjct: 1266 GHTQDVPCSQTPSSFICLARPCNYKLNCGHYCSNACGENH-TKQCKTIVPYYFPECNHTE 1324

Query: 340  LCLCHDIRN 348
               C++  N
Sbjct: 1325 KVECYEKLN 1333



>gi|395829167|ref|XP_003787732.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Otolemur
            garnettii]
          Length = 1915

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 180/344 (52%), Gaps = 16/344 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EA 
Sbjct: 1075 RPEIARLLTPHIYQDLENHPSVLKYEQIKGVSSNLFFIEHNFPEQEIQEGKSHQNQHEAH 1134

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1135 FVVELCRYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1189

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW  ++ 
Sbjct: 1190 ENDIILLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSRIIH 1247

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V   +DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1248 TLRENNQIGHTLRLCCQNHPDTHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHP 1307

Query: 239  --SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCP-DVD 293
              SSH +  C + C + +   GH              V+     P CGH ++V C     
Sbjct: 1308 YDSSHKEFQCMKPCQKVICQDGHRCPSVCFEECQPCQVKVPKTIPRCGHEQMVPCSMPAS 1367

Query: 294  NFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            +F C+E C K L+CGH C   C    C  +C     +K   CGH
Sbjct: 1368 DFCCQEPCPKVLRCGHNCSNPCGED-CVRLCSRMVIMKL-KCGH 1409



>gi|212534558|ref|XP_002147435.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Talaromyces marneffei ATCC 18224]
 gi|210069834|gb|EEA23924.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Talaromyces marneffei ATCC 18224]
          Length = 1097

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 152/244 (62%), Gaps = 26/244 (10%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDH---QESEKLERDTMSRTNTF 57
           P IR+LLTPIY D + DHE VN+   VPG+ D   FFF H   + S+ L    +S+ N  
Sbjct: 711 PAIRRLLTPIY-DNIQDHETVNNLAKVPGMGDLRSFFFSHCWMENSDSL----LSKYNQN 765

Query: 58  EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
           EA M A    YLV+ G++ S IT+L+ Y+GQRK+I K L+  S K    + ++V +VD +
Sbjct: 766 EALMIATFFVYLVLAGVDSSHITVLTFYNGQRKKILKLLK--SNKHLQGRHLKVCTVDSY 823

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN+I++LSLVRS E N GIGFL + NRVCVALSRA+ G Y+FGNA  L   S LW +
Sbjct: 824 QGEENEIVLLSLVRSSERN-GIGFLKVENRVCVALSRARRGFYMFGNAEHLAGESHLWMK 882

Query: 178 VLSILEKSKK----CDQFINLYCQKHPEKETQVFTFADFP-----LEGGCSRNCEEKMDC 228
           V+SI+ ++        ++I L C+KH  +E     F + P     L GGCS  C + ++C
Sbjct: 883 VVSIMSEADAETTTIARYIPLVCEKHGNQE-----FVELPEEMAELTGGCSMPCTQILNC 937

Query: 229 GHIC 232
           GH+ 
Sbjct: 938 GHVA 941



>gi|121713068|ref|XP_001274145.1| ATP binding protein, putative [Aspergillus clavatus NRRL 1]
 gi|119402298|gb|EAW12719.1| ATP binding protein, putative [Aspergillus clavatus NRRL 1]
          Length = 1125

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 155/267 (58%), Gaps = 21/267 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTM-SRTNTFEA 59
           PEIR+LL PIY + L DH  V   P VPG+ +   FFF H   E    D+M S+ N  EA
Sbjct: 719 PEIRRLLEPIYGN-LEDHPTVLERPHVPGMGEVRSFFFSHDWPES--SDSMASKFNEMEA 775

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            M      YLV+ G+    IT+L+ Y+GQRK++ + ++  S        ++V +VD +QG
Sbjct: 776 EMIVGFFVYLVLNGVSIDTITVLTFYNGQRKKLLRMIKNHSYLQG--HYVKVVTVDSYQG 833

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEND++ILSLVR   + + IGFLS++NRVCVALSRA++GLYIFGNA  +     LW +V+
Sbjct: 834 EENDVVILSLVRGSNA-KSIGFLSVANRVCVALSRARNGLYIFGNAKCVSAADDLWSQVI 892

Query: 180 SILEKS---KKCDQFINLYCQKHPEKETQVFTFADFP-----LEGGCSRNCEEKMDCGHI 231
            IL      +     + L CQKH +K     TF   P     L GGC R C E ++CGH 
Sbjct: 893 EILAGEHPYRSIGVSLPLTCQKHSDK-----TFIQEPSDWSRLNGGCLRPCGEALECGHK 947

Query: 232 CQSICHLSSHDKIFCPENCIRTLPCGH 258
           C   CH  SH+++ C E C   + CGH
Sbjct: 948 CSLSCHSFSHEQVQCQERCNLRMLCGH 974



>gi|317029894|ref|XP_001391481.2| ATP binding protein [Aspergillus niger CBS 513.88]
          Length = 1083

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/265 (43%), Positives = 163/265 (61%), Gaps = 18/265 (6%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGL-TDNLFFFDHQESEKLERDTM-SRTNTFEA 59
           PEIR+LL PIY + L DHE V   P V G+ T   +FF H   E   RD + S+ N  EA
Sbjct: 717 PEIRQLLEPIYGE-LYDHESVRKRPGVKGMGTIRSYFFTHLWPES--RDNLASKYNEMEA 773

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGF 117
           +M A+   YLV  G     ITIL+ Y+GQRK++   LR      P L+   ++V +VD +
Sbjct: 774 QMIAEFVVYLVQNGNTVKDITILTFYNGQRKKLLTVLRHH----PYLQGQYVKVVTVDSY 829

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN+I+ILSLVRS E++  IGFLSI+NRVCVALSRA+ G Y+FGNA+ L  ++ LWR+
Sbjct: 830 QGEENEIVILSLVRSGEND--IGFLSIANRVCVALSRARRGFYMFGNANLLVKQNRLWRD 887

Query: 178 VLSILEKSKKCDQF---INLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQ 233
           VL+++  +K        + + C +H ++ T +   +D+  + GGC   C+  +DCGH C 
Sbjct: 888 VLTLMANNKPPRHLGAQLPVTCVEH-KRTTFIQGLSDWNKINGGCDSPCDGVLDCGHPCP 946

Query: 234 SICHLSSHDKIFCPENCIRTLPCGH 258
             CH  SHD++ C E C + + C H
Sbjct: 947 IKCHSFSHDQVECNEICNKRMACKH 971



>gi|482807600|gb|EOA84533.1| hypothetical protein SETTUDRAFT_20075 [Setosphaeria turcica Et28A]
          Length = 1184

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 115/274 (41%), Positives = 156/274 (56%), Gaps = 19/274 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEV---NHYPDVPGLT-DNLFFFDHQESEKLERDTMSRTNTF 57
            PEIR+LL PIY + L DH+ V    + P V G+  +N FFF H+  E  + + MS  N  
Sbjct: 730  PEIRRLLYPIYQNTLKDHKSVINPKNRPPVEGMGGNNSFFFCHEWEESRDHN-MSAVNKM 788

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA M  +  +YLV+ G++ ++ITIL+ Y+GQRKE+ + L   +        I+V +VD +
Sbjct: 789  EAEMVVQFFDYLVLNGVDATKITILTFYNGQRKEMLRLLNAHTNLRVYRSDIQVVTVDSY 848

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEENDI++LSLVRS++ +  IGFLS  NR CVALSRAK G YIFGNA  L   S +W  
Sbjct: 849  QGEENDIVLLSLVRSNKKH-SIGFLSSENRACVALSRAKRGFYIFGNAELLACESRVWAS 907

Query: 178  VLSILEKSKK----------CDQFINLYCQKHPEKETQVFTFADFP-LEGGCSRNCEEKM 226
            V+ I+ K+KK                L C  H  K       +DF  + GGC   C+  +
Sbjct: 908  VVEIMVKNKKEKVTTGQERRVGYHFPLQCSNHGRK-MWCEVPSDFEIIMGGCDSKCDGVL 966

Query: 227  DCGHICQSICHLSSHDKIFCPENCIRTL-PCGHP 259
             CGH C  +CH   H +I C + C R +  CGHP
Sbjct: 967  PCGHRCPYMCHPFEHGRINCTQKCSRRVETCGHP 1000



>gi|328721752|ref|XP_001946566.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Acyrthosiphon pisum]
          Length = 2052

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 179/345 (51%), Gaps = 18/345 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+TP  ++ L +H  V +   + G+  ++FF +H   E    +  S++N  EAR
Sbjct: 1014 RPEIASLITPSIYNELKNHLSVYNREHIRGVNKDMFFLNHNIYENEVEEISSKSNDHEAR 1073

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++ G + +++TIL+ YSGQ       +R   +K P+L  ++++ VD +QGE
Sbjct: 1074 FLIMFARHLILQGYKTNQVTILTTYSGQ----LFLIRSLRKKHPILDGLKITVVDNYQGE 1129

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E    +GFL   NR+CVALSRAK+GLYI GN   L     LW+++  
Sbjct: 1130 ESDIILLSLVRSNEKG-NVGFLKTENRICVALSRAKYGLYIMGNMDNLYKSGNLWKQIKE 1188

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L         + L C  H    T+V    DF   +EGGC+  C+  + CGH C SICH 
Sbjct: 1189 TLVDQCSYGDELTLECAIHSGITTKVSKSEDFNIIMEGGCTMLCKSLLLCGHYCSSICHS 1248

Query: 239  --SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGH-SEVVLCPDVDNF 295
                H ++ C E C  +    HP               ++   PCGH SE+    D+  F
Sbjct: 1249 YDREHLELKCREPCNNSCDYNHPCMKKCYMDCGKCTVLMMRELPCGHQSELPCFVDIQTF 1308

Query: 296  RCKERCSKKL-KCGHQCREEC--SSPWCTAMCLTQTEVKYPGCGH 337
             C+E     L +CGH+   +C   +P C+  C  + +     CGH
Sbjct: 1309 PCEEMVESTLEECGHKIIRKCHDKNPNCSVKCYIRLD-----CGH 1348



>gi|407921970|gb|EKG15103.1| hypothetical protein MPH_07700 [Macrophomina phaseolina MS6]
          Length = 1290

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/270 (41%), Positives = 152/270 (56%), Gaps = 16/270 (5%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHY---PDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
            PEIR+LL PIY D + DH  V      P VPG+   + FFF H+  E ++   MS  N  
Sbjct: 817  PEIRRLLKPIYRDIIKDHPSVKDLAVRPLVPGMGQVSSFFFTHEWPESVDAQ-MSSCNLK 875

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA M  +   YL M  +E S IT+L+ Y+GQRK I K LR       + +  RV +VD +
Sbjct: 876  EADMIVQFYVYLFMNKVEYSEITVLTFYNGQRKLILKELRSHPELQGIGRDFRVVTVDSY 935

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEEND+++LSLVR++   R IGFL+ +NR+CVALSRAK G Y+FGN   L   S +W E
Sbjct: 936  QGEENDVVLLSLVRNNLEGR-IGFLNNANRICVALSRAKRGFYMFGNGQLLASESKVWSE 994

Query: 178  VLS----ILEKSKKCDQFIN----LYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDC 228
            V++     L K  K D  +     L C  H  + T V    D+ P+ GGC   C  ++ C
Sbjct: 995  VITQLAGKLSKRNKEDMRVGYHLPLTCTNH-GRRTFVGELDDWKPINGGCDMRCNGRLPC 1053

Query: 229  GHICQSICHLSSHDKIFCPENCIRTLPCGH 258
            GH+C   CH   H+ + C + C + L CGH
Sbjct: 1054 GHLCPYRCHPYEHEVVNCLQKCRKVLTCGH 1083



>gi|294892293|ref|XP_002773991.1| NFX1-type zinc finger protein-containing protein, putative [Perkinsus
            marinus ATCC 50983]
 gi|239879195|gb|EER05807.1| NFX1-type zinc finger protein-containing protein, putative [Perkinsus
            marinus ATCC 50983]
          Length = 1598

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 185/371 (49%), Gaps = 28/371 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE+ +L+   Y D L+DH+ V  Y  V G+  +++F DH+E E+    T S+ N FEAR
Sbjct: 960  RPEVSQLVKHFYVDGLTDHDRVKGYDRVGGVATDVYFVDHREKEQAFEGT-SKRNDFEAR 1018

Query: 61   MCAKLANYLVMGGMEESR-ITILSMYSGQRKEIYKYLREESRKTP--VLKQIRVSSVDGF 117
              A+LA+YLV      +  IT+L+ Y GQ++ I  YL  + +++   V    RV ++D +
Sbjct: 1019 FAARLASYLVRTQQYNAEDITLLTPYIGQKRLIRSYLDGDLKRSADGVKAGARVVTIDDY 1078

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEEN ++ILSLVRS+++ R +GF  I NRV VA+SRAK G+YI GNA      +  W  
Sbjct: 1079 QGEENKVVILSLVRSNKA-RKVGFTGIENRVIVAMSRAKEGMYILGNAEMFENEAN-WEV 1136

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMD-CGHICQS 234
            +++ L    +    + L C+ HP++  QV    DF    +GGC   C   +D CGH C  
Sbjct: 1137 IVARLRAQARIGPALTLQCRVHPDQFEQVARPEDFLHVKDGGCRLPCRRLLDRCGHRCPL 1196

Query: 235  ICHLSSHDKIFCPENCIRTLP--CGHPXXXXXXXXXXXXVETIIMCP-----------PC 281
             CH+  H ++ C + C R  P  CGH                   CP            C
Sbjct: 1197 NCHVFDHAQVCCDKPCDRARPAGCGHRCSHLCWECTRAGSTPEDPCPTPCSALVLARLSC 1256

Query: 282  GHSEVVLC---PDVDNFRCKERCSKKLKCGHQCREEC---SSPWCTAMCLTQTEVKYPGC 335
            GH++ V C    D    RC    + +L CGH     C     P    +C    +V+   C
Sbjct: 1257 GHTKNVRCHYREDEVELRCHRAVTVELPCGHPLATSCFKSQRPVTELLCEFTKKVRVEAC 1316

Query: 336  GHIDLCLCHDI 346
            GH     CHD+
Sbjct: 1317 GHEVTQKCHDV 1327



>gi|443707031|gb|ELU02825.1| hypothetical protein CAPTEDRAFT_212972 [Capitella teleta]
          Length = 1679

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/342 (36%), Positives = 174/342 (50%), Gaps = 13/342 (3%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI KL+  IY + L + + V  Y D+PG+  NLF  +H E+E    D++S +N  E+ 
Sbjct: 925  RPEIAKLIQDIYPN-LKNADCVKGYDDIPGIGKNLFLVNHSENESRVNDSVSISNQHESE 983

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  YL++ G     ITIL+ YSGQ       LR+        + +R  +VD +QGE
Sbjct: 984  FVVNLCRYLLLQGCPPDEITILTPYSGQ----LHALRKLMHGNHFYQGVRACTVDNYQGE 1039

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            EN+IIILSLVRS++ +R +GFL+  NRVCVALSRAK G Y  G+   L  +S LW  V+ 
Sbjct: 1040 ENEIIILSLVRSND-DRKLGFLAEDNRVCVALSRAKKGFYCIGDFEMLAGKSQLWHNVVR 1098

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
              E+       + L C+ HPE++       DF    EGGC RNC  ++ CGH+C   CH 
Sbjct: 1099 RAERMGCYGHALPLVCRNHPEEKVFAIRANDFDRAPEGGCMRNCSFRLPCGHVCGRACHA 1158

Query: 239  --SSHDKIFCPENCIRTL-PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNF 295
                H ++ C + C   L   GH                + +   C H+  V CP  +  
Sbjct: 1159 YDMEHTQVRCLQPCALELCERGHRCRKRCCDDCGSCEYKMRIIFDCKHTTFVPCPQYEEA 1218

Query: 296  RCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
             C+E C   L CGH C++ C     T  C+ +     P CGH
Sbjct: 1219 TCREPCEFILSCGHPCKKACGEEH-TQQCMVKMLRHLP-CGH 1258



>gi|470637078|ref|XP_004323856.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Tursiops
            truncatus]
          Length = 1918

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 191/366 (52%), Gaps = 25/366 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR 
Sbjct: 1078 PEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEARF 1137

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGEE
Sbjct: 1138 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGEE 1192

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDI++LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1193 NDIVLLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1250

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP   T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1251 LRENNQIGSALQLCCQNHPVIHTSVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1310

Query: 239  -SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--PD 291
             S H +  C + C + +   GH  P             V  +I+   CGH ++V C  P+
Sbjct: 1311 DSLHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKVIL--RCGHEQMVPCSMPE 1368

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC---HDIRN 348
             D F C+E C K LKCGH+C   C    C  +C  +  VK   CGH     C    D+R 
Sbjct: 1369 SD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEKVTVKL-KCGHSQKVKCGHVEDLRY 1425

Query: 349  KLQDGC 354
             L   C
Sbjct: 1426 DLPVKC 1431



>gi|466073492|ref|XP_004282934.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Orcinus orca]
          Length = 1918

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 191/366 (52%), Gaps = 25/366 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            PEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+  ++  S  N  EAR 
Sbjct: 1078 PEIARLLTPHVYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEARF 1137

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGEE
Sbjct: 1138 VVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGEE 1192

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDI++LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN  Q+  +  LW +++  
Sbjct: 1193 NDIVLLSLVRSNQEGK-VGFLQIPNRICVALSRAKKGMYCIGNM-QMLAKVPLWSKIIHT 1250

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL- 238
            L ++ +    + L CQ HP   T V   +DF    EGGCS  CE ++ CGH+C   CH  
Sbjct: 1251 LRENNQIGSALRLCCQNHPVIHTSVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPY 1310

Query: 239  -SSHDKIFCPENCIRTL-PCGH--PXX-XXXXXXXXXXVETIIMCPPCGHSEVVLC--PD 291
             S H +  C + C + +   GH  P             V  +I+   CGH ++V C  P+
Sbjct: 1311 DSLHKEFQCMKPCQKVICQDGHRCPLVCFQECQPCQVKVPKVIL--RCGHEQMVPCSMPE 1368

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC---HDIRN 348
             D F C+E C K LKCGH+C   C    C  +C  +  VK   CGH     C    D+R 
Sbjct: 1369 SD-FCCQEPCPKVLKCGHRCSHPCGED-CVRLCSEKVTVKL-KCGHSQKVKCGHVEDLRY 1425

Query: 349  KLQDGC 354
             L   C
Sbjct: 1426 DLPVKC 1431



>gi|395506865|ref|XP_003757750.1| PREDICTED: NFX1-type zinc finger-containing protein 1 [Sarcophilus
            harrisii]
          Length = 1926

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 133/371 (35%), Positives = 189/371 (50%), Gaps = 39/371 (10%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y  + G++ NLFF +H   E+   +  S  N  EAR
Sbjct: 1085 RPEIARLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHDFPEQEILEGKSHQNQHEAR 1144

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +  ++        ++V  VD +QGE
Sbjct: 1145 FVVELCKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKT-----FAGVKVHVVDKYQGE 1199

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  + +GFL I NR+CVALSRAK G+Y  GN   L  +  LW ++L 
Sbjct: 1200 ENDIILLSLVRSNKEEK-VGFLKIKNRICVALSRAKKGMYCIGNMGML-AKVPLWSKILH 1257

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             L ++ +    + L CQ HP+  T V    DF    EGGCS  CE ++ CGH+C   CH 
Sbjct: 1258 TLRENGQIGSALMLCCQNHPDTHTLVSKATDFHQVPEGGCSLPCEFRLSCGHVCTRACHP 1317

Query: 239  --SSHDKIFCPENCIRTL-------------PCGHPXXXXXXXXXXXXVETIIMCPPCGH 283
              S+H +  C + C + L             PCG               +TI+    CGH
Sbjct: 1318 YDSNHKEFQCMKPCQKILCDDGHRCPSVCFQPCG--------LCQVKVPKTILR---CGH 1366

Query: 284  SEVVLCPDVDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCL 342
             ++V C   ++ F C+E C K L+CGH+C   C    C  +C     V    CGH     
Sbjct: 1367 QQMVPCSMPESEFCCQEPCPKFLECGHKCSHSCGEE-CVRLCSEMVTVNLK-CGHSQQVK 1424

Query: 343  CHDIRNKLQDG 353
            C ++ + LQ G
Sbjct: 1425 CGNVED-LQYG 1434



>gi|378734027|gb|EHY60486.1| hypothetical protein, variant [Exophiala dermatitidis NIH/UT8656]
          Length = 1054

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 156/264 (59%), Gaps = 16/264 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNL--FFFDHQESEKLERDTMSRTNTFEA 59
            PE R+L++ +Y  +L+DH  V   P  P     +  FFFDHQ SE  + ++ S  N  EA
Sbjct: 769  PEFRRLISDLYP-SLTDHPSVVGRPAPPWGMGPIKSFFFDHQWSEYRD-ESQSIYNEEEA 826

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQI--RVSSVDGF 117
            +  A    YL+  G+    IT+L+ Y+GQRK+I K    E +  P L+Q    V +VD +
Sbjct: 827  KFIAGFYRYLIKNGLGPEHITVLTFYNGQRKKILK----ELKAYPELRQTYCAVKTVDSY 882

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE++I+ILSL RS+   + IGFL+ +NRVCVALSRAK G Y+FGNA  L   S LW  
Sbjct: 883  QGEESNIVILSLARSNPEAK-IGFLANNNRVCVALSRAKFGFYLFGNADNLMRGSPLWYN 941

Query: 178  VLSILE-KSKKCDQFINLYCQKHPEKETQVFTFAD--FPLEGGCSRNCEEKMDCGHICQS 234
            V+++L+ K K+  Q   + CQ H  K T +  + D    L+GGCS+ C   + CGH C  
Sbjct: 942  VITLLDSKPKRLGQVFPIQCQNH--KTTLLMQYPDDWQELDGGCSKPCNANLKCGHPCPL 999

Query: 235  ICHLSSHDKIFCPENCIRTLPCGH 258
             CH   HDK+ CPE C  T+ CGH
Sbjct: 1000 RCHPFDHDKVECPELCNETMVCGH 1023



>gi|378734028|gb|EHY60487.1| hypothetical protein HMPREF1120_08445 [Exophiala dermatitidis
            NIH/UT8656]
          Length = 1055

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 156/264 (59%), Gaps = 16/264 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNL--FFFDHQESEKLERDTMSRTNTFEA 59
            PE R+L++ +Y  +L+DH  V   P  P     +  FFFDHQ SE  + ++ S  N  EA
Sbjct: 770  PEFRRLISDLYP-SLTDHPSVVGRPAPPWGMGPIKSFFFDHQWSEYRD-ESQSIYNEEEA 827

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQI--RVSSVDGF 117
            +  A    YL+  G+    IT+L+ Y+GQRK+I K    E +  P L+Q    V +VD +
Sbjct: 828  KFIAGFYRYLIKNGLGPEHITVLTFYNGQRKKILK----ELKAYPELRQTYCAVKTVDSY 883

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE++I+ILSL RS+   + IGFL+ +NRVCVALSRAK G Y+FGNA  L   S LW  
Sbjct: 884  QGEESNIVILSLARSNPEAK-IGFLANNNRVCVALSRAKFGFYLFGNADNLMRGSPLWYN 942

Query: 178  VLSILE-KSKKCDQFINLYCQKHPEKETQVFTFAD--FPLEGGCSRNCEEKMDCGHICQS 234
            V+++L+ K K+  Q   + CQ H  K T +  + D    L+GGCS+ C   + CGH C  
Sbjct: 943  VITLLDSKPKRLGQVFPIQCQNH--KTTLLMQYPDDWQELDGGCSKPCNANLKCGHPCPL 1000

Query: 235  ICHLSSHDKIFCPENCIRTLPCGH 258
             CH   HDK+ CPE C  T+ CGH
Sbjct: 1001 RCHPFDHDKVECPELCNETMVCGH 1024



>gi|294899060|ref|XP_002776476.1| hypothetical protein Pmar_PMAR007856 [Perkinsus marinus ATCC 50983]
 gi|239883484|gb|EER08292.1| hypothetical protein Pmar_PMAR007856 [Perkinsus marinus ATCC 50983]
          Length = 490

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 186/371 (50%), Gaps = 28/371 (7%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPE+ +L+   Y D L+DH+ V  Y  V G+  +++F DH+E E+    T S+ N FEAR
Sbjct: 48  RPEVSQLVKHFYVDGLTDHDRVKAYDRVGGVATDVYFVDHREKEQAFEGT-SKRNDFEAR 106

Query: 61  MCAKLANYLVMGGMEESR-ITILSMYSGQRKEIYKYLREESRKTP--VLKQIRVSSVDGF 117
             A+LA+YLV      +  IT+L+ Y GQ++ I  +L  + +++   V    RV ++D +
Sbjct: 107 FAARLASYLVRTQQYNAEDITLLTPYIGQKRLIRSHLDGDLKRSADGVKAGARVVTIDDY 166

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN ++ILSLVRS+++ R +GF  I NRV VA+SRAK GLYI GNA      +  W  
Sbjct: 167 QGEENKVVILSLVRSNKA-RKVGFTGIENRVIVAMSRAKEGLYILGNAEMFENEAN-WEV 224

Query: 178 VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMD-CGHICQS 234
           +++ L    +    + L C+ HP++  QV    DF    +GGC   C   +D CGH C  
Sbjct: 225 IIARLRAQARIGPALTLQCRVHPQQFEQVARAEDFLHVKDGGCRLPCRRLLDRCGHRCPL 284

Query: 235 ICHLSSHDKIFCPENCIRTLP--CGHPXXXXXXXXXXXXVETIIMCP-----------PC 281
            CH+  H ++ C + C R  P  CGH                   CP            C
Sbjct: 285 NCHVFDHAQVCCDKPCDRARPEGCGHRCSHLCWECTRAGSTPEDPCPTPCSSPVLVRLSC 344

Query: 282 GHSEVVLC---PDVDNFRCKERCSKKLKCGHQCREEC---SSPWCTAMCLTQTEVKYPGC 335
           GH++ V C    D    RC +  + +L CGH     C     P    +C    +V+   C
Sbjct: 345 GHTKNVRCHYREDEVELRCHKAVTVELPCGHPLTTSCYKSRRPVTELLCEFTKKVRVEAC 404

Query: 336 GHIDLCLCHDI 346
           GH     CHD+
Sbjct: 405 GHEVTQKCHDV 415



>gi|328716874|ref|XP_003246062.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform 2
            [Acyrthosiphon pisum]
 gi|328716876|ref|XP_001949970.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform 1
            [Acyrthosiphon pisum]
          Length = 2065

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 180/345 (52%), Gaps = 18/345 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+TP  ++ L +H  V++   + G+T ++FF +H   E    +  S++N  EAR
Sbjct: 1028 RPEIASLITPSIYNELKNHISVHNREHIRGVTKDVFFLNHNLYENEVEEISSKSNDHEAR 1087

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++ G +  ++TIL+ YSGQ  +I    R   +K  +L+ ++++ VD +QGE
Sbjct: 1088 FLIMFARHLILQGYKTDQVTILTTYSGQLFQI----RSLRKKHAILEGMKITVVDNYQGE 1143

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E    +GFL   NR+CVALSRAK+GLYI GN   L     LW+++  
Sbjct: 1144 ESDIILLSLVRSNEKG-NVGFLKTENRICVALSRAKYGLYIMGNMDNLYNSGNLWKQIKE 1202

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L         + L C  H    T+V    DF   +EGGCS  C+  + CGH C S+CH 
Sbjct: 1203 TLVNQGSYGDELTLECAVHSGIMTKVAKSEDFNIIMEGGCSMLCKSLLLCGHYCSSVCHS 1262

Query: 239  SSHD--KIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVDNF 295
               D  ++ C E C +     HP            +  +    PCGH   + C  DV  +
Sbjct: 1263 YDRDHLELKCREPCNKFCDYNHPCKKTCYMDCGDCLVLLNKELPCGHELTLRCFVDVLTY 1322

Query: 296  RCKERCSKKLK-CGHQCREEC--SSPWCTAMCLTQTEVKYPGCGH 337
             C+E     L+ CGH   ++C    P C+  C+ + +     CGH
Sbjct: 1323 PCEEMVKVFLEICGHTIFKKCHDKKPICSYKCIDRLD-----CGH 1362



>gi|358369609|dbj|GAA86223.1| DEAD box helicase involved in nonsense mediated decay [Aspergillus
           kawachii IFO 4308]
          Length = 1092

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 164/265 (61%), Gaps = 18/265 (6%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGL-TDNLFFFDHQESEKLERDTM-SRTNTFEA 59
           PEIR+LL PIY + L+DHE V   P V G+     +FF H   E   RD++ S+ N  EA
Sbjct: 721 PEIRQLLEPIYGE-LNDHESVRKRPGVRGMGIIRSYFFTHMWPES--RDSLASKYNDMEA 777

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGF 117
           +M A+   YLV  G     ITIL+ Y+GQRK++   LR      P L+   +RV +VD +
Sbjct: 778 QMIAEFVVYLVQNGNTVKDITILTFYNGQRKKLLTVLRHH----PYLQGQYMRVVTVDSY 833

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN+I+ILSLVRS E++  IGFLSI+NRVCVALSRA+ G Y+FGNA+ L   + LWR 
Sbjct: 834 QGEENEIVILSLVRSGEND--IGFLSIANRVCVALSRARRGFYMFGNANSLAKHNQLWRG 891

Query: 178 VLSILEKSK---KCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQ 233
           VL+++  +K   +    + + C KH ++ T +   +D+  + GGC  +C+  +DCGH C 
Sbjct: 892 VLTLMANNKPPRRLGTQLPVTCVKH-KRTTFIQGLSDWNKINGGCDCHCDGTLDCGHPCP 950

Query: 234 SICHLSSHDKIFCPENCIRTLPCGH 258
             CH  SH+++ C + C + + C H
Sbjct: 951 IKCHSFSHEQVECNDICNKRMACKH 975



>gi|296411245|ref|XP_002835344.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629122|emb|CAZ79501.1| unnamed protein product [Tuber melanosporum]
          Length = 1248

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 157/266 (59%), Gaps = 18/266 (6%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDN-LFFFDHQESEKLERDTMSRTNTFEA 59
           RPEIR+LLTPIY D + DH  V   P +PG+ D  +F++ H   ++++  T SR NT EA
Sbjct: 719 RPEIRELLTPIYQDLVEDHSCVLGRPGIPGMGDTHVFWYSHMNPDQMDSGT-SRINTEEA 777

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGF 117
            M      +LV+      +IT+L+ Y GQ+ EI K +R+ +     LK   +R+++VD +
Sbjct: 778 AMIVGFIEHLVLNKTRPEKITVLTFYGGQKHEIIKRVRKNNN----LKSCDLRITTVDSY 833

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEND+IILSLVRS+     +GFL++ NR+CVALSRA+ G YIFG+A  +      W E
Sbjct: 834 QGEENDVIILSLVRSNPQG-NVGFLNVQNRICVALSRAQLGFYIFGDAQMITRADKTWWE 892

Query: 178 VLSILEKSKKCDQF-INLYCQKHPE----KETQVFTFADFPLEGGCSRNCEEKMDCGHIC 232
           +  IL  S     F + + CQ+H +    KE+Q +      + GGC + C+E + C H C
Sbjct: 893 IGKILNTSPSRIGFAMPIVCQRHGKLEFIKESQDW----VDIVGGCYQWCKELLPCSHTC 948

Query: 233 QSICHLSSHDKIFCPENCIRTLPCGH 258
           +  CH   H  I C + C++ L CGH
Sbjct: 949 RFRCHPFDHKDIRCLDPCLKRLVCGH 974



>gi|328716888|ref|XP_001949997.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Acyrthosiphon pisum]
          Length = 1820

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 180/346 (52%), Gaps = 19/346 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+TP  +D L +H  V++   + G+T ++FF +H   E    +T S++N  EAR
Sbjct: 883  RPEIASLITPSIYDELKNHISVHNREHIRGVTKDVFFLNHNLYENEVEETSSKSNDHEAR 942

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                 A +L++ G   +++TIL+ YSGQ   ++K +R   +K  +L+ ++++ VD +QGE
Sbjct: 943  FLIMFARHLILQGYTTNQVTILTTYSGQ---LFK-IRSLRKKHAMLEDMKITVVDNYQGE 998

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            E+DII+LSLVRS+E    +GFL   NR+CVALSRAK+GLYI GN   L     LW+++  
Sbjct: 999  ESDIILLSLVRSNEKG-NVGFLKTENRICVALSRAKYGLYIMGNMDNLYNSGNLWKQIKE 1057

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICH 237
             L         + L C  H    T+V    DF +    GGC+  C+  + CGH C  +CH
Sbjct: 1058 TLVNQGSYGDELTLECAVHSGIMTKVAKSEDFDIIKEGGGCTMMCKSLLLCGHYCTRMCH 1117

Query: 238  LSS--HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-PDVDN 294
                 H K  C E C +     HP            +  +    PCGH   + C  DV  
Sbjct: 1118 SDDREHLKFKCVEPCEKFCNYNHPCKKTCHMDCGDCLVLLNKELPCGHELTLQCFLDVLT 1177

Query: 295  FRCKERCSKKLK-CGHQCREEC--SSPWCTAMCLTQTEVKYPGCGH 337
            + C+E     L+ CGH   ++C    P C+  C+ + E     CGH
Sbjct: 1178 YPCEEMVEAFLEICGHTILKKCHDKKPICSYKCIDRLE-----CGH 1218



>gi|115644464|ref|XP_793206.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like
           [Strongylocentrotus purpuratus]
          Length = 1333

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 181/355 (50%), Gaps = 19/355 (5%)

Query: 1   RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
           RPEI +L+     +  L D E V  + D+ G+  N+FF  H+  E    +  S +N  EA
Sbjct: 476 RPEISRLMRMERLYPYLQDDESVRVFDDIHGVMKNIFFIHHEMEEDSVDEMKSHSNIHEA 535

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
           +    L  Y +  G    +ITIL+ YSGQ   ++ +  +   K    + +RV++VD FQG
Sbjct: 536 KFLVGLCRYFLQQGYLPEQITILTTYSGQ---LFAF--KSRMKKSDFEGVRVATVDNFQG 590

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGN----ASQLRYRSTLW 175
           EENDII+LSLVRS++     GFL I NR+CVALSRA+ GLY  GN    A Q      LW
Sbjct: 591 EENDIILLSLVRSNKEGSA-GFLKIDNRICVALSRARKGLYCIGNFKLLAQQNPSGPNLW 649

Query: 176 REVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQ 233
           RE++   E      + + L C+ H   + +V + ADF    EGGCS  CE ++ CGH+C+
Sbjct: 650 REIVKEAETYGTIGKSLVLQCRNHIGTQNEVSSEADFSKVPEGGCSLPCEARLTCGHVCR 709

Query: 234 SICHLSS--HDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLC 289
             CH +   H+   C + C RT+ P GH               ++     PCGH + V C
Sbjct: 710 MPCHTTDMKHENHKCRQKCTRTICPSGHRCMKQCYQPCDTQCKKSADQTLPCGHLQKVPC 769

Query: 290 PDVDN-FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLC 343
            +  +   C+  CS++L CGH+C+E C    CT  C          CGH  L  C
Sbjct: 770 YNSSSEVICESPCSRRLDCGHECKESCGK-ICTMFCEEIIRRSDFPCGHNVLAKC 823



>gi|459175983|ref|XP_002125314.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Ciona
            intestinalis]
          Length = 1792

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/355 (34%), Positives = 177/355 (49%), Gaps = 20/355 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP I  L+ P  +  L+DHE V    D+PG+ + L+F  H + E    D  ++ N  EA 
Sbjct: 1035 RPRIADLIRPHIYKTLTDHEVVKKCEDIPGVENYLYFISHDKMEDNVIDGKTKMNQHEAE 1094

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                L  Y ++   +  +ITIL+ Y+GQ   +   +R  + +   LK++ V++VD FQGE
Sbjct: 1095 FMVALCKYFLLHEFKPEQITILTTYTGQVLALKNIIRSSANE---LKRVYVTAVDNFQGE 1151

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS+E  + IGFL   NRVCVALSRAK GL+  GN   LR  S +W  ++S
Sbjct: 1152 ENDIILLSLVRSNEQ-KSIGFLKNHNRVCVALSRAKRGLFCIGNLQLLRSESKIWESIVS 1210

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGGCSRNCEEKMDCGHICQSICHL 238
             LE+ +     + L C+ HP+    V +  DF     GGC   C  +++CGH+C   CH 
Sbjct: 1211 DLERDQLIGPALKLQCKNHPKTCVLVESAKDFQKFPGGGCGVPCNYRLNCGHVCTRTCHP 1270

Query: 239  S--SHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII--MCPPCGHSEVVLC-PDVD 293
                H K  C + C ++ P                   ++    P CGH++ + C     
Sbjct: 1271 DDFDHSKFECIKPCTKSCPDLDHKCLKQCWEDCSICPVLVDKKMPTCGHTQEMKCFKSTS 1330

Query: 294  NFRCKERCSKKLKCGHQCREECS---SPWCTAMCLTQTEVKYPGCGHIDLCLCHD 345
               C+  C K  KCGH C + C    SP     C+ + + K   CGH     C D
Sbjct: 1331 QHNCQMPCEKTQKCGHGCPQLCYLRCSP-----CIVKIQ-KNLSCGHKKNMRCSD 1379



>gi|390347005|ref|XP_003726682.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Strongylocentrotus purpuratus]
          Length = 1885

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 183/370 (49%), Gaps = 72/370 (19%)

Query: 3    EIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARMC 62
            E+  L+   ++D L DH+ V  Y               ++ E    DT S  N  EAR+ 
Sbjct: 1053 ELSNLIRRHFYDNLQDHDTVKRY---------------EKPEDEIDDTQSHYNLHEARLV 1097

Query: 63   AKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEEN 122
              +  Y    G E  ++T L+ Y+GQ  +I K + + S+     + ++V+S+D +QGEEN
Sbjct: 1098 VAMCYYFXQQGYEXDKVTFLTAYTGQLLKI-KQMMDRSK----FEGVKVTSIDNYQGEEN 1152

Query: 123  DIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSIL 182
            DII+LS VRS+   R IGFL ISNRVCV+LSRA+ GLY  GN +    +S LW+ ++  L
Sbjct: 1153 DIILLSFVRSNNHGR-IGFLGISNRVCVSLSRARKGLYCVGNFTLFAEKSELWKGIVKDL 1211

Query: 183  EKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCGHICQSICHLS 239
            E        + L C  HPE++T V T  DF   PL GGCSR+C+ ++DCGH+C+  CH +
Sbjct: 1212 EAMGSIGDSLTLQCTNHPEEKTAVKTADDFKKVPL-GGCSRDCDTRLDCGHVCRLKCHPT 1270

Query: 240  SH-----------DKIFCPEN-----------------CIRTLPCGHPXXXXXXXXXXXX 271
                          K+ C  N                   + L CGH             
Sbjct: 1271 DLKHLVYKCKVPCSKVICERNHKCPMFCSDLENECEVIINKELQCGHRCK---------- 1320

Query: 272  VETIIMCPPCGHSEVVLCP-DVDNFRCKERCSKKLKCGHQCREECS---SPWCTAMCLTQ 327
             E +    PCGH   ++C  +V+   CK RCSK+L CGH C+E C    + +CT M    
Sbjct: 1321 -ENVEKTLPCGHKLKMICSTEVETVECKARCSKELPCGHICKERCGLDCTEYCTEMI--- 1376

Query: 328  TEVKYPGCGH 337
            T   +P CGH
Sbjct: 1377 TRDDWP-CGH 1385



>gi|281203595|gb|EFA77792.1| NF-X1-type zinc finger-containing protein [Polysphondylium pallidum
            PN500]
          Length = 1851

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/345 (35%), Positives = 173/345 (50%), Gaps = 42/345 (12%)

Query: 2    PEIRKLLTPIYHDALSDH----EEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTF 57
            P I + + P+Y   L DH    E       V G+  N+FF DH+  E    +  S++N F
Sbjct: 1189 PNISQFVKPVY-PHLIDHPSVIERYTQVHTVQGMPSNVFFLDHRHMEN--SNETSKSNIF 1245

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA   A+LA Y+V      + I IL+ Y+GQ  +I   +   +     LK I + +VD F
Sbjct: 1246 EADFVARLAEYIVQHNYSPNNIAILTPYTGQLLKIRSRVNRMN-----LKGITIRTVDQF 1300

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE D IILSLVRS+      GFLSI NR+ V LSRA++ +YI GN+  L   + LW  
Sbjct: 1301 QGEERDFIILSLVRSNNEG-STGFLSIENRINVLLSRARNAMYIVGNSQLLSKANDLWVN 1359

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSI 235
            ++S L++ KK D FI L C  HP+  TQ+   ADF    EGGC++ C+ ++DC H C   
Sbjct: 1360 LISKLKEEKKLDTFIPLVCVNHPDTITQIRNAADFDNVPEGGCNKRCDARLDCAHQCPRS 1419

Query: 236  CHL--SSHDKIFCPENCIRTLP-CGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
            CH+  S+H  + C + C + L  C H                  +C    H      P  
Sbjct: 1420 CHIGDSNHKNVTCTQYCHKPLDGCDH------------------ICQGHCHEGSRCGP-- 1459

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
                CK +    L CGH  ++ CS+P  + +C  Q +   P CGH
Sbjct: 1460 ----CKTQVQVTLHCGHSTQKSCSTPTPSVICQVQCQKSRPDCGH 1500



>gi|340378128|ref|XP_003387580.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1894

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 179/347 (51%), Gaps = 25/347 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+ P  +  L DH++V +Y  V G+  N+FF +H   EK     MS  N+ EA 
Sbjct: 945  RPEIANLVRPHIYQELFDHQKVLNYEPVKGIKTNMFFVNHTFPEKPMEGLMSPANSHEAD 1004

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
                LANYL+  G +  ++TIL+ Y+GQ   I +Y+   + ++      R+  +D FQGE
Sbjct: 1005 FVVHLANYLLFQGYKPDQLTILTPYTGQVACIKEYIESFAFES----SPRIVPIDNFQGE 1060

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS +S    GF    NR+CVALSRA+ GLY+ GN    +  S  W+++++
Sbjct: 1061 ENDIIILSLVRSVKS----GFTKEENRICVALSRARKGLYVIGNFELFKKESQTWKKIIN 1116

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L+ +K     + L C  H ++ T V    DF    +GGC   C  +M CGH+C   CH 
Sbjct: 1117 SLD-NKSFGSSLPLQCYSH-KRITDVGVTDDFSNVKDGGCFELCSYEMSCGHVCPRQCHP 1174

Query: 239  SS--HDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC-P 290
                H++  C E C RT+     PC                + I   P C H + V C  
Sbjct: 1175 DDLEHNQP-CSEPCSRTICSYNHPCPRKCSDECLPCQVFVPKVI---PSCNHQQSVPCHQ 1230

Query: 291  DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
              D F C+E C+ KL+CGH C+ +C   +    C  Q  +K   CGH
Sbjct: 1231 SPDTFTCQEDCTIKLECGHTCQRKCGEKYTNYQC-RQLVMKMLPCGH 1276



>gi|392891148|ref|NP_001254205.1| Protein ZK1067.2, isoform a [Caenorhabditis elegans]
 gi|211970484|emb|CAA93884.2| Protein ZK1067.2, isoform a [Caenorhabditis elegans]
          Length = 2212

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 179/359 (49%), Gaps = 27/359 (7%)

Query: 6    KLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARMCAKL 65
            K++   ++D ++D E V  YPDV G+  NLFF+ H   E+   D +S  N  E  M   L
Sbjct: 1312 KIVKLSFYDNVTDAENVGLYPDVQGMATNLFFWSHTSMEE-SPDEVSWLNKHEISMTVAL 1370

Query: 66   ANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEENDII 125
              +L+      + I +L+ YS Q+  +Y+        TP    I V +VD FQG+E  I+
Sbjct: 1371 VKHLLKQNYTTNDIVVLATYSAQKNLMYREYANVFGSTPDSNVIPVETVDSFQGKERKIV 1430

Query: 126  ILSLVRSDESNR---GIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSIL 182
            I+SLVRS    R   GIGFL+++NR+CVAL+RA+HG+YI GN + +   S LW ++++ L
Sbjct: 1431 IVSLVRSHRGGRENTGIGFLAVANRICVALTRAQHGMYIIGNGAYIMNNSELWNKIVNNL 1490

Query: 183  EKSKKCDQFINLYCQKHPE----KETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHL 238
             +S   +  + L C  H      K+ Q   FA    EGGC + C+ K  CGH+C+ +CH 
Sbjct: 1491 RRSNLIEYNLPLKCVAHGNIVTVKDPQ--DFATKSPEGGCMQKCDTKKFCGHVCERLCHP 1548

Query: 239  SSHDKIF--CPENCIRTLPCGHPXXXXXXXXX--------XXXVETIIMCPPCGHSEVVL 288
            +  ++    C  NC +   C +P                    VE  +    CGH     
Sbjct: 1549 NMEEEHLQRCLYNCDKK--CSNPQFQHRCKKACYEECGSCLYLVEVTL---DCGHRITTP 1603

Query: 289  CPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYP-GCGHIDLCLCHDI 346
            C  +++ +C + C+KKL CGH C  +C    CT +      V  P  CGHI    C  I
Sbjct: 1604 CSRINSSKCDQSCTKKLLCGHACAAKCGEE-CTLVSECSQLVGMPLSCGHIKQLTCSKI 1661



>gi|392891146|ref|NP_001254204.1| Protein ZK1067.2, isoform b [Caenorhabditis elegans]
 gi|320202837|emb|CBZ01828.1| Protein ZK1067.2, isoform b [Caenorhabditis elegans]
          Length = 2443

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 179/359 (49%), Gaps = 27/359 (7%)

Query: 6    KLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARMCAKL 65
            K++   ++D ++D E V  YPDV G+  NLFF+ H   E+   D +S  N  E  M   L
Sbjct: 1543 KIVKLSFYDNVTDAENVGLYPDVQGMATNLFFWSHTSMEE-SPDEVSWLNKHEISMTVAL 1601

Query: 66   ANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEENDII 125
              +L+      + I +L+ YS Q+  +Y+        TP    I V +VD FQG+E  I+
Sbjct: 1602 VKHLLKQNYTTNDIVVLATYSAQKNLMYREYANVFGSTPDSNVIPVETVDSFQGKERKIV 1661

Query: 126  ILSLVRSDESNR---GIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSIL 182
            I+SLVRS    R   GIGFL+++NR+CVAL+RA+HG+YI GN + +   S LW ++++ L
Sbjct: 1662 IVSLVRSHRGGRENTGIGFLAVANRICVALTRAQHGMYIIGNGAYIMNNSELWNKIVNNL 1721

Query: 183  EKSKKCDQFINLYCQKHPE----KETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHL 238
             +S   +  + L C  H      K+ Q   FA    EGGC + C+ K  CGH+C+ +CH 
Sbjct: 1722 RRSNLIEYNLPLKCVAHGNIVTVKDPQ--DFATKSPEGGCMQKCDTKKFCGHVCERLCHP 1779

Query: 239  SSHDKIF--CPENCIRTLPCGHPXXXXXXXXX--------XXXVETIIMCPPCGHSEVVL 288
            +  ++    C  NC +   C +P                    VE  +    CGH     
Sbjct: 1780 NMEEEHLQRCLYNCDKK--CSNPQFQHRCKKACYEECGSCLYLVEVTL---DCGHRITTP 1834

Query: 289  CPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYP-GCGHIDLCLCHDI 346
            C  +++ +C + C+KKL CGH C  +C    CT +      V  P  CGHI    C  I
Sbjct: 1835 CSRINSSKCDQSCTKKLLCGHACAAKCGEE-CTLVSECSQLVGMPLSCGHIKQLTCSKI 1892



>gi|70997992|ref|XP_753728.1| DEAD box helicase involved in nonsense mediated decay [Aspergillus
           fumigatus Af293]
 gi|66851364|gb|EAL91690.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Aspergillus fumigatus Af293]
          Length = 1007

 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 146/245 (59%), Gaps = 13/245 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR+LL PIY + L DH+ V   P VPG+ D   FFF H   E    D++S + N  EA
Sbjct: 716 PEIRRLLEPIYGE-LQDHQSVFRRPKVPGMADVRSFFFSHSWPES--SDSLSSKYNVMEA 772

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            M      YLV+ G+    IT+L+ Y+GQRK+I K +R  S      + ++V +VD +QG
Sbjct: 773 EMIVGFFVYLVLNGVSIDSITVLTFYNGQRKKILKLMRNHSYLQG--QYVKVVTVDSYQG 830

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EENDI+ILSLVRS  + R IGFLS+ NRVCVALSRA++G YIFGNA  L     LWR+V+
Sbjct: 831 EENDIVILSLVRSSNAKR-IGFLSVQNRVCVALSRARNGFYIFGNAKLLYSADELWRKVI 889

Query: 180 SILEKS---KKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQSI 235
           +I+      +     + L CQKH    T +   AD+    GGC + CEE + CGH C   
Sbjct: 890 TIMANELPYRSIGFQLPLMCQKHGNT-TLIQEPADWVKTNGGCRQPCEEPLSCGHKCVLQ 948

Query: 236 CHLSS 240
           CH  S
Sbjct: 949 CHRKS 953



>gi|159126536|gb|EDP51652.1| ATP binding protein, putative [Aspergillus fumigatus A1163]
          Length = 1007

 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 146/245 (59%), Gaps = 13/245 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR+LL PIY + L DH+ V   P VPG+ D   FFF H   E    D++S + N  EA
Sbjct: 716 PEIRRLLEPIYGE-LQDHQSVFRRPKVPGMADVRSFFFSHSWPES--SDSLSSKYNVMEA 772

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            M      YLV+ G+    IT+L+ Y+GQRK+I K +R  S      + ++V +VD +QG
Sbjct: 773 EMIVGFFVYLVLNGVSIDSITVLTFYNGQRKKILKLMRNHSYLQG--QYVKVVTVDSYQG 830

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EENDI+ILSLVRS  + R IGFLS+ NRVCVALSRA++G YIFGNA  L     LWR+V+
Sbjct: 831 EENDIVILSLVRSSNAKR-IGFLSVQNRVCVALSRARNGFYIFGNAKLLYSADELWRKVI 889

Query: 180 SILEKS---KKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQSI 235
           +I+      +     + L CQKH    T +   AD+    GGC + CEE + CGH C   
Sbjct: 890 TIMANELPYRSIGFQLPLMCQKHGNT-TLIQEPADWVKTNGGCRQPCEEPLSCGHKCVLQ 948

Query: 236 CHLSS 240
           CH  S
Sbjct: 949 CHRKS 953



>gi|465959145|gb|EMP28273.1| NFX1-type zinc finger-containing protein 1 [Chelonia mydas]
          Length = 1823

 Score =  186 bits (472), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 177/343 (51%), Gaps = 26/343 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI +LLTP  +  L +H  V  Y ++ G+  NLFF +H   E+  ++  S  N  EA+
Sbjct: 1063 RPEIAQLLTPHIYQELENHPSVLKYENIKGILSNLFFVEHDFPEQEIQEGKSHQNPHEAQ 1122

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +L  Y +      S+ITIL+ Y+GQ   + K +        +   ++V  VD +QGE
Sbjct: 1123 FVVELCKYFLCQDYLPSQITILTTYTGQLFCLRKLM-----PAKIFTGVKVHVVDKYQGE 1177

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVRS++  R  GFL ISNR+CVALSRAK GLY  GN   L  +  LW +++ 
Sbjct: 1178 ENDIILLSLVRSNKEERA-GFLQISNRICVALSRAKKGLYCIGNMGMLG-KVPLWSKIIH 1235

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADF--PLEGGCSRNCEEKMDCGHICQSICHL 238
             L +     + + L CQ HP+ +T V   ADF    EGGCSR CE +++CGH+C   CH 
Sbjct: 1236 TLREKGHIGRSLMLCCQNHPDTKTLVSKGADFCRVPEGGCSRPCEFRLNCGHVCTRACHP 1295

Query: 239  S--SHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDN 294
                H +  C + C + L   GH              V+ +   P CGH ++V C   ++
Sbjct: 1296 YDLEHKEFQCMKPCQKVLCKDGHRCPQLCFERCGQCMVKVLKTIPKCGHQQMVPCSTPES 1355

Query: 295  F-----------RCKERCSKKLKCGHQCREECSS--PWCTAMC 324
                         CK  C + L C H+C++ C+   P C   C
Sbjct: 1356 SCHTCFEGRFHEHCKSPCKRFLICSHKCQQPCTRECPPCQQAC 1398



>gi|258564538|ref|XP_002583014.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237908521|gb|EEP82922.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 1937

 Score =  186 bits (472), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 135/439 (30%), Positives = 196/439 (44%), Gaps = 90/439 (20%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESE----KLERDTMSRTNTF 57
            P I +L+    +  L DH  V+ YP VPG+ D LF+ +HQ  E    + +  + S+TN F
Sbjct: 990  PSIAELVRSTIYPRLQDHPSVHEYPGVPGMRDRLFWLNHQHLEDSPDRSQTTSFSKTNLF 1049

Query: 58   EARMCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYL-------------------- 96
            E  M   L ++LV  G  +   I +++ Y GQ +++ + L                    
Sbjct: 1050 EVEMVNGLVSHLVRQGTYKREGIAVITPYLGQLQKLRERLGRSIEIVVADKDLEDLEAMD 1109

Query: 97   ---------REESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNR 147
                     +   +KT ++  +R+++VD FQGEE  +I++SLVRS+ + R  GFL   NR
Sbjct: 1110 LLDDVIDTGKNIMQKTALVNAVRLATVDNFQGEEAKVIVISLVRSN-NERNCGFLRSPNR 1168

Query: 148  VCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVF 207
              V LSRA+HG+YI GNA +      +W +V+S+L+   +    + L C +HPE  T V 
Sbjct: 1169 ANVLLSRAQHGMYIIGNA-ETASSVPMWAKVISLLKGKNQMGPRLALCCPRHPEILTGVS 1227

Query: 208  T---FADFPLEGGCSRNCEEKMDCGHICQSICHLSS-HDKIFCPENCIR----------- 252
                F  F  EGGC+R CE ++ CGH C ++CH  S HD + C E C+R           
Sbjct: 1228 KPDDFVVFSPEGGCNRKCESRLRCGHRCPNMCHSESLHDTVRCLERCVRPMKGCDHSCPK 1287

Query: 253  -----------------TLPCGHPXXXXXXXXXXX------XVETIIMCPPCGHSEVVLC 289
                             TL CGH                   V T    P CGH  VV C
Sbjct: 1288 VCGDPCETNCQVPVPGITLKCGHKPSSLKCYQAQTPSLYSCKVPTETKAPICGHKVVVPC 1347

Query: 290  ---PDVDNFRCKERCSKKLKCGHQCREEC--------SSPWCTAMCLTQTEVKYPGCGHI 338
               P  D ++CK  C + L CGH C + C        S  +   +C  +    Y  C H+
Sbjct: 1348 GKLPLKDKYQCKVVCGQLLPCGHSCAKLCMECRPADDSGVFNHGVCKIECGRSYKTCSHV 1407

Query: 339  DLCLCHDIRNKLQDGCPFC 357
                CH      +  CP C
Sbjct: 1408 CKATCHG-----ESPCPLC 1421



>gi|281203594|gb|EFA77791.1| NF-X1-type Zn finger-containing protein [Polysphondylium pallidum
            PN500]
          Length = 1647

 Score =  186 bits (472), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 178/363 (49%), Gaps = 28/363 (7%)

Query: 2    PEIRKLLTPIYHDALSDH----EEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTF 57
            P I + + P+Y   L DH    E       V G+  N+FF DH+  E    +  S++N F
Sbjct: 981  PNISQFVKPVY-PHLIDHPSVIERFIKVQKVDGMPSNVFFLDHRHMEN--SNESSKSNIF 1037

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA    +LA Y+V      + I IL+ Y+GQ       +R  ++K PVL+ I + +VD F
Sbjct: 1038 EADFVVRLAEYIVQHNYSPNNIAILTPYTGQ----LILIRSRAKKNPVLEGITIRTVDQF 1093

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE D IILSLVRS+      GFL I NR+ V LSRA++ +YI GN+  L   + LW  
Sbjct: 1094 QGEERDFIILSLVRSNNEG-STGFLKIENRINVLLSRARNAMYIVGNSQLLSKANDLWVN 1152

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSI 235
            ++S L++ KK D FI L C  HP+  T+V T ADF    EGGC+++C+ ++DCGH C   
Sbjct: 1153 LISKLKEEKKLDTFIPLVCVNHPDTITEVRTAADFDNVPEGGCNKHCDARLDCGHQCPRS 1212

Query: 236  CHLS--SHDKIFCPENCIRTLP-CGHPXXXXXXXXX----XXXVETIIMCPPCGHSEVVL 288
            CH     H  + C   C      CGH                 VETI+    CGH+    
Sbjct: 1213 CHTHDLDHYSVICSHYCEEVYEDCGHQCQSHCHNNNCGPCKTTVETIL---ECGHTAQKY 1269

Query: 289  C-PDVDNFRCKERCSKKLK-CGHQCREECSSPWC-TAMCLTQTEVKYPGCGHIDLCLCHD 345
            C  D  +  C   C +  + CGH C        C  + C+   E     CGH     CHD
Sbjct: 1270 CYADDSSVYCTSPCERTDRDCGHDCNGSHLCGQCDISKCMAPVETTL-KCGHSLTHACHD 1328

Query: 346  IRN 348
              N
Sbjct: 1329 ETN 1331



>gi|340378122|ref|XP_003387577.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1693

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 181/345 (52%), Gaps = 21/345 (6%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI  L+ P  ++ L DH+ V  Y  + G+  N+FF DH   EK     MS  N+ EA 
Sbjct: 859  RPEIANLVRPHIYEELLDHQNVKSYKPIKGIKTNMFFVDHTFPEKPMEGLMSPANSHEAD 918

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +LA YL+  G +  ++TIL+ Y+GQ   I ++++  S ++      R+  +D FQGE
Sbjct: 919  FVVRLAEYLLFQGYKPDQLTILTPYTGQVACIKEHMKTFSFES----SPRIVPIDNFQGE 974

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDIIILSLVRS +S    GF+   NR+CVALSRA+ GLY+ GN       S  W E+++
Sbjct: 975  ENDIIILSLVRSVKS----GFMKEENRICVALSRARKGLYVIGNFELFIKESQKWEEIIN 1030

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L+ ++     + L C  H +  T V   +DF    +GGC   C  +M CGH+C   CH 
Sbjct: 1031 CLD-NESFGLSLPLQCHLH-KTSTNVKLPSDFDKVRDGGCLEWCHCRMSCGHVCPRRCHP 1088

Query: 239  SSHD-KIFCPENCIRTL-PCGHPXXXXXXXX---XXXXVETIIMCPPCGHSEVVLCP-DV 292
               + K  C + C RT+    HP               V+ +I  P C H ++V C    
Sbjct: 1089 DDLEHKQKCSKPCSRTICSYNHPCPRQCSDECLPCEVLVQKVI--PSCNHQQLVPCHWSP 1146

Query: 293  DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            D F C+E C+KKL+CGH+C+ +C    C      Q  +K   CGH
Sbjct: 1147 DTFTCQEDCTKKLECGHRCQRKCGEN-CNNYQCRQLVMKMLPCGH 1190



>gi|396462560|ref|XP_003835891.1| similar to NF-X1 finger and helicase domain protein [Leptosphaeria
            maculans JN3]
 gi|312212443|emb|CBX92526.1| similar to NF-X1 finger and helicase domain protein [Leptosphaeria
            maculans JN3]
          Length = 2070

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 133/425 (31%), Positives = 197/425 (46%), Gaps = 92/425 (21%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLE----RDTMSRTNT 56
            RP+I  L+    ++ L DH+ ++  P+V GL  NLF+ DH+  E  +    + T S++N 
Sbjct: 1095 RPQISSLIRETIYEKLIDHKSISDLPNVVGLRKNLFWLDHRNFENGKDVAIQHTKSKSND 1154

Query: 57   FEARMCAKLANYLVMGGMEESR-ITILSMYSGQRKEIYKYLR------------------ 97
            +E  M   L  ++V  G+  S  I +L+ Y+GQ +++   +R                  
Sbjct: 1155 WEVDMVHALVRHVVRQGVYGSDDIAVLTPYTGQLQKLRSTMRNSFEIVLSDRDQDALEED 1214

Query: 98   -----------------EESRKTPVLKQ-----IRVSSVDGFQGEENDIIILSLVRSDES 135
                             E+ R+ P+ K+     +RV++VD FQGEE  +II+SLVRS+E 
Sbjct: 1215 GFGVEDLADMNKGSPAQEDHRQKPLQKKNFTELLRVATVDNFQGEEAKVIIVSLVRSNE- 1273

Query: 136  NRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLY 195
             R +GFL  +NR+ V LSRA+HG+Y+ GNA +      +W++V+++L  ++     + L 
Sbjct: 1274 KRNVGFLKTTNRINVLLSRAQHGMYLIGNA-ETYSNVDMWQKVINMLRANESIGSDLGLC 1332

Query: 196  CQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICHLSSHDKIF-CPENCI 251
            C +HP     V    DFP    EGGC   C ++++CGH CQS CH  S   +F C + C 
Sbjct: 1333 CPRHPATSIDVQQPEDFPKLSPEGGCREACTDRLECGHRCQSRCHSESMHAVFHCEQPCQ 1392

Query: 252  RTLPCGHP---------------------------------XXXXXXXXXXXXVETIIMC 278
            R  PCGHP                                             V+     
Sbjct: 1393 RRRPCGHPCQKATCGEPCGNCKVKLDNIKLPCGHIKDQVECYRTLDLSQIFCGVKVSKQV 1452

Query: 279  PPCGHSEVVLCP-DV--DNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTE--VKYP 333
            P CGH+ VV C  DV   NF+C   C+  L CGH C   CS    T    TQ+E  VK+ 
Sbjct: 1453 PNCGHTPVVSCSEDVTKKNFKCPTSCNTSLPCGHTCAGNCSRCKATG---TQSEVIVKHI 1509

Query: 334  GCGHI 338
             C  I
Sbjct: 1510 ACAKI 1514



>gi|340378200|ref|XP_003387616.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1999

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 121/374 (32%), Positives = 195/374 (52%), Gaps = 31/374 (8%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP+I  L+ P  +D L DHE V  Y ++     N+FFF+H+  E      +S +N  EA+
Sbjct: 1035 RPQISSLVCPFIYDELIDHETVTTYENIRSCDKNMFFFNHKHPETEIEHLLSHSNVGEAK 1094

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
            +   L  +L+  G + S+IT+L+ Y+GQ   +   + +++      + ++V ++D FQGE
Sbjct: 1095 LVVSLCRHLLKQGYKPSQITVLTAYTGQLLCVRDMMPKKN-----FEGVQVVNIDNFQGE 1149

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDII+LSLVR++E  + +GFL   NRVCVALSRA+ G Y FGN   LR    +W  +LS
Sbjct: 1150 ENDIILLSLVRNNELKK-VGFLKEENRVCVALSRARMGFYCFGNFDMLRAVVPIWDRILS 1208

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICH 237
             +E          ++C  HP+ +  +    DF +   +GGC+  C  +++CGH C+  CH
Sbjct: 1209 YIESEGCFGSSFPIHCHNHPQYKISIEKAEDFIIHFPDGGCNIPCIYRLNCGHHCRRRCH 1268

Query: 238  LS--SHDKIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC- 289
            ++  +H++  C E C +       PC  P            + + +M P CGH + + C 
Sbjct: 1269 VNDPNHEQYCCKEPCDKLCHRDLHPC--PLRCSDACKRCTYLISQVM-PSCGHIQDMECY 1325

Query: 290  PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHI---------DL 340
             +    +C   CSKK   GH C ++CS  +C   C+   +   P C HI          +
Sbjct: 1326 KNPAEEQCHNPCSKKCPNGHICHKKCSE-YC-GNCIVLVDKIIPRCKHIVQMYCFLDPSI 1383

Query: 341  CLCHDIRNKLQDGC 354
             +C++   K+ +GC
Sbjct: 1384 AICYEKCQKIYEGC 1397



>gi|452985446|gb|EME85203.1| hypothetical protein MYCFIDRAFT_134808 [Pseudocercospora fijiensis
            CIRAD86]
          Length = 1138

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 152/267 (56%), Gaps = 27/267 (10%)

Query: 2    PEIRKLLTPIYHDALSDHEEV---NHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
            PEIR++L PIY + + DH  V   +H PDVPG+   N ++F HQ +E+ + D+MS  N  
Sbjct: 739  PEIRRILHPIYANLIKDHSSVADRDHRPDVPGMGGVNSWWFTHQWAEQRD-DSMSCYNPM 797

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            E+ M      YLV  GME   IT+L+ Y+GQRK I   LR+  R++   +   V++VD +
Sbjct: 798  ESGMIVGFVEYLVYNGMETEDITVLTFYNGQRKRILSELRQ--RQSLGGRIFNVATVDSY 855

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTL--- 174
            QGEEN ++ILSL RS++S + IGFL + NRVCVALSRA+ G YIFGN   L  +  L   
Sbjct: 856  QGEENKVVILSLARSNDSKQ-IGFLGVDNRVCVALSRAQCGFYIFGNGKLLVRKLVLPAK 914

Query: 175  ---WREVLSILEKS-----------KKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCS 219
               W +V++I+  S            + DQ I + C KH  K T +    D+    GGC 
Sbjct: 915  PKTWTQVITIMAGSGEPSEVPRLEAARFDQKITVRCHKH-NKATDIKEPEDWEKFVGGCD 973

Query: 220  RNCEEKMDCGHICQSICHLSSHDKIFC 246
              C E + CGH C   CH  SHD + C
Sbjct: 974  VPCGELLSCGHPCPVTCHPFSHDHVSC 1000



>gi|391326567|ref|XP_003737784.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Metaseiulus occidentalis]
          Length = 1807

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 181/365 (49%), Gaps = 54/365 (14%)

Query: 1    RPEIRKLLTP-IYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
            R E  KLL P IY D  S HE V+ Y +V GL  NLFF  H+ SE +E +  S++N+FEA
Sbjct: 888  RDEFLKLLVPTIYADYFS-HESVSSYENVRGLAQNLFFVTHEHSENVESENSSKSNSFEA 946

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQ----RKEIYKYLREESRKTPVLKQ------- 108
                +LA YL M G   S+I IL+ YSGQ    R EIY+   E SR+   +K        
Sbjct: 947  GFVTRLALYLRMQGYSPSQIVILTTYSGQVFAIRNEIYQI--ESSRRWSGMKTIVDGRGR 1004

Query: 109  -----------------IRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVA 151
                             IR+++VD +QGEE+DI+I S VRS+   + IGFLS  NRVCVA
Sbjct: 1005 RSRVPVHPELPLSMFEGIRITTVDNYQGEESDIVIASFVRSNVDEK-IGFLSRDNRVCVA 1063

Query: 152  LSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEK--ETQVFTF 209
            LSRAK G Y  GN + L   S  W  +   L +    ++ + LYC  H  +   T+   F
Sbjct: 1064 LSRAKKGFYCVGNIAMLAKASKTWENISRTLLEGNHVNKGLELYCDTHNFRLMATEARDF 1123

Query: 210  ADFPLEGGCSRNCEEKMD-CGHICQSICH--LSSHDKIF---------CPENCIRTLPCG 257
             +F  +GGCS+ C  ++D CGH+C   CH   + H++I          C E C R +PC 
Sbjct: 1124 DEFS-DGGCSQPCGYRLDACGHVCPKTCHKLYADHEEILCCSPTKDYRCQEPCQRLMPCN 1182

Query: 258  -HPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDN-----FRCKERCSKKLKCGHQC 311
             HP            +E + M  PCGH   V C D  +       C      +L CGH+ 
Sbjct: 1183 LHPCTKKCSSPCGKCMEFVEMESPCGHMVTVQCRDSKDEDCLRHACVANVELELPCGHKN 1242

Query: 312  REECS 316
               CS
Sbjct: 1243 MIACS 1247



>gi|409044771|gb|EKM54252.1| hypothetical protein PHACADRAFT_174761 [Phanerochaete carnosa
            HHB-10118-sp]
          Length = 2312

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 178/373 (47%), Gaps = 57/373 (15%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKL-ERDTMSRTNTFEA 59
            RP+I  L+    +  L DHE V +YP V G+ +N+FFFDHQ  E   E D++S+ N FE 
Sbjct: 1251 RPQISDLIRRTLYPKLEDHESVKNYPSVRGMRENVFFFDHQHKENGGEDDSISKFNQFEV 1310

Query: 60   RMCAKLANYLVMGG--MEESRITILSMYSGQRKEIYKYL------------------REE 99
             M   L  YL+  G    E  I +L  Y GQ   +   L                  RE 
Sbjct: 1311 DMIVDLVMYLLRQGPYSAEGDIVVLCAYLGQLARMRDALAQKVTVVIDERDQRDLADREA 1370

Query: 100  SRK-----------TPVLKQIRVSSVDGFQGEENDIIILSLVRS------DE-----SNR 137
             ++             V +++R+ ++D +QGEE  I+ILSLVR+      DE     S++
Sbjct: 1371 DQEDLGDDVTTVEHVKVTRRVRLRTIDNYQGEEAKIVILSLVRNSGGAKDDETLCGHSSK 1430

Query: 138  G---IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINL 194
            G   +GFL   NR  VALSRA+ GLYI GNA  LR RS++WR VLSILE+S     F+ +
Sbjct: 1431 GRVNVGFLRSENRTNVALSRAREGLYILGNARDLRLRSSMWRSVLSILEESDCVGTFLPI 1490

Query: 195  YCQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICHLS--SHDKIFCPEN 249
             C +H ++  +V      P    +GGC R C+ ++ CGH+C   CH    +H  + C + 
Sbjct: 1491 ACHRHQDQAEKVAKPGQLPRIAPDGGCLRQCDSRLSCGHLCPYKCHSDDLNHKSVRCEQR 1550

Query: 250  CIRTLPCGHPXXXXXXXXXXXXVETIIMCP-PCGHSEVVL----CPDVDNFRCKERCSKK 304
            C R  P GHP            +  +     PCGH +  +      D+    C     K+
Sbjct: 1551 CTRLCPRGHPCSRPCADACGQCITMVSHVELPCGHVKTQVPCFALDDLSEVSCGVHLKKQ 1610

Query: 305  -LKCGHQCREECS 316
             L C H+    CS
Sbjct: 1611 LLDCEHEAEMACS 1623



>gi|443711408|gb|ELU05196.1| hypothetical protein CAPTEDRAFT_135240 [Capitella teleta]
          Length = 1363

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 170/326 (52%), Gaps = 19/326 (5%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI  L+TP  +  L++H  V  + ++ G+  NLFF +H + E     + S +N  EA 
Sbjct: 648 RPEISNLITPHIYKTLTNHPSVLTFENIRGIKGNLFFVNHSQKESNSELSSSHSNYHEAE 707

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
              +L  YL     E S++TIL+MY GQ   + K  ++ +R        +V++VD FQGE
Sbjct: 708 YLTRLVQYLFDQDYEPSQVTILTMYKGQVNLLEKKTKDLARG------FKVTTVDNFQGE 761

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           E+DII+LS VRS++ +  +GFL ISNR+CVALSRA+ GL+  GN   LR  S +W  +  
Sbjct: 762 ESDIILLSCVRSNDED-SVGFLKISNRICVALSRARMGLFGIGNMDLLRASSDVWDNICR 820

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
            +EK  +    + L C+ HPE +    T  DF     GGCS +C+ ++ CGH C   CH 
Sbjct: 821 TMEKEGQIVDALPLGCRIHPENKFLAKTADDFDDVPNGGCSEDCKFRLKCGHTCSLKCHS 880

Query: 239 SS--HDKIFCPENCIRTLPCGHPXXXXXXXXX-----XXXVETIIMCPPCGHSEVVLCPD 291
           +   H+K  C ++C      GH                   E II  P C H ++V C  
Sbjct: 881 NDERHEKYQCLKSCSSKCANGHSCSTFCHAESECPPCQTLCEKII--PKCNHVQMVPCHM 938

Query: 292 V-DNFRCKERCSKKLKCGHQCREECS 316
           +   F C   C+K L CGH C + C 
Sbjct: 939 IAGKFGCMMPCAKILACGHVCPKSCG 964



>gi|321455284|gb|EFX66421.1| hypothetical protein DAPPUDRAFT_332222 [Daphnia pulex]
          Length = 1151

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 148/261 (56%), Gaps = 5/261 (1%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPE+ +L+ P  +  L +H  V  +P VP +  N+FF DH   E  E    S  N+ EA 
Sbjct: 627 RPEVSRLIVPSVYSHLENHSSVLQHPVVPSINRNVFFIDHDHQEAREEGGSSYYNSHEAA 686

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M  +LA++L   G+++ +IT+L  Y+ Q + +  + R E  K   L ++ +++VD +QGE
Sbjct: 687 MALRLAHFLCEQGVQQEKITVLVTYAAQMRAMVAH-RREQYKLRSLDRVHITTVDNYQGE 745

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYR-STLWREVL 179
           ENDIIILSLVR++   + +GFL   NRVCVALSRA+HGL++ GN   L    S LW  V 
Sbjct: 746 ENDIIILSLVRNNRI-KSVGFLRTPNRVCVALSRARHGLFLLGNIRLLAGSGSKLWLHVQ 804

Query: 180 SILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEG-GCSRNCEEKMDCGHICQSICHL 238
           ++L K+ +  + + L C +H ++  +V     FP+ G  C   C  K+DCGH CQ  C  
Sbjct: 805 NVLTKNGELGKELTLRCDRHHQQTVKVKLPEHFPICGIVCKLKCGAKLDCGHSCQLPCRN 864

Query: 239 S-SHDKIFCPENCIRTLPCGH 258
              H    C +     LPCGH
Sbjct: 865 QCQHAVALCQQMVETLLPCGH 885



>gi|170573366|ref|XP_001892441.1| hypothetical protein [Brugia malayi]
 gi|158602007|gb|EDP38728.1| conserved hypothetical protein [Brugia malayi]
          Length = 1632

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 163/327 (49%), Gaps = 20/327 (6%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            P I   L P ++  +   E V  YP+V G   NL+F  H   E +   T SR N+FE   
Sbjct: 873  PAIANTLMPEFYPLMRSSENVFRYPNVEGCQKNLYFISHCHDEDVIFST-SRKNSFEGDF 931

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYK--YLREESRKTPVLKQIRVSSVDGFQG 119
               L+ Y V  G   S+IT+L  Y+ Q   +     L+  +   P+     V ++D +QG
Sbjct: 932  MVNLSAYFVQQGYACSQITLLCAYTAQANYVRTQIMLKFNNANLPL-----VETIDNYQG 986

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EENDI+ILSLVRS  S+   GFL ISNRVCVALSR+K GLY+ GN   L+  S LW  + 
Sbjct: 987  EENDIVILSLVRSQPSSNA-GFLGISNRVCVALSRSKLGLYVIGNMHFLKSNSALWNRLY 1045

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL----EGGCSRNCEEKMDCGHICQSI 235
              L            +C KH    TQ+   AD  L    EGGC  +C+    CGHIC   
Sbjct: 1046 ISLSDVDSIGDGFPAFCAKH--DATQIIYNADEFLIKTPEGGCYYSCDFVRPCGHICGQP 1103

Query: 236  CHLSS--HDKIFCPENCIRTLPCG--HPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPD 291
            CH +   H+K  C   C++T      HP               +    PCGH+  V+C  
Sbjct: 1104 CHRTDQEHNK-SCTHPCLKTCSTASRHPCTKLCGEPCGKCQFFVNKTFPCGHTTGVVCYL 1162

Query: 292  VDNFRCKERCSKKLKCGHQCREECSSP 318
             +   C+++CSK+L CGHQCR++C  P
Sbjct: 1163 FEEAVCQQKCSKELPCGHQCRKKCREP 1189



>gi|449298169|gb|EMC94186.1| hypothetical protein BAUCODRAFT_141556 [Baudoinia compniacensis
           UAMH 10762]
          Length = 1128

 Score =  180 bits (457), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 110/259 (42%), Positives = 145/259 (55%), Gaps = 21/259 (8%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHY---PDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
           PE+R+LL PIY + + DH  V H    PDVPG+   N FFF HQ  E+L+ D MS  N  
Sbjct: 735 PEVRRLLQPIYKNLIEDHASVKHSANRPDVPGMGGVNSFFFTHQWPEQLD-DQMSAFNVD 793

Query: 58  EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIR--VSSVD 115
           EA M      YLV  G+E   ITIL+ Y+GQRK+    LR+     P L      V +VD
Sbjct: 794 EAEMIVGFVEYLVYNGVETKDITILTFYNGQRKQFLSKLRQR----PSLSGYTGPVVTVD 849

Query: 116 GFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQ-LRYRSTL 174
            +QGEEN I+ILSLVRS+   + IGFLS+ NRVCVALSRA+ G Y+FGN ++  +    L
Sbjct: 850 SYQGEENKIVILSLVRSNNKLK-IGFLSVDNRVCVALSRAQCGFYMFGNGNKGPKAEDRL 908

Query: 175 WREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQ 233
             E LS +  +      + + C  H +  T + +  D+  + GGC   C   + CGH C+
Sbjct: 909 KSEPLSRVSTT------LPVRCSVH-DNRTLIGSSTDWDKITGGCELKCTGTLPCGHACE 961

Query: 234 SICHLSSHDKIFCPENCIR 252
             CH   HD I C + C R
Sbjct: 962 LTCHPFDHDVINCVQRCGR 980



>gi|189238133|ref|XP_001814326.1| PREDICTED: similar to NFX1-type zinc finger-containing protein 1
           [Tribolium castaneum]
 gi|270008819|gb|EFA05267.1| hypothetical protein TcasGA2_TC015422 [Tribolium castaneum]
          Length = 1004

 Score =  179 bits (455), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 148/258 (57%), Gaps = 14/258 (5%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI  LL    +  L DHE V + P +PG+  N+FF DH + E+    T ++ NT EAR
Sbjct: 430 RPEIADLLRVRIYPFLKDHESVLNRPGIPGMHKNVFFVDHNQGEETSSLT-TKKNTHEAR 488

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               LA YL++ G + S I IL+ Y GQ  EI K ++ ++     L+ ++VS++DGFQG+
Sbjct: 489 FLVFLARYLILNGHKSSDIVILATYLGQMLEIEKLVKSQT----CLEGVKVSTLDGFQGQ 544

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           E +I++LSLVRS      IGFL   NR+CVALSRA+ G YI G  + L  +S +W  V  
Sbjct: 545 EAEIVLLSLVRSSH----IGFLKAENRICVALSRARSGFYIMGKMALLAGKSQIWNGVKR 600

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
            L K     + I L CQKH +  TQV T  DF     GGC   C E M CGH C  +CH 
Sbjct: 601 CLAKQGAIGRKIALVCQKH-KTVTQVETIDDFQNVQNGGCHLKCCEIMACGHNCVLLCH- 658

Query: 239 SSHDKIFCPENCI-RTLP 255
           +S+ K  C   C+ R+ P
Sbjct: 659 TSYLKHKCERKCVTRSTP 676



>gi|66821279|ref|XP_644135.1| hypothetical protein DDB_G0274483 [Dictyostelium discoideum AX4]
 gi|60472181|gb|EAL70134.1| hypothetical protein DDB_G0274483 [Dictyostelium discoideum AX4]
          Length = 1638

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 183/344 (53%), Gaps = 30/344 (8%)

Query: 2    PEIRKLLTPIY-----HDALSDHEEVN----HYPDVPGLTDNLFFFDH--QESEKLERDT 50
            P I + + P+Y     H ++ + E +N    +   V G+  N++FFDH  +ES   E   
Sbjct: 1080 PSISQFVVPVYPNLQNHSSVVEKERINSADGYRSIVRGVLYNVYFFDHSNRESRAQEPHI 1139

Query: 51   MSRTNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESR--------- 101
             S++N FEAR+    ANYL+    E  RITIL+ Y+GQ  EI   + E+ +         
Sbjct: 1140 NSKSNAFEARLITSFANYLLDQNYEPERITILAPYAGQLLEINDAINEKMKHSSNVPPQG 1199

Query: 102  KTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYI 161
            +T  L++I V +VD +QGEENDIII+S VR++E N   GFLS++NR+ V LSRA+ GL+I
Sbjct: 1200 QTHPLQRILVRTVDQYQGEENDIIIISSVRNNERNVA-GFLSLTNRINVMLSRAREGLFI 1258

Query: 162  FGNASQL---RYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLE 215
            FGN   L   R  + +W+ +   LE++ +  + + L C+ H +  T +    DF     +
Sbjct: 1259 FGNRELLERSREDAGIWKNMFPKLEENNQVGKTLPLVCENHRKGITHIRDEKDFIQYAKD 1318

Query: 216  GGCSRNCEEKMDCGHICQSICH-LSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVET 274
            GGCS+ C   +DCGH C   CH L ++    C + C++ L CGH             V+ 
Sbjct: 1319 GGCSKPCAFLLDCGHTCSKKCHPLQTNHNFNCNKPCLKQLDCGHLCQLECCKICRCEVDI 1378

Query: 275  IIMCPPCGHSEVVLCPDVDN--FRCKERCSKKLKCGHQCREECS 316
                P CGHS    C  V N   RC E CSK    G +C ++CS
Sbjct: 1379 DKTHPRCGHSVKTPCYRVLNPFDRCCEPCSKLNDKGLKCLKKCS 1422



>gi|317151632|ref|XP_001824793.2| ATP binding protein [Aspergillus oryzae RIB40]
          Length = 1048

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 152/267 (56%), Gaps = 22/267 (8%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR+LL P+Y + L DH  V   P VPG+ D   +FF H   E    D++S + N  EA
Sbjct: 717 PEIRRLLEPLYGE-LHDHPSVLERPRVPGMGDFRSYFFSHNWPES--NDSLSSKYNEKEA 773

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            M      +LV+ G+    IT+L+ Y+GQRK++ K  +  S      + + V +VD FQG
Sbjct: 774 EMVVGFFMHLVLNGVAVKDITVLTFYNGQRKKLLKLFKGNSYLQG--QYVNVVTVDSFQG 831

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+I+ILSLVRS      IGFLSI NRVCVALSRA+ G Y+FG+++ L    +LW +V+
Sbjct: 832 EENEIVILSLVRSGRPT--IGFLSIENRVCVALSRARTGFYMFGDSTALADADSLWWQVV 889

Query: 180 SIL---EKSKKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHI 231
           +++      ++   ++ L C KH     +   +   P E     GGC   C E++ CGH 
Sbjct: 890 TLMGGKNPKRRLGFYLPLTCTKH-----ENVIYKKDPSEWDTAYGGCDLPCNERLGCGHR 944

Query: 232 CQSICHLSSHDKIFCPENCIRTLPCGH 258
           C   CH  SHD++ C E C R + CGH
Sbjct: 945 CSLPCHSFSHDQVKCTEVCDRQMRCGH 971



>gi|66815813|ref|XP_641923.1| NF-X1-type zinc finger-containing protein [Dictyostelium discoideum
            AX4]
 gi|60470001|gb|EAL67982.1| NF-X1-type zinc finger-containing protein [Dictyostelium discoideum
            AX4]
          Length = 1793

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 189/364 (51%), Gaps = 27/364 (7%)

Query: 2    PEIRKLLTPIYHDALSDHEEV----NHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTF 57
            P I + + PIY + L +H EV         + G+  N+FF +H   E    ++ S++N F
Sbjct: 1121 PNISQFIHPIYPN-LRNHPEVLIRFATESTIKGIQKNIFFLEHTIPESSPTESTSKSNLF 1179

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA     LA+YL+    + + I IL+ Y+GQ  +I   +R  +RK  +L +++V +VD +
Sbjct: 1180 EADYVVGLADYLLKQEYKPTDIVILTPYTGQLLKIKNQIR--NRKHELLSKVQVRTVDQY 1237

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE +I+ILSLVRS+E     GF+ I NR+ VA+SRA++ +Y+ GN+  LR  + +W  
Sbjct: 1238 QGEECNIVILSLVRSNERGDS-GFVKIKNRINVAISRARNAMYLVGNSDLLRKANPIWEN 1296

Query: 178  VLSILEKS--KKCDQFINLYCQKHPEKETQVFT---FADFPLEGGCSRNCEEKMDCGHIC 232
            +  IL +         + L C+ H ++ T + +   FA+ P +GGC  NC  +++CGH C
Sbjct: 1297 MFKILSEPSVNAIGPILKLRCENHKDQITNITSGKDFANVP-QGGCLLNCSTRLECGHQC 1355

Query: 233  QSICHLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCP-------PCGHSE 285
               CH+   D I    N   T PC H              +   +C        PCGH +
Sbjct: 1356 GLACHIFDQDHI----NIKCTKPCEHIHQKCGHTCKKTCSDDCGLCEVLVDRDLPCGHKK 1411

Query: 286  VVLCP-DVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCH 344
             + C  D   ++C+E C K+ +CGH+C  +CS       C  + E K   CGHI+   C+
Sbjct: 1412 KLACNIDPLQYKCQEPCQKQRRCGHKCELKCSEYCEKNNCKEKVEKKLQ-CGHIETKECY 1470

Query: 345  DIRN 348
            +  N
Sbjct: 1471 NNSN 1474



>gi|238505152|ref|XP_002383805.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Aspergillus flavus NRRL3357]
 gi|220689919|gb|EED46269.1| DEAD box helicase involved in nonsense mediated decay, putative
           [Aspergillus flavus NRRL3357]
          Length = 1048

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 152/267 (56%), Gaps = 22/267 (8%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR+LL P+Y + L DH  V   P VPG+ D   +FF H   E    D++S + N  EA
Sbjct: 717 PEIRRLLEPLYGE-LHDHPSVLERPRVPGMGDFRSYFFSHNWPES--NDSLSSKYNEKEA 773

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            M      +LV+ G+    IT+L+ Y+GQRK++ K  +  S      + + V +VD FQG
Sbjct: 774 EMIVGFFMHLVLNGVAVKDITVLTFYNGQRKKLLKLFKGNSYLQG--QYVNVVTVDSFQG 831

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+I+ILSLVRS      IGFLSI NRVCVALSRA+ G Y+FG+++ L    +LW +V+
Sbjct: 832 EENEIVILSLVRSGRPT--IGFLSIENRVCVALSRARTGFYMFGDSTALADADSLWWQVV 889

Query: 180 SIL---EKSKKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDCGHI 231
           +++      ++   ++ L C KH     +   +   P E     GGC   C E++ CGH 
Sbjct: 890 TLMGGKNPKRRLGFYLPLTCTKH-----ENVIYKKDPSEWDTAYGGCDLPCNERLGCGHR 944

Query: 232 CQSICHLSSHDKIFCPENCIRTLPCGH 258
           C   CH  SHD++ C E C R + CGH
Sbjct: 945 CSLPCHSFSHDQVKCTEVCDRQMRCGH 971



>gi|402084911|gb|EJT79929.1| hypothetical protein GGTG_05011 [Gaeumannomyces graminis var. tritici
            R3-111a-1]
          Length = 1305

 Score =  178 bits (452), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 113/273 (41%), Positives = 149/273 (54%), Gaps = 21/273 (7%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEA 59
            +PEIR+LL   Y + LSDH  V   PDVPG+   N++ F HQ  E+++ D  S+ N  EA
Sbjct: 759  KPEIRQLLDHFY-EGLSDHPLVASRPDVPGMGGRNMWLFHHQWPEEMDADC-SKYNRQEA 816

Query: 60   RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK---QIRVSSVDG 116
             M  K   YLV  G +   ITIL+ Y+GQRK + + LR E    P L+      V +VD 
Sbjct: 817  EMAVKFFAYLVNNGTDPGLITILTFYNGQRKVLLRMLRNE----PALRGMSSFNVFTVDS 872

Query: 117  FQGEENDIIILSLVRSDESNRG--IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRST- 173
            +QGEEND++ILSLVRS + +    +GFL   NR  VA+SRA+ G YIFGN   L   +  
Sbjct: 873  YQGEENDVVILSLVRSPKPDAQYLVGFLEDRNRATVAISRARCGFYIFGNFINLLRANEE 932

Query: 174  ---LWREVLSILEKSKKCD--QFINLYCQKHPEKETQVFTFADFPLE-GGCSRNCEEKMD 227
               +W  V S    +   D  + + + CQ+H   ET +    DF    GGC R C   + 
Sbjct: 933  SFYVWGNVHSCFAVNGYLDTARGLPIVCQQHGS-ETWIKGLDDFVGNAGGCRRMCTGHLP 991

Query: 228  CGHICQSICHLSSHDKIFCPENCIRTLP-CGHP 259
            CGH C+  CH   HD   C E C + LP CGHP
Sbjct: 992  CGHKCRLACHWRRHDSYACSEPCTKKLPSCGHP 1024



>gi|340370919|ref|XP_003383993.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1982

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 180/354 (50%), Gaps = 39/354 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI KL+ P  +  L DH++V +Y  V G+  N+FF +H   EK     MS  N+ EA 
Sbjct: 1150 RPEIAKLVCPHIYQELFDHQKVLNYKSVKGMKTNMFFVNHTFPEKPMEGLMSPANSHEAD 1209

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQR---KEIYKYLREESRKTPVLKQIRVSSVDGF 117
               +LA YL+  G +  ++TIL+ Y+GQ    KE  K    ES         R+  +D F
Sbjct: 1210 FVVRLAKYLLFQGYKPDQLTILTPYTGQVACIKECIKSFAFESSP-------RIVPIDNF 1262

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEENDIIILSLVRS +S    GF+   NR+CVALSRAK GLY+ GN       S  W++
Sbjct: 1263 QGEENDIIILSLVRSVKS----GFMKEENRICVALSRAKKGLYVIGNFELFMKESQTWKK 1318

Query: 178  VLSILEKSKKCDQF--INLYCQKHPEKE-TQVFTFADFP--LEGGCSRNCEEKMDCGHIC 232
            +++ L+     + F  ++L  Q H  K  T V    DF    +GGC   C  +M CGH+C
Sbjct: 1319 IINSLD-----NNFFGLSLPLQCHLHKTITDVKLPVDFDKVKDGGCLELCCYRMVCGHVC 1373

Query: 233  QSICHLSSHD-KIFCPENCIRTL-----PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEV 286
               CH    + K  C + C RT+     PC                +TI   P C H ++
Sbjct: 1374 PRRCHPDDLEHKQPCLKPCSRTICSFDHPCPRLCSEKCPPCKESVWKTI---PSCNHQQL 1430

Query: 287  VLC---PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            V C   PD+  F C+E C K L+CGH+C+  C    CT     +  +K   CGH
Sbjct: 1431 VPCHCSPDI--FTCQEECIKMLECGHRCKRRCGEK-CTNYQCPELVMKMLPCGH 1481



>gi|512206582|gb|EPE35401.1| P-loop containing nucleoside triphosphate hydrolase [Glarea
            lozoyensis ATCC 20868]
          Length = 1291

 Score =  177 bits (448), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 159/282 (56%), Gaps = 33/282 (11%)

Query: 2    PEIRKLL----TPIYHDALSDHE---EVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSR 53
            P+IR LL     P Y + L DH+   E+++ P VPG+   N++FF H  +E    D MS 
Sbjct: 730  PDIRGLLCVEANPFYLN-LRDHDSVLELDNRPPVPGMGGINVYFFHHTWTECRNAD-MSI 787

Query: 54   TNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSS 113
             N  EA+M     N+L+M G++ + ITIL+ Y+GQRK I   L+     + +L   +V +
Sbjct: 788  NNQDEAQMIVAHFNHLLMNGVDANDITILTFYNGQRKAILHQLKRHPGLSGIL-YFKVFT 846

Query: 114  VDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRY--- 170
            VD +QGEENDIIILSLVRS+ S   IGFL   NR+ VALSRA+ GLYI+GN++ L     
Sbjct: 847  VDSYQGEENDIIILSLVRSN-STMSIGFLENKNRLVVALSRARRGLYIYGNSTTLTVGEE 905

Query: 171  ------RSTLWREVLSILEKSK--KCDQFINLYCQKHPEKETQVFTFADFP-----LEGG 217
                  R  LW  ++  ++       D+ + +YC++H EK      + + P     L GG
Sbjct: 906  SENYVGRDPLWWPLIEHMKYRGWYNFDRGLPIYCERHKEK-----IYVEDPDDWVGLNGG 960

Query: 218  CSRNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTLPCGHP 259
            CSR CE  +DCGH C   CH   H  + C E+C   + CGHP
Sbjct: 961  CSRECEGSLDCGHSCPYACHPFDHSTVECAESCPLMVECGHP 1002



>gi|134075955|emb|CAK48149.1| unnamed protein product [Aspergillus niger]
          Length = 1147

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 151/244 (61%), Gaps = 18/244 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGL-TDNLFFFDHQESEKLERDTM-SRTNTFEA 59
           PEIR+LL PIY + L DHE V   P V G+ T   +FF H   E   RD + S+ N  EA
Sbjct: 717 PEIRQLLEPIYGE-LYDHESVRKRPGVKGMGTIRSYFFTHLWPES--RDNLASKYNEMEA 773

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGF 117
           +M A+   YLV  G     ITIL+ Y+GQRK++   LR      P L+   ++V +VD +
Sbjct: 774 QMIAEFVVYLVQNGNTVKDITILTFYNGQRKKLLTVLRHH----PYLQGQYVKVVTVDSY 829

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN+I+ILSLVRS E++  IGFLSI+NRVCVALSRA+ G Y+FGNA+ L  ++ LWR+
Sbjct: 830 QGEENEIVILSLVRSGEND--IGFLSIANRVCVALSRARRGFYMFGNANLLVKQNRLWRD 887

Query: 178 VLSILEKSKKCDQF---INLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQ 233
           VL+++  +K        + + C +H ++ T +   +D+  + GGC   C+  +DCGH C 
Sbjct: 888 VLTLMANNKPPRHLGAQLPVTCVEH-KRTTFIQGLSDWNKINGGCDSPCDGVLDCGHPCP 946

Query: 234 SICH 237
             CH
Sbjct: 947 IKCH 950



>gi|350635573|gb|EHA23934.1| hypothetical protein ASPNIDRAFT_181522 [Aspergillus niger ATCC
           1015]
          Length = 947

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 151/244 (61%), Gaps = 18/244 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGL-TDNLFFFDHQESEKLERDTM-SRTNTFEA 59
           PEIR+LL PIY + L DHE V   P V G+ T   +FF H   E   RD + S+ N  EA
Sbjct: 691 PEIRQLLEPIYGE-LYDHESVRKRPGVKGMGTIRSYFFTHLWPES--RDNLASKYNEMEA 747

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGF 117
           +M A+   YLV  G     ITIL+ Y+GQRK++   LR      P L+   ++V +VD +
Sbjct: 748 QMIAEFVVYLVQNGNTVKDITILTFYNGQRKKLLTVLRHH----PYLQGQYVKVVTVDSY 803

Query: 118 QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
           QGEEN+I+ILSLVRS E++  IGFLSI+NRVCVALSRA+ G Y+FGNA+ L  ++ LWR+
Sbjct: 804 QGEENEIVILSLVRSGEND--IGFLSIANRVCVALSRARRGFYMFGNANLLVKQNRLWRD 861

Query: 178 VLSILEKSKKCDQF---INLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEKMDCGHICQ 233
           VL+++  +K        + + C +H ++ T +   +D+  + GGC   C+  +DCGH C 
Sbjct: 862 VLTLMANNKPPRHLGAQLPVTCVEH-KRTTFIQGLSDWNKINGGCDSPCDGVLDCGHPCP 920

Query: 234 SICH 237
             CH
Sbjct: 921 IKCH 924



>gi|296416458|ref|XP_002837896.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633782|emb|CAZ82087.1| unnamed protein product [Tuber melanosporum]
          Length = 1844

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 172/357 (48%), Gaps = 48/357 (13%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESE----KLERDTMSRTNTF 57
            P I  L+    +  L DH    + P VPGL   LF+ DH+  E    K E    S  N F
Sbjct: 884  PSISALIRNTLYPKLQDHFTTLNNPPVPGLAKRLFWMDHRHPEAGADKTELIQTSHANDF 943

Query: 58   EARMCAKLANYLVMGGMEES-RITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDG 116
            E  M   L  +L   G+ +S  I +L+ Y  Q   + K L     K  +L ++R+++VD 
Sbjct: 944  EVDMVVGLVRHLSRQGVYKSGDIAVLTPYLRQMFNLRKKL---GSKGDLLSEVRIATVDN 1000

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            FQGEE  ++I+SLVRS+++ R  GFL  SNR+ V LSRA+HG+YIFGNA+       +W 
Sbjct: 1001 FQGEEAKVVIISLVRSNDAGR-CGFLRTSNRINVLLSRAQHGMYIFGNAATCN-GVKMWS 1058

Query: 177  EVLSILEKSKKCDQFINLYCQKHPEKETQVFT---FADFPLEGGCSRNCEEKMDCGHICQ 233
            +V+ +LE+    D+ + L C +HP+   +V T   F  F  EGGC   CE ++DCGH C 
Sbjct: 1059 DVIGMLEQEGSIDETLALCCPRHPDTPIKVKTPEEFHIFSPEGGCMERCEWRLDCGHPCV 1118

Query: 234  SICH----------LSSHDKIF------CP-------ENCIRT-----LPCGHPXXXXXX 265
              CH          +   ++IF      CP       +NC+ +     LPCGH       
Sbjct: 1119 KKCHSDTLHRNTVCMDKCERIFKHCDHPCPKACGVACDNCVISVPGAILPCGHISSTLKC 1178

Query: 266  XXXXXXV------ETIIMCPPCGHSEVVLC-PDVDNFRCKERCSKKLKCGHQCREEC 315
                         E     P CGH   + C  DVD   C E C   L CGHQC  +C
Sbjct: 1179 FELQNLAGVKCKREVKRKLPLCGHVVSLKCHVDVDRRECNEPCGAILPCGHQCTMKC 1235



>gi|347841006|emb|CCD55578.1| hypothetical protein BofuT4_P155690.1 [Botryotinia fuckeliana T4]
          Length = 1292

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 151/279 (54%), Gaps = 35/279 (12%)

Query: 3    EIRKLL----TPIYHDALSDHEEV----NHYPDVPGLTDNLFFFDHQESEKLERD-TMSR 53
            EIR+LL     P Y D L DH+ V    NH P VPG+  + +FF H+  E   RD  MS 
Sbjct: 734  EIRELLCIEPNPFYVD-LHDHQNVRDRVNHRPPVPGMNYDSYFFSHKWQE--HRDVNMSC 790

Query: 54   TNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYL--REESRKTPVLKQIRV 111
             N  EA M A   NYLV+ G++   IT+L+ Y+GQRK + K L  R  S  TP  K   V
Sbjct: 791  YNAPEAEMVAGFFNYLVLNGVQPENITVLTYYNGQRKLLLKELSRRVTSVATPYFK---V 847

Query: 112  SSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLR-- 169
             +VD +QGEEN++I+LSLVR +  +  +GFL   NRV VALSRA+ GLYIFGNA  +   
Sbjct: 848  YTVDAYQGEENEVILLSLVRGN-PHSSVGFLRSKNRVVVALSRAQRGLYIFGNAITVAGQ 906

Query: 170  -----YRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP-----LEGGCS 219
                  R  LW  +L  L   +K    + + C KH     Q  T+   P     L GGC 
Sbjct: 907  EADNGSREKLWMPILLHLLDERKFGSKLPILCSKH-----QNHTYVSEPEHWEDLSGGCH 961

Query: 220  RNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTLPCGH 258
              C   + CGH+C   CH + H+K+ C E C + L CGH
Sbjct: 962  EACGGILPCGHLCPYKCHPTPHNKVLCKEPCEKLLDCGH 1000



>gi|472240422|gb|EMR85193.1| putative dead box helicase protein [Botryotinia fuckeliana BcDW1]
          Length = 1292

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 151/279 (54%), Gaps = 35/279 (12%)

Query: 3    EIRKLL----TPIYHDALSDHEEV----NHYPDVPGLTDNLFFFDHQESEKLERD-TMSR 53
            EIR+LL     P Y D L DH+ V    NH P VPG+  + +FF H+  E   RD  MS 
Sbjct: 734  EIRELLCIEPNPFYVD-LHDHQNVRDRVNHRPPVPGMNYDSYFFSHKWQE--HRDVNMSC 790

Query: 54   TNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYL--REESRKTPVLKQIRV 111
             N  EA M A   NYLV+ G++   IT+L+ Y+GQRK + K L  R  S  TP  K   V
Sbjct: 791  YNAPEAEMVAGFFNYLVLNGVQPENITVLTYYNGQRKLLLKELSRRVTSVATPYFK---V 847

Query: 112  SSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLR-- 169
             +VD +QGEEN++I+LSLVR +  +  +GFL   NRV VALSRA+ GLYIFGNA  +   
Sbjct: 848  YTVDAYQGEENEVILLSLVRGN-PHSSVGFLRSKNRVVVALSRAQRGLYIFGNAITVAGQ 906

Query: 170  -----YRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP-----LEGGCS 219
                  R  LW  +L  L   +K    + + C KH     Q  T+   P     L GGC 
Sbjct: 907  EADNGSREKLWMPILLHLLDERKFGSKLPILCSKH-----QNHTYVSEPEHWEDLSGGCH 961

Query: 220  RNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTLPCGH 258
              C   + CGH+C   CH + H+K+ C E C + L CGH
Sbjct: 962  EACGGILPCGHLCPYKCHPTPHNKVLCKEPCEKLLDCGH 1000



>gi|290981792|ref|XP_002673615.1| Zinc-finger domain-containing protein [Naegleria gruberi]
 gi|284087200|gb|EFC40871.1| Zinc-finger domain-containing protein [Naegleria gruberi]
          Length = 1991

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 176/324 (54%), Gaps = 13/324 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPE+R+L+  ++++ L DHE V  + +V G++ N+ F +H++ EK   D  S TN  EA 
Sbjct: 1314 RPEVRELVD-MFYEKLIDHESVKQFENVNGVSKNVCFIEHKKLEKTSDDVQSLTNPHEAE 1372

Query: 61   MCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
               K + YL+ +   + S+ITIL+ Y GQ   I K LRE   +  + +++RVS+VD +QG
Sbjct: 1373 FLCKFSKYLLNVRQFKASQITILTPYRGQVILIKKTLRELLNQD-LYRELRVSTVDDYQG 1431

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
            EEN+II+LSLVRS+ +   +GF+ I+NR+ V+LSRAK GLYI GN   LR     WR+V 
Sbjct: 1432 EENEIILLSLVRSN-NFENLGFVKITNRIIVSLSRAKKGLYIIGNHDLLRNNED-WRKVF 1489

Query: 180  SILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICH 237
            + L+ S +    + L C  H E+   +   +DF   + GGC + C  +  CGHIC   CH
Sbjct: 1490 ARLKHSDRILDHLPLSCPTHSEERECIREPSDFDGVIWGGCKKPCTYRYPCGHICSLPCH 1549

Query: 238  LSS-HDKIFCPENCIRTLP-CGH---PXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDV 292
              S H +  C + C      CGH                 +       CGH   V C   
Sbjct: 1550 HDSLHKERKCEKICGEKYEDCGHRCEDKCHHGKSCPKCKTKVDYKFVACGHVTKVACHLK 1609

Query: 293  DNFR-CKERCSKKLKCGHQCREEC 315
            +  + CK  C+K L CGH CR +C
Sbjct: 1610 NTTQLCKSTCNKLLGCGHNCRGQC 1633



>gi|258570863|ref|XP_002544235.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237904505|gb|EEP78906.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 1046

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 141/245 (57%), Gaps = 26/245 (10%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L PIYH+ L DHE V + P +PG+ + + +FF H   E  +   +S+ N  EA+
Sbjct: 687 PEIRRMLAPIYHN-LEDHEAVLNRPGIPGMGNLSSYFFCHAWPESSD-SLLSKYNENEAK 744

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLK--QIRVSSVDGFQ 118
           M      YL M G+    IT+L+ Y+GQRK+I K L++     P+L+    +V +VD +Q
Sbjct: 745 MVVGFYLYLFMNGVSAEHITVLTFYNGQRKKILKALKD----APLLQGQYAKVVTVDSYQ 800

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN++++LSLVRS E N  IGFLS+ NRVCVALSRAK G YIFGNA  L  R+ LW EV
Sbjct: 801 GEENEVVLLSLVRSGEHN--IGFLSVENRVCVALSRAKRGFYIFGNAEALSIRNGLWWEV 858

Query: 179 LSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL----EGGCSRNCEEKMDCGHICQS 234
           + I+ K             K P    +       PL       C R C + + CGH C+ 
Sbjct: 859 VQIMRKEP-----------KRPRDVEEAGWGVSIPLFTHERVRCGRPCRQLLPCGHECKK 907

Query: 235 ICHLS 239
            C LS
Sbjct: 908 KCFLS 912



>gi|395325918|gb|EJF58333.1| hypothetical protein DICSQDRAFT_110272 [Dichomitus squalens LYAD-421
            SS1]
          Length = 2246

 Score =  174 bits (441), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 181/408 (44%), Gaps = 76/408 (18%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RP I   +  I +  L D+E V  YP V G+  +++F +H   E    D++S+ NT+E  
Sbjct: 1194 RPTISHFIREILYPKLEDNEIVTRYPPVQGMQKDVYFLNHLNKENGTEDSVSKFNTYEVD 1253

Query: 61   MCAKLANYLVMGGMEE--SRITILSMYSGQRKEIYKYLRE-------------------- 98
            M   L  Y +  G       I +L  Y GQ +++   LR+                    
Sbjct: 1254 MIKDLVLYFLRQGAYSGPGDIAVLCAYLGQLQKVRAALRDLKIAVSVDERDADQLARQGL 1313

Query: 99   ----ESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRS----DESNRGIGFLSISNRVCV 150
                E ++  V K IR+ +VD FQG+E  I+I+SLVR+    D  +  IGFL  +NR+ V
Sbjct: 1314 DEDVEFQEVVVAKHIRLGTVDIFQGQEAKIVIVSLVRNSGQIDTESASIGFLKSANRINV 1373

Query: 151  ALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFA 210
            ALSRAKHGL++ GNA+ LR ++ +W  +L  +E   +      + C +HPE+   V    
Sbjct: 1374 ALSRAKHGLFVLGNAANLR-KNQIWSTILDEMESRDQIGPAFPIVCPRHPEQVQLVSKPG 1432

Query: 211  DFPL---EGGCSRNCEEKMDCGHICQSICH--LSSHDKIFCPENCIR------------- 252
              PL    GGC   C  ++ CGHIC S CH  L +H  + C E C R             
Sbjct: 1433 QLPLYAPAGGCVLPCNARLACGHICPSACHAVLDNHRSVRCMEPCNRTPCPRQHPCSRRC 1492

Query: 253  --------------TLPCGHPXXX------XXXXXXXXXVETIIMCPPCGHSEVVLC-PD 291
                          TLPCGH                    + +   P C HS +V C  D
Sbjct: 1493 SDDCGRCEFPMYSVTLPCGHTASKVPCHKLQDLYSVQCTKQVLKKLPGCEHSAIVACHED 1552

Query: 292  VDNFRCKERCSKKLK-CGHQCREECSSPWCTAMCLTQTEVKYPGCGHI 338
              N  C E C  KL+ C   C+  CS   C ++ + +T+   P  G +
Sbjct: 1553 PANAWCSEPCGGKLQCCSRTCKASCSD--CRSLTVQRTQ---PAVGKM 1595



>gi|393911665|gb|EJD76411.1| NFX1-type zinc finger-containing protein 1 [Loa loa]
          Length = 1968

 Score =  174 bits (441), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/330 (35%), Positives = 161/330 (48%), Gaps = 31/330 (9%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
            P I     P ++  + + + V  YPDV G   NL+F +H   E +   T S  N+FE   
Sbjct: 1160 PAISNTFMPEFYPLMKNADNVLSYPDVKGCRKNLYFINHSHEEDVLFST-SHKNSFEGDF 1218

Query: 62   CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGEE 121
              +L+ Y +  G   S+IT+L  Y+ Q      Y+R +  K        V +VD +QGEE
Sbjct: 1219 MIRLSTYFIQQGYSCSQITLLCAYTAQAN----YVRTQMLKFNNSSLPLVETVDNYQGEE 1274

Query: 122  NDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSI 181
            NDIIILSL+RS  SN GIGFL +SNRVCVALSR++ GLY+ GN   LR  S LW  +   
Sbjct: 1275 NDIIILSLIRSQPSN-GIGFLGVSNRVCVALSRSRLGLYVIGNMHFLRSNSLLWHRLCIA 1333

Query: 182  LEKSKKCDQFINLYCQKHPEKETQVFTFADFPL----EGGCSRNCEEKMDCGHICQSICH 237
            L  +         +C KH    TQ+   AD  L    EGGC   C+    CGHIC   CH
Sbjct: 1334 LANADCIGVGFPAFCAKH--DVTQIIHSADEFLIKTPEGGCYCPCDFVRPCGHICGQPCH 1391

Query: 238  LSSHD-KIFCPENCIRTLP----------CGHPXXXXXXXXXXXXVETIIMCPPCGHSEV 286
             +  + +  C   C++T            CG                      PCGH+  
Sbjct: 1392 RTDPEHRTTCTHPCLKTCSKLFRHLCTKLCGESCGTCQSFENKTF--------PCGHATS 1443

Query: 287  VLCPDVDNFRCKERCSKKLKCGHQCREECS 316
            V+C   +   C+E+C K+L CGH+C ++CS
Sbjct: 1444 VVCYLFEETVCQEKCLKELPCGHRCTKKCS 1473



>gi|440640027|gb|ELR09946.1| hypothetical protein GMDG_04422 [Geomyces destructans 20631-21]
          Length = 1866

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 181/390 (46%), Gaps = 79/390 (20%)

Query: 2    PEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESE---KLERDTMSRTNTF 57
            P I +L+  P+Y D L DH  V+ YP+V G+   L++ +HQE+E     +  ++SRTN+F
Sbjct: 909  PSISELVRVPLYPD-LQDHPSVSEYPEVDGMRHRLYWLNHQENEDPRNAQAVSLSRTNSF 967

Query: 58   EARMCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYL-------------------- 96
            E  M A L ++LV  G      I +++ Y GQ ++I K L                    
Sbjct: 968  EVEMVASLVSHLVRQGTYGPEDIAVITPYLGQLQKIKKRLANSFEIIVGDRDQEDLQAQG 1027

Query: 97   ----------REESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISN 146
                      R + +KT +L  +R+++VD FQGEE  +I++SLVRS++  +  GFL  SN
Sbjct: 1028 LQDDPEAKDGRIQIQKTTLLSSLRIATVDNFQGEEAKVIVVSLVRSNKDQK-CGFLKTSN 1086

Query: 147  RVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQV 206
            R+ V LSRA+HG+YI GN+   R    +W +VLS+LE+S      + L C +H E   +V
Sbjct: 1087 RINVLLSRARHGMYIIGNSDTSR-PVPMWAKVLSVLERSNNIGPSLALCCPRHKETPIEV 1145

Query: 207  FTFADF---PLEGGCSRNCEEKMDCGHICQSICHLSS-HDKIFCPENCIRT--------- 253
                DF     EGGC++ C  ++ CGH C ++CH SS H  + C E C RT         
Sbjct: 1146 SVPDDFSRLAPEGGCAKRCSSRLQCGHSCINMCHSSSLHKAVRCLERCPRTKKGCEHECP 1205

Query: 254  -------------------LPCGHPX------XXXXXXXXXXXVETIIMCPPCGHSEVVL 288
                               LPCGH                   V    +   C H   V 
Sbjct: 1206 RVCGDLCEKECQVVVYNIPLPCGHIAGHLKCHEAQTPGKVNCQVRMEQVMKHCKHQIRVP 1265

Query: 289  C---PDVDNFRCKERCSKKLKCGHQCREEC 315
            C   P   ++ C   C   L CGH C   C
Sbjct: 1266 CYELPLNVDYPCSATCGAALTCGHNCTHAC 1295



>gi|477585958|gb|ENI03044.1| hypothetical protein COCC4DRAFT_62859 [Bipolaris maydis ATCC 48331]
          Length = 1874

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 173/356 (48%), Gaps = 48/356 (13%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKL---ERDTMSRTNTFE 58
            P I  L+    +  L DH +   YP+V G+   LF+ DH+  E     E    S+TN +E
Sbjct: 962  PMISSLVRKTLYPKLRDHPDTTSYPEVSGMRRRLFWLDHRNVEDAGDPEDIMQSKTNIWE 1021

Query: 59   ARMCAKLANYL-VMGGMEESRITILSMYSGQ-RKEIYKYLREESRKTPVLKQIRVSSVDG 116
            A+M   L  +L   G      I +L+ Y GQ R++ ++ +     K  +L ++RV+SVD 
Sbjct: 1022 AKMVTALVRHLCRQGKYRPGEIAVLTPYMGQLRQQQHQMVG----KGKLLDELRVASVDN 1077

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            FQGEE  +II+SLVRS+   +  GFL   NR+ V LSRAKHG+YI G+A    + S +W 
Sbjct: 1078 FQGEEATVIIVSLVRSN-VYQNCGFLKTPNRINVLLSRAKHGMYIIGDAKTSSHVS-MWS 1135

Query: 177  EVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQ 233
             V+ +LEK       + L C +HP+ +  V +  DF +   EGGC+  C  ++ CGH C 
Sbjct: 1136 SVIELLEKGGNIGSKLELQCSRHPDNKIYVSSPDDFAIHAPEGGCAEKCGLRLSCGHSCA 1195

Query: 234  SICHLSS-HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII-MCPPCGH-SEVVLCP 290
              CH ++ H+ + C E C R   C HP             E I+ +  PCGH ++ V C 
Sbjct: 1196 VKCHSTTLHEAVKCMELCTRVRECRHPCSKKCNTPCGECYEKILNVLLPCGHVAKEVECR 1255

Query: 291  DVDN-------------------------------FRCKERCSKKLKCGHQCREEC 315
            +++N                               F+C   C   L CGH CR+ C
Sbjct: 1256 NMENLAGVKCEHPVEREMPGCGHHLTVPCHENTTDFKCLHSCDSLLSCGHNCRKPC 1311



>gi|451994177|gb|EMD86648.1| hypothetical protein COCHEDRAFT_1185767 [Bipolaris maydis C5]
          Length = 1841

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 173/356 (48%), Gaps = 48/356 (13%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKL---ERDTMSRTNTFE 58
            P I  L+    +  L DH +   YP+V G+   LF+ DH+  E     E    S+TN +E
Sbjct: 929  PMISSLVRKTLYPKLRDHPDTTSYPEVSGMRRRLFWLDHRNVEDAGDPEDIMQSKTNIWE 988

Query: 59   ARMCAKLANYL-VMGGMEESRITILSMYSGQ-RKEIYKYLREESRKTPVLKQIRVSSVDG 116
            A+M   L  +L   G      I +L+ Y GQ R++ ++ +     K  +L ++RV+SVD 
Sbjct: 989  AKMVTALVRHLCRQGKYRPGEIAVLTPYMGQLRQQQHQMVG----KGKLLDELRVASVDN 1044

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            FQGEE  +II+SLVRS+   +  GFL   NR+ V LSRAKHG+YI G+A    + S +W 
Sbjct: 1045 FQGEEATVIIVSLVRSN-VYQNCGFLKTPNRINVLLSRAKHGMYIIGDAKTSSHVS-MWS 1102

Query: 177  EVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQ 233
             V+ +LEK       + L C +HP+ +  V +  DF +   EGGC+  C  ++ CGH C 
Sbjct: 1103 SVIELLEKGGNIGSKLELQCSRHPDNKIYVSSPDDFAIHAPEGGCAEKCGLRLSCGHSCA 1162

Query: 234  SICHLSS-HDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETII-MCPPCGH-SEVVLCP 290
              CH ++ H+ + C E C R   C HP             E I+ +  PCGH ++ V C 
Sbjct: 1163 VKCHSTTLHEAVKCMELCTRVRECRHPCSKKCNTPCGECYEKILNVLLPCGHVAKEVECR 1222

Query: 291  DVDN-------------------------------FRCKERCSKKLKCGHQCREEC 315
            +++N                               F+C   C   L CGH CR+ C
Sbjct: 1223 NMENLAGVKCEHPVEREMPGCGHHLTVPCHENTTDFKCLHSCDSLLSCGHNCRKPC 1278



>gi|340378126|ref|XP_003387579.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like
            [Amphimedon queenslandica]
          Length = 1946

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 176/343 (51%), Gaps = 17/343 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            RPEI KL+ P  +  L DH++V +Y  V G+  N+FF  H  SE+     MS  N+ EA 
Sbjct: 1114 RPEIAKLVCPHIYRELLDHQKVLNYEPVKGIKTNMFFVSHTFSEQPMEGLMSPANSHEAD 1173

Query: 61   MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               +LA YL+  G +  ++TIL+ Y+GQ   I + ++  S ++      R+  +D FQGE
Sbjct: 1174 FVVRLAKYLLTQGYKPDQLTILTPYTGQVACIKERMKTFSFES----SPRIVPIDNFQGE 1229

Query: 121  ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
            ENDI+ILSLVRS +S    GF+   NR+CVALSRAK GLY+ GN       S  W+ +++
Sbjct: 1230 ENDIVILSLVRSVKS----GFMKEENRICVALSRAKKGLYVIGNFELFTKESRTWKTIIN 1285

Query: 181  ILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEKMDCGHICQSICHL 238
             L+ S      + L C  H +  T V    DF    +GGC   C  +M CGH+C   CH 
Sbjct: 1286 SLD-SNFFGFSLPLQCHLH-KTITDVKLPVDFDKVKDGGCLELCCYRMACGHVCPRRCHP 1343

Query: 239  SSHD-KIFCPENCIRTL-PCGHPXXXXXXXXXXXXVETII-MCPPCGHSEVVLCPDVDN- 294
               + K  C + C R +    HP             E ++ + P C H ++V C    N 
Sbjct: 1344 DDLEHKQKCLKQCSRKICSFDHPCPRLCSEKCPPCKELVLKIIPSCNHQQLVPCHWSPNL 1403

Query: 295  FRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVKYPGCGH 337
            F C E C K L+CGH+C+  C    CT     +  +K   CGH
Sbjct: 1404 FTCLEECIKMLECGHRCKRRCGEK-CTNYQCRELVMKMLPCGH 1445



>gi|302501773|ref|XP_003012878.1| hypothetical protein ARB_00760 [Arthroderma benhamiae CBS 112371]
 gi|291176439|gb|EFE32238.1| hypothetical protein ARB_00760 [Arthroderma benhamiae CBS 112371]
          Length = 1085

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 142/234 (60%), Gaps = 17/234 (7%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L+PIY D L+DH  V    DVPG+   N +FF H+ +E  +    SR N  EA+
Sbjct: 723 PEIRRILSPIYDD-LNDHPSVLDRKDVPGMGGINSYFFTHEWTESPD-SLSSRYNQKEAK 780

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YL M G+    ITIL+ Y+GQRK I K L+E   K    +  +V +VD +QGE
Sbjct: 781 MIVGFYVYLHMNGVPLEDITILTFYNGQRKLILKALKE--NKLFQGQYTKVVTVDSYQGE 838

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+++ILSLVRS+E++  IGFL+  NRVCVALSRAK G YIFGNA  L   + LW EV  
Sbjct: 839 ENEVVILSLVRSNEAD-NIGFLANENRVCVALSRAKRGFYIFGNAESLAITNGLWWEVSQ 897

Query: 181 ILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLE-----GGCSRNCEEKMDC 228
           I+ K+ K+   F+ L C+KH  K     T    P E     GGCS+ C E++ C
Sbjct: 898 IMRKAPKRLGYFLPLMCKKHGTK-----TLISNPDEWSNNDGGCSQRCGEELHC 946



>gi|169600809|ref|XP_001793827.1| hypothetical protein SNOG_03257 [Phaeosphaeria nodorum SN15]
 gi|160705521|gb|EAT89988.2| hypothetical protein SNOG_03257 [Phaeosphaeria nodorum SN15]
          Length = 1142

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 108/259 (41%), Positives = 146/259 (56%), Gaps = 21/259 (8%)

Query: 2    PEIRKLLTPIYHDALSDH---EEVNHYPDVPGLTD-NLFFFDHQESEKLERD-TMSRTNT 56
            PEIR+LL PIY + L DH   E++ + P V G+   N F+F H+  E   RD   S  N 
Sbjct: 774  PEIRRLLAPIYENTLKDHASVEDLANRPPVEGMGGTNSFYFCHEWPES--RDGNQSTLNE 831

Query: 57   FEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDG 116
             EA+M     +YLV+ G+E  +IT+L+ Y+GQRK + +  R   + +     I+V +VDG
Sbjct: 832  QEAKMITGFVDYLVLNGVEAPKITLLTFYNGQRKRLLRECRNH-QNSQAFAGIKVVTVDG 890

Query: 117  FQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
            +QGEENDI+ILSLVRS+  ++ IGFLS  NR CVALSRAK G YIFGNA  L   S +W 
Sbjct: 891  YQGEENDIVILSLVRSNHHHK-IGFLSSDNRACVALSRAKRGFYIFGNAELLACESRVWA 949

Query: 177  EVLSILEKSKKCD----------QFINLYCQKHPEKETQVFTFADF-PLEGGCSRNCEEK 225
             V+ I+ K  K              + L C  H  ++  +   AD+  + GGC R C   
Sbjct: 950  RVVDIMYKDSKVQVKSGQKRRVGYNLPLQCTAH-NRKIWIEDPADWDEIHGGCDRKCGGT 1008

Query: 226  MDCGHICQSICHLSSHDKI 244
            + C H C   CH   HD+I
Sbjct: 1009 LPCQHKCPYRCHPFGHDQI 1027



>gi|302686188|ref|XP_003032774.1| hypothetical protein SCHCODRAFT_108124 [Schizophyllum commune H4-8]
 gi|300106468|gb|EFI97871.1| hypothetical protein SCHCODRAFT_108124, partial [Schizophyllum
            commune H4-8]
          Length = 2185

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 168/356 (47%), Gaps = 59/356 (16%)

Query: 11   IYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARMCAKLANYLV 70
            I +  LSDH  V  YPDV G+  N+FFF H   E  E+D++S+ N FE  +   L  Y +
Sbjct: 1210 ILYPTLSDHPLVEQYPDVQGMRQNVFFFTHTHQENGEKDSVSKFNMFEVEIIRDLVIYFL 1269

Query: 71   MGG--MEESRITILSMYSGQRKEIYKYLR---------------------------EESR 101
              G    +  I +L  Y GQ +++   L+                           E   
Sbjct: 1270 KQGPYTGKGDIAVLCAYLGQLQKVRAALKDAKLAVSLDERDQEQLERQGGEELEPGESFE 1329

Query: 102  KTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRG---IGFLSISNRVCVALSRAKHG 158
               V K IR+ +VD FQGEE  I+I+SLVR+     G   IGFL + NR+ VALSRAKHG
Sbjct: 1330 NVQVAKHIRLGTVDTFQGEEAKIVIVSLVRNSGDFAGDSPIGFLKVVNRINVALSRAKHG 1389

Query: 159  LYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL---E 215
             YI GNA+ LR+ +T W ++L  +E   +    + + C +HP+   ++      PL   E
Sbjct: 1390 QYILGNAANLRHNAT-WSKILDEMEAKGQVGTALPIVCPRHPDTTREIDGPNQLPLEAPE 1448

Query: 216  GGCSRNCEEKMDCGHICQSICH--LSSHDKIFCPENCIRT---------LPCGHPXXXXX 264
            GGC   C+ ++ CGH CQS+CH  L  H ++ C   C R            CG P     
Sbjct: 1449 GGCLARCDYQLKCGHTCQSVCHPDLEMHGRMKCTMPCPRIKCPRQHPCPRECGQPCGDCE 1508

Query: 265  XXXXXXXVETIIMCPPCGH-SEVVLCPDVDNF---RCKERCSKKLK-CGHQCREEC 315
                   +       PCGH +  V C D++N    +C+ + +K+L  C H    EC
Sbjct: 1509 FPMYNVQL-------PCGHVAARVKCHDMENLASVKCRVKVTKQLPLCEHSTMVEC 1557



>gi|170092415|ref|XP_001877429.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647288|gb|EDR11532.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 2289

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 135/402 (33%), Positives = 181/402 (45%), Gaps = 64/402 (15%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFF--DHQESEKLERDTMSRTNTFE 58
            RPEI  L+    +  L DH+ V  Y +V G T N+FFF  DH+E+     +T S+ N FE
Sbjct: 1236 RPEISNLIRETLYPRLIDHDIVKGYSNVRGFTKNVFFFNHDHKENGGSSEETTSKFNMFE 1295

Query: 59   ARMCAKLANYLVMGGM--EESRITILSMYSGQRKEIYKYLRE------------------ 98
              M   L  YL+  G   +E  I +L  Y GQ  ++   L E                  
Sbjct: 1296 VSMIKDLVLYLLRQGTYSQEGDIVVLCAYLGQLAKLRDALSEAVAVVIDERDQEALAEKD 1355

Query: 99   ESRK--------TPVLKQIRVSSVDGFQGEENDIIILSLVRSD----ESNRG----IGFL 142
            E R           V +++R+ +VD +QGEE  IIILSLVR+     E  RG    IGFL
Sbjct: 1356 EERDDLETHVEHVKVSRRVRLRTVDNYQGEEAKIIILSLVRNSGAVGEDVRGNMKSIGFL 1415

Query: 143  SISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHP-- 200
               NR  VALSRAK GLYI GNA+QL  +S +WR V+  LE  +       + CQ+HP  
Sbjct: 1416 KSENRTNVALSRAKEGLYILGNAAQLASKSRMWRGVIEQLEAVESIGTAFPIACQRHPTA 1475

Query: 201  -EKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHLS--SHDKIFCPENCIRTLPCG 257
             E  +       F  +GGC R C+ ++ CGH+C   CH    +H  + C ++C R    G
Sbjct: 1476 VEYVSMPGQLPQFAPDGGCLRPCDARLKCGHVCSYKCHPDDPNHLAVLCSQDCTRLCSRG 1535

Query: 258  HP-XXXXXXXXXXXXVETIIMCPPCGHSEVVLCP--------DVDNFRCKERCSKKL-KC 307
            HP              E   +  PCGHS    CP        D++N  C     K L  C
Sbjct: 1536 HPCGKECSQPCGPCMFEVAEVQLPCGHS----CPSVPCYRLDDLENINCGVIIRKALITC 1591

Query: 308  GHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNK 349
             H     CS+   + +C  Q       CG +  C   D R +
Sbjct: 1592 EHFADMACSADPESYVCKKQ-------CGGVTTCCGRDCRAQ 1626



>gi|154285632|ref|XP_001543611.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150407252|gb|EDN02793.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 313

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/227 (42%), Positives = 137/227 (60%), Gaps = 6/227 (2%)

Query: 34  NLFFFDHQESEKLERDTMSRTNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIY 93
           N FFF H   E  +   +S+ N  EARM      YL + G+    ITIL+ Y+GQRK+I 
Sbjct: 5   NSFFFCHDWPESSD-SLLSKYNDREARMIVGFFIYLHLNGVPVQDITILTFYNGQRKKIL 63

Query: 94  KYLREESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALS 153
           K LR+ +      + ++VS+VD +QGEEN+I++LSLVRS+E++  +GFL++ NRVCVALS
Sbjct: 64  KALRDNNILQG--QYLKVSTVDSYQGEENEIVLLSLVRSNENSGNMGFLAVENRVCVALS 121

Query: 154 RAKHGLYIFGNASQLRYRSTLWREVLSILE-KSKKCDQFINLYCQKHPEKETQVFTFADF 212
           RAK G YIFGNA  L   + LW EV+ I+    ++    + + C  H  K T +     +
Sbjct: 122 RAKRGFYIFGNAEFLAVSNPLWWEVVQIVNCGPRRIGYRVPITCGNHQAK-TYIAEPDHW 180

Query: 213 PL-EGGCSRNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTLPCGH 258
            L  GGC+  C++K+ CGH C   CH  SH ++ C + C   LPCGH
Sbjct: 181 SLTNGGCTLKCDQKLKCGHDCPLRCHAVSHSQVKCQQPCTELLPCGH 227



>gi|396500111|ref|XP_003845643.1| similar to helicase required for RNAi-mediated heterochromatin
            assembly 1 [Leptosphaeria maculans JN3]
 gi|312222224|emb|CBY02164.1| similar to helicase required for RNAi-mediated heterochromatin
            assembly 1 [Leptosphaeria maculans JN3]
          Length = 1092

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 155/287 (54%), Gaps = 34/287 (11%)

Query: 2    PEIRKLLTPIYHDALSDHE---EVNHYPDVPGLT-DNLFFFDHQESEKLERDTMSRT-NT 56
            PEIR+LL PIY   L DHE   +V++ P V G+  +N FFF H+  E  +RD    T N 
Sbjct: 780  PEIRRLLYPIYESTLKDHESVKDVSNRPPVEGMGGNNSFFFCHEWPE--DRDANKSTFNE 837

Query: 57   FEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDG 116
             EA M     +YLV+ G++ ++IT+L+ Y+GQRK I + LRE S     +  ++V +VD 
Sbjct: 838  REAAMIVGYFDYLVLNGVDAAKITVLTFYNGQRKTILRKLREHSNLRSYVSVVKVVTVDS 897

Query: 117  FQGEENDIIILSLVRSDESNRG------------IGFLSISNRVCVALSRAKHGLYIFGN 164
            +QGEENDI++LSLVRS   N+             IGFLS  NR CVALSRAK G YIFGN
Sbjct: 898  YQGEENDIVLLSLVRSTTRNQTTTSLVRSSKPHKIGFLSSENRACVALSRAKRGFYIFGN 957

Query: 165  ASQLRYRSTLWREVLSILEKSKKCD-----------QFINLYCQKHPEKETQVFTFADFP 213
            A  L   S  W  V+ I+  +KK             QF  L C  H  K   V    D+ 
Sbjct: 958  AELLACESGTWAAVIDIMYGNKKFKVVSGQTRRIGYQF-PLQCSVHGRK-IWVEEPGDWE 1015

Query: 214  -LEGGCSRNCEEKMDCGHICQSICHLSSHDKIFCPENCIRTL-PCGH 258
             L GGC   C   + C H C  +CH   HD++ C + C R +  CGH
Sbjct: 1016 LLHGGCDIRCTGVLPCQHRCPYMCHPFEHDRVNCTQQCSRRIEACGH 1062



>gi|328723535|ref|XP_003247867.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform
           2 [Acyrthosiphon pisum]
 gi|328723537|ref|XP_001945309.2| PREDICTED: NFX1-type zinc finger-containing protein 1-like isoform
           1 [Acyrthosiphon pisum]
          Length = 1061

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 158/327 (48%), Gaps = 7/327 (2%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
           RPEI  L+ P  +  L +H  V   P V G+  ++F   H   E+   +  S  N+ EA 
Sbjct: 670 RPEIAGLVAPTIYPYLRNHASVMERPHVKGVGMDIFCITHNVHEEKNYELSSFVNSVEAN 729

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
               LANYL+  G     +TI++MY+ Q   I   +   S     L  IRVSSVD +QGE
Sbjct: 730 YLVALANYLLKQGYYPEDVTIMAMYNAQVIYITNLI--NSPPFEHLANIRVSSVDAYQGE 787

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN+I++LSLVRS+ +N  IGFL  +NRVCVALSRA+ G Y+ G+   L   S LW  + +
Sbjct: 788 ENEIVLLSLVRSNNNN-SIGFLKTNNRVCVALSRARLGFYMAGDLKLLARASKLWNSIKT 846

Query: 181 ILEKSKKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHL-- 238
            L         + L CQ H +      +  DF    GC   C  K+ CGH+C+ +CH+  
Sbjct: 847 YLCSLNALGPKLLLKCQIHNKVIGSASSGLDFEKFTGCQLKCNVKLSCGHLCKELCHIED 906

Query: 239 SSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNFRCK 298
           S H  + C   C R  P  H              E I     CGH     C D++  +C 
Sbjct: 907 SGHLMVKCSNVCNRKCPRDHLCSKMCHEECSCQ-EMINEITNCGHIVQGKCSDIEYMKCD 965

Query: 299 ERCSKKLKCGHQCREECSSPW-CTAMC 324
            +  K L CGH   ++C   + C  +C
Sbjct: 966 IKVKKILSCGHTLEKKCYEQFNCIEIC 992



>gi|428181268|gb|EKX50132.1| hypothetical protein GUITHDRAFT_57273, partial [Guillardia theta
           CCMP2712]
          Length = 470

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/337 (33%), Positives = 162/337 (48%), Gaps = 26/337 (7%)

Query: 1   RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESE--------KLERDTMS 52
           RPEI +L+    +  L D + V  YP V G+   +FF+ H   E        + +    S
Sbjct: 53  RPEISRLIRETIYPDLLDGQRVLLYPPVKGMLYPVFFWHHSVPEDSFHPGDMRYQTQEGS 112

Query: 53  RTNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVS 112
           +TN+ E      L  YL+  G    +ITIL+ Y GQ   I K L++ S        IRV+
Sbjct: 113 KTNSHEVACVIALVTYLLQQGYARDQITILTGYLGQSVLITKELKKLSASK---SGIRVA 169

Query: 113 SVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRS 172
           +VD +QGEEND++ILSLVRS+ +    GF+ + NRV V LSRAK G+YI G+   L +R 
Sbjct: 170 TVDNYQGEENDLLILSLVRSNPTQMS-GFMKVENRVNVLLSRAKQGMYIIGDKDTLTHRD 228

Query: 173 TLWREVLSILEKSKKCDQFINLYCQKHPEKE---TQVFTFADFPLEGGCSRNCEEKMDCG 229
            +W +V+SIL +S      I + CQ+HP+       V  F  F L+GGC   C  ++ CG
Sbjct: 229 AMWSKVVSILSESSCVGDAIPITCQRHPKDIRCCRDVKDFKSFALDGGCILPCPTRLSCG 288

Query: 230 HICQSICHLSSHDKIFCPENCIR---TLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEV 286
           H C  +CH   H+   C + C R        H              E I    PCGH++ 
Sbjct: 289 HACPRLCHPDGHEGFQCRQPCTRRPDQCQQQHRCKKLCFQACGKCSELIETVLPCGHTKP 348

Query: 287 VLC---PDVDNFRCKERCSKKLK-----CGHQCREEC 315
           + C    +     C E+ +  +      CGH C   C
Sbjct: 349 IECWRSAEPSRSYCAEKVTVLMPKLSNLCGHVCNAPC 385



>gi|393214645|gb|EJD00138.1| P-loop containing nucleoside triphosphate hydrolase protein
            [Fomitiporia mediterranea MF3/22]
          Length = 2288

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 186/407 (45%), Gaps = 55/407 (13%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLE-RDTMSRTNTFEA 59
            RP +  L+    +  L DHE V  Y  V G+  ++FF  H   E     D++S+ N +E 
Sbjct: 1230 RPSVSSLIRDTLYPKLKDHEVVYKYAPVRGMDKDVFFLSHGNKEHGGGDDSVSKHNPYEV 1289

Query: 60   RMCAKLANYLVMGGM--EESRITILSMYSGQRKEIYKYLREES----------------- 100
             M   L  YL+  G    +  I +L  Y GQ  ++   L+ E                  
Sbjct: 1290 LMIKDLVKYLLRQGSYSADGSIVVLCAYLGQLAKVRDALKGEMTVVIDERDQDALAKHEG 1349

Query: 101  ----------RKTPVLKQIRVSSVDGFQGEENDIIILSLVR--------------SDESN 136
                       +  + +++R+ SVD +QGEE DI+ILSLVR              S ++N
Sbjct: 1350 EPDVDETISVERVHITQRVRIRSVDNYQGEEADIVILSLVRNSGGGHESNVHDIVSRKAN 1409

Query: 137  RGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYC 196
              IGFL   NR  VALSRA+ GLYI GNAS L  RS++W  V+S LE++    + I + C
Sbjct: 1410 ANIGFLRSKNRTNVALSRARQGLYILGNASDLASRSSMWSSVISQLEEAAAIGEAIPIRC 1469

Query: 197  QKHPEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICHLS--SHDKIFCPENCI 251
             +HP+    +    + P    +GGC R+C E+++CGH C   CH    +H  +FC + C 
Sbjct: 1470 HRHPDDLRYISKPGELPKLSPDGGCLRSCGERLECGHTCPYKCHSDDPNHRNVFCTQPCP 1529

Query: 252  RTLPCGHPXXXXXXXXXXXXVE-TIIMCPPCGH-SEVVLCPDVDNF---RCKERCSKKL- 305
            +    GHP            V  +  +  PCGH  + VLC  +D+    +C  +  + L 
Sbjct: 1530 KLCSKGHPCRRQCGEPCGKCVHPSRDVALPCGHVHKTVLCHQMDDLAEIKCMVKVVRDLP 1589

Query: 306  KCGHQCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQD 352
             C H     CSS      C    + K P CG++    CH  ++  +D
Sbjct: 1590 TCEHSVGMPCSSDVKEIKCQALCDGKLPCCGNLCKAKCHACQDPPED 1636



>gi|119479501|ref|XP_001259779.1| ATP binding protein, putative [Neosartorya fischeri NRRL 181]
 gi|119407933|gb|EAW17882.1| ATP binding protein, putative [Neosartorya fischeri NRRL 181]
          Length = 1026

 Score =  171 bits (433), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 125/202 (61%), Gaps = 9/202 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR+LL PIY + L DH+ V   P VPG+ D   FFF H   E  +    S+ N  EA 
Sbjct: 718 PEIRRLLEPIYGE-LQDHQSVLRRPKVPGMADVRSFFFSHSWPESSD-SLASKYNVMEAE 775

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQGE 120
           M      YLV+ G+    IT+L+ Y+GQRK+I K +R  S      + ++V +VD +QGE
Sbjct: 776 MIVGFFVYLVLNGVSVDNITVLTFYNGQRKKILKLMRNHSYLQG--QYVKVVTVDSYQGE 833

Query: 121 ENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLS 180
           EN I+ILSLVRS  + +GIGFLS+ NRVCVALSRA++G YIFGNA  L     LWR+V++
Sbjct: 834 ENGIVILSLVRSSNA-KGIGFLSVQNRVCVALSRARNGFYIFGNAKLLYSADDLWRKVIT 892

Query: 181 ILEKSKKCDQF---INLYCQKH 199
           I+   + C      + L CQKH
Sbjct: 893 IMANERPCRSIGFQLPLTCQKH 914



>gi|452843136|gb|EME45071.1| hypothetical protein DOTSEDRAFT_52452 [Dothistroma septosporum NZE10]
          Length = 1138

 Score =  171 bits (432), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 155/279 (55%), Gaps = 30/279 (10%)

Query: 2    PEIRKLLTPIYHDALSDHEEV---NHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
            PEIR++L PIY + + DH  V    + P+V G+   N FFF HQ +E+ + D MS  NT 
Sbjct: 732  PEIRRVLYPIYKNKIKDHPSVRDSENRPNVEGMGGVNSFFFTHQWTEQRD-DQMSCLNTR 790

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EA M   L  +L   G+E   ITIL+ Y+GQRK I   LR  +  T   ++  V++VD +
Sbjct: 791  EADMIVGLVEHLAYNGVEIEDITILTFYNGQRKRILTSLRNST--TLGKQKFNVATVDSY 848

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEEN ++ILSLVRS++ N+ IGFL I NRVCVALSRA+ G YIFGN   L   S  W+ 
Sbjct: 849  QGEENKVVILSLVRSNDRNQ-IGFLDIDNRVCVALSRAQCGFYIFGNGMLLHNNSKTWKT 907

Query: 178  VLSILE----KSKKCDQFINLY------------CQKHPEKETQVFTFADFPL-EGGCSR 220
            V  I+     K ++ D+ I  +            C  H ++  +V    D+ L  GGC  
Sbjct: 908  VTQIMSGKPLKKEQLDKDIPEFIPQRLGTAFPTRCSNH-DRLFEVNDADDWNLINGGCDL 966

Query: 221  NCEEKMDCGHICQSICHLSSHDKIFCPENCIRTLPCGHP 259
            +C  ++ CGH CQ  CH   H+ +    NC + +P   P
Sbjct: 967  DCGGRLPCGHACQIKCHPFPHEIV----NCAQCVPQNRP 1001



>gi|255936813|ref|XP_002559433.1| Pc13g10110 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584053|emb|CAP92080.1| Pc13g10110 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1923

 Score =  170 bits (430), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 119/388 (30%), Positives = 178/388 (45%), Gaps = 76/388 (19%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEK-LERDTMSRT--NTFE 58
            P I +L+    +  L D   V+ YP++ G+   LF+ DH++ E   + D MS +  N+ E
Sbjct: 971  PSIARLIRETLYPKLKDAASVSEYPEIMGMRKRLFWLDHRQREGGSDPDAMSTSHWNSHE 1030

Query: 59   ARMCAKLANYLVMGGM-EESRITILSMYSGQRKEIYKYLRE------------------- 98
              M   L N+L+  G  +   I +L+ Y GQ   + K L E                   
Sbjct: 1031 VDMTVLLVNHLIRQGECKHGDIAVLTPYLGQLHRLRKRLDELFAIVVGDRDQEDLKQAGY 1090

Query: 99   ---ESRKTPVLKQ-----IRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCV 150
               E +  P++K      +RV++VD FQGEE  ++++SLVRS+  N+  GFL  SNR+ V
Sbjct: 1091 GDYEVKPKPMIKAALSQTLRVATVDNFQGEEAKVVVISLVRSNPKNK-CGFLRTSNRINV 1149

Query: 151  ALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFA 210
             LSRA+HG+YI GN S+      +W +V+ IL++ +   + + L C +HP+    V T  
Sbjct: 1150 LLSRAQHGMYIIGN-SETSIHVPMWAQVVKILKQDQNIGEALELQCPRHPDTPIAVSTPE 1208

Query: 211  DFPL---EGGCSRNCEEKMDCGHICQSICHLSS-HDKIFC-------------------- 246
            DFP    EGGC+  C +++ CGH C   CH    H+ +FC                    
Sbjct: 1209 DFPKFSPEGGCNLRCVKRLSCGHACAQKCHSDLLHNAVFCLERCPRPFSGCNHSCPKRCG 1268

Query: 247  ---PENCI-------RTLPCGHPX------XXXXXXXXXXXVETIIMCPPCGHSEVVLC- 289
               PE C+       R LPCGHP                  V      P C H   + C 
Sbjct: 1269 DPCPERCMVNVYQMHRKLPCGHPVPNLPCWQDQDISTVGCLVRVDKTVPGCNHVVSLPCH 1328

Query: 290  --PDVDNFRCKERCSKKLKCGHQCREEC 315
               +  ++RC  +C   L CGH C++ C
Sbjct: 1329 VDVETKDYRCVAQCRSPLPCGHLCKKMC 1356



>gi|389624197|ref|XP_003709752.1| hypothetical protein MGG_11779 [Magnaporthe oryzae 70-15]
 gi|351649281|gb|EHA57140.1| hypothetical protein MGG_11779 [Magnaporthe oryzae 70-15]
          Length = 1942

 Score =  169 bits (429), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 191/370 (51%), Gaps = 55/370 (14%)

Query: 1    RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFF--DHQESEKLERD-TMSRTNT 56
            RPEI KL   P+Y D L DHE V ++P+V G+  NLF+   DHQE +   ++ + S+TN 
Sbjct: 992  RPEISKLYRIPLYPD-LKDHENVMNHPNVVGMRRNLFWLEHDHQEDKAAGQNRSTSKTNK 1050

Query: 57   FEARMCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYL------------------- 96
            +E  M   L  +LV  G   +S I +L+ Y+GQ + + K L                   
Sbjct: 1051 WEVDMVVPLVRHLVRQGKYSQSDIAVLTPYAGQLRSLRKALDSEFDIFVSDRDEEALAAD 1110

Query: 97   -------REESRKT---------PVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIG 140
                    E +R+T          + + +R+++VD FQGEE  III+SLVR +  N+ +G
Sbjct: 1111 SHGKSDSEETTRQTEWDKMFVKKSLAETLRLATVDNFQGEEAKIIIISLVRGNPENK-VG 1169

Query: 141  FLSISNRVCVALSRAKHGLYIFGNASQ-LRYRSTLWREVLSILEKSKKCDQFINLYCQKH 199
            FL  SNRV V LSRA  G+YI GN++  L     +WR+V  +LE      Q I+L C++H
Sbjct: 1170 FLRTSNRVNVLLSRAMDGMYIIGNSNTYLGSGVQMWRDVYQLLEDEGNVGQTISLCCERH 1229

Query: 200  PEKETQVFTFADFPL---EGGCSRNCEEKMD-CGHICQSICHLSSHDKIF-CPENCIRTL 254
             E   +  T  DF +   EGGC   C ++++ CGH C++ CH  S  +++ CP+ C+RT 
Sbjct: 1230 RETPIECATPEDFHVKSPEGGCDLRCGKRLERCGHRCRAKCHSDSMHQVWNCPQACVRTR 1289

Query: 255  P-CGHP-XXXXXXXXXXXXVETIIMCPPCGH-SEVVLC---PDVDNFRCKERCSKKL-KC 307
            P C HP             V+   +  PCGH  + + C    D+   +CK    K +  C
Sbjct: 1290 PTCSHPCPKLCGQSCGPCLVKLNGIRLPCGHIMDKIPCHIQQDLQALKCKTFVEKTVPGC 1349

Query: 308  GHQCREECSS 317
             H+ + ECS+
Sbjct: 1350 KHKIKVECST 1359



>gi|307108148|gb|EFN56389.1| hypothetical protein CHLNCDRAFT_144939 [Chlorella variabilis]
          Length = 1817

 Score =  169 bits (428), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 128/403 (31%), Positives = 184/403 (45%), Gaps = 91/403 (22%)

Query: 1    RPEIRKLLTPIYHDALS----------DHEEVNHYPDVPGLTDNLFFFDHQESEKLERDT 50
            RPEI + +    + +L           DH +V+ Y  V G+   +F+  H   E  +RD 
Sbjct: 989  RPEISRFIRATIYPSLKASSPRPSLALDHPKVHRYRAVKGMQRCVFWMTHTAPEGGDRDD 1048

Query: 51   MS-RTNTFEARMCAKLANYLVMGGMEESRITILSMYSGQ----RKEIYKYL------REE 99
            +S + N  EA+M  +LA YLV  G     ITIL+ Y GQ    R+E  ++       R+ 
Sbjct: 1049 LSSKFNAHEAQMATRLARYLVQNGYGGGDITILTPYVGQLLQLRREASRHFCISMDERDA 1108

Query: 100  -----------------SRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFL 142
                              R+  +   +R++++D +QGEEN IIILSLVRS+  N+ IGF+
Sbjct: 1109 AELAELEEPEGAPAAGAGREVSMKDAVRLATIDNYQGEENRIIILSLVRSNRDNQ-IGFV 1167

Query: 143  SISNRVCVALSRAKHGLYIFGNASQL--RYRSTLWREVLSILEKSKKCDQFINLYCQKHP 200
             + NR  V LSRAK G++I GN+  L    +  +W +V+ + E+        +L CQKHP
Sbjct: 1168 RLQNRTNVLLSRAKEGMFIIGNSECLVNSKQPGIWPQVVDMFEQEGAIGPAFHLVCQKHP 1227

Query: 201  EKETQVFTFADFPL---EGGCSRNCEEKMD-CGHICQSICHLS--SHDKIFCPENCIRTL 254
            +    V   ADF     +GGCSR+C E++  CGH C  +CH     H    C + C R  
Sbjct: 1228 DAINAVSQPADFDTRVSDGGCSRSCTERLQPCGHACPRLCHSDDPQHRLAKCMKPCNRPQ 1287

Query: 255  PCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDVDNFRCKERC--------SKKLK 306
            PCGH                     PC H            +C E+C        S +L 
Sbjct: 1288 PCGH---------------------PCQH------------KCHEQCGQCRVRVPSVRLP 1314

Query: 307  CGHQCRE-EC--SSPWCTAMCLTQTEVKYPGCGHIDLCLCHDI 346
            CGH   + EC  +S   +  C    EV+ P C HI    C D+
Sbjct: 1315 CGHAMAQLECWRTSQLESVQCEQLLEVQMPHCRHIIRVPCSDV 1357



>gi|225557229|gb|EEH05516.1| helicase required for RNAi-mediated heterochromatin assembly 1
           [Ajellomyces capsulatus G186AR]
          Length = 1076

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 143/261 (54%), Gaps = 47/261 (18%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARM 61
           PEIR++L PIY D L DH E                                     ARM
Sbjct: 707 PEIRRILAPIYDD-LEDHPE-------------------------------------ARM 728

Query: 62  CAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVDGFQG 119
                 YL + G+    ITIL+ Y+GQRK+I K LR+ +    +L+   ++VS+VD +QG
Sbjct: 729 IVGFFIYLHLNGVPVQDITILTFYNGQRKKILKALRDNN----ILQGQYLKVSTVDSYQG 784

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+I++LSLVRS+E++  +GFL++ NRVCVALSRAK G YIFGNA  L   + LW EV+
Sbjct: 785 EENEIVLLSLVRSNENSGNMGFLAVENRVCVALSRAKRGFYIFGNAEFLAVSNPLWWEVV 844

Query: 180 SILE-KSKKCDQFINLYCQKHPEKETQVFTFADFPL-EGGCSRNCEEKMDCGHICQSICH 237
            I+    ++    + + C  H + +T +     + L  GGC+  C++K+ CGH C   CH
Sbjct: 845 QIVNCGPRRIGYRVPITCGNH-QAKTYIAEPDHWSLTNGGCTLKCDQKLKCGHDCPLRCH 903

Query: 238 LSSHDKIFCPENCIRTLPCGH 258
             SH ++ C + C   LPCGH
Sbjct: 904 AVSHSQVKCQQPCTDLLPCGH 924



>gi|494828902|gb|EON65660.1| hypothetical protein W97_04899 [Coniosporium apollinis CBS 100218]
          Length = 1024

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 143/257 (55%), Gaps = 32/257 (12%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNH---YPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
            PEIR++L PIY D ++DH  +      P VPG+   + +FF H+  E  ++  MS  N  
Sbjct: 778  PEIRRILKPIYGDLITDHPAMKDPCVRPPVPGMGSISSYFFTHEWPETRDQ-YMSSCNLG 836

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQ--IRVSSVD 115
            EA M     +YLV+ G+   +IT+L+ Y+GQRK I + LR+     P LK    +V +VD
Sbjct: 837  EAEMIVNFFDYLVLNGVSYGQITVLTFYNGQRKAILRGLRDH----PNLKGHIFKVVTVD 892

Query: 116  GFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLW 175
             +QGEENDI++LSLVRS+++ + +GFL++ NRVCVALSRAK G YIFGN   L   S  W
Sbjct: 893  SYQGEENDIVLLSLVRSNDAGK-VGFLNVDNRVCVALSRAKRGFYIFGNGELLVNASKTW 951

Query: 176  REVLSILEKSKK----------CDQFINLYCQKHPEKETQVFTFADFP-----LEGGCSR 220
              V+ I+   KK              + L C +H  K     TF   P     + GGC  
Sbjct: 952  VSVIEIMAGKKKPFPALGPKRRLGFHLPLECTQHGRK-----TFIREPNDWANINGGCEA 1006

Query: 221  NCEEKMDCGHICQSICH 237
             C+  ++CGH C   CH
Sbjct: 1007 KCKTTLECGHACPLNCH 1023



>gi|341902841|gb|EGT58776.1| hypothetical protein CAEBREN_17840 [Caenorhabditis brenneri]
          Length = 2059

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 162/328 (49%), Gaps = 29/328 (8%)

Query: 7    LLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEARMCAKLA 66
            ++ P ++D + D E V  YP+V G+  NL+F+ H + E+   D +S  N  EA M   L 
Sbjct: 1158 IVKPAFYDNVVDAENVGLYPEVEGMATNLYFWSHSKPEE-SHDGISWMNRHEASMTVALV 1216

Query: 67   NYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVL-------KQIRVSSVDGFQG 119
             +L+        I +L+ YS QR+  Y       R+ P++         I V +VD FQG
Sbjct: 1217 KHLLKQNYTHQDIVVLTTYSAQRQYFY-------REFPIMFGTSNDGSVIPVETVDSFQG 1269

Query: 120  EENDIIILSLVRS---DESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWR 176
             E  I I+SLVRS    + N GIGFL+++NR+CVAL+RA+HG+YI GN + +   S LW+
Sbjct: 1270 RERKIAIVSLVRSHRGQQINTGIGFLAVANRICVALTRAQHGMYIVGNGAYIMNNSRLWK 1329

Query: 177  EVLSILEKSKKCDQFINLYCQKHPE----KETQVFTFADFPLEGGCSRNCEEKMDCGHIC 232
            +++  L +    +  I L C  H      KE +   FA+   EGGC   C+    CGH+C
Sbjct: 1330 QIVDQLNRRSFIEYRIPLKCVAHNNIIWVKEPR--DFAEESPEGGCLEICDIPKRCGHVC 1387

Query: 233  QSICH--LSSHDKIFCPENCIRTLP---CGHPXXXXXXXXXXXXVETIIMCPPCGHSEVV 287
            +  CH  +     + C   C  T P     H             +  + +   CGH+   
Sbjct: 1388 KRPCHPKIEYEHSLRCEYPCQATCPNTKYNHKCARLCYEDCGSCMRLVDVKLECGHTIST 1447

Query: 288  LCPDVDNFRCKERCSKKLKCGHQCREEC 315
             C  +   +C ++C+K L CGHQC   C
Sbjct: 1448 PCSRIQIAQCDQKCNKTLVCGHQCPLRC 1475



>gi|169607895|ref|XP_001797367.1| hypothetical protein SNOG_07011 [Phaeosphaeria nodorum SN15]
 gi|160701515|gb|EAT85662.2| hypothetical protein SNOG_07011 [Phaeosphaeria nodorum SN15]
          Length = 1911

 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 135/443 (30%), Positives = 199/443 (44%), Gaps = 103/443 (23%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESE---KLE-RDTMSRTNT 56
            RPEI  L+    +  L+DH    + P+V GL +N+F+ DH   E   ++E + + SR+N+
Sbjct: 1009 RPEISTLIRETLYAKLADHTSTINMPNVVGLRENVFWLDHTHLEDDGQMEVQHSKSRSNS 1068

Query: 57   FEARMCAKLANYLVMGGM-EESRITILSMYSGQRKEIYKYLR------------------ 97
            +E +M   +  ++V  G+ + S I +L+ Y+GQ +++   +R                  
Sbjct: 1069 WEVQMVHAMVRHVVRQGLYKSSDIAVLTPYTGQLQKLRAAMRNDFEIVLSERDEEALEKD 1128

Query: 98   -----------------EESRKTPVLKQI----RVSSVDGFQGEENDIIILSLVRSDESN 136
                             E+ RK    KQ+    R+++VD FQGEE  ++I+SLVRS+++ 
Sbjct: 1129 GFTISNTPQDQRVAAAAEQGRKPLEKKQLSDLLRIATVDNFQGEEAKVVIISLVRSNKAQ 1188

Query: 137  RGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRST-LWREVLSILEKSKKCDQFINLY 195
            + +GFL  SNR+ V LSRAKHG+YI GNA    Y +  +W+ V+ +L      +  + L 
Sbjct: 1189 K-VGFLKTSNRINVLLSRAKHGMYIIGNADT--YTTVDMWQHVIGMLRAKNSVEPSLGLC 1245

Query: 196  CQKHPEKETQV---FTFADFPLEGGCSRNCEEKMDCGHICQSICHLSS-HDKIFCPENCI 251
            C +HPEK  ++     FA F  EGGC   C +++DCGH C + CH  + H    C E C 
Sbjct: 1246 CPRHPEKVMEICEPEDFAKFSPEGGCREACIDRLDCGHSCLARCHSKAMHAAFHCEEPCE 1305

Query: 252  RTL-PCGHPXXXXXXXXX----XXXVETIIMCPPCGH----------------------S 284
            R+  PCGH                 V+ I +   CGH                      S
Sbjct: 1306 RSHEPCGHSCQKQTCGEPCGKCMTKVDNIRLS--CGHIHNGVFCHLTLDLTSISCHVPVS 1363

Query: 285  EVVLCPDVD------------NFRCKERCSKKLKCGHQCREECS----------SPWCTA 322
            + VL  D D             FRC E C   L CGHQC   C           S    A
Sbjct: 1364 KQVLGCDHDIVVKCSQDVTSLGFRCPEPCKSTLPCGHQCPGSCGHCKSKTVDNKSVVKHA 1423

Query: 323  MCLTQTEVKYPGCGHIDLCLCHD 345
             C+ +   K   C H     CHD
Sbjct: 1424 KCMEKCHRKMGTCNHACGRYCHD 1446



>gi|453082493|gb|EMF10540.1| P-loop containing nucleoside triphosphate hydrolase protein
           [Mycosphaerella populorum SO2202]
          Length = 1165

 Score =  167 bits (423), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 148/266 (55%), Gaps = 28/266 (10%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNH---YPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTF 57
           PEIR+LL PIY + + DH  V      PDVPG+   N F+F H  +E  + D MS  N  
Sbjct: 733 PEIRRLLHPIYGNLIKDHPSVTDPECRPDVPGMGGVNSFWFTHSWTEGRD-DLMSCHNED 791

Query: 58  EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIR--VSSVD 115
           EA+M A    YL   G++   ITIL+ Y+GQRK++ + LR       VL+  R  V +VD
Sbjct: 792 EAKMIAGFVEYLSYNGVQPQDITILTFYNGQRKKLLQELRSRI----VLRDCRFTVVTVD 847

Query: 116 GFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRY--RST 173
            +QGEEN ++ILSL RS++  + +GFLS+ NRVCVALSRA+ G YIFGNA  L       
Sbjct: 848 SYQGEENKVVILSLARSNDHGQ-MGFLSVENRVCVALSRAQCGFYIFGNALLLHKIESGK 906

Query: 174 LWREVLSILEKS-------------KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSR 220
            W  V++I+                ++ + F  + C+ H   E Q+    ++ L GGC +
Sbjct: 907 TWTTVMNIMAGKEVKEMDDMELVHRQRFNAFFTVRCKNH-GNEVQIHHPDEWTLHGGCKQ 965

Query: 221 NCEEKMDCGHICQSICHLSSHDKIFC 246
            C+ ++ CGH C  +CH   H+ + C
Sbjct: 966 VCQAQLPCGHDCTLLCHPMDHEDVNC 991



>gi|440467163|gb|ELQ36401.1| hypothetical protein OOU_Y34scaffold00663g1 [Magnaporthe oryzae Y34]
 gi|440485178|gb|ELQ65159.1| hypothetical protein OOW_P131scaffold00520g2 [Magnaporthe oryzae
            P131]
          Length = 1849

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 183/367 (49%), Gaps = 66/367 (17%)

Query: 1    RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFF--DHQESEKLERD-TMSRTNT 56
            RPEI KL   P+Y D L DHE V ++P+V G+  NLF+   DHQE +   ++ + S+TN 
Sbjct: 945  RPEISKLYRIPLYPD-LKDHENVMNHPNVVGMRRNLFWLEHDHQEDKAAGQNRSTSKTNK 1003

Query: 57   FEARMCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYL------------------- 96
            +E  M   L  +LV  G   +S I +L+ Y+GQ + + K L                   
Sbjct: 1004 WEVDMVVPLVRHLVRQGKYSQSDIAVLTPYAGQLRSLRKALDSEFDIFVSDRDEEALAAD 1063

Query: 97   -------REESRKT---------PVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIG 140
                    E +R+T          + + +R+++VD FQGEE  III+SLVR +  N+ +G
Sbjct: 1064 SHGKSDSEETTRQTEWDKMFVKKSLAETLRLATVDNFQGEEAKIIIISLVRGNPENK-VG 1122

Query: 141  FLSISNRVCVALSRAKHGLYIFGNASQ-LRYRSTLWREVLSILEKSKKCDQFINLYCQKH 199
            FL  SNRV V LSRA  G+YI GN++  L     +WR+V  +LE      Q I+L C++H
Sbjct: 1123 FLRTSNRVNVLLSRAMDGMYIIGNSNTYLGSGVQMWRDVYQLLEDEGNVGQTISLCCERH 1182

Query: 200  PEKETQVFTFADFPL---EGGCSRNCEEKMD-CGHICQSICHLSSHDKIF-CPENC-IRT 253
             E   +  T  DF +   EGGC   C ++++ CGH C++ CH  S  +++ CP+ C ++ 
Sbjct: 1183 RETPIECATPEDFHVKSPEGGCDLRCGKRLERCGHRCRAKCHSDSMHQVWNCPQACDLQA 1242

Query: 254  LPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCP---DVDNFRCKERCSKKLKCGHQ 310
            L C               VE  +  P C H   V C    +   F C   C + L CGH 
Sbjct: 1243 LKC------------KTFVEKTV--PGCKHKIKVECSTNVESGAFHCPVPCEELLACGHG 1288

Query: 311  CREECSS 317
            C   C S
Sbjct: 1289 CTGNCGS 1295



>gi|380489050|emb|CCF36962.1| hypothetical protein CH063_00242 [Colletotrichum higginsianum]
          Length = 1949

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 173/395 (43%), Gaps = 81/395 (20%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEK-----LERDTMSRTNT 56
            P I  L+    + +LSD + V  YP+V G+   LF+  H+  E       E    S +N 
Sbjct: 982  PSISDLVRSTLYPSLSDSDGVRGYPEVRGMAKRLFWLHHESPESGRNSDQESIETSYSNE 1041

Query: 57   FEARMCAKLANYLVMGGMEES-RITILSMYSGQRKEIYKYL------------------- 96
            FE +M + L ++L+  G+ +S  I +L+ Y GQ   + + L                   
Sbjct: 1042 FEIQMVSALVSHLLWQGVYKSGDIAVLTPYLGQLNRLRQKLGSVMQIVINDRDMDDLTEM 1101

Query: 97   -----------REESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSIS 145
                       R E+ KT  L ++R ++VD FQGEE  +II+SLVRS+   R  GFLS S
Sbjct: 1102 GSSEAPSRDSPRREAAKTTALHEVRAATVDNFQGEEAKVIIVSLVRSNNEKR-CGFLSTS 1160

Query: 146  NRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQ 205
            NR+ V LSRAKHG+YI GN S       +W +V  IL+      + + L C +HPE  + 
Sbjct: 1161 NRINVLLSRAKHGMYIIGN-SNTSSHVPMWAQVTEILQNGGNFGKELELQCPRHPENRSF 1219

Query: 206  VF---TFADFPLEGGCSRNCEEKMDCGHICQSICHLSS-HDKIFCPENCIRT-------- 253
            V     F     +GGC+  C+ ++ CGH C   CH    H+ + C E C R         
Sbjct: 1220 VSRPEQFVQSAPDGGCNLRCDRRLTCGHSCTGPCHSDFLHNAVLCLEGCARPKDKCEHLC 1279

Query: 254  ----------------------LPCGHPX------XXXXXXXXXXXVETIIMCPPCGHSE 285
                                  L CGH                   V+     P CGH+ 
Sbjct: 1280 RKRCGEACDKLCKELLRDVAFELSCGHVIDTVECWKAQSPSSIKCAVQVDKKIPGCGHTV 1339

Query: 286  VVLC-PDV--DNFRCKERCSKKLKCGHQCREECSS 317
             V C  DV  D++RCK  C  K  CGH C+  CS+
Sbjct: 1340 EVSCHVDVTNDSYRCKAECGFKRPCGHACKMSCSA 1374



>gi|345328222|ref|XP_003431252.1| PREDICTED: LOW QUALITY PROTEIN: NFX1-type zinc finger-containing
            protein 1-like [Ornithorhynchus anatinus]
          Length = 1934

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 185/401 (46%), Gaps = 67/401 (16%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTF--- 57
            RPEI +LLTP  +  L +H  V  Y  +      L      E+E  +R  + R  +    
Sbjct: 1085 RPEIAQLLTPHIYQDLENHPSVLKYEQI---KRCLVGKKKCETEDEKRSRLLRGLSVFCG 1141

Query: 58   ----EARMCAKLANYLVMGG-----MEES--------------RITILSMYSGQRKEIYK 94
                EAR   ++    V  G      EES              +ITIL+ Y+GQ   + K
Sbjct: 1142 GVGPEARGAVEVPRESVESGERRWTTEESLAGDTQRERIHLPSQITILTTYTGQLFCLRK 1201

Query: 95   YLREESRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSR 154
             +  ++        ++V  VD +QGEENDII+LSLVRS+ + + +GFL ISNR+CVALSR
Sbjct: 1202 LMPAKT-----FAGVKVHVVDKYQGEENDIILLSLVRSNRAGK-VGFLQISNRICVALSR 1255

Query: 155  AKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL 214
            AK G+Y  GNA  L  R  LW  +L  L ++ +  + + L CQ HP+  T+V   +DF  
Sbjct: 1256 AKKGMYCIGNAGML-ARVPLWSRILHTLRENGQIGRALTLCCQNHPDTRTRVARASDFQR 1314

Query: 215  --EGGCSRNCEEKMDCGHICQSICHL--SSHDKIFCPENCIRTL-------------PCG 257
              EGGC   CE ++ CGH+C   CH    SH +  C + C + L             PCG
Sbjct: 1315 VPEGGCDLLCEFRLGCGHVCTRACHPYDPSHAEFRCMKPCQKVLCAAGHRCQLVCFQPCG 1374

Query: 258  HPXXXXXXXXXXXXVETIIMCPPCGHSEVVLCPDV-DNFRCKERCSKKLKCGHQCREECS 316
                          V+     P CGH + V C    ++F C+  C + L CGH+CR  C 
Sbjct: 1375 D-----------CQVKVPKTLPGCGHRQPVPCSVAEEDFACQAPCRRLLGCGHRCRGACG 1423

Query: 317  SPWCTAMCLTQTEVKYPGCGHIDLCLCHDIRNKLQDGCPFC 357
               C  +C     V  P CGH     C    +  +DG   C
Sbjct: 1424 QE-CDPLCAELVPVSLP-CGHSQEVKCGRAADPRRDGAVEC 1462



>gi|302668358|ref|XP_003025751.1| NF-X1 finger and helicase domain protein, putative [Trichophyton
           verrucosum HKI 0517]
 gi|291189878|gb|EFE45140.1| NF-X1 finger and helicase domain protein, putative [Trichophyton
           verrucosum HKI 0517]
          Length = 944

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 138/223 (61%), Gaps = 10/223 (4%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMS-RTNTFEA 59
           PEIR++L+PIY D L+DH  V    DVPG+   N +FF H+ +E    D++S R N  EA
Sbjct: 723 PEIRRILSPIYDD-LNDHPSVLDRKDVPGMGGINSYFFTHEWTES--SDSLSSRYNQKEA 779

Query: 60  RMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
           +M      YL M G+    ITIL+ Y+GQRK I K L+E   K    +  +V +VD +QG
Sbjct: 780 KMIVGFYVYLHMNGVPLEDITILTFYNGQRKLILKALKEN--KLFQGQYTKVVTVDSYQG 837

Query: 120 EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVL 179
           EEN+++ILSLVRS+E++  IGFL+  NRVCVALSRAK G YIFGNA  L   + LW EV 
Sbjct: 838 EENEVVILSLVRSNEAD-NIGFLANENRVCVALSRAKRGFYIFGNAESLAITNGLWWEVS 896

Query: 180 SILEKS-KKCDQFINLYCQKHPEKETQVFTFADFPLEGGCSRN 221
            I+ K+ K+   F+ L C+KH  K T + +    PL    + N
Sbjct: 897 QIMRKTPKRLGYFLPLMCKKHGTK-TLISSMMPHPLNISSNPN 938



>gi|118365347|ref|XP_001015894.1| hypothetical protein TTHERM_00266590 [Tetrahymena thermophila]
 gi|89297661|gb|EAR95649.1| hypothetical protein TTHERM_00266590 [Tetrahymena thermophila SB210]
          Length = 2475

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 157/323 (48%), Gaps = 15/323 (4%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEAR 60
            R E   ++   Y   L DH  V  Y +V G+  N  F +H   EK  ++ +S +N  EA+
Sbjct: 1629 RSEFSNIIRQFY-PKLKDHFSVQKYQNVIGMQKNFLFLNHSTPEKQIKNRVSMSNDREAQ 1687

Query: 61   MCAKLANYLV-MGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQG 119
            + A L  Y++     ++ +IT+LS+Y GQ + + KY+ +      +L Q+ VS+VD +QG
Sbjct: 1688 LVANLVKYILDQNQFKQKQITVLSLYQGQCR-LLKYMLQ----LKLLSQVVVSTVDNYQG 1742

Query: 120  EENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRST-LWREV 178
            EENDIIILSLVRS+  N  IGFL  SNR+ V  SRAK G Y+FGN    + +    W+ +
Sbjct: 1743 EENDIIILSLVRSNPENE-IGFLKNSNRINVGFSRAKVGFYVFGNFEMFKNQKIDFWQNI 1801

Query: 179  LSILEKSKKCDQFINLYCQKHP---EKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSI 235
                E +    + I   C +H        Q          GGC   C ++  C H+C+  
Sbjct: 1802 TQYCEANSFVQEKITSKCSQHNAIINISLQNDEIQQRSPNGGCLNVCNKRRKCNHLCEQQ 1861

Query: 236  CHLSSHDKIFCPENCIRTLPCGHPXXXXXXXX--XXXXVETIIMCPPCGHSEVVLCPD-V 292
            CH  S +   C   C ++LPC H               VE   +  PCGH   V C D +
Sbjct: 1862 CHNGSCELFICNHPCNKSLPCQHQCKKKCSEICGGFCNVEVQKIIEPCGHKNTVKCGDNL 1921

Query: 293  DNFRCKERCSKKLKCGHQCREEC 315
            + F+CK    K   C HQ   EC
Sbjct: 1922 EEFQCKFMVQKVFDCNHQTFVEC 1944



>gi|393244936|gb|EJD52447.1| P-loop containing nucleoside triphosphate hydrolase protein
            [Auricularia delicata TFB-10046 SS5]
          Length = 2315

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 172/395 (43%), Gaps = 80/395 (20%)

Query: 1    RPEIRKLL-TPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEK-LERDTMSRTNTFE 58
            RP I  L+  P+ +  L DH  V  YPDV G+  N+FF  H   E+    +++S+ N FE
Sbjct: 1257 RPAIADLIRVPMLYPDLEDHPRVLGYPDVQGMPKNVFFMTHTHKEQGGGEESVSKHNIFE 1316

Query: 59   ARMCAKLANYLVMGG---MEESRITILSMYSGQR---KEIYKYL---------------- 96
             +M   L +YLV       +   I +L  Y GQ    +E +  L                
Sbjct: 1317 VQMAVDLVSYLVRQTPRYADAGSIVVLCAYLGQMVRLREAFANLFTVVIDERDQEKLANA 1376

Query: 97   ----REE---------SRKTPVLKQIRVSSVDGFQGEENDIIILSLVR-----SDESNRG 138
                REE         + +  + ++I + +VD FQGEE DIIILSLVR     SDES   
Sbjct: 1377 GVEDREEDDAAADQPRAERVQISQRILLRTVDNFQGEEADIIILSLVRNAGELSDESRTS 1436

Query: 139  IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQK 198
            IGFL   NR  VALSRA+HGLYI GNA+ L  RS LW  V++ L+++      + ++C +
Sbjct: 1437 IGFLKSINRTNVALSRARHGLYILGNAANLAARSALWATVINKLKETDAIGPGLPIHCSR 1496

Query: 199  H----PEKETQVFTFADFPLEGGCSRNCEEKMDCGHICQSICHLSSHDKIFCPENCIRT- 253
            H    P   T+    A    +GGC   C E++ CGH C   CH   H  + C + C +  
Sbjct: 1497 HLDDGPRYATKPGDIARLAPDGGCLFPCGERLGCGHKCPHKCHPGGHSAVVCSQRCTKLC 1556

Query: 254  -------------------------LPCGHPXXXX------XXXXXXXXVETIIMCPPCG 282
                                     LPCGH                   V  +   P C 
Sbjct: 1557 ARQHPCSKLCSEACGNCRFPIRGVELPCGHIANTVPCFQLDDLSQRICNVPVLKTLPHCE 1616

Query: 283  HSEVVLCP-DVDNFRCKERCSKKLK-CGHQCREEC 315
            H+  + C  D   ++C+E C   ++ C H C   C
Sbjct: 1617 HTATMPCSTDPTQWQCQEPCGMIVQSCSHVCAARC 1651



>gi|395752432|ref|XP_002830451.2| PREDICTED: LOW QUALITY PROTEIN: NFX1-type zinc finger-containing
            protein 1 [Pongo abelii]
          Length = 1898

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 165/322 (51%), Gaps = 18/322 (5%)

Query: 40   HQESEKLERDTMSRTNTFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREE 99
             Q+   + +  ++   + EA    +L    +      S+ITIL+ Y+GQ   + K +  +
Sbjct: 1095 QQKRSHINKSNLTIRTSTEAHFVVELCXKFLCQEYLPSQITILTTYTGQLFCLRKLMPAK 1154

Query: 100  SRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGL 159
            +        +RV  VD +QGEENDII+LSLVRS++  + +GFL ISNR+CVALSRAK G+
Sbjct: 1155 T-----FAGVRVHVVDKYQGEENDIILLSLVRSNQEGK-VGFLQISNRICVALSRAKKGM 1208

Query: 160  YIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFPL--EGG 217
            Y  GN  Q+  +  LW +++  L ++ +    + L CQ HPE  T V   +DF    EGG
Sbjct: 1209 YCIGNM-QMLAKVPLWSKIIHTLRENNQIGPMLRLCCQNHPETHTLVSKASDFQKVPEGG 1267

Query: 218  CSRNCEEKMDCGHICQSICHL--SSHDKIFCPENCIRTL-PCGHP-XXXXXXXXXXXXVE 273
            CS  CE ++ CGH+C   CH   SSH +  C + C + +   GH              V+
Sbjct: 1268 CSLPCEFRLGCGHVCTRACHPYDSSHKEFQCMKPCQKVICQEGHRCPLVCFQECQPCQVK 1327

Query: 274  TIIMCPPCGHSEVVLC--PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVK 331
                 P CGH ++V C  P+ D F C+E CSK L+CGH+C   C    C  +C     VK
Sbjct: 1328 VPKTIPQCGHEQMVPCSVPESD-FCCQEPCSKSLRCGHRCSHPCGED-CVQLCSEMVTVK 1385

Query: 332  YPGCGHIDLCLCHDIRNKLQDG 353
               CGH     C  +   L  G
Sbjct: 1386 L-KCGHSQPVKCGHVEGLLYGG 1406



>gi|296817639|ref|XP_002849156.1| helicase required for RNAi-mediated heterochromatin assembly 1
           [Arthroderma otae CBS 113480]
 gi|238839609|gb|EEQ29271.1| helicase required for RNAi-mediated heterochromatin assembly 1
           [Arthroderma otae CBS 113480]
          Length = 1072

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 130/205 (63%), Gaps = 11/205 (5%)

Query: 2   PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTD-NLFFFDHQESEKLERDTMSRTNTFEAR 60
           PEIR++L+PIY+D L DH  V   PD+PG+   N +FF H  +E  + +  S+ N  EAR
Sbjct: 716 PEIRRILSPIYND-LHDHSSVLERPDIPGMGGINSYFFTHVWAESFD-NLSSKYNQKEAR 773

Query: 61  MCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVL--KQIRVSSVDGFQ 118
           M      YL M G+    ITIL+ Y+GQRK I K L++     P+   +  +V +VD +Q
Sbjct: 774 MVVGFYVYLHMNGVPVKDITILTFYNGQRKYILKALKD----NPLFHGQYTKVVTVDSYQ 829

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREV 178
           GEEN+I++LSLVRS+E +  IGFL+  NRVCVALSRA+ G YIFGNA  L   + LW +V
Sbjct: 830 GEENEIVLLSLVRSNEGD-NIGFLANENRVCVALSRARRGFYIFGNAESLAISNGLWWQV 888

Query: 179 LSILEKS-KKCDQFINLYCQKHPEK 202
             I++ + K+   F+ L C+KH  K
Sbjct: 889 AQIMKNAPKRLGYFLPLMCKKHMAK 913



>gi|471226226|ref|XP_004032160.1| nfx1-type zinc finger protein, putative [Ichthyophthirius
           multifiliis]
 gi|340504087|gb|EGR30573.1| nfx1-type zinc finger protein, putative [Ichthyophthirius
           multifiliis]
          Length = 512

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 167/335 (49%), Gaps = 41/335 (12%)

Query: 1   RPEIRKLLTPIY-HDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDTMSRTNTFEA 59
           R E    +  IY  ++  DH+ +  YP+V G+  N+ F +H+E E   ++  S+ N +EA
Sbjct: 94  RFEFADFIRLIYPRESYEDHQTIQVYPNVLGMPQNMIFINHKELESCIQENKSKKNFYEA 153

Query: 60  RMCAKLANYLVMGG-MEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGFQ 118
               +LA Y+V+ G  + ++ITIL  Y GQ +EI K +R+   K   L  I + SVD +Q
Sbjct: 154 NYAIELAKYIVLQGQFKPNQITILCFYLGQTQEIRKIVRKNHNKQ--LNGITIVSVDNYQ 211

Query: 119 GEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRY------RS 172
           GEEN+IIILS +RS++  + +GF    NR+ VA SRAK G YI GN            + 
Sbjct: 212 GEENEIIILSCIRSNKEGK-MGFTKTENRINVAFSRAKIGFYILGNFGMFNTNYENNNKE 270

Query: 173 TLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFTFADF---PLEGGCSRNCEEKMDCG 229
           TLW+++L++ +K +     IN  C++H +  T V  + DF   PL GGC + C+    CG
Sbjct: 271 TLWQKILTLAKKKEFIKDEINFVCKQHNQG-TLVKHYDDFVKMPL-GGCKKFCKLVRKCG 328

Query: 230 HICQSICHLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC 289
           HIC   CH +  +   C + C++   CGH             ++    C P         
Sbjct: 329 HICPLNCHNNPCESFECQQKCLKVYECGHSCQ----------LKCFSNCNPL-------- 370

Query: 290 PDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMC 324
                  C++   K L CGH   E CS    +  C
Sbjct: 371 -------CQQYVHKTLNCGHIKNEVCSKNINSIQC 398



>gi|392579889|gb|EIW73016.1| hypothetical protein TREMEDRAFT_59181 [Tremella mesenterica DSM 1558]
          Length = 2114

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 167/348 (47%), Gaps = 51/348 (14%)

Query: 16   LSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDT-MSRTNTFEARMCAKLANYLVMGG- 73
            L DHE V  YPDV G+  N+FF DH+  E    D   S++N +E  M   LA Y +  G 
Sbjct: 1099 LMDHELVTQYPDVRGMGKNVFFLDHRNPESKGGDEGASKSNDYEVSMACDLALYFLKQGS 1158

Query: 74   -MEESRITILS---------MYSGQRKEIYKYLREESRKTPVLKQIRVS------SVDGF 117
               E  I IL+         M    ++EI + + EE    P +KQ+ V+      +VD F
Sbjct: 1159 YTREGDIVILALAGRHITVIMDERDQREIDRRVGEEEDSEPEVKQVAVAHQVLLRTVDNF 1218

Query: 118  QGEENDIIILSLVR-SDESN----RGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRS 172
            QGEE  I+ILSLVR + E++    + IGFL  +NR  VALSRAKHGLYI GNA QL  RS
Sbjct: 1219 QGEEAKIVILSLVRNAGEADSLTPQTIGFLKSNNRANVALSRAKHGLYIMGNAPQLAARS 1278

Query: 173  TLWREVLSILEKSKKCDQFINLYCQKHPEK---ETQVFTFADFPLEGGCSRNCEEKMDCG 229
            ++W  ++  L +S        + C +HPE     +Q         +GGC   CE  M CG
Sbjct: 1279 SMWETIIGELSESDCMGNGWPIACARHPETLRYASQPGQIQQLSPDGGCLLQCEMSMPCG 1338

Query: 230  HICQSICHLSSHDKIFCPENCIRTLPCGHPXXXXXXXXXXXXVETIIMCPPCGHSEVVLC 289
            H+C+              +N     P   P              ++    PCGH   +LC
Sbjct: 1339 HLCRQ-------------KNVAAVAPVYSPAATHVRRGAMKIAASL----PCGHIVDLLC 1381

Query: 290  PD---VDNFRCKERCSKKL-KCGH----QCREECSSPWCTAMCLTQTE 329
             +   +D+ +C E  SKK   C H    +C ++ +S  C A+C T T+
Sbjct: 1382 WETRSLDHVKCHEMVSKKFASCEHSRIVRCGDDVNSYPCKAICGTPTD 1429



>gi|348680039|gb|EGZ19855.1| hypothetical protein PHYSODRAFT_298238 [Phytophthora sojae]
          Length = 1989

 Score =  164 bits (415), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 184/429 (42%), Gaps = 98/429 (22%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQE-----SEKLERDTMSRTN 55
            RP+I +LL  +++  + D  E   YP + G+  N+FF +H +     S++  + T S +N
Sbjct: 1061 RPQISQLLRMLFYPEVRDARETLEYPSLLGVDKNVFFVNHSQPEDGASDEFGKSTSSHSN 1120

Query: 56   TFEARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREE---------------- 99
             +E         +L+  G +   I +L+ Y GQ  +I   L+ E                
Sbjct: 1121 EYEVEYIVATLKFLLQQGYQSCDIALLTPYVGQLMKIRSALKGEFVLELNELDQQEIQRT 1180

Query: 100  ------------------------SRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDES 135
                                    + K  +   IR ++VD FQGEE  +I++SLVRS  +
Sbjct: 1181 FGDDGDDVEDDTGTMRRDSPSALGATKKNLSDTIRAATVDNFQGEEATVILVSLVRSSTN 1240

Query: 136  NRG---IGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFI 192
             +G   IGFL I NR+ V LSRAKHGL   G+   LR +S +W+++L  LE        +
Sbjct: 1241 IQGRETIGFLKIPNRINVLLSRAKHGLIFVGHGDLLRAKSPIWQQILDQLESDGCYGDGL 1300

Query: 193  NLYCQKHPEKE---TQVFTFADFPLEGGCSRNCEEKM-DCGHICQSICHLS--SHDKIFC 246
             L+CQ HP+ +   +   +FA    +GGC R C  ++  CGH C  +CH+   SH  ++C
Sbjct: 1301 PLHCQLHPDYQRVASNPSSFALLSPDGGCLRPCGRRLPGCGHACPKLCHVDQPSHKAVYC 1360

Query: 247  PENCIR---------------------------TLPCGHPXXXX--------XXXXXXXX 271
             + C+R                           TLPCGH                     
Sbjct: 1361 TQPCLRLQEGCSHVCPRVCGDPCGRCEVLVGSITLPCGHTYSNARCFEAKKPSNVRCNVV 1420

Query: 272  VETIIMCPPCGHSEVVLCPDVDNFRCKERCSKKLKCGHQCREECSSPWCTAMCLTQTEVK 331
            VE +I    CGH +   C  + + +CK +C   L CGH+C   CS+      C+  T   
Sbjct: 1421 VEKLISV--CGHIQNTAC-YITDVKCKRKCGAVLTCGHECSRTCSN------CIEDTLEV 1471

Query: 332  YPGCGHIDL 340
            Y G    D 
Sbjct: 1472 YEGVPEPDF 1480



>gi|327305767|ref|XP_003237575.1| hypothetical protein TERG_02292 [Trichophyton rubrum CBS 118892]
 gi|326460573|gb|EGD86026.1| hypothetical protein TERG_02292 [Trichophyton rubrum CBS 118892]
          Length = 1906

 Score =  164 bits (415), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 192/375 (51%), Gaps = 43/375 (11%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQ---ESEKLERDTMSRTNTF 57
            RPEI  L+    +  L DH     +PDV G+ +N+F+ DH+   +S   ++   S +N++
Sbjct: 994  RPEISCLIRMTLYPRLVDHPSTKTFPDVVGMRNNVFWLDHENMEDSSNSDQHQRSHSNSW 1053

Query: 58   EARMCAKLANYLVMGGMEESR-ITILSMYSGQRKEIYKYLREE-------------SRKT 103
            E  M   L  +++  G+ ES+ I +L+ Y+GQ +++   LR +             ++  
Sbjct: 1054 EVDMAQSLVRHIIRQGVYESKDIALLTPYTGQLQKLRAKLRSDFEIVLSDRDLETLAKDG 1113

Query: 104  PVLKQ-----IRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHG 158
             V K+     +RV++VD FQGEE+ I+I+SLVRS++  + +GFL  +NR+ V LSRA+HG
Sbjct: 1114 SVEKKNLSEFLRVATVDNFQGEESKIVIISLVRSNKEKK-VGFLRTTNRINVLLSRAQHG 1172

Query: 159  LYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQV---FTFADFPLE 215
            +Y+ GNA        +W +V+ +L+  +   + + L C +H +   QV     F  F  E
Sbjct: 1173 MYLIGNADTYS-NVPMWAKVIGMLDAEQSVGKRLGLCCSRHMDTVMQVSEPLDFEKFSPE 1231

Query: 216  GGCSRNCEEKM-DCGHICQSICHLSSHDKIF-CPENCIRT-LPCGHPXXXXXXXXX---- 268
            GGC   C+ ++  CGH C + CH  +  ++F CP+ C R   PC H              
Sbjct: 1232 GGCQLPCDRRLTTCGHKCLARCHSDAMHEVFQCPQPCQRLHSPCKHGCQKQTCGEDCGVC 1291

Query: 269  XXXVETIIMCPPCGHSE-VVLC---PDVDNFRCKERCSKKL-KCGHQCREECSSPWCTA- 322
               ++ +++  PC H+E  V C    DV + +C  R  K++ KC H     C      A 
Sbjct: 1292 MIKIDNVLL--PCEHTEDGVPCYRTQDVKSIKCNARVQKRVPKCNHLVDVPCFRDVSIAF 1349

Query: 323  MCLTQTEVKYPGCGH 337
            +C T+ E   P CGH
Sbjct: 1350 LCPTKCEASLP-CGH 1363



>gi|512897300|ref|XP_004924119.1| PREDICTED: NFX1-type zinc finger-containing protein 1-like [Bombyx
            mori]
          Length = 1137

 Score =  164 bits (414), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 136/230 (59%), Gaps = 12/230 (5%)

Query: 1    RPEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQ---ESEKLERDTMSRTNTF 57
            RP + +LL P  + AL  H +V +YPDV G+ DNL+FF H+   ++E LE  + S  NTF
Sbjct: 915  RPRVAELLVPTVYPALDSHPDVYNYPDVRGMADNLYFFTHEVLEDTEGLE-GSWSHRNTF 973

Query: 58   EARMCAKLANYLVMGGMEESRITILSMYSGQRKEIYKYLREESRKTPVLKQIRVSSVDGF 117
            EAR C  LANYL         +TILS Y  Q       +++ S K   L+ I++++VD +
Sbjct: 974  EARWCVVLANYLRQMKYLAHEVTILSTYMEQ----VSLIKQLSLKYNSLRDIKITAVDNY 1029

Query: 118  QGEENDIIILSLVRSDESNRGIGFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWRE 177
            QGEE+ I+ILSLVRS++  + IGFL+ +NR+CVALSRA+ G YIFGN + L+  + +W  
Sbjct: 1030 QGEESRIVILSLVRSNKDGK-IGFLNATNRICVALSRAREGFYIFGNMNLLKTANNVWSS 1088

Query: 178  VLSILEKSKKCDQFINLYCQKHPEKETQVFTFADFP--LEGGCSRNCEEK 225
            +   L K       + L C KH  K  +V T  +F   + G C  NC +K
Sbjct: 1089 INEKLIKQNAIGNKLTLVC-KHHAKRLEVRTVNEFEKYISGTCPMNCGKK 1137



>gi|350639341|gb|EHA27695.1| hypothetical protein ASPNIDRAFT_225641 [Aspergillus niger ATCC 1015]
          Length = 1915

 Score =  164 bits (414), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 125/398 (31%), Positives = 175/398 (43%), Gaps = 55/398 (13%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDT---MSRTNTFE 58
            P I +L+    +  L DH  +  YP VPG+   LF+ DH   E     T    S+TNT+E
Sbjct: 947  PSISELVRETLYPKLQDHPTMTSYPLVPGIARRLFWLDHCNVEDPTDPTEPMQSKTNTWE 1006

Query: 59   ARMCAKLANYL-VMGGMEESRITILSMYSGQRKEIYKYLREE------------------ 99
              M   L  +L   G      I +L+ Y GQ + +   L +E                  
Sbjct: 1007 IGMVTALVRHLCQQGKYGPGEIAVLTPYVGQLRMLRNVLEKEMTIIISETDSDALDESEG 1066

Query: 100  --------------------SRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGI 139
                                 +K  +L  IR+++VD FQGEE  ++I+SLVRS+   R  
Sbjct: 1067 LQVSGPCMNEHGKWCGKQRAPQKGSLLDAIRLATVDNFQGEEASVVIVSLVRSNRP-RNC 1125

Query: 140  GFLSISNRVCVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKH 199
            GFL + NR+ V LSRAKHG+YI G+AS     + +W  V+ +LEK       + L C +H
Sbjct: 1126 GFLKMPNRINVLLSRAKHGMYIIGDASTAST-APMWSSVIHLLEKGANIGPKLELRCDRH 1184

Query: 200  PEKETQVFTFADFPL---EGGCSRNCEEKMDCGHICQSICHLS-SHDKIFCPENCIRTLP 255
            P     V    DF +   EGGC+  C  ++DCGH C   CH    H  + C E C R   
Sbjct: 1185 PSNGFYVNCPNDFTIHAPEGGCAEKCGLRLDCGHTCPVKCHSERQHKAVKCMELCTRMKS 1244

Query: 256  CGHPXXXXXXXXXXXXVETI-IMCPPCGH-SEVVLCPDVDNF---RCKERCSKKL-KCGH 309
            CGH             ++ +  +  PCGH +E V C  + N    RC +R S+ + +CGH
Sbjct: 1245 CGHACPKKCHEQCGECLQVVHNVLLPCGHITEAVECRQMGNLAKVRCTKRVSRTMDRCGH 1304

Query: 310  QCREECSSPWCTAMCLTQTEVKYPGCGHIDLCLCHDIR 347
              +  C        C    +   P CGH    LC   R
Sbjct: 1305 SAQIRCFENDGAVNCFHPCDSPMP-CGHTCRRLCWQCR 1341



>gi|350636678|gb|EHA25037.1| hypothetical protein ASPNIDRAFT_118758 [Aspergillus niger ATCC 1015]
          Length = 1907

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 117/392 (29%), Positives = 164/392 (41%), Gaps = 82/392 (20%)

Query: 2    PEIRKLLTPIYHDALSDHEEVNHYPDVPGLTDNLFFFDHQESEKLERDT----MSRTNTF 57
            P I +L+    +  L D   V  YP+V G+   LF+FDHQ  E     T     S  N F
Sbjct: 959  PSIAQLVRDTLYPRLEDAPSVLEYPEVCGMRQRLFWFDHQHPEAGNSSTDAVNTSHWNAF 1018

Query: 58   EARMCAKLANYLVMGG-MEESRITILSMYSGQRKEIYKYLREE----------------- 99
            E  M   L  +L+  G      I +L+ Y GQ   + + L E                  
Sbjct: 1019 EVEMTTALVAHLIRQGCYRAGEIAVLTPYLGQLHRLRRRLSESFSIVLGDRDQDDLEAAG 1078

Query: 100  -----------SRKTPVLKQIRVSSVDGFQGEENDIIILSLVRSDESNRGIGFLSISNRV 148
                         ++  L+ +R +++D FQGEE  ++++SLVRS+ + R  GFL  SNR+
Sbjct: 1079 LNESDADIHAPVSQSTALQTVRAATIDNFQGEEAKVVVISLVRSN-AQRRCGFLRTSNRI 1137

Query: 149  CVALSRAKHGLYIFGNASQLRYRSTLWREVLSILEKSKKCDQFINLYCQKHPEKETQVFT 208
             V LSRAKHG+YI GNA+       +WR+V+ IL+        I L C +HP+    V  
Sbjct: 1138 NVLLSRAKHGMYIIGNAA-TSMDVPMWRQVVEILKSKDNFGTQIKLQCPRHPDSPIAVSE 1196

Query: 209  ---FADFPLEGGCSRNCEEKMDCGHICQSICHLS-SHDKIFCPENCIRT----------- 253
               F  F  EGGC++ C  ++ CGH C+  CH +  H+ ++C E C R            
Sbjct: 1197 PDHFVQFSPEGGCNQRCVNRLKCGHACKQKCHSTLLHNAVYCQEPCPRPLKGCDHACPKH 1256

Query: 254  -------------------LPCGHPXXXXXXXXXXXXVETIIMCP--------PCGHSEV 286
                               LPCGH              E  + CP         C H+  
Sbjct: 1257 CGDKCPQRCQVTVFDANRHLPCGHAAAELPCWQAQDLSE--VKCPMPVAKQVRGCNHTVT 1314

Query: 287  VLC---PDVDNFRCKERCSKKLKCGHQCREEC 315
            V C     +  F C   C   L CGH CR +C
Sbjct: 1315 VPCHVDVGIPTFNCPAVCGAILACGHPCRRKC 1346