BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10023_c0_seq1-m.9 internal 2-1930(-) 643 (-)
         (643 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511000024|gb|EPB81594.1| hypothetical protein HMPREF1544_1168...   912   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|71018555|ref|XP_759508.1| hypothetical protein UM03361.1 [Ust...   889   0.0     
gi|388851857|emb|CCF54451.1| probable SEC26-coatomer complex bet...   887   0.0     Ustilago hordei
gi|501310438|dbj|GAC99198.1| hypothetical protein PHSY_006798 [P...   887   0.0     Pseudozyma hubeiensis SY62
gi|384493896|gb|EIE84387.1| hypothetical protein RO3G_09097 [Rhi...   883   0.0     Rhizopus delemar RA 99-880
gi|443897709|dbj|GAC75048.1| vesicle coat complex COPI, beta sub...   881   0.0     Moesziomyces antarcticus T-34
gi|319411717|emb|CBQ73761.1| probable SEC26-coatomer complex bet...   879   0.0     Sporisorium reilianum SRZ2
gi|343781354|gb|AEM55580.1| coatomer beta subunit [Puccinia stri...   874   0.0     Puccinia striiformis f. sp. tritici [wheat yellow rust]
gi|402222759|gb|EJU02825.1| coatomer subunit beta [Dacryopinax s...   871   0.0     Dacryopinax primogenitus
gi|328854469|gb|EGG03601.1| hypothetical protein MELLADRAFT_4451...   868   0.0     Melampsora larici-populina 98AG31
gi|331241739|ref|XP_003333517.1| hypothetical protein PGTG_14939...   866   0.0     Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|358057584|dbj|GAA96582.1| hypothetical protein E5Q_03252 [Mix...   864   0.0     Mixia osmundae IAM 14324
gi|471885171|emb|CCO33617.1| Coatomer subunit beta AltName: Full...   862   0.0     Rhizoctonia solani AG-1 IB
gi|393213128|gb|EJC98625.1| coatomer protein [Fomitiporia medite...   850   0.0     Fomitiporia mediterranea MF3/22
gi|406862688|gb|EKD15737.1| coatomer subunit beta [Marssonina br...   844   0.0     Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|392570899|gb|EIW64071.1| coatomer protein [Trametes versicolo...   841   0.0     Trametes versicolor FP-101664 SS1
gi|296424561|ref|XP_002841816.1| hypothetical protein [Tuber mel...   836   0.0     Tuber melanosporum Mel28
gi|395334713|gb|EJF67089.1| coatomer protein [Dichomitus squalen...   836   0.0     Dichomitus squalens LYAD-421 SS1
gi|406695179|gb|EKC98492.1| ER to transport-related protein [Tri...   833   0.0     Trichosporon asahii var. asahii CBS 8904
gi|440634799|gb|ELR04718.1| hypothetical protein GMDG_06947 [Geo...   832   0.0     Pseudogymnoascus destructans 20631-21
gi|401887092|gb|EJT51097.1| ER to golgi family transport-related...   830   0.0     Trichosporon asahii var. asahii CBS 2479
gi|449551218|gb|EMD42182.1| coatomer protein [Ceriporiopsis subv...   829   0.0     Gelatoporia subvermispora B
gi|156062874|ref|XP_001597359.1| conserved hypothetical protein ...   828   0.0     Sclerotinia sclerotiorum 1980 UF-70
gi|500253877|gb|EON97524.1| putative coatomer subunit beta prote...   826   0.0     Phaeoacremonium minimum UCRPA7
gi|154299992|ref|XP_001550413.1| conserved hypothetical protein ...   825   0.0     Botrytis cinerea B05.10
gi|361127247|gb|EHK99222.1| putative Coatomer subunit beta [Glar...   825   0.0     Glarea lozoyensis 74030
gi|212542539|ref|XP_002151424.1| Coatomer subunit beta, putative...   825   0.0     Talaromyces marneffei ATCC 18224
gi|347832046|emb|CCD47743.1| similar to coatomer subunit beta [B...   824   0.0     Botrytis cinerea T4
gi|336365229|gb|EGN93580.1| hypothetical protein SERLA73DRAFT_97...   824   0.0     Serpula lacrymans var. lacrymans S7.3
gi|345566841|gb|EGX49781.1| hypothetical protein AOL_s00076g665 ...   824   0.0     Arthrobotrys oligospora ATCC 24927
gi|242768312|ref|XP_002341543.1| Coatomer subunit beta, putative...   823   0.0     Talaromyces stipitatus ATCC 10500
gi|169781566|ref|XP_001825246.1| coatomer subunit beta [Aspergil...   822   0.0     Aspergillus oryzae RIB40
gi|512207863|gb|EPE36680.1| ARM repeat-containing protein [Glare...   822   0.0     Glarea lozoyensis ATCC 20868
gi|403417090|emb|CCM03790.1| predicted protein [Fibroporia radic...   821   0.0     Fibroporia radiculosa
gi|389623857|ref|XP_003709582.1| coatomer subunit beta [Magnapor...   820   0.0     Magnaporthe oryzae 70-15
gi|378729683|gb|EHY56142.1| hypothetical protein HMPREF1120_0423...   820   0.0     Exophiala dermatitidis NIH/UT8656
gi|471571529|gb|EMR70281.1| putative coatomer beta subunit prote...   818   0.0     Eutypa lata UCREL1
gi|358372860|dbj|GAA89461.1| coatomer subunit beta [Aspergillus ...   817   0.0     Aspergillus kawachii IFO 4308
gi|261203611|ref|XP_002629019.1| coatomer beta subunit [Ajellomy...   817   0.0     Blastomyces gilchristii SLH14081
gi|154287944|ref|XP_001544767.1| coatomer beta subunit [Ajellomy...   816   0.0     Histoplasma capsulatum NAm1
gi|325090047|gb|EGC43357.1| coatomer beta subunit [Ajellomyces c...   816   0.0     Histoplasma capsulatum H88
gi|226291349|gb|EEH46777.1| coatomer subunit beta [Paracoccidioi...   816   0.0     Paracoccidioides brasiliensis Pb18
gi|145239595|ref|XP_001392444.1| coatomer subunit beta [Aspergil...   816   0.0     Aspergillus niger CBS 513.88
gi|225679614|gb|EEH17898.1| coatomer subunit beta [Paracoccidioi...   816   0.0     Paracoccidioides brasiliensis Pb03
gi|295667820|ref|XP_002794459.1| coatomer subunit beta [Paracocc...   815   0.0     Paracoccidioides lutzii Pb01
gi|380487790|emb|CCF37813.1| hypothetical protein CH063_09056 [C...   815   0.0     Colletotrichum higginsianum
gi|70995412|ref|XP_752462.1| Coatomer subunit beta [Aspergillus ...   815   0.0     Aspergillus fumigatus Af293
gi|225560044|gb|EEH08326.1| coatomer beta subunit [Ajellomyces c...   815   0.0     Histoplasma capsulatum G186AR
gi|320587926|gb|EFX00401.1| coatamer subunit protein [Grosmannia...   815   0.0     Grosmannia clavigera kw1407
gi|119495787|ref|XP_001264671.1| Coatomer subunit beta, putative...   815   0.0     Aspergillus fischeri NRRL 181
gi|429858586|gb|ELA33401.1| coatomer beta subunit [Colletotrichu...   814   0.0     Colletotrichum gloeosporioides Nara gc5
gi|402080899|gb|EJT76044.1| coatomer subunit beta [Gaeumannomyce...   814   0.0     Gaeumannomyces graminis var. tritici R3-111a-1
gi|240278792|gb|EER42298.1| coatomer beta subunit [Ajellomyces c...   814   0.0     Histoplasma capsulatum H143
gi|407926368|gb|EKG19335.1| Clathrin/coatomer adaptor adaptin-li...   813   0.0     Macrophomina phaseolina MS6
gi|409051995|gb|EKM61471.1| hypothetical protein PHACADRAFT_2481...   812   0.0     Phanerochaete carnosa HHB-10118-sp
gi|342884986|gb|EGU85102.1| hypothetical protein FOXB_04381 [Fus...   812   0.0     Fusarium oxysporum Fo5176
gi|299756686|ref|XP_001829526.2| coatomer beta subunit [Coprinop...   812   0.0     Coprinopsis cinerea okayama7#130
gi|472588712|gb|EMS26184.1| coatomer protein complex, subunit be...   811   0.0     Rhodotorula toruloides NP11
gi|485926729|gb|EOD50948.1| putative coatomer subunit protein [N...   811   0.0     Neofusicoccum parvum UCRNP2
gi|494830908|gb|EON67419.1| hypothetical protein W97_06672 [Coni...   811   0.0     Coniosporium apollinis CBS 100218
gi|46111797|ref|XP_382956.1| hypothetical protein FG02780.1 [Fus...   811   0.0     
gi|322693002|gb|EFY84881.1| coatomer beta subunit [Metarhizium a...   811   0.0     Metarhizium acridum CQMa 102
gi|408389614|gb|EKJ69053.1| hypothetical protein FPSE_10779 [Fus...   811   0.0     Fusarium pseudograminearum CS3096
gi|58269570|ref|XP_571941.1| ER to Golgi transport-related prote...   810   0.0     Cryptococcus neoformans var. neoformans JEC21
gi|367045178|ref|XP_003652969.1| hypothetical protein THITE_2114...   810   0.0     Thielavia terrestris NRRL 8126
gi|389751331|gb|EIM92404.1| coatomer beta subunit [Stereum hirsu...   809   0.0     Stereum hirsutum FP-91666 SS1
gi|302884432|ref|XP_003041112.1| predicted protein [Nectria haem...   809   0.0     Nectria haematococca mpVI 77-13-4
gi|353236342|emb|CCA68339.1| probable coatomer complex beta chai...   809   0.0     Serendipita indica DSM 11827
gi|310801161|gb|EFQ36054.1| hypothetical protein GLRG_11198 [Glo...   808   0.0     Colletotrichum graminicola M1.001
gi|67518019|ref|XP_658781.1| hypothetical protein AN1177.2 [Aspe...   808   0.0     Aspergillus nidulans FGSC A4
gi|303320261|ref|XP_003070130.1| Coatomer beta subunit, putative...   807   0.0     Coccidioides posadasii C735 delta SOWgp
gi|320031983|gb|EFW13940.1| coatomer beta subunit [Coccidioides ...   807   0.0     Coccidioides posadasii str. Silveira
gi|321260991|ref|XP_003195215.1| ER to Golgi transport-related p...   807   0.0     Cryptococcus gattii WM276
gi|346326497|gb|EGX96093.1| coatomer beta subunit [Cordyceps mil...   807   0.0     Cordyceps militaris CM01
gi|400592789|gb|EJP60849.1| coatomer beta subunit [Beauveria bas...   806   0.0     Beauveria bassiana ARSEF 2860
gi|346973212|gb|EGY16664.1| coatomer subunit beta [Verticillium ...   806   0.0     Verticillium dahliae VdLs.17
gi|119184223|ref|XP_001243039.1| hypothetical protein CIMG_06935...   805   0.0     Coccidioides immitis RS
gi|477532473|gb|ENH84094.1| coatomer beta subunit [Colletotrichu...   805   0.0     Colletotrichum orbiculare MAFF 240422
gi|388583435|gb|EIM23737.1| Coatomer, beta subunit [Wallemia seb...   805   0.0     Wallemia mellicola CBS 633.66
gi|358389359|gb|EHK26951.1| adaptor protein [Trichoderma virens ...   805   0.0     Trichoderma virens Gv29-8
gi|367022052|ref|XP_003660311.1| hypothetical protein MYCTH_2298...   804   0.0     Myceliophthora thermophila ATCC 42464
gi|336266400|ref|XP_003347968.1| hypothetical protein SMAC_07343...   804   0.0     Sordaria macrospora k-hell
gi|475673873|gb|EMT70984.1| Coatomer subunit beta [Fusarium oxys...   804   0.0     Fusarium oxysporum f. sp. cubense race 4
gi|392598141|gb|EIW87463.1| coatomer protein [Coniophora puteana...   803   0.0     Coniophora puteana RWD-64-598 SS2
gi|336471233|gb|EGO59394.1| hypothetical protein NEUTE1DRAFT_794...   803   0.0     Neurospora tetrasperma FGSC 2508
gi|85085318|ref|XP_957481.1| coatomer beta subunit [Neurospora c...   803   0.0     Neurospora crassa OR74A
gi|116195722|ref|XP_001223673.1| conserved hypothetical protein ...   802   0.0     Chaetomium globosum CBS 148.51
gi|171690972|ref|XP_001910411.1| hypothetical protein [Podospora...   801   0.0     Podospora anserina S mat+
gi|358395440|gb|EHK44827.1| hypothetical protein TRIATDRAFT_1318...   800   0.0     Trichoderma atroviride IMI 206040
gi|115491503|ref|XP_001210379.1| coatomer beta subunit [Aspergil...   800   0.0     Aspergillus terreus NIH2624
gi|340515085|gb|EGR45342.1| coatamer complex, beta subunit [Tric...   800   0.0     Trichoderma reesei QM6a
gi|340960441|gb|EGS21622.1| coatomer subunit beta-like protein [...   800   0.0     Chaetomium thermophilum var. thermophilum DSM 1495
gi|258568962|ref|XP_002585225.1| coatomer beta subunit [Uncinoca...   799   0.0     Uncinocarpus reesii 1704
gi|255937485|ref|XP_002559769.1| Pc13g13550 [Penicillium chrysog...   797   0.0     Penicillium rubens Wisconsin 54-1255
gi|425767560|gb|EKV06129.1| Coatomer subunit beta, putative [Pen...   797   0.0     Penicillium digitatum PHI26
gi|453089945|gb|EMF17985.1| Coatomer, beta subunit [Mycosphaerel...   795   0.0     Sphaerulina musiva SO2202
gi|328772205|gb|EGF82244.1| hypothetical protein BATDEDRAFT_1910...   795   0.0     Batrachochytrium dendrobatidis JAM81
gi|398410555|ref|XP_003856626.1| coatomer subunit beta [Zymosept...   794   0.0     Zymoseptoria tritici IPO323
gi|392578450|gb|EIW71578.1| hypothetical protein TREMEDRAFT_7120...   793   0.0     Tremella mesenterica DSM 1558
gi|322711623|gb|EFZ03196.1| coatomer beta subunit [Metarhizium a...   791   0.0     
gi|477509668|gb|ENH62958.1| Coatomer subunit beta [Fusarium oxys...   790   0.0     Fusarium oxysporum f. sp. cubense race 1
gi|393240816|gb|EJD48341.1| coatomer beta subunit [Auricularia d...   790   0.0     Auricularia subglabra TFB-10046 SS5
gi|170107540|ref|XP_001884980.1| coatomer protein [Laccaria bico...   788   0.0     Laccaria bicolor S238N-H82
gi|452989220|gb|EME88975.1| hypothetical protein MYCFIDRAFT_2587...   787   0.0     Cercospora fijiensis CIRAD86
gi|426194035|gb|EKV43967.1| coatomer protein [Agaricus bisporus ...   787   0.0     Agaricus bisporus var. bisporus H97
gi|121701799|ref|XP_001269164.1| Coatomer subunit beta, putative...   786   0.0     Aspergillus clavatus NRRL 1
gi|449304842|gb|EMD00849.1| hypothetical protein BAUCODRAFT_2922...   786   0.0     Baudoinia panamericana UAMH 10762
gi|409078036|gb|EKM78400.1| hypothetical protein AGABI1DRAFT_605...   785   0.0     Agaricus bisporus var. burnettii JB137-S8
gi|452847733|gb|EME49665.1| hypothetical protein DOTSEDRAFT_6844...   781   0.0     Dothistroma septosporum NZE10
gi|399170809|emb|CCE28350.1| probable coatomer complex beta chai...   780   0.0     Claviceps purpurea 20.1
gi|296816567|ref|XP_002848620.1| coatomer subunit beta [Arthrode...   780   0.0     Arthroderma otae CBS 113480
gi|327293872|ref|XP_003231632.1| coatomer subunit beta [Trichoph...   778   0.0     Trichophyton rubrum CBS 118892
gi|302497856|ref|XP_003010927.1| hypothetical protein ARB_02824 ...   778   0.0     Arthroderma benhamiae CBS 112371
gi|326479208|gb|EGE03218.1| coatomer subunit beta [Trichophyton ...   778   0.0     Trichophyton equinum CBS 127.97
gi|302658469|ref|XP_003020938.1| hypothetical protein TRV_04960 ...   778   0.0     Trichophyton verrucosum HKI 0517
gi|315049935|ref|XP_003174342.1| coatomer subunit beta [Arthrode...   777   0.0     Microsporum gypseum CBS 118893
gi|390604963|gb|EIN14354.1| coatomer beta subunit [Punctularia s...   777   0.0     Punctularia strigosozonata HHB-11173 SS5
gi|326474250|gb|EGD98259.1| coatomer subunit beta [Trichophyton ...   774   0.0     Trichophyton tonsurans CBS 112818
gi|405121752|gb|AFR96520.1| coatomer beta subunit [Cryptococcus ...   772   0.0     
gi|451998828|gb|EMD91291.1| hypothetical protein COCHEDRAFT_1175...   769   0.0     Bipolaris maydis C5
gi|238498358|ref|XP_002380414.1| Coatomer subunit beta, putative...   769   0.0     Aspergillus flavus NRRL3357
gi|451845130|gb|EMD58444.1| hypothetical protein COCSADRAFT_1858...   769   0.0     Bipolaris sorokiniana ND90Pr
gi|189210794|ref|XP_001941728.1| coatomer subunit beta [Pyrenoph...   768   0.0     Pyrenophora tritici-repentis Pt-1C-BFP
gi|396462136|ref|XP_003835679.1| similar to coatomer subunit bet...   768   0.0     Leptosphaeria maculans JN3
gi|330914072|ref|XP_003296483.1| hypothetical protein PTT_06597 ...   765   0.0     Pyrenophora teres f. teres 0-1
gi|482804728|gb|EOA81827.1| hypothetical protein SETTUDRAFT_1654...   764   0.0     Setosphaeria turcica Et28A
gi|443925245|gb|ELU44124.1| coatomer beta subunit [Rhizoctonia s...   763   0.0     Rhizoctonia solani AG-1 IA
gi|169623680|ref|XP_001805247.1| hypothetical protein SNOG_15084...   762   0.0     Parastagonospora nodorum SN15
gi|302683943|ref|XP_003031652.1| hypothetical protein SCHCODRAFT...   757   0.0     Schizophyllum commune H4-8
gi|505757709|gb|EOR01830.1| Coatomer subunit beta [Wallemia icht...   739   0.0     Wallemia ichthyophaga EXF-994
gi|465792498|emb|CCU97609.1| unnamed protein product [Malassezia...   707   0.0     Malassezia sympodialis ATCC 42132
gi|164660098|ref|XP_001731172.1| hypothetical protein MGL_1355 [...   696   0.0     Malassezia globosa CBS 7966
gi|512194834|gb|EPE10590.1| coatomer subunit beta [Ophiostoma pi...   693   0.0     Ophiostoma piceae UAMH 11346
gi|320581205|gb|EFW95426.1| coatomer beta subunit [Ogataea parap...   669   0.0     
gi|294658846|ref|XP_461182.2| DEHA2F19272p [Debaryomyces hanseni...   657   0.0     Debaryomyces hansenii CBS767
gi|149068231|gb|EDM17783.1| coatomer protein complex, subunit be...   657   0.0     Rattus norvegicus [brown rat]
gi|507533686|ref|XP_004650903.1| PREDICTED: coatomer subunit bet...   656   0.0     Jaculus jaculus
gi|18158449|ref|NP_542959.1| coatomer subunit beta [Rattus norve...   656   0.0     Rattus norvegicus [brown rat]
gi|15426055|ref|NP_203534.1| coatomer subunit beta [Mus musculus...   655   0.0     Mus musculus [mouse]
gi|327281271|ref|XP_003225372.1| PREDICTED: coatomer subunit bet...   654   0.0     Anolis carolinensis [Carolina anole]
gi|354488599|ref|XP_003506455.1| PREDICTED: coatomer subunit bet...   653   0.0     Cricetulus griseus [Chinese hamsters]
gi|224285129|gb|ACN40292.1| unknown [Picea sitchensis]                653   0.0     Picea sitchensis
gi|149634429|ref|XP_001507656.1| PREDICTED: coatomer subunit bet...   653   0.0     Ornithorhynchus anatinus [duck-billed platypus]
gi|507949063|ref|XP_004683083.1| PREDICTED: coatomer subunit bet...   653   0.0     Condylura cristata
gi|296217627|ref|XP_002755030.1| PREDICTED: coatomer subunit bet...   653   0.0     
gi|291384667|ref|XP_002708871.1| PREDICTED: coatomer protein com...   653   0.0     Oryctolagus cuniculus [European rabbit]
gi|395815306|ref|XP_003781171.1| PREDICTED: coatomer subunit bet...   652   0.0     Otolemur garnettii
gi|82181062|sp|Q66HV4.1|COPB_DANRE RecName: Full=Coatomer subuni...   652   0.0     Danio rerio [leopard danio]
gi|326920038|ref|XP_003206283.1| PREDICTED: coatomer subunit bet...   652   0.0     
gi|426244754|ref|XP_004016182.1| PREDICTED: coatomer subunit bet...   652   0.0     
gi|397494753|ref|XP_003818236.1| PREDICTED: coatomer subunit bet...   652   0.0     Pan paniscus [bonobo]
gi|505840234|ref|XP_004613638.1| PREDICTED: coatomer subunit bet...   652   0.0     Sorex araneus [Eurasian shrew]
gi|114636308|ref|XP_001172089.1| PREDICTED: coatomer subunit bet...   652   0.0     Pan troglodytes
gi|57530020|ref|NP_001006467.1| coatomer subunit beta [Gallus ga...   652   0.0     Gallus gallus [bantam]
gi|504168338|ref|XP_004593816.1| PREDICTED: coatomer subunit bet...   652   0.0     Ochotona princeps [southern American pika]
gi|7705369|ref|NP_057535.1| coatomer subunit beta [Homo sapiens]...   652   0.0     Homo sapiens [man]
gi|348559918|ref|XP_003465762.1| PREDICTED: coatomer subunit bet...   652   0.0     Cavia porcellus [guinea pig]
gi|470631112|ref|XP_004321868.1| PREDICTED: coatomer subunit bet...   652   0.0     Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|471358282|ref|XP_004369725.1| PREDICTED: coatomer subunit bet...   652   0.0     Trichechus manatus latirostris
gi|332211837|ref|XP_003255022.1| PREDICTED: coatomer subunit bet...   652   0.0     Nomascus leucogenys [White-cheeked Gibbon]
gi|466055248|ref|XP_004279206.1| PREDICTED: coatomer subunit bet...   652   0.0     Orcinus orca [Orca]
gi|297689219|ref|XP_002822052.1| PREDICTED: coatomer subunit bet...   652   0.0     
gi|301775861|ref|XP_002923349.1| PREDICTED: coatomer subunit bet...   652   0.0     Ailuropoda melanoleuca
gi|75041667|sp|Q5R922.1|COPB_PONAB RecName: Full=Coatomer subuni...   652   0.0     Pongo abelii [Orang-utan]
gi|449280860|gb|EMC88085.1| Coatomer subunit beta [Columba livia]     651   0.0     Columba livia [carrier pigeon]
gi|478488258|ref|XP_004418517.1| PREDICTED: coatomer subunit bet...   651   0.0     Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|512904460|ref|XP_004900324.1| PREDICTED: coatomer subunit bet...   651   0.0     
gi|118151108|ref|NP_001071475.1| coatomer subunit beta [Bos taur...   651   0.0     Bos taurus [bovine]
gi|224050801|ref|XP_002198193.1| PREDICTED: coatomer subunit bet...   651   0.0     Taeniopygia guttata
gi|213983027|ref|NP_001135674.1| coatomer protein complex, subun...   651   0.0     Xenopus tropicalis [western clawed frog]
gi|472392711|ref|XP_004415630.1| PREDICTED: coatomer subunit bet...   650   0.0     Odobenus rosmarus divergens
gi|348509611|ref|XP_003442341.1| PREDICTED: coatomer subunit bet...   650   0.0     Oreochromis niloticus
gi|410973239|ref|XP_003993062.1| PREDICTED: coatomer subunit bet...   650   0.0     Felis catus [cat]
gi|148223539|ref|NP_001085859.1| coatomer protein complex, subun...   650   0.0     Xenopus laevis [clawed frog]
gi|344280549|ref|XP_003412045.1| PREDICTED: coatomer subunit bet...   650   0.0     Loxodonta africana [African bush elephant]
gi|511857334|ref|XP_004752082.1| PREDICTED: coatomer subunit bet...   650   0.0     Mustela putorius furo [black ferret]
gi|345787834|ref|XP_534069.3| PREDICTED: coatomer subunit beta [...   650   0.0     Canis lupus familiaris [dogs]
gi|126332121|ref|XP_001367107.1| PREDICTED: coatomer subunit bet...   650   0.0     Monodelphis domestica
gi|149719463|ref|XP_001504991.1| PREDICTED: coatomer subunit bet...   649   0.0     Equus caballus [domestic horse]
gi|297268352|ref|XP_002808121.1| PREDICTED: LOW QUALITY PROTEIN:...   649   0.0     
gi|50300477|ref|NP_001002013.1| coatomer subunit beta [Danio rer...   649   0.0     Danio rerio [leopard danio]
gi|395543422|ref|XP_003773617.1| PREDICTED: coatomer subunit bet...   649   0.0     
gi|432851750|ref|XP_004067066.1| PREDICTED: coatomer subunit bet...   649   0.0     Oryzias latipes [Japanese rice fish]
gi|148223736|ref|NP_001090083.1| uncharacterized protein LOC7351...   647   0.0     Xenopus laevis [clawed frog]
gi|507685168|ref|XP_004711619.1| PREDICTED: coatomer subunit bet...   647   0.0     Echinops telfairi [lesser hedgehog tenrec]
gi|224143423|ref|XP_002324951.1| predicted protein [Populus tric...   647   0.0     Populus trichocarpa [western balsam poplar]
gi|288860138|ref|NP_001165837.1| coatomer subunit beta [Sus scro...   647   0.0     Sus scrofa [pigs]
gi|498947885|ref|XP_004543244.1| PREDICTED: coatomer subunit bet...   646   0.0     Maylandia zebra
gi|410913063|ref|XP_003970008.1| PREDICTED: coatomer subunit bet...   646   0.0     Takifugu rubripes [tiger puffer]
gi|459370720|gb|EMG48736.1| Coatomer beta subunit [Candida malto...   645   0.0     Candida maltosa Xu316
gi|406606124|emb|CCH42484.1| hypothetical protein BN7_2029 [Wick...   645   0.0     Wickerhamomyces ciferrii
gi|508781970|gb|EOY29226.1| Coatomer, beta subunit isoform 1 [Th...   644   0.0     Theobroma cacao [chocolate]
gi|30689050|ref|NP_194877.2| coatomer subunit beta-2 [Arabidopsi...   644   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|225429750|ref|XP_002282410.1| PREDICTED: coatomer subunit bet...   643   0.0     Vitis vinifera
gi|5257007|gb|AAD41240.1| beta-cop homolog [Homo sapiens]             642   0.0     Homo sapiens [man]
gi|5262760|emb|CAB45908.1| Beta-COP-like protein [Arabidopsis th...   642   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|356521768|ref|XP_003529523.1| PREDICTED: coatomer subunit bet...   642   0.0     Glycine max [soybeans]
gi|149238742|ref|XP_001525247.1| coatomer beta subunit [Lodderom...   642   0.0     Lodderomyces elongisporus NRRL YB-4239
gi|255721367|ref|XP_002545618.1| coatomer beta subunit [Candida ...   641   0.0     Candida tropicalis MYA-3404
gi|224121310|ref|XP_002330795.1| predicted protein [Populus tric...   641   0.0     
gi|470121855|ref|XP_004296972.1| PREDICTED: coatomer subunit bet...   640   0.0     Fragaria vesca subsp. vesca
gi|482551248|gb|EOA15441.1| hypothetical protein CARUB_v10004083...   640   0.0     Capsella rubella
gi|334187061|ref|NP_194876.2| coatomer subunit beta-1 [Arabidops...   640   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|5262759|emb|CAB45907.1| putative protein [Arabidopsis thalian...   639   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|449461669|ref|XP_004148564.1| PREDICTED: coatomer subunit bet...   639   0.0     Cucumis sativus [cucumbers]
gi|356526314|ref|XP_003531763.1| PREDICTED: coatomer subunit bet...   639   e-180   Glycine max [soybeans]
gi|302816011|ref|XP_002989685.1| hypothetical protein SELMODRAFT...   639   e-180   Selaginella moellendorffii
gi|168042714|ref|XP_001773832.1| predicted protein [Physcomitrel...   639   e-180   Physcomitrella patens
gi|241958562|ref|XP_002422000.1| beta-coat protein of the COPI c...   637   e-180   Candida dubliniensis CD36
gi|213515116|ref|NP_001133821.1| Coatomer subunit beta [Salmo sa...   637   e-180   Salmo salar
gi|448527490|ref|XP_003869511.1| Sec26 protein [Candida orthopsi...   637   e-180   Candida orthopsilosis Co 90-125
gi|260943546|ref|XP_002616071.1| hypothetical protein CLUG_03312...   637   e-180   Clavispora lusitaniae ATCC 42720
gi|502149433|ref|XP_004507525.1| PREDICTED: coatomer subunit bet...   636   e-180   Cicer arietinum [garbanzo]
gi|460365417|ref|XP_004228599.1| PREDICTED: coatomer subunit bet...   636   e-180   Solanum lycopersicum
gi|297802880|ref|XP_002869324.1| coatomer subunit beta-1 [Arabid...   636   e-180   Arabidopsis lyrata subsp. lyrata
gi|168059347|ref|XP_001781664.1| predicted protein [Physcomitrel...   635   e-180   Physcomitrella patens
gi|68477011|ref|XP_717483.1| hypothetical protein CaO19.8161 [Ca...   635   e-179   Candida albicans SC5314
gi|260825750|ref|XP_002607829.1| hypothetical protein BRAFLDRAFT...   635   e-179   Branchiostoma floridae
gi|354546153|emb|CCE42882.1| hypothetical protein CPAR2_205250 [...   635   e-179   Candida parapsilosis
gi|302820254|ref|XP_002991795.1| hypothetical protein SELMODRAFT...   634   e-179   Selaginella moellendorffii
gi|168015790|ref|XP_001760433.1| predicted protein [Physcomitrel...   634   e-179   Physcomitrella patens
gi|150866782|ref|XP_001386493.2| hypothetical protein PICST_9120...   634   e-179   Scheffersomyces stipitis CBS 6054
gi|47230461|emb|CAF99654.1| unnamed protein product [Tetraodon n...   632   e-179   Tetraodon nigroviridis
gi|19112195|ref|NP_595403.1| coatomer beta subunit (predicted) [...   630   e-178   Schizosaccharomyces pombe 972h-
gi|344243210|gb|EGV99313.1| Coatomer subunit beta [Cricetulus gr...   629   e-178   Cricetulus griseus [Chinese hamsters]
gi|483511397|gb|EOB00260.1| Coatomer subunit beta, partial [Anas...   629   e-177   Anas platyrhynchos [duck]
gi|444730394|gb|ELW70780.1| Coatomer subunit beta [Tupaia chinen...   629   e-177   Tupaia chinensis
gi|448106229|ref|XP_004200694.1| Piso0_003290 [Millerozyma farin...   629   e-177   Millerozyma farinosa CBS 7064
gi|465990125|gb|EMP38286.1| Coatomer subunit beta [Chelonia mydas]    628   e-177   Chelonia mydas [green seaturtle]
gi|190344474|gb|EDK36153.2| hypothetical protein PGUG_00251 [Mey...   628   e-177   Meyerozyma guilliermondii ATCC 6260
gi|460407939|ref|XP_004249406.1| PREDICTED: coatomer subunit bet...   627   e-177   Solanum lycopersicum
gi|281341607|gb|EFB17191.1| hypothetical protein PANDA_012478 [A...   627   e-177   Ailuropoda melanoleuca
gi|431919659|gb|ELK18047.1| Coatomer subunit beta [Pteropus alecto]   627   e-177   Pteropus alecto
gi|405964798|gb|EKC30244.1| Coatomer subunit beta [Crassostrea g...   627   e-177   Crassostrea gigas
gi|344303982|gb|EGW34231.1| hypothetical protein SPAPADRAFT_1355...   626   e-177   Spathaspora passalidarum NRRL Y-27907
gi|344234745|gb|EGV66613.1| hypothetical protein CANTEDRAFT_1005...   626   e-177   Candida tenuis ATCC 10573
gi|254574274|ref|XP_002494246.1| Essential beta-coat protein of ...   625   e-176   Komagataella phaffii GS115
gi|499004084|ref|XP_004535246.1| PREDICTED: coatomer subunit bet...   625   e-176   Ceratitis capitata
gi|146421861|ref|XP_001486874.1| hypothetical protein PGUG_00251...   625   e-176   Meyerozyma guilliermondii ATCC 6260
gi|296081749|emb|CBI20754.3| unnamed protein product [Vitis vini...   623   e-176   Vitis vinifera
gi|157106589|ref|XP_001649392.1| coatomer beta subunit [Aedes ae...   622   e-175   Aedes aegypti
gi|462413219|gb|EMJ18268.1| hypothetical protein PRUPE_ppa000957...   621   e-175   Prunus persica
gi|321475505|gb|EFX86468.1| hypothetical protein DAPPUDRAFT_3130...   620   e-175   Daphnia pulex
gi|195400901|ref|XP_002059054.1| GJ15202 [Drosophila virilis] >g...   619   e-175   Drosophila virilis
gi|170034388|ref|XP_001845056.1| coatomer subunit beta [Culex qu...   619   e-174   Culex quinquefasciatus
gi|242005067|ref|XP_002423396.1| Coatomer subunit beta, putative...   618   e-174   Pediculus humanus corporis [human body lice]
gi|297611333|ref|NP_001065875.2| Os11g0174000 [Oryza sativa Japo...   618   e-174   
gi|218185340|gb|EEC67767.1| hypothetical protein OsI_35302 [Oryz...   618   e-174   Oryza sativa Indica Group [Indian rice]
gi|326430367|gb|EGD75937.1| coatomer beta subunit [Salpingoeca s...   618   e-174   Salpingoeca rosetta
gi|430813538|emb|CCJ29123.1| unnamed protein product [Pneumocyst...   617   e-174   Pneumocystis jirovecii
gi|242057059|ref|XP_002457675.1| hypothetical protein SORBIDRAFT...   617   e-174   Sorghum bicolor [broomcorn]
gi|462411071|gb|EMJ16120.1| hypothetical protein PRUPE_ppa000955...   617   e-174   Prunus persica
gi|413946857|gb|AFW79506.1| hypothetical protein ZEAMMB73_811536...   617   e-174   Zea mays [maize]
gi|156366295|ref|XP_001627074.1| predicted protein [Nematostella...   616   e-174   Nematostella vectensis
gi|357131486|ref|XP_003567368.1| PREDICTED: coatomer subunit bet...   616   e-174   Brachypodium distachyon [annual false brome]
gi|449671081|ref|XP_002164725.2| PREDICTED: coatomer subunit bet...   615   e-173   
gi|50556394|ref|XP_505605.1| YALI0F19074p [Yarrowia lipolytica] ...   615   e-173   Yarrowia lipolytica CLIB122
gi|195432256|ref|XP_002064142.1| GK19864 [Drosophila willistoni]...   615   e-173   Drosophila willistoni
gi|189234428|ref|XP_001816488.1| PREDICTED: similar to coatomer ...   615   e-173   Tribolium castaneum [rust-red flour beetle]
gi|470317594|gb|EMR09294.1| hypothetical protein PNEG_02254 [Pne...   614   e-173   Pneumocystis murina B123
gi|225443308|ref|XP_002275226.1| PREDICTED: coatomer subunit bet...   614   e-173   Vitis vinifera
gi|195130843|ref|XP_002009860.1| GI15599 [Drosophila mojavensis]...   614   e-173   Drosophila mojavensis
gi|474423520|gb|EMS67617.1| Coatomer subunit beta-2 [Triticum ur...   613   e-173   Triticum urartu
gi|414877091|tpg|DAA54222.1| TPA: hypothetical protein ZEAMMB73_...   613   e-173   Zea mays [maize]
gi|195481318|ref|XP_002101602.1| GE15534 [Drosophila yakuba] >gi...   612   e-172   Drosophila yakuba
gi|357131519|ref|XP_003567384.1| PREDICTED: coatomer subunit bet...   611   e-172   Brachypodium distachyon [annual false brome]
gi|475614601|gb|EMT29144.1| Coatomer subunit beta-2 [Aegilops ta...   610   e-172   Aegilops tauschii
gi|125525418|gb|EAY73532.1| hypothetical protein OsI_01415 [Oryz...   610   e-172   Oryza sativa Indica Group [Indian rice]
gi|302850384|ref|XP_002956719.1| hypothetical protein VOLCADRAFT...   609   e-172   Volvox carteri f. nagariensis
gi|385304212|gb|EIF48239.1| coatomer beta subunit [Dekkera bruxe...   608   e-171   Brettanomyces bruxellensis AWRI1499
gi|122235033|sp|Q0JNK5.1|COPB2_ORYSJ RecName: Full=Coatomer subu...   608   e-171   Oryza sativa Japonica Group [Japonica rice]
gi|11138076|dbj|BAB17749.1| putative coatmer beta subunit (beta-...   608   e-171   Oryza sativa Japonica Group [Japonica rice]
gi|195345433|ref|XP_002039273.1| GM22820 [Drosophila sechellia] ...   607   e-171   Drosophila sechellia
gi|17647193|ref|NP_523400.1| beta-coatomer protein [Drosophila m...   607   e-171   Drosophila melanogaster
gi|220942592|gb|ACL83839.1| betaCop-PA [synthetic construct]          607   e-171   synthetic construct
gi|383856102|ref|XP_003703549.1| PREDICTED: coatomer subunit bet...   606   e-171   
gi|383856100|ref|XP_003703548.1| PREDICTED: coatomer subunit bet...   606   e-171   Megachile rotundata
gi|194892406|ref|XP_001977656.1| GG18127 [Drosophila erecta] >gi...   606   e-171   Drosophila erecta
gi|478263742|gb|ENN82045.1| hypothetical protein YQE_01620, part...   605   e-170   Dendroctonus ponderosae
gi|470140160|ref|XP_004305811.1| PREDICTED: coatomer subunit bet...   604   e-170   
gi|414588445|tpg|DAA39016.1| TPA: hypothetical protein ZEAMMB73_...   604   e-170   
gi|297796593|ref|XP_002866181.1| coatomer subunit beta-1 [Arabid...   603   e-170   
gi|198467315|ref|XP_001354355.2| GA19453 [Drosophila pseudoobscu...   602   e-170   
gi|34556165|dbj|BAC87706.1| coatomer subunit beta [Botryococcus ...   602   e-170   
gi|332016435|gb|EGI57348.1| Coatomer subunit beta [Acromyrmex ec...   602   e-169   
gi|384249201|gb|EIE22683.1| coatomer subunit beta [Coccomyxa sub...   602   e-169   
gi|303276653|ref|XP_003057620.1| coatomer subunit beta [Micromon...   602   e-169   
gi|110763426|ref|XP_001120953.1| PREDICTED: coatomer subunit bet...   600   e-169   
gi|307180173|gb|EFN68206.1| Coatomer subunit beta [Camponotus fl...   600   e-169   
gi|475584568|gb|EMT19811.1| Coatomer subunit beta-2 [Aegilops ta...   599   e-169   
gi|195039810|ref|XP_001990951.1| GH12352 [Drosophila grimshawi] ...   599   e-168   
gi|194766724|ref|XP_001965474.1| GF22509 [Drosophila ananassae] ...   598   e-168   
gi|198432741|ref|XP_002131807.1| PREDICTED: coatomer subunit bet...   598   e-168   
gi|472343|gb|AAA21090.1| bcop [Drosophila melanogaster]               597   e-168   
gi|322793237|gb|EFZ16894.1| hypothetical protein SINV_11018 [Sol...   597   e-168   
gi|159486455|ref|XP_001701255.1| beta-cop [Chlamydomonas reinhar...   597   e-168   
gi|156549244|ref|XP_001606861.1| PREDICTED: coatomer subunit bet...   596   e-168   
gi|158302111|ref|XP_321735.4| AGAP001399-PA [Anopheles gambiae s...   594   e-167   
gi|195172069|ref|XP_002026824.1| GL27037 [Drosophila persimilis]...   591   e-166   
gi|255076481|ref|XP_002501915.1| coatomer subunit beta [Micromon...   590   e-166   
gi|307199989|gb|EFN80339.1| Coatomer subunit beta [Harpegnathos ...   589   e-165   
gi|350413321|ref|XP_003489957.1| PREDICTED: coatomer subunit bet...   587   e-165   
gi|307106709|gb|EFN54954.1| hypothetical protein CHLNCDRAFT_5619...   586   e-165   
gi|488565885|ref|XP_004472613.1| PREDICTED: coatomer subunit bet...   586   e-165   
gi|298204799|emb|CBI25297.3| unnamed protein product [Vitis vini...   585   e-164   
gi|412986253|emb|CCO17453.1| predicted protein [Bathycoccus pras...   585   e-164   
gi|443702157|gb|ELU00318.1| hypothetical protein CAPTEDRAFT_1842...   584   e-164   
gi|380014965|ref|XP_003691483.1| PREDICTED: coatomer subunit bet...   584   e-164   
gi|302423814|ref|XP_003009737.1| coatomer subunit beta [Verticil...   578   e-162   
gi|470424972|ref|XP_004337758.1| coatmer subunit, putative [Acan...   578   e-162   
gi|193692994|ref|XP_001949960.1| PREDICTED: coatomer subunit bet...   578   e-162   
gi|474377124|gb|EMS64278.1| Coatomer subunit beta-2 [Triticum ur...   577   e-162   
gi|340373285|ref|XP_003385172.1| PREDICTED: coatomer subunit bet...   577   e-162   
gi|313241726|emb|CBY33945.1| unnamed protein product [Oikopleura...   575   e-161   
gi|313235746|emb|CBY11196.1| unnamed protein product [Oikopleura...   574   e-161   
gi|367010024|ref|XP_003679513.1| hypothetical protein TDEL_0B017...   570   e-160   
gi|254583384|ref|XP_002497260.1| ZYRO0F01474p [Zygosaccharomyces...   569   e-159   
gi|196001017|ref|XP_002110376.1| hypothetical protein TRIADDRAFT...   568   e-159   
gi|167533935|ref|XP_001748646.1| hypothetical protein [Monosiga ...   566   e-159   
gi|428180759|gb|EKX49625.1| coatomer subunit beta 1 [Guillardia ...   565   e-158   
gi|255715323|ref|XP_002553943.1| KLTH0E10736p [Lachancea thermot...   559   e-157   
gi|156846248|ref|XP_001646012.1| hypothetical protein Kpol_1031p...   558   e-156   
gi|213408705|ref|XP_002175123.1| coatomer subunit beta [Schizosa...   558   e-156   
gi|485614939|gb|EOD12644.1| COPB1, beta subunit of the coatomer ...   558   e-156   
gi|402590753|gb|EJW84683.1| hypothetical protein WUBG_04405 [Wuc...   554   e-155   
gi|170583079|ref|XP_001896419.1| coatomer beta subunit [Brugia m...   553   e-155   
gi|426367543|ref|XP_004050789.1| PREDICTED: coatomer subunit bet...   552   e-154   
gi|403213595|emb|CCK68097.1| hypothetical protein KNAG_0A04190 [...   551   e-154   
gi|50305849|ref|XP_452885.1| hypothetical protein [Kluyveromyces...   550   e-154   
gi|444313665|ref|XP_004177490.1| hypothetical protein TBLA_0A017...   549   e-153   
gi|401624257|gb|EJS42321.1| sec26p [Saccharomyces arboricola H-6]     548   e-153   
gi|410079967|ref|XP_003957564.1| hypothetical protein KAFR_0E027...   546   e-153   
gi|145345513|ref|XP_001417252.1| predicted protein [Ostreococcus...   545   e-152   
gi|50292531|ref|XP_448698.1| hypothetical protein [Candida glabr...   544   e-152   
gi|470474982|ref|XP_004342116.1| Adaptin domain containing prote...   544   e-152   
gi|365761408|gb|EHN03065.1| Sec26p [Saccharomyces cerevisiae x S...   544   e-152   
gi|401840022|gb|EJT42947.1| SEC26-like protein [Saccharomyces ku...   543   e-152   
gi|513030318|gb|AGO10343.1| AaceriABL112Wp [Saccharomycetaceae s...   541   e-151   
gi|45185118|ref|NP_982835.1| ABL112Wp [Ashbya gossypii ATCC 1089...   541   e-151   
gi|393911864|gb|EFO27068.2| coatomer beta subunit [Loa loa]           539   e-151   
gi|365985153|ref|XP_003669409.1| hypothetical protein NDAI_0C050...   535   e-149   
gi|323338184|gb|EGA79417.1| Sec26p [Saccharomyces cerevisiae Vin13]   535   e-149   
gi|151942215|gb|EDN60571.1| coatomer subunit [Saccharomyces cere...   535   e-149   
gi|268563416|ref|XP_002646930.1| Hypothetical protein CBG19635 [...   535   e-149   
gi|398366227|ref|NP_010524.3| Sec26p [Saccharomyces cerevisiae S...   535   e-149   
gi|323305561|gb|EGA59303.1| Sec26p [Saccharomyces cerevisiae Fos...   535   e-149   
gi|365766322|gb|EHN07820.1| Sec26p [Saccharomyces cerevisiae x S...   534   e-149   
gi|256270008|gb|EEU05257.1| Sec26p [Saccharomyces cerevisiae JAY...   534   e-149   
gi|312067971|ref|XP_003136994.1| coatomer beta subunit [Loa loa]      533   e-149   
gi|595413|gb|AAA61710.1| beta COP [Saccharomyces cerevisiae]          533   e-149   
gi|190404812|gb|EDV08079.1| yeast coatomer subunit [Saccharomyce...   533   e-149   
gi|341885400|gb|EGT41335.1| hypothetical protein CAEBREN_01904 [...   531   e-148   
gi|366989905|ref|XP_003674720.1| hypothetical protein NCAS_0B026...   528   e-147   
gi|367006358|ref|XP_003687910.1| hypothetical protein TPHA_0L011...   525   e-146   
gi|363752996|ref|XP_003646714.1| hypothetical protein Ecym_5117 ...   524   e-146   
gi|17536967|ref|NP_494441.1| Protein COPB-1 [Caenorhabditis eleg...   524   e-146   
gi|308495464|ref|XP_003109920.1| hypothetical protein CRE_06434 ...   523   e-146   
gi|339245715|ref|XP_003374491.1| coatomer subunit beta [Trichine...   522   e-145   
gi|507110700|emb|CDF34449.1| unnamed protein product [Chondrus c...   521   e-145   
gi|301118979|ref|XP_002907217.1| coatomer subunit beta, putative...   518   e-144   
gi|312373694|gb|EFR21393.1| hypothetical protein AND_17130 [Anop...   514   e-143   
gi|62701951|gb|AAX93024.1| Adaptin N terminal region, putative [...   514   e-143   
gi|255548574|ref|XP_002515343.1| Coatomer subunit beta, putative...   506   e-141   
gi|348690466|gb|EGZ30280.1| hypothetical protein PHYSODRAFT_2637...   504   e-140   
gi|325192011|emb|CCA26477.1| predicted protein putative [Albugo ...   499   e-138   
gi|449516748|ref|XP_004165408.1| PREDICTED: coatomer subunit bet...   496   e-138   
gi|298714920|emb|CBJ27676.1| Coatomer protein complex, beta sub-...   495   e-137   
gi|397615044|gb|EJK63179.1| hypothetical protein THAOC_16183 [Th...   492   e-136   
gi|308802968|ref|XP_003078797.1| coatomer subunit beta (ISS) [Os...   492   e-136   
gi|422295509|gb|EKU22808.1| hypothetical protein NGA_0357120 [Na...   483   e-134   
gi|219119217|ref|XP_002180373.1| predicted protein [Phaeodactylu...   479   e-132   
gi|66809305|ref|XP_638375.1| coatomer protein complex beta subun...   478   e-132   
gi|323449852|gb|EGB05737.1| hypothetical protein AURANDRAFT_7028...   474   e-131   
gi|223999607|ref|XP_002289476.1| coatomer protein subunit beta 1...   473   e-131   
gi|330800743|ref|XP_003288393.1| hypothetical protein DICPUDRAFT...   469   e-129   
gi|391345000|ref|XP_003746781.1| PREDICTED: coatomer subunit bet...   462   e-127   
gi|290980950|ref|XP_002673194.1| coatomer protein complex, subun...   452   e-124   
gi|281207038|gb|EFA81222.1| coatomer protein complex beta subuni...   451   e-124   
gi|226468516|emb|CAX69935.1| Coatomer subunit beta [Schistosoma ...   449   e-123   
gi|452820720|gb|EME27759.1| coatomer protein complex, subunit be...   446   e-123   
gi|485624026|gb|EOD20142.1| COPB1, beta subunit of the coatomer ...   439   e-120   
gi|74207982|dbj|BAE29109.1| unnamed protein product [Mus musculus]    439   e-120   
gi|470301253|ref|XP_004347301.1| coatomer subunit beta [Capsaspo...   435   e-119   
gi|195567509|ref|XP_002107302.1| GD15643 [Drosophila simulans] >...   434   e-119   
gi|470259943|ref|XP_004359974.1| coatomer protein complex beta s...   425   e-116   
gi|358337408|dbj|GAA33402.2| coatomer subunit beta [Clonorchis s...   419   e-114   
gi|253761177|ref|XP_002489057.1| hypothetical protein SORBIDRAFT...   407   e-111   
gi|67967944|dbj|BAE00454.1| unnamed protein product [Macaca fasc...   384   e-104   
gi|390350551|ref|XP_787302.2| PREDICTED: coatomer subunit beta-l...   381   e-103   
gi|71656279|ref|XP_816689.1| coatomer beta subunit [Trypanosoma ...   380   e-103   
gi|407843803|gb|EKG01643.1| coatomer beta subunit, putative [Try...   380   e-103   
gi|620110|emb|CAA57622.1| beta-Coat protein [Homo sapiens]            378   e-102   
gi|407404804|gb|EKF30128.1| coatomer beta subunit, putative, par...   375   e-101   
gi|323449048|gb|EGB04939.1| hypothetical protein AURANDRAFT_7238...   370   1e-99   
gi|449016173|dbj|BAM79575.1| coatomer protein complex, subunit b...   367   7e-99   
gi|293335447|ref|NP_001169567.1| uncharacterized protein LOC1003...   362   2e-97   
gi|475526879|gb|EMT07379.1| Coatomer subunit beta-1 [Aegilops ta...   358   2e-96   
gi|391333108|ref|XP_003740964.1| PREDICTED: coatomer subunit bet...   357   9e-96   
gi|1432173|gb|AAB04026.1| CopB, partial [Dictyostelium discoideum]    351   5e-94   
gi|289629218|ref|NP_001166193.1| coatomer protein complex subuni...   341   4e-91   
gi|403342367|gb|EJY70502.1| Coatomer subunit beta [Oxytricha tri...   338   3e-90   
gi|340052202|emb|CCC46473.1| putative coatomer beta subunit [Try...   335   4e-89   
gi|305678519|gb|ADM64309.1| Y25C1A [Heterodera glycines]              333   7e-89   
gi|389615621|dbj|BAM20767.1| beta-coatomer protein, partial [Pap...   333   1e-88   
gi|342179891|emb|CCC89365.1| putative coatomer beta subunit [Try...   326   1e-86   
gi|357614667|gb|EHJ69205.1| putative coatomer subunit beta [Dana...   320   1e-84   
gi|294897128|ref|XP_002775837.1| coatomer beta subunit, putative...   314   4e-83   
gi|398014579|ref|XP_003860480.1| coatomer beta subunit, putative...   314   6e-83   
gi|146085421|ref|XP_001465268.1| putative coatomer beta subunit ...   313   1e-82   
gi|157868669|ref|XP_001682887.1| putative coatomer beta subunit ...   310   7e-82   
gi|389603920|ref|XP_003723105.1| putative coatomer beta subunit ...   308   3e-81   
gi|401421416|ref|XP_003875197.1| putative coatomer beta subunit ...   305   2e-80   
gi|115504327|ref|XP_001218956.1| coatomer beta subunit [Trypanos...   300   1e-78   
gi|74849229|sp|Q9NFU6.1|COPB_TRYBB RecName: Full=Coatomer subuni...   300   1e-78   
gi|300123497|emb|CBK24769.2| unnamed protein product [Blastocyst...   297   6e-78   
gi|242070233|ref|XP_002450393.1| hypothetical protein SORBIDRAFT...   293   1e-76   
gi|241672283|ref|XP_002400218.1| coatomer beta subunit, putative...   291   6e-76   
gi|224121314|ref|XP_002330796.1| predicted protein [Populus tric...   288   3e-75   
gi|74149670|dbj|BAE36453.1| unnamed protein product [Mus musculus]    278   5e-72   
gi|507659282|ref|XP_004635004.1| PREDICTED: coatomer subunit bet...   266   2e-68   
gi|471197577|ref|XP_004255707.1| coatomer beta subunit, putative...   264   6e-68   
gi|357131488|ref|XP_003567369.1| PREDICTED: coatomer subunit bet...   263   9e-68   
gi|357131521|ref|XP_003567385.1| PREDICTED: coatomer subunit bet...   259   2e-66   
gi|353231201|emb|CCD77619.1| putative coatomer beta subunit [Sch...   259   2e-66   
gi|256071116|ref|XP_002571887.1| coatomer beta subunit [Schistos...   258   4e-66   
gi|146168466|ref|XP_001016810.2| Adaptin N-terminal region famil...   253   2e-64   
gi|221502047|gb|EEE27793.1| coatomer beta subunit, putative [Tox...   252   2e-64   
gi|401400822|ref|XP_003880866.1| adaptin N terminal region famil...   252   2e-64   
gi|221481324|gb|EEE19718.1| coatomer beta subunit, putative [Tox...   252   2e-64   
gi|237838963|ref|XP_002368779.1| coatomer beta subunit, putative...   252   2e-64   
gi|122091427|sp|Q9U4N3.2|COPB_TOXGO RecName: Full=Coatomer subun...   251   7e-64   
gi|326524674|dbj|BAK04273.1| predicted protein [Hordeum vulgare ...   248   3e-63   
gi|209877382|ref|XP_002140133.1| coatomer beta subunit protein [...   237   1e-59   
gi|167390223|ref|XP_001739253.1| coatomer beta subunit [Entamoeb...   223   1e-55   
gi|145489855|ref|XP_001430929.1| hypothetical protein [Parameciu...   223   1e-55   
gi|407042312|gb|EKE41264.1| coatomer beta subunit, putative [Ent...   221   4e-55   
gi|146332245|gb|ABQ22628.1| coatomer subunit beta-like protein [...   219   3e-54   
gi|297596554|ref|NP_001042759.2| Os01g0281400 [Oryza sativa Japo...   218   5e-54   
gi|103484562|dbj|BAE94772.1| beta3-COP [Entamoeba histolytica]        216   2e-53   
gi|67478194|ref|XP_654513.1| coatomer beta subunit [Entamoeba hi...   215   3e-53   
gi|449704785|gb|EMD44961.1| coatomer beta subunit, putative [Ent...   215   3e-53   
gi|293336098|ref|NP_001170748.1| uncharacterized protein LOC1003...   214   1e-52   
gi|67484674|ref|XP_657557.1| coatomer beta subunit [Entamoeba hi...   211   5e-52   
gi|407043076|gb|EKE41725.1| coatomer beta subunit, putative [Ent...   210   1e-51   
gi|167381228|ref|XP_001735631.1| coatomer subunit beta-2 [Entamo...   209   2e-51   
gi|471189306|ref|XP_004184388.1| coatomer subunit beta, putative...   203   1e-49   
gi|221060160|ref|XP_002260725.1| coatamer protein, beta subunit ...   201   6e-49   
gi|258597740|ref|XP_001348451.2| coatamer protein, beta subunit,...   201   8e-49   
gi|82915189|ref|XP_729000.1| coatomer subunit beta [Plasmodium y...   198   3e-48   
gi|156101966|ref|XP_001616676.1| coatamer protein, beta subunit ...   197   8e-48   
gi|390370520|ref|XP_798988.3| PREDICTED: coatomer subunit beta-l...   194   6e-47   
gi|293331569|ref|NP_001170208.1| uncharacterized protein LOC1003...   191   6e-46   
gi|70954245|ref|XP_746178.1| coatamer protein, beta subunit [Pla...   189   2e-45   
gi|68070071|ref|XP_676947.1| hypothetical protein [Plasmodium be...   183   2e-43   
gi|471219362|ref|XP_004024206.1| hypothetical protein IMG5_19790...   180   1e-42   
gi|85683123|gb|ABC73537.1| CG6223 [Drosophila miranda]                173   2e-40   
gi|399217994|emb|CCF74881.1| unnamed protein product [Babesia mi...   159   2e-36   
gi|126649247|ref|XP_001388296.1| hypothetical protein [Cryptospo...   158   4e-36   
gi|117653540|gb|ABK55185.1| p15 [Caenorhabditis remanei] >gi|117...   157   1e-35   
gi|117653532|gb|ABK55181.1| p15 [Caenorhabditis remanei] >gi|117...   157   1e-35   
gi|117653596|gb|ABK55213.1| p15 [Caenorhabditis remanei]              156   2e-35   
gi|117653576|gb|ABK55203.1| p15 [Caenorhabditis remanei]              156   2e-35   
gi|117653534|gb|ABK55182.1| p15 [Caenorhabditis remanei] >gi|117...   154   6e-35   
gi|117653542|gb|ABK55186.1| p15 [Caenorhabditis remanei] >gi|117...   154   8e-35   
gi|167385089|ref|XP_001737201.1| coatomer beta subunit [Entamoeb...   153   2e-34   
gi|56757848|gb|AAW27064.1| SJCHGC04770 protein [Schistosoma japo...   151   6e-34   
gi|407914815|gb|EKG08872.1| hypothetical protein MPH_14206, part...   150   2e-33   
gi|156087110|ref|XP_001610962.1| coatamer beta subunit [Babesia ...   149   2e-33   
gi|74212622|dbj|BAE31049.1| unnamed protein product [Mus musculus]    149   2e-33   
gi|156334555|ref|XP_001619475.1| hypothetical protein NEMVEDRAFT...   147   9e-33   
gi|510910102|ref|XP_004833189.1| conserved hypothetical protein ...   138   7e-30   
gi|154416164|ref|XP_001581105.1| Adaptin N terminal region famil...   131   7e-28   
gi|76156305|gb|AAX27517.2| SJCHGC03753 protein [Schistosoma japo...   129   3e-27   
gi|449526642|ref|XP_004170322.1| PREDICTED: coatomer subunit bet...   127   1e-26   
gi|170101879|ref|XP_001882156.1| hypothetical protein LACBIDRAFT...   125   6e-26   
gi|109137040|gb|ABG25175.1| hypothetical protein CBG19635 [Caeno...   122   3e-25   
gi|167394895|ref|XP_001741143.1| coatomer beta subunit [Entamoeb...   120   1e-24   
gi|457875603|ref|XP_004224362.1| coatamer protein beta subunit [...   119   2e-24   
gi|242046580|ref|XP_002400032.1| coatomer beta subunit, putative...   119   3e-24   
gi|71033133|ref|XP_766208.1| coatomer beta subunit [Theileria pa...   116   2e-23   
gi|357511899|ref|XP_003626238.1| Coatomer subunit beta [Medicago...   112   3e-22   
gi|403221058|dbj|BAM39191.1| coatamer subunit beta [Theileria or...   111   8e-22   
gi|183233774|ref|XP_001913914.1| coatomer subunit beta [Entamoeb...   110   1e-21   
gi|414588446|tpg|DAA39017.1| TPA: hypothetical protein ZEAMMB73_...   108   5e-21   
gi|224105767|ref|XP_002333771.1| predicted protein [Populus tric...   108   5e-21   
gi|484857089|gb|EOB14840.1| Coatomer subunit beta [Nosema bombyc...   108   6e-21   
gi|484856139|gb|EOB13945.1| Coatomer subunit beta [Nosema bombyc...   107   1e-20   
gi|156403622|ref|XP_001640007.1| predicted protein [Nematostella...    97   1e-17   
gi|300707652|ref|XP_002996025.1| hypothetical protein NCER_10094...    97   1e-17   
gi|396081913|gb|AFN83527.1| coatomer complex subunit beta [Encep...    96   4e-17   
gi|401827396|ref|XP_003887790.1| coatomer subunit beta [Encephal...    93   3e-16   
gi|19173437|ref|NP_597240.1| COATOMER COMPLEX BETA SUBUNIT [Ence...    90   2e-15   
gi|449328741|gb|AGE95017.1| coatomer complex beta subunit [Encep...    89   5e-15   
gi|253746702|gb|EET01805.1| Coatomer beta subunit [Giardia intes...    89   5e-15   
gi|47156917|gb|AAT12307.1| coatomer complex beta subunit [Antono...    88   9e-15   
gi|387594155|gb|EIJ89179.1| hypothetical protein NEQG_00998 [Nem...    86   5e-14   
gi|303390342|ref|XP_003073402.1| coatomer complex subunit beta [...    85   6e-14   
gi|169806056|ref|XP_001827773.1| coatomer beta subunit [Enterocy...    84   1e-13   
gi|159119290|ref|XP_001709863.1| Coatomer beta subunit [Giardia ...    81   1e-12   
gi|378755932|gb|EHY65957.1| hypothetical protein NERG_00653 [Nem...    81   1e-12   


>gi|511000024|gb|EPB81594.1| hypothetical protein HMPREF1544_11686 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 951

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/642 (69%), Positives = 516/642 (80%), Gaps = 3/642 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KHD+             +SPDIEVRRKA+RIALE+V++RNVQEVV+FLKKELSKT D  Y
Sbjct: 309 KHDRVLDDLVMDILQVLSSPDIEVRRKAIRIALEMVSSRNVQEVVLFLKKELSKTQDDAY 368

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CAIKFSEVAANVVHVLMEFLGDSNNPAAVDV+AFVREVVEKFP 
Sbjct: 369 EKNTEYRQLLIQSIHTCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVVAFVREVVEKFPG 428

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR SI EKLL+TF D+KSGKVFRGALWI+GEYC + K+I++AWKQIR  LGEIP+LASEQ
Sbjct: 429 LRESILEKLLDTFADMKSGKVFRGALWIIGEYCESEKEIDDAWKQIRHALGEIPLLASEQ 488

Query: 182 RLLXXXXXXXXXXXXXXXXXXXT-TSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAV 240
           +LL                   +  ++ RRILADGTYATE+A++ +S++ ++LEA+KAA 
Sbjct: 489 KLLDATEAADNEEEKPDKSAVPSGVAAPRRILADGTYATESAYTESSASASRLEAVKAAK 548

Query: 241 KPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQS 300
           KPPLRSLLL+GD++LG+VL++ +TKLVLRY+ I+ D    NA +AEAMLIM SI+R+GQS
Sbjct: 549 KPPLRSLLLAGDYFLGTVLSTAITKLVLRYNKIASDATLANARKAEAMLIMTSILRIGQS 608

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           +F +  IDEDSYDRIM  L I+        I +V+L DTR  +A+ +             
Sbjct: 609 KFVAFEIDEDSYDRIMQDLRIVGTAGQSEEINTVYLQDTREVYAKQLQAEDKRLADAKAE 668

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 VQVDD IVFRQFSK++ G   DEY+ DL+RATG  D +DDL+SKL+R+VQLTGF
Sbjct: 669 SEASVQVQVDDAIVFRQFSKKS-GGATDEYDQDLSRATGSLDDKDDLMSKLNRIVQLTGF 727

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SD VYAEA VNVHQYDIL+DVLIVNQT+ETLQNL++EFATLGDLKLV+RP  HNLAPHSF
Sbjct: 728 SDKVYAEAVVNVHQYDILMDVLIVNQTNETLQNLTVEFATLGDLKLVDRPATHNLAPHSF 787

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            +VKA IKVSSTETGVIFGNIVYD  G++E NCVVLNDIHIDIMDYINPAYCNETQFRSM
Sbjct: 788 LTVKAPIKVSSTETGVIFGNIVYDSHGSTE-NCVVLNDIHIDIMDYINPAYCNETQFRSM 846

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           WTEFEWENKVNVNTN+ DLR YL HIM STNMSCLTP+  L GDCGFLSANMYARSIFGE
Sbjct: 847 WTEFEWENKVNVNTNVGDLRGYLQHIMDSTNMSCLTPKKQLEGDCGFLSANMYARSIFGE 906

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           DALAN+SIEK  +G ITGH+RIRSKTQGIALSLGDKITLAQK
Sbjct: 907 DALANLSIEKNGEGPITGHIRIRSKTQGIALSLGDKITLAQK 948



>gi|71018555|ref|XP_759508.1| hypothetical protein UM03361.1 [Ustilago maydis 521]
 gi|46098996|gb|EAK84229.1| hypothetical protein UM03361.1 [Ustilago maydis 521]
          Length = 982

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/666 (66%), Positives = 521/666 (78%), Gaps = 24/666 (3%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD--Q 59
           KH+              +SPD++VRRKALRIALE+V++RN++EVV+ LKKEL KT+D  Q
Sbjct: 313 KHEHVIDPLVMDLLRVLSSPDMDVRRKALRIALEMVSSRNIEEVVLLLKKELMKTVDSSQ 372

Query: 60  DYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKF 119
             +KN EYRQLLIQS+H CAIKFSEVA+NVVHVLMEFLGDSNNP+AVDVIAFVREVVEKF
Sbjct: 373 SQDKNLEYRQLLIQSVHTCAIKFSEVASNVVHVLMEFLGDSNNPSAVDVIAFVREVVEKF 432

Query: 120 PNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILAS 179
           P+LRSSI +KLL TF D+KSGKVFRGALWIVGEYC++ +D++EA +QIR  +GE+PILA+
Sbjct: 433 PDLRSSIVDKLLRTFTDIKSGKVFRGALWIVGEYCASIQDVKEAMQQIRKVIGEVPILAA 492

Query: 180 EQRLLXXXXXXX---------XXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTL 230
           E+RLL                            T+S++ R+ ADGTYATETAFSS ++  
Sbjct: 493 EERLLESSTAETDGTKEEADAASSYSALAAAKPTSSAANRVRADGTYATETAFSSETNQA 552

Query: 231 AKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLI 290
           A+LEA+K A KPPLRSLLL GDFY GSVLASTLTKLVLR++ +S D    N+LRAEAMLI
Sbjct: 553 ARLEAVKNASKPPLRSLLLLGDFYTGSVLASTLTKLVLRFAELSSDAGAKNSLRAEAMLI 612

Query: 291 MASIIRVGQSQFASNPIDEDSYDRIMSCLHIL-----EQISTDYSIKSVFLHDTRAAFAR 345
           M SI+RVGQS FA++PIDEDS +RIM+C+  L     E        K VFLHDT+ A+ +
Sbjct: 613 MTSIVRVGQSNFAASPIDEDSTERIMACVETLASSAEEAQPESKEAKQVFLHDTKQAYTK 672

Query: 346 IVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADS-R 404
           +V                   VQ DDL+ FRQFSK+   D  +EYE +LT+ATG A++ +
Sbjct: 673 MVEHEQAKAAEKLAKETKKVKVQPDDLLSFRQFSKQAADDAVEEYERELTQATGTAEAAK 732

Query: 405 DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDL 464
           DD ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DILLDVL+VNQTSETLQNLSIEFATLGDL
Sbjct: 733 DDFISKLARVVQLTGFSDPVYAEAYVNVHQFDILLDVLVVNQTSETLQNLSIEFATLGDL 792

Query: 465 KLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDGP---GT---SESNCVVLND 518
           KLVERP+ + LAP+S+ S+KATIKVSSTETGVIFGNI+Y+G    GT    ++ CVVLND
Sbjct: 793 KLVERPSNYTLAPYSYQSIKATIKVSSTETGVIFGNIIYEGAAGTGTQSAGDAKCVVLND 852

Query: 519 IHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPE 578
           IHIDIMDYI PAYCNE QFR+MWTEFEWENKVNVNT+ITDLR+YL HIMKSTNMSCLTPE
Sbjct: 853 IHIDIMDYIAPAYCNEAQFRAMWTEFEWENKVNVNTSITDLRDYLAHIMKSTNMSCLTPE 912

Query: 579 VALSGDCGFLSANMYARSIFGEDALANISIEKQTDG-AITGHVRIRSKTQGIALSLGDKI 637
            +L+G+CGFLSANMYARS+FGEDALAN+SIE   DG  I GHVRIRSKTQGIALSLGDKI
Sbjct: 913 ASLAGECGFLSANMYARSLFGEDALANLSIELLPDGKTIQGHVRIRSKTQGIALSLGDKI 972

Query: 638 TLAQKA 643
           TLAQKA
Sbjct: 973 TLAQKA 978



>gi|388851857|emb|CCF54451.1| probable SEC26-coatomer complex beta chain of secretory pathway
           vesicles [Ustilago hordei]
          Length = 985

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/669 (66%), Positives = 521/669 (77%), Gaps = 27/669 (4%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD--Q 59
           KH+              +SPD++VRRKALRIALE+V++RN++EVV+ LKKEL KT D  Q
Sbjct: 313 KHEHVIDPLVMDLLRVLSSPDMDVRRKALRIALEMVSSRNIEEVVLLLKKELMKTTDSSQ 372

Query: 60  DYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKF 119
             EKN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNNP+AVDVIAFVREVVEKF
Sbjct: 373 SQEKNLEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNPSAVDVIAFVREVVEKF 432

Query: 120 PNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILAS 179
           P+LRSSI +KLL TF D+KSGKVFRGALWIVGEYC++ +DI+EA +QIR  +GE+PILA+
Sbjct: 433 PDLRSSIVDKLLRTFADIKSGKVFRGALWIVGEYCASIEDIKEAMQQIRKVIGEVPILAA 492

Query: 180 EQRLLXXXXXXXXXXXXXXX------------XXXXTTSSSRRILADGTYATETAFSSNS 227
           E+RLL                                +S++ R+ ADGTYATETAFSS +
Sbjct: 493 EERLLESSTAEAADGTSKEEADAASSSSALGGAAKVPSSAANRVRADGTYATETAFSSEA 552

Query: 228 STLAKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEA 287
           +  A+LEA+K A KPPLRSLLL GDFY G+VLASTLTKLVLR++ +S D    N++RAE+
Sbjct: 553 NQAARLEAVKNASKPPLRSLLLLGDFYTGTVLASTLTKLVLRFAELSSDATAKNSMRAES 612

Query: 288 MLIMASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDY-----SIKSVFLHDTRAA 342
           ML M SI+RVG+S+FA++PIDEDS +RIM+C+  L     D        K VFLHDT+AA
Sbjct: 613 MLFMTSIVRVGESKFAASPIDEDSTERIMACVETLASSIQDVEPESAEAKEVFLHDTKAA 672

Query: 343 FARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQAD 402
           + ++V                   VQ DDL+ FRQFSK+   D A+EYE +LT+ATG A+
Sbjct: 673 YTKMVEHEQAKAAEKLAKETKVVKVQPDDLLSFRQFSKKAADDAAEEYERELTQATGAAE 732

Query: 403 S-RDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATL 461
           + +DD ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DILLDVL+VNQT+ETLQNLSIEFATL
Sbjct: 733 AVKDDFISKLARVVQLTGFSDPVYAEAYVNVHQFDILLDVLVVNQTAETLQNLSIEFATL 792

Query: 462 GDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDG-PGT-----SESNCVV 515
           GDLKLVERP+ + LAP+S+ S+KATIKVSSTETGVIFGNI+Y+G  GT      ++ CVV
Sbjct: 793 GDLKLVERPSNYTLAPYSYQSIKATIKVSSTETGVIFGNIIYEGAAGTGTQSAGDAKCVV 852

Query: 516 LNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCL 575
           LNDIHIDIMDYI PAYCNE QFR+MWTEFEWENKVNVNT+ITDLREYL HIMKSTNMSCL
Sbjct: 853 LNDIHIDIMDYIAPAYCNEAQFRAMWTEFEWENKVNVNTSITDLREYLAHIMKSTNMSCL 912

Query: 576 TPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDG-AITGHVRIRSKTQGIALSLG 634
           TPE +L+G+CGFLSANMYARS+FGEDALAN+SIE   DG  I GHVRIRSKTQGIALSLG
Sbjct: 913 TPEASLAGECGFLSANMYARSLFGEDALANLSIELLPDGKTIQGHVRIRSKTQGIALSLG 972

Query: 635 DKITLAQKA 643
           DKITLAQKA
Sbjct: 973 DKITLAQKA 981



>gi|501310438|dbj|GAC99198.1| hypothetical protein PHSY_006798 [Pseudozyma hubeiensis SY62]
          Length = 982

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/666 (66%), Positives = 523/666 (78%), Gaps = 24/666 (3%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD--Q 59
           KH+              +SPD++VRRKALRIAL++V++RN++EVV+ LKKEL KT+D  Q
Sbjct: 313 KHEHVIDPLVMDLLRVLSSPDMDVRRKALRIALDMVSSRNIEEVVLLLKKELMKTVDSAQ 372

Query: 60  DYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKF 119
             +KN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNNP+AVDVIAFVREVVEKF
Sbjct: 373 SQDKNLEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNPSAVDVIAFVREVVEKF 432

Query: 120 PNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILAS 179
           P+LRSSI +KLL TF D+KSGKVFRGALWIVGEYC++ +D++EA +QIR  +GE+PILA+
Sbjct: 433 PDLRSSIVDKLLRTFTDIKSGKVFRGALWIVGEYCASIEDVKEAMQQIRKVVGEVPILAA 492

Query: 180 EQRLLXXXXXXX---------XXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTL 230
           E+RLL                             TS++ R+ ADGTYATETAFSS ++  
Sbjct: 493 EERLLDSSAAEVDGAKEEADAASSSSALATAKPATSAANRVRADGTYATETAFSSEANQA 552

Query: 231 AKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLI 290
           A+LEA+K+A KPPLRSLLL GDFY G+VLASTLTKLVLR++ +S D    N+LRAE+ML+
Sbjct: 553 ARLEAVKSASKPPLRSLLLLGDFYTGAVLASTLTKLVLRFAELSSDAAAKNSLRAESMLM 612

Query: 291 MASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDYS-----IKSVFLHDTRAAFAR 345
           M SI+RVGQS+FA++PIDEDS +RIM+C+  L     D        K VFLHDT+ A+ +
Sbjct: 613 MTSIVRVGQSKFAASPIDEDSTERIMACVETLASSIEDAQPESKEAKQVFLHDTKQAYTK 672

Query: 346 IVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQAD-SR 404
           +V                   VQ DDL+ FRQFSK+   D A+EYE +LT+ATG A+ ++
Sbjct: 673 MVEHEQAKAAEKLAKETKVVKVQPDDLLSFRQFSKKAADDAAEEYERELTQATGTAEAAK 732

Query: 405 DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDL 464
           DD ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DI+LDVL+VNQT+ETLQNLSIEFATLGDL
Sbjct: 733 DDFISKLARVVQLTGFSDPVYAEAYVNVHQFDIMLDVLVVNQTAETLQNLSIEFATLGDL 792

Query: 465 KLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDG-PGT-----SESNCVVLND 518
           KLVERP+ + LAP+S+ S+KATIKVSSTETGVIFGNI+Y+G  GT      ++ CVVLND
Sbjct: 793 KLVERPSNYTLAPYSYQSIKATIKVSSTETGVIFGNIIYEGAAGTGTQSAGDAKCVVLND 852

Query: 519 IHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPE 578
           IHIDIMDYI PAYCNE QFR+MWTEFEWENKVNVNT+ITDLREYL HIMKSTNMSCLTPE
Sbjct: 853 IHIDIMDYIAPAYCNEAQFRAMWTEFEWENKVNVNTSITDLREYLAHIMKSTNMSCLTPE 912

Query: 579 VALSGDCGFLSANMYARSIFGEDALANISIEKQTDG-AITGHVRIRSKTQGIALSLGDKI 637
            +L+G+CGFLSANMYARS+FGEDALAN+SIE   DG  I GHVRIRSKTQGIALSLGDKI
Sbjct: 913 ASLAGECGFLSANMYARSLFGEDALANLSIELLPDGKTIQGHVRIRSKTQGIALSLGDKI 972

Query: 638 TLAQKA 643
           TLAQKA
Sbjct: 973 TLAQKA 978



>gi|384493896|gb|EIE84387.1| hypothetical protein RO3G_09097 [Rhizopus delemar RA 99-880]
          Length = 953

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/628 (68%), Positives = 508/628 (80%), Gaps = 7/628 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I LE+VT+RNVQ+VV+FLKKEL K  D  YEK+NEYRQLLIQSIH C
Sbjct: 326 SSPDIDVRRKALHIVLEMVTSRNVQDVVLFLKKELVKAQDDSYEKSNEYRQLLIQSIHTC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAANVVHVLMEFLGDS+NPAAVDVI+FVREVVEKFP LR SI EKLL+TF D+K
Sbjct: 386 AIKFSEVAANVVHVLMEFLGDSSNPAAVDVISFVREVVEKFPALRESILEKLLDTFSDMK 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALWI+GEYC + K+I++AW QIR GLGE+P+LASEQ+LL              
Sbjct: 446 SGKVFRGALWIIGEYCESLKEIDDAWDQIRRGLGEVPLLASEQKLLDAAEADSEDGNKEG 505

Query: 199 XXXXXTTS---SSRRILADGTYATETAFSSNSSTL-AKLEAIKAAVKPPLRSLLLSGDFY 254
                  S   + RRILADGTYATE+A++ +SS   A+LEA+KAA KPPLRSL+L+GD++
Sbjct: 506 SEKPMIPSGGAAPRRILADGTYATESAYTESSSAAEARLEAVKAAKKPPLRSLILAGDYF 565

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           LG+VL++ LTKLVLRY+G+  D    NA +AEAMLIM SI+RVGQS+F +  IDEDSYDR
Sbjct: 566 LGTVLSTALTKLVLRYNGLVGDASLANARKAEAMLIMTSILRVGQSKFVAFEIDEDSYDR 625

Query: 315 IMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
           IM  L ++   + D ++ +V+L +TR  +++ +                   +Q DD IV
Sbjct: 626 IMQDLRVVGS-AGDETVDNVYLKETREVYSKQLQAQNKRLADAKAESELSSQIQADDAIV 684

Query: 375 FRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQ 434
           FRQF+K++ G  ADEY+ DL+RATG  D +DDL+SKL+ +VQLTGFSD VYAEA VNVHQ
Sbjct: 685 FRQFTKKS-GGNADEYDQDLSRATGSLDDKDDLMSKLNHIVQLTGFSDKVYAEAVVNVHQ 743

Query: 435 YDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTET 494
           YDIL+DVLIVNQT+ETLQNL++EFATLGDLKLV+RP  HNLAPHSF + K  IKVSSTET
Sbjct: 744 YDILMDVLIVNQTNETLQNLTVEFATLGDLKLVDRPATHNLAPHSFLTAKVPIKVSSTET 803

Query: 495 GVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNT 554
           GVIFGNIVYD  G++E NCVVLNDIHIDIMDYINPAYC ETQFRSMWTEFEWENKVNVNT
Sbjct: 804 GVIFGNIVYDSHGSTE-NCVVLNDIHIDIMDYINPAYCTETQFRSMWTEFEWENKVNVNT 862

Query: 555 NITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDG 614
           NI+DLR YL HIMKSTNM+CLTP+  L GDCGFLSANMYA+SIFGEDALAN+SIEK  DG
Sbjct: 863 NISDLRNYLQHIMKSTNMNCLTPKKQLEGDCGFLSANMYAKSIFGEDALANLSIEKNGDG 922

Query: 615 AITGHVRIRSKTQGIALSLGDKITLAQK 642
            ITGH+RIRSKTQGIALSLGDKITLAQK
Sbjct: 923 PITGHIRIRSKTQGIALSLGDKITLAQK 950



>gi|443897709|dbj|GAC75048.1| vesicle coat complex COPI, beta subunit [Pseudozyma antarctica
           T-34]
          Length = 984

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/668 (66%), Positives = 522/668 (78%), Gaps = 26/668 (3%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD--- 58
           KH+              +SPD++VRRKALRIALE+V++RN++EVV+ LKKEL KT+D   
Sbjct: 313 KHEHVIDPLVMDLLRVLSSPDMDVRRKALRIALEMVSSRNIEEVVLLLKKELMKTVDTSQ 372

Query: 59  QDYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEK 118
              +KN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNNP+AVDVIAFVREVVEK
Sbjct: 373 SSQDKNLEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNPSAVDVIAFVREVVEK 432

Query: 119 FPNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILA 178
           FP+LRSSI +KLL TF D+KSGKVFRGALWIVGEYC++ +D++EA +QIR  +GE+PILA
Sbjct: 433 FPDLRSSIVDKLLRTFTDIKSGKVFRGALWIVGEYCASIEDVKEAMQQIRKVIGEVPILA 492

Query: 179 SEQRLLXXXXXXXXXXXXXXXX----------XXXTTSSSRRILADGTYATETAFSSNSS 228
           +E+RLL                              +S++ R+ ADGTYATETAFSS ++
Sbjct: 493 AEERLLEASSTGVEAEAAAEQTDAGASSSALGAAAKSSAANRVRADGTYATETAFSSEAN 552

Query: 229 TLAKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAM 288
             A+LEA+K+A KPPLRSLLL GDFY G+VLASTLTKLVLR++ +S D    N+LRAEAM
Sbjct: 553 QAARLEAVKSASKPPLRSLLLLGDFYTGTVLASTLTKLVLRFAQLSSDATAKNSLRAEAM 612

Query: 289 LIMASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDYSIKS-----VFLHDTRAAF 343
           LIM SI+RVGQS+FA+ PIDEDS +RIM+C+  L     +   +S     VFLHDT+AA+
Sbjct: 613 LIMTSIVRVGQSKFAATPIDEDSVERIMACVETLASSMQEAEPESEEANEVFLHDTKAAY 672

Query: 344 ARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQAD- 402
            ++V                   VQ DDL+ FRQFSK+   D A+EYE +LT+ATG A+ 
Sbjct: 673 TKMVEHEQAKQAEKLAKETKVVKVQPDDLLSFRQFSKKAADDAAEEYERELTQATGAAEA 732

Query: 403 SRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLG 462
           ++DD ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DILLDVL+VNQT+ETLQNLSIEFATLG
Sbjct: 733 AKDDFISKLARVVQLTGFSDPVYAEAYVNVHQFDILLDVLVVNQTAETLQNLSIEFATLG 792

Query: 463 DLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDG-PGT-----SESNCVVL 516
           DLKLVERP+ + LAP+S+ S+KATIKVSSTETGVIFGNI+Y+G  GT      ++ CVVL
Sbjct: 793 DLKLVERPSNYTLAPYSYQSIKATIKVSSTETGVIFGNIIYEGAAGTGTQSAGDAKCVVL 852

Query: 517 NDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLT 576
           NDIHIDIMDYI PAYCNE QFR+MWTEFEWENKVNVNT ITDLREYL HIMKSTNMSCLT
Sbjct: 853 NDIHIDIMDYIAPAYCNEAQFRAMWTEFEWENKVNVNTAITDLREYLAHIMKSTNMSCLT 912

Query: 577 PEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDG-AITGHVRIRSKTQGIALSLGD 635
           P+ +L+G+CGFLSANMYARS+FGEDALAN+SIE   DG  I GHVRIRSKTQGIALSLGD
Sbjct: 913 PDASLAGECGFLSANMYARSLFGEDALANLSIELLPDGKTIQGHVRIRSKTQGIALSLGD 972

Query: 636 KITLAQKA 643
           KITLAQKA
Sbjct: 973 KITLAQKA 980



>gi|319411717|emb|CBQ73761.1| probable SEC26-coatomer complex beta chain of secretory pathway
           vesicles [Sporisorium reilianum SRZ2]
          Length = 980

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/665 (65%), Positives = 519/665 (78%), Gaps = 23/665 (3%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD--Q 59
           KH+              +SPD++VRRKALRIALE+V++RN++EVV+ LKKEL KT+D  +
Sbjct: 313 KHEHVIDPLVMDLLRVLSSPDMDVRRKALRIALEMVSSRNIEEVVLLLKKELMKTVDSAR 372

Query: 60  DYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKF 119
             +KN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNNP+AVDVIAFVREVVEKF
Sbjct: 373 SQDKNLEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNPSAVDVIAFVREVVEKF 432

Query: 120 PNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILAS 179
           PNLRSSI +KLL TF ++KSGKVFRGALWIVGEYC++ +DI+EA +QIR  +GE+PILA+
Sbjct: 433 PNLRSSIVDKLLRTFTEIKSGKVFRGALWIVGEYCADIEDIKEAMQQIRKVIGEVPILAA 492

Query: 180 EQRLLXXXXXXX--------XXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLA 231
           E+RLL                            +S++ R+ ADGTYATETAFSS ++  A
Sbjct: 493 EERLLDSSTAEADGIAEGADEASSSSALAKPAASSAANRVRADGTYATETAFSSEANQAA 552

Query: 232 KLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIM 291
           +L+A+K A KPPLRSLLL GDFY G+VLASTLTKLVLR+  +S D    N+LRAEAMLIM
Sbjct: 553 RLDAVKNASKPPLRSLLLLGDFYTGTVLASTLTKLVLRFGELSSDAAAQNSLRAEAMLIM 612

Query: 292 ASIIRVGQSQFASNPIDEDSYDRIMSCLH-----ILEQISTDYSIKSVFLHDTRAAFARI 346
            SI+RVGQS+F++ PIDEDS +RIM+C+      +L         K VFLHDT+AA+ ++
Sbjct: 613 TSIVRVGQSKFSAAPIDEDSTERIMACVETLASSVLAAEPESKEAKQVFLHDTKAAYTKM 672

Query: 347 VXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQAD-SRD 405
           V                   VQ DDL+ FRQFSK+   D A+EYE +LT+ATG A+ ++D
Sbjct: 673 VEHEQAKAAEKLAKETKVVKVQPDDLLSFRQFSKKAADDAAEEYERELTQATGAAEAAKD 732

Query: 406 DLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLK 465
           D ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DILLDVL+VNQT+ETLQNLSIEFATLGDLK
Sbjct: 733 DFISKLARVVQLTGFSDPVYAEAYVNVHQFDILLDVLVVNQTAETLQNLSIEFATLGDLK 792

Query: 466 LVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDG-PGT-----SESNCVVLNDI 519
           LVERP+ + LAP+S+ S+KATIKVSSTETGVIFGNI+Y+G  GT      ++ CVVLNDI
Sbjct: 793 LVERPSNYTLAPYSYQSIKATIKVSSTETGVIFGNIIYEGAAGTGTQSAGDAKCVVLNDI 852

Query: 520 HIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEV 579
           HIDIMDYI PAYCNE QFR+MW++FEWENKVNVNT I+DLR+YL HIMKSTNMSCLTPE 
Sbjct: 853 HIDIMDYIAPAYCNEAQFRAMWSDFEWENKVNVNTGISDLRQYLAHIMKSTNMSCLTPEA 912

Query: 580 ALSGDCGFLSANMYARSIFGEDALANISIEKQTDG-AITGHVRIRSKTQGIALSLGDKIT 638
           +L+G+CGFLSANMYARS+FGEDALAN+SIE   DG  I GHVRIRSKTQGIALSLGDKIT
Sbjct: 913 SLAGECGFLSANMYARSLFGEDALANLSIELLPDGKTIQGHVRIRSKTQGIALSLGDKIT 972

Query: 639 LAQKA 643
           LAQK 
Sbjct: 973 LAQKG 977



>gi|343781354|gb|AEM55580.1| coatomer beta subunit [Puccinia striiformis f. sp. tritici]
          Length = 970

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/642 (66%), Positives = 503/642 (78%), Gaps = 6/642 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+++RRKA  +AL++V++RNV++VV+F KKEL KTL + +
Sbjct: 322 KHEHVLDDMVMDLLRVLSSPDMDLRRKATNLALDMVSSRNVEDVVLFFKKELIKTLSETF 381

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNN AAVDVIAFVREVVEKFP+
Sbjct: 382 EKNAEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNSAAVDVIAFVREVVEKFPD 441

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LRSSI +KLL+TF D+KSGKVFRGALWIVGEYC+  +D+ E  +QIR  +GE+PILASEQ
Sbjct: 442 LRSSIIKKLLQTFGDIKSGKVFRGALWIVGEYCTTEEDMLETLQQIRTVIGEVPILASEQ 501

Query: 182 RLLXXXXXXXXXXXXX--XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAA 239
           RLL                       +++ ++LADGTYATET+FS  +S  A L  +KA 
Sbjct: 502 RLLDAAEAEAEAEAQTDESGTTKPVPTATTKVLADGTYATETSFSVTAS--ASLSKVKAQ 559

Query: 240 VKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQ 299
            KPPLR+L+L GDFY GSVLAS LTKLVLR+ G+S+D    N LRAEAML+M S+IRVGQ
Sbjct: 560 AKPPLRALILGGDFYTGSVLASALTKLVLRFVGLSKDNSLINELRAEAMLMMTSVIRVGQ 619

Query: 300 SQFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX 359
           SQF S PIDEDS +RI +CL  L +++    I+ +FLHDT+AA+ +++            
Sbjct: 620 SQFVSVPIDEDSVERITTCLQALAEVTQSKPIEDIFLHDTQAAYTQMIAHVEKKAAEKRG 679

Query: 360 XXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTG 419
                  VQ DDLI FRQF+K+N G   D+YE DLT+ATG  D+ +D +SKLSR+VQLTG
Sbjct: 680 KDKKSVAVQADDLISFRQFTKKNDG-YIDDYEADLTQATGTLDTENDFLSKLSRIVQLTG 738

Query: 420 FSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHS 479
           FSDPVYAEAYVNV+Q+DI+LDVLIVNQTSETLQNL++EFATLGDLKLVERP  H L P S
Sbjct: 739 FSDPVYAEAYVNVNQFDIMLDVLIVNQTSETLQNLTVEFATLGDLKLVERPIPHTLGPMS 798

Query: 480 FHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRS 539
           F S+KATIKVSSTETGVIFGNI YDGP TS+ +CVVLNDIHIDI+DYI PA+CNE QFRS
Sbjct: 799 FQSIKATIKVSSTETGVIFGNIFYDGPATSDGHCVVLNDIHIDILDYIKPAFCNENQFRS 858

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MWTEFEWENKVNVNT+I DLR YL HIM +TNMSCLTP+ ALSGDCGFLSANMYARS+FG
Sbjct: 859 MWTEFEWENKVNVNTSIDDLRSYLDHIMAATNMSCLTPDAALSGDCGFLSANMYARSLFG 918

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQ 641
           EDALAN+SIEK  DG + GHVRIRSKTQGIALSLGDKITL Q
Sbjct: 919 EDALANLSIEK-ADGVLQGHVRIRSKTQGIALSLGDKITLLQ 959



>gi|402222759|gb|EJU02825.1| coatomer subunit beta [Dacryopinax sp. DJM-731 SS1]
          Length = 951

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/643 (66%), Positives = 512/643 (79%), Gaps = 7/643 (1%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+EVRRKA+ IAL ++T+RNV++VV+FLKK+LS+TLD ++
Sbjct: 311 KHEHVLDSLVMDMLRILSSPDMEVRRKAIGIALAMITSRNVEDVVLFLKKQLSRTLDNEF 370

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CAI+FSEVAANVVH LMEFLGD++N +A+DVIAFVREVVEKFP 
Sbjct: 371 EKNAEYRQLLIQSIHVCAIRFSEVAANVVHSLMEFLGDASNSSAIDVIAFVREVVEKFPG 430

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR SI EKL++TF ++KSGKVFRGALWI GEY S+  DI EA+++IR  LGEIPILASEQ
Sbjct: 431 LRKSIVEKLMQTFGEIKSGKVFRGALWIAGEYASDTDDILEAFQEIRKVLGEIPILASEQ 490

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                         R+L DGTYATETAFS+ ++  A+LEA+KAA K
Sbjct: 491 RLL---DEAGGDEEAGQSLDGTAAPHKPRLLPDGTYATETAFSTTAAQ-ARLEAVKAAAK 546

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQ 301
           PPLR+L+L GDFY G VLA+TLTKLV+R+S +++D KK N LRAEAMLIM S++RVGQS+
Sbjct: 547 PPLRALILGGDFYTGVVLATTLTKLVMRFSELAKDKKKVNVLRAEAMLIMTSVVRVGQSK 606

Query: 302 FASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXX 361
           F++ PIDEDS +RI++C+  L Q++ +  +K +FL +T+A +A++V              
Sbjct: 607 FSAVPIDEDSQERILNCVETLAQLANEPVVKEIFLTETKAVYAKMVATEERKAAEKKAKE 666

Query: 362 XXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
                +Q DDLI FRQFSK++  D  D+YE D+TRATG A++ +DLIS LSRVVQLTGFS
Sbjct: 667 TKASAIQADDLITFRQFSKKSALDGVDDYEQDVTRATGSAETSEDLISDLSRVVQLTGFS 726

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEA + VH +DILLDVLIVNQ+S+TLQN+ +EFATLGDLKLVERPT H + PHSF 
Sbjct: 727 DPVYAEALIKVHGFDILLDVLIVNQSSDTLQNMCVEFATLGDLKLVERPTTHTVGPHSFL 786

Query: 482 SVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMW 541
           SVKATIKVSSTETGVIFGNI+++  GT+E+ CVVLNDIHIDIMDYI PAYC+ETQFRSMW
Sbjct: 787 SVKATIKVSSTETGVIFGNIIWEA-GTNEA-CVVLNDIHIDIMDYIKPAYCSETQFRSMW 844

Query: 542 TEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGED 601
           TEFEWEN+VNVNT ITDLR YL HIMKSTNM+CLTPE ALSGDC FLSANMYARS+FGED
Sbjct: 845 TEFEWENRVNVNTTITDLRAYLAHIMKSTNMACLTPEAALSGDCDFLSANMYARSLFGED 904

Query: 602 ALANISIEK-QTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           ALAN+SIEK ++ G I GHVRIRSKTQGIALSLGDKITLAQKA
Sbjct: 905 ALANLSIEKVESTGIIQGHVRIRSKTQGIALSLGDKITLAQKA 947



>gi|328854469|gb|EGG03601.1| hypothetical protein MELLADRAFT_44511 [Melampsora larici-populina
           98AG31]
          Length = 957

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/645 (66%), Positives = 504/645 (78%), Gaps = 8/645 (1%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KHD              +SPD++VR+KA  +AL++V++RNV++VV+FLKKEL KTL + +
Sbjct: 315 KHDHVLDDMVMEILRVLSSPDMDVRKKATSLALDMVSSRNVEDVVLFLKKELVKTLSETF 374

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNN AAVDVI+FVREVVEKFP+
Sbjct: 375 EKNAEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNSAAVDVISFVREVVEKFPD 434

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LRSSI EKLL+TF ++KSGKVFRGALWIVGEYC+   D+ E + QIR  +GEIPILASEQ
Sbjct: 435 LRSSIIEKLLQTFPEIKSGKVFRGALWIVGEYCTTPSDMLETFSQIRKVIGEIPILASEQ 494

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSS----SRRILADGTYATETAFSSNSSTLAKLEAIK 237
           RLL                   T  S    + ++LADGTYATET FS  ++  A L  +K
Sbjct: 495 RLLDAAEAEAEAEASASENVNNTKPSGPTTTTKVLADGTYATETTFSVTAT--ASLNKVK 552

Query: 238 AAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRV 297
           A  KPPLR+++L GDFY G+ LASTLTKLVLR+S  S+D ++ N L+AEAML+M S+IRV
Sbjct: 553 AQSKPPLRAMILGGDFYTGAALASTLTKLVLRFSEHSKDSREINGLKAEAMLMMTSVIRV 612

Query: 298 GQSQFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXX 357
           GQS F+S PIDEDS +RI +CL  L ++     IK +FLHDT+AA+ ++V          
Sbjct: 613 GQSHFSSVPIDEDSVERITTCLQALAEVPEGKPIKEIFLHDTQAAYTQMVAHDEKKKAEK 672

Query: 358 XXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQL 417
                    VQVDDLI F+QF+KRN G E DEYE DLT+ATG  ++++D +SKLSRV+QL
Sbjct: 673 KSKDSKLIEVQVDDLISFKQFNKRN-GIEGDEYETDLTKATGTMEAKEDFLSKLSRVIQL 731

Query: 418 TGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAP 477
           TGFSDPVYAEAYVNV+Q+DILLDVLIVNQTSETLQNL++EFATLGDLKLVERP  H L P
Sbjct: 732 TGFSDPVYAEAYVNVNQFDILLDVLIVNQTSETLQNLTVEFATLGDLKLVERPVSHTLGP 791

Query: 478 HSFHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQF 537
            SF S+KATIKVSSTETGVIFGNI YDG  +S+ +CVVLNDIHIDI+DYI PA+CNE QF
Sbjct: 792 MSFQSIKATIKVSSTETGVIFGNIFYDGVASSDGHCVVLNDIHIDILDYIKPAFCNEAQF 851

Query: 538 RSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSI 597
           RSMWTEFEWENKVNV+T I DLR YL HIM +TNMSCLTP+ ALSG+CGFLSANMYARS+
Sbjct: 852 RSMWTEFEWENKVNVSTKIDDLRVYLDHIMAATNMSCLTPDAALSGECGFLSANMYARSL 911

Query: 598 FGEDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           FGEDALAN+SIEK  DG + GHVRIRSKTQGIALSLGDKITL Q+
Sbjct: 912 FGEDALANLSIEK-ADGVLQGHVRIRSKTQGIALSLGDKITLLQR 955



>gi|331241739|ref|XP_003333517.1| hypothetical protein PGTG_14939 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309312507|gb|EFP89098.1| hypothetical protein PGTG_14939 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 970

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/642 (65%), Positives = 501/642 (78%), Gaps = 6/642 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+++RRKA  +AL++V++RNV++VV+F KKEL KTL + +
Sbjct: 322 KHEHVLDDMVMDLLRVLSSPDMDLRRKATNLALDMVSSRNVEDVVLFFKKELIKTLSETF 381

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CAIKFSEVA+NVVHVLMEFLGDSNN AAVDVI+FVREVVEKFP+
Sbjct: 382 EKNAEYRQLLIQSIHTCAIKFSEVASNVVHVLMEFLGDSNNSAAVDVISFVREVVEKFPD 441

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LRSSI +KLL+TF D+KSGKVFRGALWIVGEYC+  +D+ E  +QIR  +GE+PILASEQ
Sbjct: 442 LRSSIIKKLLQTFGDIKSGKVFRGALWIVGEYCTTEEDMLETLQQIRTVIGEVPILASEQ 501

Query: 182 RLLXXXXXXXXXXXXXXXX--XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAA 239
           RLL                       +++ ++LADGTYATET+FS  +S  A L  +KA 
Sbjct: 502 RLLDAAEAEAEAEAQADESGNSKPVQTTTTKVLADGTYATETSFSVTAS--ASLNKVKAQ 559

Query: 240 VKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQ 299
            KPPLR+L+L GDFY GSVLAS LTKLVLR+ G+S++    N LRAEAML+M S+IRVGQ
Sbjct: 560 SKPPLRALILGGDFYTGSVLASALTKLVLRFVGLSQNSSLINELRAEAMLMMTSVIRVGQ 619

Query: 300 SQFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX 359
           SQF S PIDEDS +RI +CL  L +++    I+ +FLHDT+AA+ +++            
Sbjct: 620 SQFVSVPIDEDSVERITTCLQALAEVTKSKPIEDIFLHDTQAAYTQMIAHVEKKAAEKRG 679

Query: 360 XXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTG 419
                  VQ DDLI FRQF+K+N G   D+YE DLT+ATG  D+ +D +SKLSR+VQLTG
Sbjct: 680 KDKKSVAVQPDDLINFRQFAKKNDG-YIDDYEADLTQATGNLDTANDFLSKLSRIVQLTG 738

Query: 420 FSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHS 479
           FSDPVYAEAYVNV+Q+DI+LDVLIVNQT ETLQNL++EFATLGDLKLVERP  H L P S
Sbjct: 739 FSDPVYAEAYVNVNQFDIMLDVLIVNQTPETLQNLTVEFATLGDLKLVERPIPHTLGPMS 798

Query: 480 FHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRS 539
           F S+KATIKVSSTETGVIFGNI YDGP TS+ +CVVLNDIHIDI+DYI PA+CNE QFRS
Sbjct: 799 FQSIKATIKVSSTETGVIFGNIFYDGPATSDGHCVVLNDIHIDILDYIKPAFCNENQFRS 858

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MWTEFEWENKVNVNT I DLR YL HIM +TNMSCLTP+ ALSGDCGFLSANMYARS+FG
Sbjct: 859 MWTEFEWENKVNVNTAIDDLRTYLDHIMAATNMSCLTPDAALSGDCGFLSANMYARSLFG 918

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQ 641
           EDALAN+SIEK  DG + GHVRIRSKTQGIALSLGDKITL Q
Sbjct: 919 EDALANLSIEK-ADGVLQGHVRIRSKTQGIALSLGDKITLLQ 959



>gi|358057584|dbj|GAA96582.1| hypothetical protein E5Q_03252 [Mixia osmundae IAM 14324]
          Length = 955

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/622 (68%), Positives = 500/622 (80%), Gaps = 5/622 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD+EV+RKAL +AL++V++RNV EV  FLKKEL KTLDQ  EKN EYRQLLIQSIH C
Sbjct: 329 SSPDMEVKRKALALALDMVSSRNVSEVTSFLKKELLKTLDQQLEKNLEYRQLLIQSIHTC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI++SEVA+NVVH LMEFLGDSN  +AVDVIAFVREVVEKFP+LR SI EKLL+TF ++K
Sbjct: 389 AIRYSEVASNVVHTLMEFLGDSNTTSAVDVIAFVREVVEKFPDLRVSIVEKLLQTFGEIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALWI GEYC++ + I E   QIR  LGE+P+LA+EQRLL              
Sbjct: 449 SGKVFRGALWISGEYCTSLEGINETMLQIRKVLGEVPMLAAEQRLLDEAEAAAQSQADPS 508

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                TT+++ R+LADGTYATET +S  S+ + +L A+K+A KPPLRSL+L GDFY  SV
Sbjct: 509 VDSKPTTTTTTRVLADGTYATETVYSDPSAQI-RLAAVKSASKPPLRSLILGGDFYTASV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LASTLTKLVL +  +S D    NAL+AEAMLIM S+IRVGQSQFA+ PIDEDS DRI +C
Sbjct: 568 LASTLTKLVLHFVELSSDHSAINALKAEAMLIMTSLIRVGQSQFAAVPIDEDSVDRISTC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           L  +  +    ++K VFLHDT+AA+A++V                   VQ DDLI FRQ 
Sbjct: 628 LRSVASVQP--AVKQVFLHDTQAAYAQMVAHEETKAAEKRAKDSKATAVQADDLITFRQL 685

Query: 379 SKRNIGDEADEYELDLTRATGQADS-RDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           SK+  GD ADEY+LDLTRATG A++ +DD ISKL+RVVQLTGFSDPVYAEAYVNVHQ+DI
Sbjct: 686 SKKAGGD-ADEYDLDLTRATGAAEAVKDDFISKLNRVVQLTGFSDPVYAEAYVNVHQFDI 744

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
            LDVL+VNQT ETLQNLS+EFATLGDLK+ ERP Q+ L PHSF S+KATIKVSSTETGVI
Sbjct: 745 HLDVLVVNQTVETLQNLSVEFATLGDLKISERPVQYTLGPHSFQSIKATIKVSSTETGVI 804

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNI YDGP TS+S+CVVLNDIHIDI+DYINPA+CNE QFRSMWTEFEWENKVNVNT+I 
Sbjct: 805 FGNIFYDGPSTSDSHCVVLNDIHIDILDYINPAHCNEAQFRSMWTEFEWENKVNVNTSIA 864

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           DLR+YL HIM +TNM+CLT + AL GDCGFLSAN+YA+S+FGEDALAN+SIEK  DG ++
Sbjct: 865 DLRQYLAHIMSATNMACLTNDAALKGDCGFLSANLYAKSLFGEDALANLSIEKLADGTLS 924

Query: 618 GHVRIRSKTQGIALSLGDKITL 639
           GHVRIRSKTQGIALSLGDKI+L
Sbjct: 925 GHVRIRSKTQGIALSLGDKISL 946



>gi|471885171|emb|CCO33617.1| Coatomer subunit beta AltName: Full=Beta-coat protein [Rhizoctonia
           solani AG-1 IB]
          Length = 639

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/631 (68%), Positives = 503/631 (79%), Gaps = 14/631 (2%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKN---NEYRQLLIQSIH 76
           SPD++VRRK L IAL +VT+RNV+EVV  LKK L++T + + EK     EYRQLLIQSIH
Sbjct: 9   SPDLDVRRKCLGIALGMVTSRNVEEVVGLLKKALARTTEAEAEKTPGTTEYRQLLIQSIH 68

Query: 77  GCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMD 136
            CAIKFSEVAA+VVH LMEFLGD+NNPAAVDV+AFVREVVEKFPNLR +IT +LLETF +
Sbjct: 69  VCAIKFSEVAASVVHALMEFLGDTNNPAAVDVVAFVREVVEKFPNLRGAITSRLLETFGE 128

Query: 137 VKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXX 196
           +KSGKVFRG LWIVGEYCS+  +IE  +++IR  LGEIPILA+EQRLL            
Sbjct: 129 IKSGKVFRGGLWIVGEYCSDAPEIEGVFEKIREVLGEIPILAAEQRLLDAATAAAAEDGA 188

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                  T SS+ R+LADGTYATETA+S+N    A+LEA+K A KPPLR+L+L GDFY G
Sbjct: 189 DKDKKETTKSSAPRVLADGTYATETAYSNNG---ARLEAVKNANKPPLRALILGGDFYTG 245

Query: 257 SVLASTLTKLVLRYSGISE--DPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           SVLA+TLTKLVLRY G +E  D K+ N+LRAEAMLIM S+IRVGQSQF + PIDEDS +R
Sbjct: 246 SVLAATLTKLVLRY-GEAEGVDAKRANSLRAEAMLIMTSLIRVGQSQFVTVPIDEDSQER 304

Query: 315 IMSCLHILE--QISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDL 372
           IM+C+  L   +++ +  ++ +FL DT+AA+A++V                   +Q DDL
Sbjct: 305 IMNCVQTLASAELAKNTRVREMFLKDTKAAYAKMVAHEEKKTAEKKARDTKKSAIQADDL 364

Query: 373 IVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
           I FRQF+K+   +  D+YEL+++RATG A+    +IS LSRVVQLTGFSDPVYAEAYV +
Sbjct: 365 ITFRQFTKKATNEGLDDYELEVSRATGAAEVGSSVISNLSRVVQLTGFSDPVYAEAYVKI 424

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
             +DILLDVLIVNQT++TLQNL IEFATLGD+KLVERPT H LAPHSFHSVKATIKVSST
Sbjct: 425 QGFDILLDVLIVNQTTDTLQNLVIEFATLGDVKLVERPTTHTLAPHSFHSVKATIKVSST 484

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNI+++  GTSE+ CVVLNDIHIDIMDYI PAYCNE QFRSMWTEFEWEN+VNV
Sbjct: 485 ETGVIFGNIIWEA-GTSET-CVVLNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWENRVNV 542

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK-Q 611
           NT ITDLR YL HIMKSTNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+SIEK +
Sbjct: 543 NTTITDLRTYLNHIMKSTNMSCLTPEAALSGDCDFLSANMYARSLFGEDALANLSIEKIE 602

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
             G I GHVRIRSKTQGIALSLGDKITLAQK
Sbjct: 603 GTGNIQGHVRIRSKTQGIALSLGDKITLAQK 633



>gi|393213128|gb|EJC98625.1| coatomer protein [Fomitiporia mediterranea MF3/22]
          Length = 952

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/642 (65%), Positives = 505/642 (78%), Gaps = 7/642 (1%)

Query: 1   EKHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD 60
           +KH+              +SPD+EVRRKA+ I+L +VT+RNV+EVV+FLKK+L +T+ +D
Sbjct: 310 QKHEHVIDSLVMDILRVLSSPDLEVRRKAISISLAMVTSRNVEEVVLFLKKQLQRTMTED 369

Query: 61  YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFP 120
           YEK  EYRQLLIQSIH CA+KFSEVAA+V+H LMEFLG+SNNPAAVDV+AFVREVVEKFP
Sbjct: 370 YEKIAEYRQLLIQSIHVCAVKFSEVAASVIHALMEFLGESNNPAAVDVVAFVREVVEKFP 429

Query: 121 NLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASE 180
           +LR +ITEKL++T  ++KSGKVFRGALWIVGEYC++   I+  ++ +R  LGEIPILASE
Sbjct: 430 DLRPTITEKLIQTLPEIKSGKVFRGALWIVGEYCADPSAIQSVFQALRVVLGEIPILASE 489

Query: 181 QRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAV 240
           QRLL                   T ++  R+LADGTYATE+A++S SS  A+LEAIKAA 
Sbjct: 490 QRLL---DEAGGDEEDEKTGETKTGTTKPRVLADGTYATESAYTSTSS--ARLEAIKAAA 544

Query: 241 KPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQS 300
           KPPLR+L+L GDFY G+VLASTLTKLVLR+S IS D   +NALRAEAMLIM S+IRVGQS
Sbjct: 545 KPPLRTLILQGDFYTGAVLASTLTKLVLRFSEISSDAGASNALRAEAMLIMTSVIRVGQS 604

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           +F + PIDEDS +RIM+CL  L ++    + + VFL DT+AA+++++             
Sbjct: 605 KFVTIPIDEDSQERIMNCLQTLSELKIKDAAEEVFLKDTKAAYSKMINAQEKKALEKKEK 664

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 VQVDDL+ FRQFSK+   D+  +Y+ D+ RATG  + ++D IS LSR+ QLTGF
Sbjct: 665 EAKTNVVQVDDLLTFRQFSKKT-ADDVLDYDEDVGRATGATEVQEDFISSLSRISQLTGF 723

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SD +YAEAYV V  +DILLDVL+VNQTS  LQNL ++FATLGDLKLVERPT H LAPHSF
Sbjct: 724 SDAIYAEAYVKVAGFDILLDVLLVNQTSGVLQNLVLDFATLGDLKLVERPTVHTLAPHSF 783

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            S+KATIKVSSTETGVIFGNI+++G G  E+ CVVLNDIHIDIMDYI PAYCNE QFRSM
Sbjct: 784 LSIKATIKVSSTETGVIFGNILWEGGGLEEA-CVVLNDIHIDIMDYIKPAYCNEAQFRSM 842

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           WTEFEWEN+VNV T+ITDLR YL HIMKSTNM+CLTPE A+SGDC FLSAN+YARS+FGE
Sbjct: 843 WTEFEWENRVNVTTSITDLRGYLRHIMKSTNMACLTPEGAMSGDCAFLSANLYARSLFGE 902

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           DALAN+SIEK   GAITGHVRIRSKTQGIALSLGD+ITLAQK
Sbjct: 903 DALANLSIEKTDTGAITGHVRIRSKTQGIALSLGDRITLAQK 944



>gi|406862688|gb|EKD15737.1| coatomer subunit beta [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 959

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/620 (65%), Positives = 489/620 (78%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALEIAMEMVSSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFPNLR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSAVDVISFVKEVVEKFPNLRPSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALW+VGEY     DI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWVVGEYSLEANDIRDAWKRIRASLGEIPILASEQRLLDEVADGQEPAKEAE 507

Query: 199 XXX---XXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                     + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL
Sbjct: 508 QVNGHPKAAPTGSRRVLADGTYATESALTSKSAVAAKLEAVKAAQKPPLRQLILDGDYYL 567

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            SVL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRI
Sbjct: 568 ASVLSSTLTKLVMRHSEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRI 627

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           M+C+  L + + +  +++VFL DTR AF  +V                   VQVDD++  
Sbjct: 628 MTCVRSLAEFAQNKELETVFLDDTRKAFRAMVQVEEKRRAAKEAVEKAKTAVQVDDVVSI 687

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQ +K+N GD  DE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 688 RQLAKKNAGDGTDEIELDLEKATGGDSAVEDLTSKLSRVVQLTGFSDPVYAEAYVKVHQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TG
Sbjct: 748 DIVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFQNVQATIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++E++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 808 VIFGNVVYDGASSTENSVVILNDVHVDIMDYIQPAICTETQFRTMWTEFEWENKVNINSK 867

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LRE+L  +M STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 868 AKSLREFLTQLMASTNMSCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDG 927

Query: 615 AITGHVRIRSKTQGIALSLG 634
            +TG VRIRS++QG+ALSLG
Sbjct: 928 PVTGFVRIRSRSQGLALSLG 947



>gi|392570899|gb|EIW64071.1| coatomer protein [Trametes versicolor FP-101664 SS1]
          Length = 952

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/625 (64%), Positives = 502/625 (80%), Gaps = 8/625 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L L ++RNV+EVV+FLKK+L +T DQ++EK  EYRQLLIQSIH C
Sbjct: 329 SSADLEVRRKAISIVLSLTSSRNVEEVVMFLKKQLQRTQDQEFEKAPEYRQLLIQSIHVC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VVH LM+FLGDSNNP+A+DV++FVREVVEKFP LR +I +KL++T  ++K
Sbjct: 389 AVKFSEVAASVVHALMDFLGDSNNPSALDVVSFVREVVEKFPQLRRTICDKLIQTLPEIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV+RG LWI+GEY  + ++I+E ++Q+R  LGEIPILASEQRLL              
Sbjct: 449 SGKVYRGVLWILGEYAEDVQEIQEVFRQLRKVLGEIPILASEQRLLEEASAEDGEEKKDE 508

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                T S   ++LADGTYATE+AF+S SS  A+LEA+KAA KPPLR+L+L GDFY G+V
Sbjct: 509 VK---TESHKPKVLADGTYATESAFTSVSS--ARLEAVKAASKPPLRALILGGDFYTGAV 563

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLVLRYS +S++ +K+NA++AEAMLIMASIIRVGQS+F S PIDEDS +RIM+C
Sbjct: 564 LASALTKLVLRYSELSKEARKSNAVKAEAMLIMASIIRVGQSKFVSVPIDEDSSERIMNC 623

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-VQVDDLIVFRQ 377
           +  L ++    ++  +FL DT+AA++++V                    VQVDDL+ FRQ
Sbjct: 624 IQTLSELEAQPAVHDIFLKDTKAAYSKMVAAQEKKAAEKRESEKAKAAIVQVDDLLSFRQ 683

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+ + D  D+ E D+ RATG  +  +D +S LSR+ QLTGFSDP+YAEAYV VH +DI
Sbjct: 684 FSKKAVDDTLDDSE-DVNRATGAGEVTEDFLSNLSRISQLTGFSDPIYAEAYVKVHGFDI 742

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           LLDVL+VNQT++TLQNL ++FATLGDLKLVERP+ + +APHSF S+KATIKVSSTETGVI
Sbjct: 743 LLDVLLVNQTADTLQNLCLDFATLGDLKLVERPSVYTVAPHSFQSIKATIKVSSTETGVI 802

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GPG +E  CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV T I+
Sbjct: 803 FGSILWEGPGLAE-QCVILNDIHIDIMDYIKPAYCTEQQFRSMWTEFEWENRVNVTTTIS 861

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D REYL H+MK+TNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S+E+  DG+IT
Sbjct: 862 DPREYLNHVMKATNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLSVERTEDGSIT 921

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 922 GHVRIRSKTQGIALSLGDRITMAQK 946



>gi|296424561|ref|XP_002841816.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638065|emb|CAZ86007.1| unnamed protein product [Tuber melanosporum]
          Length = 950

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/617 (65%), Positives = 489/617 (79%), Gaps = 2/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+KAL IA+++ +++NV+EVV+ LK +L+KT+DQDYEKNNEYRQLLI +IH C
Sbjct: 328 SSPDIDVRKKALDIAMDMASSKNVEEVVMLLKSQLAKTVDQDYEKNNEYRQLLIHAIHTC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVIAFV+EVVEKFP LRSSI E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVGLLMDFISDFNNSSAVDVIAFVKEVVEKFPALRSSIIERLMGTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEYC   KDI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYCVEQKDIREAWKRIRASLGEIPILASEQRLLDEQPEDDAEQVGEG 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  S SR++LADGTYATE+A +S S++ AKLEA+KAA KPPLRSL+L GDF+L SV
Sbjct: 508 SKPA-VPSGSRKVLADGTYATESALTSESASAAKLEAVKAAQKPPLRSLILDGDFFLASV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S IS D  +TNAL+AEAMLIM SIIRVGQS+F    IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSEISSDASRTNALKAEAMLIMISIIRVGQSEFVKAKIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L +  T   I+ VFL DTR AF  +V                   +QVDD++  RQ 
Sbjct: 627 VRSLAEFETKKEIEKVFLEDTRKAFRVMVAAEEKKRIAKEELEKGKNMIQVDDVLAIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SK++  + AD  E DL +ATG   S +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 687 SKKSAANGADIVEQDLEKATGADASVEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDII 746

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PHSF SV+ATIKVSST+T VIF
Sbjct: 747 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHSFQSVQATIKVSSTDTAVIF 806

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDGP ++E+N V+LND+H+DIMDYI PAYC+ETQFR+MWTEFEWENKVN+N+    
Sbjct: 807 GNVVYDGPSSTETNVVILNDVHVDIMDYIQPAYCSETQFRTMWTEFEWENKVNINSKAKT 866

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +MKSTNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG + 
Sbjct: 867 LRDFLDQLMKSTNMACLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPVI 926

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 927 GFVRIRSRSQGLALSLG 943



>gi|395334713|gb|EJF67089.1| coatomer protein [Dichomitus squalens LYAD-421 SS1]
          Length = 953

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/625 (64%), Positives = 493/625 (78%), Gaps = 7/625 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ D+EVRRKA+ I L L ++RNV+EVV+FLKK+L KT DQ+YEK  EYRQLLIQSIH C
Sbjct: 329 SATDLEVRRKAIGIVLSLTSSRNVEEVVLFLKKQLQKTQDQEYEKAPEYRQLLIQSIHVC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VVH LM+FLGDS+NP+A+DV+AFVREVVEKFP LR +I EKL +T  ++K
Sbjct: 389 AVKFSEVAASVVHALMDFLGDSSNPSALDVVAFVREVVEKFPQLRGTICEKLTQTLPEIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV+RG LWI+GEY     +IEE  +++R  LGEIPILASEQRLL              
Sbjct: 449 SGKVYRGILWILGEYAEQTAEIEEVLRELRKVLGEIPILASEQRLL--EEAAGAEDGEER 506

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  +S  ++LADGTYA+E+AF+S SS  A+LEA+KAA KPPLR+L+L GDFY GSV
Sbjct: 507 KDEVRAEASKPKVLADGTYASESAFTSVSS--ARLEAVKAAAKPPLRALILGGDFYTGSV 564

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLVLR+S +S D +K NALRAEAMLIMAS+IRVGQS+F + PIDEDS +RIMSC
Sbjct: 565 LASALTKLVLRFSELSSDKRKVNALRAEAMLIMASVIRVGQSKFVTVPIDEDSTERIMSC 624

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-VQVDDLIVFRQ 377
           +  L ++ +   +  +FL DT+AA++++V                    VQVDDL+ FRQ
Sbjct: 625 IQTLSELESKPPVHEIFLKDTKAAYSKMVAAQEKKAAEKKESEKAKAAIVQVDDLLTFRQ 684

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSKR   D  D+ E D+ RATG  +  +D IS LSR+ QLTGFSDP+YAEAYV VH +DI
Sbjct: 685 FSKRAADDVIDDSE-DVNRATGAGEVTEDFISNLSRISQLTGFSDPIYAEAYVKVHGFDI 743

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           LLDVL+VNQT++TLQNL ++FATLGDLKLVERP+ + +APHSF S+KATIKVSSTETGVI
Sbjct: 744 LLDVLLVNQTADTLQNLCLDFATLGDLKLVERPSIYTIAPHSFQSIKATIKVSSTETGVI 803

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GPG +E  CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV T I+
Sbjct: 804 FGSILWEGPGMAE-QCVILNDIHIDIMDYIKPAYCTEQQFRSMWTEFEWENRVNVTTTIS 862

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D REYL H+MK+TNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S+E+   G IT
Sbjct: 863 DPREYLEHVMKATNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLSVERTEAGTIT 922

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 923 GHVRIRSKTQGIALSLGDRITMAQK 947



>gi|406695179|gb|EKC98492.1| ER to transport-related protein [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 939

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/642 (62%), Positives = 498/642 (77%), Gaps = 2/642 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+               SPD+EV+RKA+ IAL++VT+RNV++VV+FLKK+L  TLDQD+
Sbjct: 295 KHEHVLDGMVMDILKVLNSPDMEVKRKAVGIALQMVTSRNVEDVVLFLKKQLQSTLDQDF 354

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           +KN EYRQLLIQSIH CAIKFSEVAANVV+VLM+FLGDSNNP+AVDVI+FVREVVEKFP+
Sbjct: 355 DKNVEYRQLLIQSIHSCAIKFSEVAANVVYVLMDFLGDSNNPSAVDVISFVREVVEKFPD 414

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR +ITEKL++TF ++KSGKVFRGA+WIVGEYC+   DI+ A  ++R  +GE+PILASEQ
Sbjct: 415 LRPTITEKLVQTFSEIKSGKVFRGAMWIVGEYCTGAADIKRAIFELRKVIGEVPILASEQ 474

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                      +  R+LADGTYATET ++S ++T A+LE ++AA K
Sbjct: 475 RLLDEAEAADEAAQAEKEPEQPQAVTKTRVLADGTYATETVYTSTAAT-ARLEQVRAAAK 533

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQ 301
           PPLR+L+L GD++  +VLASTLTKLVLR+  +  D +  N LRAEA+LIM SIIRVGQS+
Sbjct: 534 PPLRALILGGDYFTATVLASTLTKLVLRFQELHSDAQAFNQLRAEAILIMTSIIRVGQSK 593

Query: 302 FASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXX 361
           F S PIDEDS +RIM+C+  L Q+     +  +FL DT+AA+A+++              
Sbjct: 594 FVSVPIDEDSQERIMNCIESLAQLQDSKPVHEMFLKDTQAAYAKMLAAEEKKAKAKKDLE 653

Query: 362 XXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
                VQ DDLI F     +N+  + D+ ++D+ RATG  + +DD +SKL+R+VQLTGFS
Sbjct: 654 NKKSQVQADDLIQFSLLQTKNLDGDDDDLDVDVVRATGATEVKDDFVSKLARIVQLTGFS 713

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEA VN+ Q+DI+LDVLIVNQT+ETLQNL+IEFATLGDLKLVERP  H L PH FH
Sbjct: 714 DPVYAEAVVNIQQFDIMLDVLIVNQTNETLQNLTIEFATLGDLKLVERPAPHTLGPHGFH 773

Query: 482 SVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRSM 540
           ++KATIKVSSTETGVIFGNIVYD  G S+++  +VLND+H+DIMDYI PAYCNE QFRSM
Sbjct: 774 NIKATIKVSSTETGVIFGNIVYDKQGASDASVNIVLNDVHVDIMDYIKPAYCNEAQFRSM 833

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           WTEFEWENKVNVNT I+DLR YL HIMKSTNM+CLTPE ALSG+C FLSAN+ ARS+FGE
Sbjct: 834 WTEFEWENKVNVNTQISDLRTYLDHIMKSTNMACLTPEAALSGNCDFLSANLCARSLFGE 893

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           DALAN+SIEK  DG+I GHVRIRSKTQGIALSLGD+IT+ QK
Sbjct: 894 DALANLSIEKTEDGSIQGHVRIRSKTQGIALSLGDRITILQK 935



>gi|440634799|gb|ELR04718.1| hypothetical protein GMDG_06947 [Geomyces destructans 20631-21]
          Length = 958

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/619 (63%), Positives = 488/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL + LE+V+++NV +VV+ LKKEL+KT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALELTLEMVSSKNVADVVLLLKKELTKTVDQEYEKNNEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI+FSEVAA+VV +LM+F+ D N+ +AVDVI+FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 388 AIRFSEVAASVVDLLMDFIADFNSTSAVDVISFVKEVVEKFPKLRQTIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEY +   DI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSTEASDIRDAWKRIRASLGEIPILASEQRLLDEGSEGQEEKEAHT 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SRR+LADGTYATE+A +S S+ LAKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGTDKPSAPTGSRRVLADGTYATESALTSTSAVLAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 SVLSSTLTKLVMRHSEISKDEARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++VFL DTR AF  +V                  TVQVDD++  R
Sbjct: 628 SCVRSLAEFAQKKELETVFLEDTRKAFRAMVQVEEKKRAAKEAVEKAKTTVQVDDVVQIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N  D A+E ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKNASDGANEIELDLEKATGGDTATEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ TIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFQNVQCTIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGQSSTDNNVVILNDVHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KSLREFLTQLMACTNMTCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGDDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 928 VTGFVRIRSRSQGLALSLG 946



>gi|401887092|gb|EJT51097.1| ER to golgi family transport-related protein [Trichosporon asahii
            var. asahii CBS 2479]
          Length = 1006

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/642 (62%), Positives = 497/642 (77%), Gaps = 2/642 (0%)

Query: 2    KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
            KH+               SPD+EV+RKA+ IAL++VT+ NV++VV+FLKK+L  TLDQD+
Sbjct: 362  KHEHVLDGMVMDILKVLNSPDMEVKRKAVGIALQMVTSHNVEDVVLFLKKQLQSTLDQDF 421

Query: 62   EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
            +KN EYRQLLIQSIH CAIKFSEVAANVV+VLM+FLGDSNNP+AVDVI+FVREVVEKFP+
Sbjct: 422  DKNVEYRQLLIQSIHSCAIKFSEVAANVVYVLMDFLGDSNNPSAVDVISFVREVVEKFPD 481

Query: 122  LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
            LR +ITEKL++TF ++KSGKVFRGA+WIVGEYC+   DI+ A  ++R  +GE+PILASEQ
Sbjct: 482  LRPTITEKLVQTFSEIKSGKVFRGAMWIVGEYCTGAADIKRAIFELRKVIGEVPILASEQ 541

Query: 182  RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
            RLL                      +  R+LADGTYATET ++S ++T A+LE ++AA K
Sbjct: 542  RLLDEAEAADEAAQAEKEPEQPQAVTKTRVLADGTYATETVYTSTAAT-ARLEQVRAAAK 600

Query: 242  PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQ 301
            PPLR+L+L GD++  +VLASTLTKLVLR+  +  D +  N LRAEA+LIM SIIRVGQS+
Sbjct: 601  PPLRALILGGDYFTATVLASTLTKLVLRFQELHSDAQAFNQLRAEAILIMTSIIRVGQSK 660

Query: 302  FASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXX 361
            F S PIDEDS +RIM+C+  L Q+     +  +FL DT+AA+A+++              
Sbjct: 661  FVSVPIDEDSQERIMNCIESLAQLQDSKPVHEMFLKDTQAAYAKMLAAEEKKAKAKKDLE 720

Query: 362  XXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
                 VQ DDLI F     +N+  + D+ ++D+ RATG  + +DD +SKL+R+VQLTGFS
Sbjct: 721  NKKSQVQADDLIQFSLLQTKNLDGDDDDLDVDVVRATGATEVKDDFVSKLARIVQLTGFS 780

Query: 422  DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
            DPVYAEA VN+ Q+DI+LDVLIVNQT+ETLQNL+IEFATLGDLKLVERP  H L PH FH
Sbjct: 781  DPVYAEAVVNIQQFDIMLDVLIVNQTNETLQNLTIEFATLGDLKLVERPAPHTLGPHGFH 840

Query: 482  SVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRSM 540
            ++KATIKVSSTETGVIFGNIVYD  G S+++  +VLND+H+DIMDYI PAYCNE QFRSM
Sbjct: 841  NIKATIKVSSTETGVIFGNIVYDKQGASDASVNIVLNDVHVDIMDYIKPAYCNEAQFRSM 900

Query: 541  WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
            WTEFEWENKVNVNT I+DLR YL HIMKSTNM+CLTPE ALSG+C FLSAN+ ARS+FGE
Sbjct: 901  WTEFEWENKVNVNTQISDLRTYLDHIMKSTNMACLTPEAALSGNCDFLSANLCARSLFGE 960

Query: 601  DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
            DALAN+SIEK  DG+I GHVRIRSKTQGIALSLGD+IT+ QK
Sbjct: 961  DALANLSIEKTEDGSIQGHVRIRSKTQGIALSLGDRITILQK 1002



>gi|449551218|gb|EMD42182.1| coatomer protein [Ceriporiopsis subvermispora B]
          Length = 950

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/625 (64%), Positives = 495/625 (79%), Gaps = 9/625 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L L T+RNV+EVV+FLKK+L KT DQ++EK  EYRQLLIQSIH C
Sbjct: 328 SSADLEVRRKAIGIVLSLTTSRNVEEVVLFLKKQLQKTQDQEFEKAPEYRQLLIQSIHVC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVA +VVH LM+FLGDSNNP+A+DV+AFVREVVEKFP LR +I EKL++T  ++K
Sbjct: 388 AVKFSEVAGSVVHALMDFLGDSNNPSALDVVAFVREVVEKFPPLRRTICEKLIQTLREIK 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV+RG LWI+GEY  +  +I++ ++++R  LGEIPILASEQRLL              
Sbjct: 448 SGKVYRGILWILGEYAEDIPEIQDTFRELRKVLGEIPILASEQRLL----EETNAEDEAN 503

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                T SS  R+LADGTYATETAF+S S+  A+LEA+KAA KPPLR+L+L GDF+ GSV
Sbjct: 504 DGQPKTESSKPRVLADGTYATETAFTSMSN--ARLEAVKAAAKPPLRTLILGGDFFTGSV 561

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLVLR+S +S D K+ N LRAEAMLIMASIIRVGQS F + PIDEDS +RIM+C
Sbjct: 562 LASALTKLVLRFSELSSDAKRANGLRAEAMLIMASIIRVGQSSFVTVPIDEDSNERIMNC 621

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX-XXXXXXTVQVDDLIVFRQ 377
           +  L ++ T   +  +FL DT+AA++++V                    VQVDDL+ FRQ
Sbjct: 622 IETLSELQTKPVVHDIFLKDTKAAYSKMVTAQEKKAAEKKELEKAETKIVQVDDLLTFRQ 681

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK++  +  D+ E D+ RATG  +  +D +S LSR+ QLTGFSDP+YAEAYV VH +DI
Sbjct: 682 FSKKSADNVLDDAE-DVGRATGSGEVHEDFLSNLSRISQLTGFSDPIYAEAYVKVHGFDI 740

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNL ++FATLGDLKLVERP+ + +APHSF S+KATIKVSSTETGVI
Sbjct: 741 MLDVLLVNQTADTLQNLCLDFATLGDLKLVERPSVYTIAPHSFQSIKATIKVSSTETGVI 800

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GPG +E  CV+L+DIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV T I+
Sbjct: 801 FGSILWEGPGMAE-QCVILSDIHIDIMDYIKPAYCTEAQFRSMWTEFEWENRVNVTTTIS 859

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D REYL H+M +TNMSCLTPE A+SGDC FLSANMYARS+FGEDALAN+S+E+  +G IT
Sbjct: 860 DPREYLQHVMSATNMSCLTPEGAVSGDCDFLSANMYARSLFGEDALANLSVERTEEGNIT 919

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 920 GHVRIRSKTQGIALSLGDRITMAQK 944



>gi|156062874|ref|XP_001597359.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980]
 gi|154696889|gb|EDN96627.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 958

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/619 (64%), Positives = 485/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+KAL +ALE+V+++NV++VV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSPDIDVRKKALDLALEMVSSKNVEDVVLLLKKELSKTVDQEYEKNAEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVA +VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAESVVDLLMDFIADFNNTSAVDVISFVKEVVEKFPKLRPSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RGALWIVGEY     DI +AW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEANDIRDAWRRIRASLGEIPILASEQRLLDEATDGQEPKEPEQ 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 INGNSKAAPTGSRRVLADGTYATESALTSQSAVTAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 SVLSSTLTKLVMRHSEISSDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +++ +  ++S FL DTR AF  +V                   VQVDD++  R
Sbjct: 628 SCVRSLAEVAQNKQLESAFLEDTRKAFRDMVQVEEKKRAAKEAVEKAKSAVQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N  D ADE ELDL +ATG   S +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKNTVDGADEIELDLEKATGGDSSVEDLSSKLSRVVQLTGFSDPVYAEAYVTVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VE+PT  NL PH F +V+ATIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVEKPTTQNLGPHDFQNVQATIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTENSVVILNDVHVDIMDYIQPAVCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KTLREFLNQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 928 VTGFVRIRSRSQGLALSLG 946



>gi|500253877|gb|EON97524.1| putative coatomer subunit beta protein [Togninia minima UCRPA7]
          Length = 959

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/620 (64%), Positives = 488/620 (78%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALGIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI  +L++T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNTSAVDVINFVKEVVEKFPKLRPSIVRRLVDTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXX--XXXXXXXXX 196
           +GKV+RG LWIVGEY +   DI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGILWIVGEYSTEESDIRDAWKRIRASLGEIPILASEQRLLDNVDGEEEKEKEQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATETA +S +S  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGHHKPAAPTGSRRVLADGTYATETALTSQASAAAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL++TLTKLV+R++ IS D K+TNALRAEAMLIM SIIRVGQS F   PIDEDS DR+M
Sbjct: 568 TVLSATLTKLVMRHAEISSDSKRTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRVM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           S +  L + S    +++V+L DTR AF  +V                   VQVDD++  R
Sbjct: 628 SNVRALAEFSEHKELETVYLDDTRKAFRAMVQVEEKKRAAKEAVEKAKTAVQVDDVVGIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N+GD ADE ELDL RATG  + + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 688 QLSKKNMGDGADEIELDLERATGGDSSAAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 748 DIVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 808 VIFGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSK 867

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LRE+L  +M++TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 868 AKTLREFLDQLMQATNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGDDG 927

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG VRIRS++QG+ALSLG
Sbjct: 928 PITGFVRIRSRSQGLALSLG 947



>gi|154299992|ref|XP_001550413.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10]
          Length = 850

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/619 (63%), Positives = 484/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL +ALE+V+++NV++VV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 220 SSTDIDVRKKALDLALEMVSSKNVEDVVLLLKKELSKTVDQEYEKNAEYRQLLIHSIHQC 279

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVA +VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 280 AIKFSEVAESVVDLLMDFIADFNNTSAVDVISFVKEVVEKFPKLRPSIVERLVSTLSEVR 339

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RGALWIVGEY     DI +AW++IRA LGEIPILASEQRLL              
Sbjct: 340 AGKVYRGALWIVGEYSLEANDIRDAWRRIRASLGEIPILASEQRLLDEATDGQEPKEPEQ 399

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 400 TNGHSKAAPTGSRRVLADGTYATESALTSQSAVTAKLEAVKAAQKPPLRQLILDGDYYLA 459

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 460 SVLSSTLTKLVMRHSEISSDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 519

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +++ +  ++S FL DTR AF  +V                   VQVDD++  R
Sbjct: 520 SCVRSLAEVAQNKQLESAFLQDTRKAFRDMVQVEEKKRAAKEAVEKAKSAVQVDDVVSIR 579

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N  D ADE ELDL +ATG   S +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 580 QLAKKNTIDGADEIELDLEKATGGDSSVEDLSSKLSRVVQLTGFSDPVYAEAYVTVHQFD 639

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VE+PT  NL PH F +V+ATIKVSST+TGV
Sbjct: 640 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVEKPTTQNLGPHDFQNVQATIKVSSTDTGV 699

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN++YDG  ++E+N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 700 IFGNVIYDGASSTENNVVILNDVHVDIMDYIQPAVCTETQFRTMWTEFEWENKVNINSKA 759

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 760 KTLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 819

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 820 VTGFVRIRSRSQGLALSLG 838



>gi|361127247|gb|EHK99222.1| putative Coatomer subunit beta [Glarea lozoyensis 74030]
          Length = 870

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/619 (63%), Positives = 483/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKEL+KT+DQ+YEKNNEYR+LLI SIH C
Sbjct: 240 SSPDIDVRRKALGIALEMVSSKNVEEVVLLLKKELTKTIDQEYEKNNEYRRLLIHSIHQC 299

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D N+ +AVDVI+FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 300 AIKFSEVAASVVGLLMDFIADFNSTSAVDVISFVKEVVEKFPALRPTIVERLVSTLSEVR 359

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEY     DI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 360 AGKVYRGALWIVGEYSLEATDIRDAWKRIRASLGEIPILASEQRLLDDVADDTEAPKDDQ 419

Query: 199 XX--XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 420 VNGHSKAAPTGSRRVLADGTYATESALTSQSAVKAKLEAVKAAQKPPLRQLILDGDYFLA 479

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 480 SVLSSTLTKLVMRHSEISKDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 539

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + + +  ++   L DTR AF  +V                   VQVDD++  R
Sbjct: 540 SCVRSLAEFANNKELEKDLLDDTRKAFRAMVQVEEKKRAAKVAQAKAKSAVQVDDVVSIR 599

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N GD  DE ELDL +ATG  ++ DDL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 600 QLAKKNAGDGTDEIELDLEKATGGDNAVDDLSSKLSRVVQLTGFSDPVYAEAYVQVHQFD 659

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VE+PT  NL PH F +V+ TIKVSST+TGV
Sbjct: 660 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVEKPTTQNLGPHDFQNVQTTIKVSSTDTGV 719

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E+N V+LND+H+DIMDYI PA C ETQFR MW EFEWENKVN+N+  
Sbjct: 720 IFGNVVYDGASSTENNVVILNDVHVDIMDYIQPAVCTETQFRDMWAEFEWENKVNINSKA 779

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 780 KSLREFLTQLMACTNMSCLTPEASLKGDCQFLSANLYARSMFGEDALANLSIEKEGEDGP 839

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 840 VTGFVRIRSRSQGLALSLG 858



>gi|212542539|ref|XP_002151424.1| Coatomer subunit beta, putative [Talaromyces marneffei ATCC 18224]
 gi|210066331|gb|EEA20424.1| Coatomer subunit beta, putative [Talaromyces marneffei ATCC 18224]
          Length = 956

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/620 (62%), Positives = 488/620 (78%), Gaps = 3/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+V+ LKKEL+KT+D+ YEK++EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIAMEMVSSKNVEEIVMLLKKELAKTVDEQYEKSSEYRQLLIQSIHHC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+GD NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIGDFNNNSAVDVISFVKEVVEKFPKLRGSIIERLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RG LW++GEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLETSDIREAWKRIRASLGEIPILASEQRLLDEVPDDNAAVLEQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    S SR++LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGHSKAAAPSGSRKVLADGTYATESALTSQSAAAAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R++ +S+D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHAEVSQDAARTNALRAEAMLIMISIVRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           +C+  L + S    +++ FL DTR AF  IV                   VQ+DD I  R
Sbjct: 628 TCVRSLSEFSERKELETTFLEDTRKAFKTIVQAEEKKRAAKEASEKAKTAVQIDDAIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N G+ ADE ELDL +ATG   + +DL SKLSR+VQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLTKKNAGEGADEIELDLIKATGGDSTVEDLSSKLSRIVQLTGFSDPVYAEAYVQVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL P  F +V+AT+KVSST+ GV
Sbjct: 748 IILDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPRDFLNVQATVKVSSTDAGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VY+G  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYEGSSSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
            DLRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KDLREFLKQLMESTNMTCLTPEASLQGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLGD 635
           ITG VRIRS++QG+AL+LG+
Sbjct: 928 ITGFVRIRSRSQGLALALGN 947



>gi|347832046|emb|CCD47743.1| similar to coatomer subunit beta [Botryotinia fuckeliana T4]
 gi|472241745|gb|EMR86456.1| putative coatomer beta subunit protein [Botryotinia fuckeliana
           BcDW1]
          Length = 958

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/619 (63%), Positives = 484/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL +ALE+V+++NV++VV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSTDIDVRKKALDLALEMVSSKNVEDVVLLLKKELSKTVDQEYEKNAEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVA +VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAESVVDLLMDFIADFNNTSAVDVISFVKEVVEKFPKLRPSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RGALWIVGEY     DI +AW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEANDIRDAWRRIRASLGEIPILASEQRLLDEATDGQEPKEPEQ 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 TNGHSKAAPTGSRRVLADGTYATESALTSQSAVTAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 SVLSSTLTKLVMRHSEISSDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +++ +  ++S FL DTR AF  +V                   VQVDD++  R
Sbjct: 628 SCVRSLAEVAQNKQLESAFLQDTRKAFRDMVQVEEKKRAAKEAVEKAKSAVQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N  D ADE ELDL +ATG   S +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKNTIDGADEIELDLEKATGGDSSVEDLSSKLSRVVQLTGFSDPVYAEAYVTVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VE+PT  NL PH F +V+ATIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVEKPTTQNLGPHDFQNVQATIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN++YDG  ++E+N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVIYDGASSTENNVVILNDVHVDIMDYIQPAVCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KTLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 928 VTGFVRIRSRSQGLALSLG 946



>gi|336365229|gb|EGN93580.1| hypothetical protein SERLA73DRAFT_97514 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336377791|gb|EGO18951.1| hypothetical protein SERLADRAFT_358706 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 964

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/626 (63%), Positives = 491/626 (78%), Gaps = 6/626 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L + ++RNV+EVV+FLKK+L KT +Q+YEK  EYRQLL+QSIH  
Sbjct: 337 SSADMEVRRKAMSIVLSMTSSRNVEEVVLFLKKQLQKTQEQEYEKAPEYRQLLVQSIHVM 396

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI+FSEVAA+VVH LMEFLGDSNNP+A+DV+AFVREVVEKFPNLR +I +KL++T  ++K
Sbjct: 397 AIRFSEVAASVVHALMEFLGDSNNPSALDVVAFVREVVEKFPNLRQTICDKLVQTLSEIK 456

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG LWI+GEY     DI+   +++R  LGEIPILASEQRLL              
Sbjct: 457 SGKVFRGVLWILGEYVEGLADIQSTLQELRKVLGEIPILASEQRLLDEAGGEGDDDDAKK 516

Query: 199 XXXXXTTSSSR-RILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                  SS R R+LADGTYATETA++S S+  A+LEA+KAA KPPLR+L+L GDF+ G+
Sbjct: 517 EDKPKAESSGRPRVLADGTYATETAYTSTST--ARLEAVKAAAKPPLRALILGGDFFTGA 574

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLA+ LTKLVLR+ G++ D  K+N LRAEAMLIM S IRVGQS+F + PIDEDS +RI+S
Sbjct: 575 VLAAALTKLVLRFDGLTSDRTKSNTLRAEAMLIMTSTIRVGQSKFVTVPIDEDSNERILS 634

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIV-XXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           C+  L ++    +++ +FL DT+AA+++++                    VQVDDL+ FR
Sbjct: 635 CIQTLSELQEKPAVQDIFLKDTKAAYSKMLGAQEKKAAEKKEVETTKTAAVQVDDLLTFR 694

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           QFS+++  D  D Y+ DL RATG  + R+D IS LSR+ QLTGFSDP+YAEAYV +H +D
Sbjct: 695 QFSRKSADDPID-YDEDLGRATGAGEVREDFISNLSRISQLTGFSDPIYAEAYVKMHGFD 753

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           ILLDVL+VNQT  TLQNL ++FATLGDLKLVERP  + +APH F S+KATIKVSSTETGV
Sbjct: 754 ILLDVLLVNQTPNTLQNLCLDFATLGDLKLVERPAVYTIAPHGFQSIKATIKVSSTETGV 813

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFG+I+++GP  +ES CV+LNDIHIDIMDYI PAYCNE QFRSMWTEFEWEN+VNV+T +
Sbjct: 814 IFGSILWEGPALAES-CVILNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWENRVNVSTVM 872

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAI 616
           +D REYL H+MKSTNMSCLTPE A+SGDC FLSANMYARS+FGEDALAN+SIEK   G I
Sbjct: 873 SDPREYLKHVMKSTNMSCLTPEGAMSGDCDFLSANMYARSLFGEDALANLSIEKTEAGTI 932

Query: 617 TGHVRIRSKTQGIALSLGDKITLAQK 642
            GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 933 IGHVRIRSKTQGIALSLGDRITMAQK 958



>gi|345566841|gb|EGX49781.1| hypothetical protein AOL_s00076g665 [Arthrobotrys oligospora ATCC
           24927]
          Length = 953

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/635 (62%), Positives = 493/635 (77%), Gaps = 4/635 (0%)

Query: 1   EKHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD 60
           +KHD               SPDI+VR+KAL I L +V++RNV++VV+ LKKEL+KT+DQ+
Sbjct: 310 KKHDGVLDDLTMEILRVLNSPDIDVRKKALDITLSMVSSRNVEDVVMLLKKELAKTVDQE 369

Query: 61  YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFP 120
           YEKN EYRQLLI +IH CAI+FSEVAANVV +LM+F+GD NN +AVDVIAFV+EVVEKFP
Sbjct: 370 YEKNAEYRQLLIHAIHNCAIRFSEVAANVVGLLMDFIGDFNNTSAVDVIAFVKEVVEKFP 429

Query: 121 NLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASE 180
            LR +I EKLL T  +V++GKV+RGALWIVGEYC   KDI EAWK+IRA LGEIPIL+SE
Sbjct: 430 ALRQNIVEKLLVTLGEVRAGKVYRGALWIVGEYCVEPKDIREAWKRIRASLGEIPILSSE 489

Query: 181 QRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAV 240
           Q+LL                     + SR++LADGTYATE+A +S+S+T AKLEA+KAA 
Sbjct: 490 QKLLEAVPEEGEQTTAAPKS---APTGSRKVLADGTYATESALTSDSATAAKLEAVKAAQ 546

Query: 241 KPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQS 300
           KPPLR+L+L GDF+L SVL+STLTKLV+R++ IS+D  +TNAL+AEAMLIM SIIRVGQS
Sbjct: 547 KPPLRALILDGDFFLASVLSSTLTKLVMRHAEISKDTARTNALKAEAMLIMISIIRVGQS 606

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           QF    IDEDS DRIM+C+  L +      +++VFL DTR AF  ++             
Sbjct: 607 QFVKTKIDEDSVDRIMACVKCLSEFEDRKELETVFLDDTRKAFRAMITAEEKKRAATDAR 666

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 +QVDD+I FRQ SK+N G+ AD  ELDL +ATG   + +D+ SKLSRVVQLTGF
Sbjct: 667 EKNKNAIQVDDVISFRQLSKKNAGESADVIELDLEKATGGDGAVEDVASKLSRVVQLTGF 726

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SDPVYAEAYV VHQ+DI+LDVL+VNQT++TLQNL++EFATLGDLK+VE+PT  +LAPHSF
Sbjct: 727 SDPVYAEAYVKVHQFDIVLDVLLVNQTADTLQNLTVEFATLGDLKVVEKPTTQSLAPHSF 786

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            SV+ATIKVSST+ GVIFGN+VYDG  ++E+N V+LND+H+DIMDYI PA C ETQFRSM
Sbjct: 787 QSVQATIKVSSTDQGVIFGNVVYDGASSTETNVVILNDVHVDIMDYIQPATCTETQFRSM 846

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           WTEFEWENKVN+N+    LRE+L  +M ++NM+CLTPE +L GDC FLSAN+YA+S+FGE
Sbjct: 847 WTEFEWENKVNINSKAPTLREFLNQLMAASNMNCLTPEASLKGDCQFLSANLYAKSVFGE 906

Query: 601 DALANISIEKQTDGA-ITGHVRIRSKTQGIALSLG 634
           DALAN+S+E+  +G  ITG VRIRS++QG+ALSLG
Sbjct: 907 DALANLSVEQDGEGGPITGFVRIRSRSQGLALSLG 941



>gi|242768312|ref|XP_002341543.1| Coatomer subunit beta, putative [Talaromyces stipitatus ATCC 10500]
 gi|218724739|gb|EED24156.1| Coatomer subunit beta, putative [Talaromyces stipitatus ATCC 10500]
          Length = 956

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/620 (63%), Positives = 487/620 (78%), Gaps = 3/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+V+ LKKEL+KT+D+ YEK++EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALSIAMEMVSSKNVEEIVMLLKKELAKTVDEQYEKSSEYRQLLIQSIHLC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+GD NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIGDFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLETSDIREAWKRIRASLGEIPILASEQRLLDEVPDDNATVLDQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    S SR++LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGHSKAAAPSGSRKVLADGTYATESALTSQSAAAAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDAARTNALRAEAMLIMISIVRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           +C+  L + S    +++ FL DTR AF  IV                   VQ+DD I  R
Sbjct: 628 TCVRALSEFSERKELETTFLEDTRKAFKTIVQTEEKKRAAKAASEKAKTAVQIDDAIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N G+  DE ELDL +ATG   + +DL SKLSR+VQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLTKKNAGEGTDEIELDLIKATGGDATVEDLSSKLSRIVQLTGFSDPVYAEAYVQVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL P  F +V+AT+KVSST+ GV
Sbjct: 748 IILDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPRDFLNVQATVKVSSTDAGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGSSSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
            DLRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KDLREFLKQLMESTNMTCLTPEASLQGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLGD 635
           ITG VRIRS++QG+AL+LG+
Sbjct: 928 ITGFVRIRSRSQGLALALGN 947



>gi|169781566|ref|XP_001825246.1| coatomer subunit beta [Aspergillus oryzae RIB40]
 gi|83773988|dbj|BAE64113.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391865381|gb|EIT74665.1| vesicle coat complex COPI, beta subunit [Aspergillus oryzae 3.042]
          Length = 955

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/618 (63%), Positives = 485/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVMLLKKELAKTVDEQYEKNSEYRQLLIQSIHNC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFPNLR+SI ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPNLRASIVDRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIREAWKKIRASLGEIPILASEQRLLDETPEDSALKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHAKPSAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DRIM 
Sbjct: 568 VLSSTLTKLVMRHSEVSEDAARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRIMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQ
Sbjct: 628 CVRSLAEFSERKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQIDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+N  + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FSKKNALEGAEEIELDLAKATGGDSTVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERP  HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPATHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++ES+ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTESHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLKQLMDSTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGDDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|512207863|gb|EPE36680.1| ARM repeat-containing protein [Glarea lozoyensis ATCC 20868]
          Length = 958

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/619 (63%), Positives = 483/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKEL+KT+DQ+YEKNNEYR+LLI SIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEVVLLLKKELTKTIDQEYEKNNEYRRLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D N+ +AVDVI+FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVGLLMDFIADFNSTSAVDVISFVKEVVEKFPALRPTIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXX--X 196
           +GKV+RGALWIVGEY     DI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEATDIRDAWKRIRASLGEIPILASEQRLLDDVADDTEAPKDDQ 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATE+A +S S+  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 508 VNGHSKAAPTGSRRVLADGTYATESALTSQSAVKAKLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVL+STLTKLV+R+S IS+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 SVLSSTLTKLVMRHSEISKDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + + +  ++   L DTR AF  +V                   VQVDD++  R
Sbjct: 628 SCVRSLAEFANNKELEKDLLDDTRKAFRAMVQVEEKKRAAKVAQAKAKSAVQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N GD  DE ELDL +ATG  ++ DDL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKNAGDGTDEIELDLEKATGGDNAVDDLSSKLSRVVQLTGFSDPVYAEAYVQVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VE+PT  NL PH F +V+ TIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVEKPTTQNLGPHDFQNVQTTIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E+N V+LND+H+DIMDYI PA C ETQFR MW EFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTENNVVILNDVHVDIMDYIQPAVCTETQFRDMWAEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KSLREFLTQLMACTNMSCLTPEASLKGDCQFLSANLYARSMFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 928 VTGFVRIRSRSQGLALSLG 946



>gi|403417090|emb|CCM03790.1| predicted protein [Fibroporia radiculosa]
          Length = 953

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/625 (63%), Positives = 493/625 (78%), Gaps = 6/625 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L + ++RNV+E+V+F KK+L KT +QD+EK  EYRQLLIQSIH C
Sbjct: 328 SSADLEVRRKAMSIVLSMTSSRNVEEIVLFFKKQLQKTQEQDFEKAPEYRQLLIQSIHVC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VVH LM+FLGDSNNP+A+DV+AFVREVVEKFP LR +I EKL++T  ++K
Sbjct: 388 AVKFSEVAASVVHALMDFLGDSNNPSALDVVAFVREVVEKFPPLRPTICEKLIQTLGEIK 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV+RG LWI+GEY    + I+E + ++R  LGEIPIL SEQRLL              
Sbjct: 448 SGKVYRGVLWILGEYTEGGEQIQEVFYELRKVLGEIPILTSEQRLLEETGLEDEQKERDE 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                T S+  ++LADGTYATETAF+S SS  A+LEA+KAA KPPLR+L+L GDF+ GS 
Sbjct: 508 QQPK-TESTKPKVLADGTYATETAFTSMSS--ARLEAVKAAAKPPLRTLILGGDFFTGSA 564

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLVLRY+ +S D KKTNAL+AEAMLIMAS+IRVGQS+F + PIDEDS +RIMSC
Sbjct: 565 LASALTKLVLRYTEVSSDVKKTNALKAEAMLIMASVIRVGQSKFVTVPIDEDSSERIMSC 624

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIV-XXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           +  L ++     +  +FL DTR A++++V                    VQVDDL+ FRQ
Sbjct: 625 IQTLGELVAKPVVHDMFLKDTRIAYSKMVLAQEKKAAEKKEQESAKAKIVQVDDLLTFRQ 684

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+KR + D+  +   D+ RATG  + ++D IS LSR+ QLTGFSDP+YAEAYV VH +DI
Sbjct: 685 FTKR-VADDVIDDIEDVGRATGATEIQEDFISNLSRISQLTGFSDPIYAEAYVKVHGFDI 743

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           LLDVL+VNQT++TLQNL ++FATLGDLKLVERP+ + +APHSF S+KATIKVSSTETGVI
Sbjct: 744 LLDVLLVNQTADTLQNLCLDFATLGDLKLVERPSVYTVAPHSFQSIKATIKVSSTETGVI 803

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GPG +E  CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV T+I+
Sbjct: 804 FGSILWEGPGMAE-QCVILNDIHIDIMDYIKPAYCTEAQFRSMWTEFEWENRVNVTTSIS 862

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D REYL H+MK+TNMSCLTPE A+SGDC FLSANMYARS+FGEDALAN+S+E+   G IT
Sbjct: 863 DPREYLRHVMKATNMSCLTPEGAVSGDCDFLSANMYARSLFGEDALANLSVERTDAGTIT 922

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 923 GHVRIRSKTQGIALSLGDRITMAQK 947



>gi|389623857|ref|XP_003709582.1| coatomer subunit beta [Magnaporthe oryzae 70-15]
 gi|351649111|gb|EHA56970.1| coatomer subunit beta [Magnaporthe oryzae 70-15]
 gi|440474961|gb|ELQ43676.1| coatomer subunit beta [Magnaporthe oryzae Y34]
 gi|440482377|gb|ELQ62873.1| coatomer subunit beta [Magnaporthe oryzae P131]
          Length = 958

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/619 (63%), Positives = 487/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN+EYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALGIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNSEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN ++VDVI FV+EVVEKFP LR SI  +L+ET  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSSVDVINFVKEVVEKFPTLRPSIVTRLVETLAEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY    KDI +AW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGILWIIGEYSLEEKDIRDAWRRIRASLGEIPILASEQRLLDTADEEDSKADDQV 507

Query: 199 XX-XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGGSKAAPTGSRKVLADGTYATETALTSQSSKAAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHSEISSDHARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    +++V+L DT+ AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLAEFTERKELETVYLEDTKKAFRAMVAVEEKKRAAKVAVEKAKTAVQVDDVVAIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
            SK+N GD AD  E+DL RATG  + + +DL SKL+RVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 LSKKNAGDGADMAEVDLERATGGDSSAAEDLSSKLNRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGV
Sbjct: 748 IILDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  +++++ V+L+D+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ I
Sbjct: 808 IFGNVVYDGAHSTDTHVVILSDVHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKI 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR +L  +MK+TNM+CLTPE  L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KTLRGFLDELMKATNMNCLTPEAGLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|378729683|gb|EHY56142.1| hypothetical protein HMPREF1120_04239 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 958

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/621 (63%), Positives = 487/621 (78%), Gaps = 5/621 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD++VRRKAL IALE+V+++NVQE+V+ LKKELSKT+ + YEKN EYRQLLIQSIH C
Sbjct: 328 SSPDLDVRRKALSIALEMVSSKNVQEIVMLLKKELSKTVVEQYEKNAEYRQLLIQSIHHC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV VLM+F+ D NN +AV+VI+FV+EVVEKFP LRS I E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDVLMDFIADFNNSSAVEVISFVKEVVEKFPKLRSPIVERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG+LW++GEY     DI+EAWK+IRA LGEIPILA+EQRLL              
Sbjct: 448 AGKVYRGSLWVIGEYSLQEHDIKEAWKRIRASLGEIPILAAEQRLLEEQSSEDAEVPKEQ 507

Query: 199 X---XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                   T+SSSR++LADGTYATETA +S+S+  A+LEA+KAA KPPLR L+L GD+YL
Sbjct: 508 VNGHANKPTSSSSRKVLADGTYATETAMTSDSAAKARLEAVKAAQKPPLRQLILDGDYYL 567

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           GSVL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRI
Sbjct: 568 GSVLSSTLTKLVMRHSEISSDQARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSIDRI 627

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           MSC+  L + +    +++ FL DTR AF  +V                   +QVDD+   
Sbjct: 628 MSCVKALAEFTEHKELETSFLDDTREAFRAMVQAEEKKRAAKEAVEKAKTAIQVDDVFTI 687

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQ +K++  D  DE ELDL +ATG   S +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 688 RQLTKKSAADGMDEMELDLEKATGGDASYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT HNL P  F +V++TIKVSST+TG
Sbjct: 748 DIILDVLLVNQTNETLQNLSVEFATLGDLKVVERPTTHNLGPQDFLNVQSTIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYD P  ++++ V+LND+H DIMDYI PA C+ET FR+MWTEFEWENKVN+++ 
Sbjct: 808 VIFGNVVYDSPSGTDTHVVILNDVHADIMDYIQPATCSETAFRTMWTEFEWENKVNIHSK 867

Query: 556 ITD--LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD 613
            TD  LR++L  +MKSTNM+CLTPE AL GDC FLSAN+YARS+FGEDALAN+SIEK  D
Sbjct: 868 STDKTLRQFLEQLMKSTNMTCLTPEAALQGDCQFLSANLYARSVFGEDALANLSIEKTAD 927

Query: 614 GAITGHVRIRSKTQGIALSLG 634
            +I G +RIRS++QG+ALSLG
Sbjct: 928 NSIVGFIRIRSRSQGLALSLG 948



>gi|471571529|gb|EMR70281.1| putative coatomer beta subunit protein [Eutypa lata UCREL1]
          Length = 959

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/619 (63%), Positives = 481/619 (77%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           TS DI+VRRKAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 TSTDIDVRRKALSIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D +N +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFSNSSAVDVINFVKEVVEKFPKLRPSIVERLVATLNEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXX--XXXXXXXXX 196
           +GKV+RG +WIVGEY    +DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIIWIVGEYSLEERDIREAWKRIRASLGEIPILASEQRLLESHGDSEEKPLEQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    S SR++LADGTYATETA +SNS+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGHSKPAAPSGSRKVLADGTYATETALTSNSAAAAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL++ LTKLV+R++ IS D  +TNAL+AEAMLIM SIIRVGQS F   PIDEDS DRIM
Sbjct: 568 TVLSAALTKLVMRHAEISSDTARTNALKAEAMLIMISIIRVGQSHFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + S    ++ VFL DTR AF  +V                   +QVDD++  R
Sbjct: 628 SCIRSLAEFSQRKELEGVFLDDTRKAFRAMVQVEEKKRAAKEAYEKAKTAIQVDDVVQIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q SK+N  D ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLSKKNATDGADEIELDLEKATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR++L  +M  TNM+CLTPE ++ GDC FLSAN+YA+S+FGEDALAN+SIEK+  DG 
Sbjct: 868 KTLRDFLEQLMACTNMNCLTPEASMKGDCQFLSANLYAKSVFGEDALANLSIEKEGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|358372860|dbj|GAA89461.1| coatomer subunit beta [Aspergillus kawachii IFO 4308]
          Length = 955

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 486/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALSIALEMVSSKNVEEIVMLLKKELAKTVDEQYEKNSEYRQLLIQSIHNC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR+SI ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPALRTSIVDRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    +DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEERDIREAWKRIRASLGEIPILASEQRLLDEVPEDAALKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHSKPSAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DR+M 
Sbjct: 568 VLSSTLTKLVMRHSEVSEDVARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRVMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSQKKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKTAVQVDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K+   + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FTKKAALEGAEEIELDLAKATGGDSTVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++ES+ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTESHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
           +LRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 NLREFLKQLMESTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|261203611|ref|XP_002629019.1| coatomer beta subunit [Ajellomyces dermatitidis SLH14081]
 gi|239586804|gb|EEQ69447.1| coatomer beta subunit [Ajellomyces dermatitidis SLH14081]
 gi|239608162|gb|EEQ85149.1| coatomer beta subunit [Ajellomyces dermatitidis ER-3]
 gi|327349347|gb|EGE78204.1| coatomer beta subunit [Ajellomyces dermatitidis ATCC 18188]
          Length = 956

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/619 (63%), Positives = 487/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIAMEMVSSKNVEEIVMLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR+SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIVDFNNNSAVDVISFVKEVVEKFPKLRASIIERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW++GEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDDVPKENGPPKDQV 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SR++LADGTYATE+A +S SS  A+LEA+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHPKPSAPTGSRKVLADGTYATESALTSQSSEAARLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDSARTNALRAEAMLIMISIIRVGQSQFVKAHIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   VQVDD I  R
Sbjct: 628 SCVRSLAEFAQHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K++  + ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKSTEEGADEIELDLAKATGGDSTYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LND+  DIMDYI+PA+C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTETHVVILNDVKADIMDYIHPAHCTETQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  DG 
Sbjct: 868 KSLREFLHQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|154287944|ref|XP_001544767.1| coatomer beta subunit [Ajellomyces capsulatus NAm1]
 gi|150408408|gb|EDN03949.1| coatomer beta subunit [Ajellomyces capsulatus NAm1]
          Length = 956

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/619 (63%), Positives = 485/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I +E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIVMEMVSSKNVEEIVMLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW++GEY     DI EAWK++RA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLEANDIREAWKRVRASLGEIPILASEQRLLDEVPAEDGPIKEQV 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SR++LADGTYATE+A +S SS  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHSKPSAPTGSRKVLADGTYATESALTSQSSEAAKLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKALIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   VQVDD I  R
Sbjct: 628 SCVRSLAEFAQHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K++  + ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKSAEEGADEIELDLAKATGGDSAYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LNDI  DIMDYI+PA+C E+QFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTETHVVILNDIKADIMDYIHPAHCTESQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  DG 
Sbjct: 868 KSLREFLSQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|325090047|gb|EGC43357.1| coatomer beta subunit [Ajellomyces capsulatus H88]
          Length = 956

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/619 (63%), Positives = 485/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I +E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIVMEMVSSKNVEEIVMLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW++GEY     DI EAWK++RA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLEANDIREAWKRVRASLGEIPILASEQRLLDEVPAEDGPLKEQV 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SR++LADGTYATE+A +S SS  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHSKPSAPTGSRKVLADGTYATESALTSQSSEAAKLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKALIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   VQVDD I  R
Sbjct: 628 SCVRSLAEFAQHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K++  + ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKSAEEGADEIELDLAKATGGDSAYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LNDI  DIMDYI+PA+C E+QFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTENHVVILNDIKADIMDYIHPAHCTESQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  DG 
Sbjct: 868 KSLREFLSQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|226291349|gb|EEH46777.1| coatomer subunit beta [Paracoccidioides brasiliensis Pb18]
          Length = 955

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 482/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIAMEMVSSKNVEEIVMLLKKELTKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +L + + D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLTDLIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEALEENAPQKDQV 507

Query: 199 XXXXXTTS-SSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 ++ S  R+L+DGTYATE+A +S SS  AKLE +KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHSKPSAPSGSRVLSDGTYATESALTSQSSAAAKLETVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSKHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADERAKTAVQVDDTIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K++  + ADE ELDL +ATG      DL SKLSRVVQLTGFSDPVYAEAYV +HQ+DI
Sbjct: 688 LAKKSAEEGADEIELDLAKATGGDSIYGDLPSKLSRVVQLTGFSDPVYAEAYVKIHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDGP ++E++ V+LND+  DIMDYI+PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGPSSTETHVVILNDVKADIMDYIHPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  +G I
Sbjct: 868 SLREFLHQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGENGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|145239595|ref|XP_001392444.1| coatomer subunit beta [Aspergillus niger CBS 513.88]
 gi|134076955|emb|CAK45364.1| unnamed protein product [Aspergillus niger]
 gi|350629580|gb|EHA17953.1| hypothetical protein ASPNIDRAFT_52756 [Aspergillus niger ATCC 1015]
          Length = 955

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 485/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVMLLKKELAKTVDEQYEKNSEYRQLLIQSIHNC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR+SI ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPALRTSIVDRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    +DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEERDIREAWKRIRASLGEIPILASEQRLLDEVPEDAALKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHSKPSAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DR+M 
Sbjct: 568 VLSSTLTKLVMRHSEVSEDVARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRVMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSQKKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKTAVQVDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K+   + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FTKKAALEGAEEIELDLAKATGGDSTVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++ES+ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTESHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
           +LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 NLREFLKQLMDSTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|225679614|gb|EEH17898.1| coatomer subunit beta [Paracoccidioides brasiliensis Pb03]
          Length = 955

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 482/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIAMEMVSSKNVEEIVMLLKKELTKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +L + + D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLTDLIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEVLEENAPQKDQV 507

Query: 199 XXXXXTTS-SSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 ++ S  R+L+DGTYATE+A +S SS  AKLE +KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHSKPSAPSGSRVLSDGTYATESALTSQSSAAAKLETVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSKHKELETTFLEDTRRAFRAMVQVEEKKRAAKEADEKAKTAVQVDDTIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K++  + ADE ELDL +ATG      DL SKLSRVVQLTGFSDPVYAEAYV +HQ+DI
Sbjct: 688 LAKKSAEEGADEIELDLAKATGGDSIYGDLPSKLSRVVQLTGFSDPVYAEAYVKIHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDGP ++E++ V+LND+  DIMDYI+PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGPSSTETHVVILNDVKADIMDYIHPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  +G I
Sbjct: 868 SLREFLHQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGENGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|295667820|ref|XP_002794459.1| coatomer subunit beta [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285875|gb|EEH41441.1| coatomer subunit beta [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 955

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 483/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IA+E+V+++NV+E+++ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIAMEMVSSKNVEEIIMLLKKELTKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +L + + D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLTDLIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVVTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLGEVLEENAPQKDQV 507

Query: 199 XXXXXTTS-SSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 ++ S  R+LADGTYATE+A +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHSKPSAPSGSRVLADGTYATESALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSKHKELETTFLEDTRRAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K++  + ADE ELDL +ATG      D+ SKLSRVVQLTGFSDPVYAEAYV +HQ+DI
Sbjct: 688 LAKKSAEEGADEIELDLAKATGGDSIYGDVSSKLSRVVQLTGFSDPVYAEAYVKIHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDGP ++E++ V+LND+  DIMDYI+PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGPSSTETHVVILNDVKADIMDYIHPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  +G I
Sbjct: 868 SLREFLHQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGENGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|380487790|emb|CCF37813.1| hypothetical protein CH063_09056 [Colletotrichum higginsianum]
          Length = 956

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/617 (62%), Positives = 481/617 (77%), Gaps = 1/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI +IH C
Sbjct: 328 SSPDIDVRRKALDIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHTIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFPNLR  I ++L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSAVDVINFVKEVVEKFPNLRKPIVQRLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    +DI +AW+ IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEERDIRDAWRSIRASLGEIPILASEQRLLDGDGDEENKEQVNG 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  + SR++LADGTYATETA +S S+  AKLEA+KAA KPPLR L+L GD+YL +V
Sbjct: 508 HSKPAAPTGSRKVLADGTYATETALTSQSAVAAKLEAVKAAQKPPLRQLILDGDYYLATV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L++TL KLV+R++ IS +  +TNALR EAMLIM SIIRVGQSQF   PIDEDS DRIMSC
Sbjct: 568 LSATLVKLVMRHAEISAESARTNALRGEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMSC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + + +  +++V+L DTR AF  +V                   +QVDD++  RQ 
Sbjct: 628 VRSLSEFTQNKELETVYLDDTRKAFRAMVQAEEKKKAAKEAVEKAKTAIQVDDVVQIRQL 687

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SK+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 688 SKKNANDGLDEIEVDLERATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV 747

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVIF
Sbjct: 748 LDVLLVNQTMETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIF 807

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 808 GNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAKS 867

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +M +TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 868 LRDFLEQLMAATNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPIT 927

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 928 GFVRIRSRSQGLALSLG 944



>gi|70995412|ref|XP_752462.1| Coatomer subunit beta [Aspergillus fumigatus Af293]
 gi|66850097|gb|EAL90424.1| Coatomer subunit beta, putative [Aspergillus fumigatus Af293]
 gi|159131217|gb|EDP56330.1| Coatomer subunit beta, putative [Aspergillus fumigatus A1163]
          Length = 955

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/618 (63%), Positives = 486/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKEL KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEVVMLLKKELGKTVDEQYEKNSEYRQLLIQSIHHC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR+SI ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRASIVDRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI EAWK+IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIREAWKRIRSSLGEIPILASEQRLLDEVPDETALKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHTKPSAPTGSRKVLADGTYATESALTSESAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM 
Sbjct: 568 VLSSTLTKLVMRHSEVSQDVARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSIDRIMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLSEFSQRKELETTFLEDTRKAFRDMVQVEDKKRAAKEAVEKAKTAVQVDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K++  + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FTKKSGLEGAEEMELDLAKATGGDSTVETVASKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLKQLMESTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|225560044|gb|EEH08326.1| coatomer beta subunit [Ajellomyces capsulatus G186AR]
          Length = 956

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/619 (63%), Positives = 485/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I +E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIVMEMVSSKNVEEIVMLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW++GEY     DI EAWK++RA LGEIPILASE+RLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLEANDIREAWKRVRASLGEIPILASERRLLDEVPAEDGPLKEQV 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SR++LADGTYATE+A +S SS  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHSKPSAPTGSRKVLADGTYATESALTSQSSEAAKLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKALIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   VQVDD I  R
Sbjct: 628 SCVRSLAEFAQHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K++  + ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKSAEEGADEIELDLAKATGGDSAYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGV
Sbjct: 748 IVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LNDI  DIMDYI+PA+C E+QFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTETHVVILNDIKADIMDYIHPAHCTESQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  DG 
Sbjct: 868 KSLREFLSQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|320587926|gb|EFX00401.1| coatamer subunit protein [Grosmannia clavigera kw1407]
          Length = 958

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/620 (64%), Positives = 486/620 (78%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 327 SSPDIDVRRKALAIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I +KL+ET  +V+
Sbjct: 387 AIKFSEVAASVVDLLMDFVADFNNASAVDVINFVKEVVEKFPQLRPTIVQKLVETLGEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWIVGEY  N  DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 447 AGKVYRGILWIVGEYSLNAADIREAWKRIRASLGEIPILASEQRLLDHADDGEVKEPEQL 506

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSS-TLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                +  + SRR+LADGTYATETA +S +S + AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 507 NGHKQSAPTGSRRVLADGTYATETALTSQTSASAAKLEAVKAAQKPPLRQLILDGDYYLA 566

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL++TLTKLV+R+S IS D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIM
Sbjct: 567 TVLSATLTKLVMRHSEISADVSRTNALRAEAMLIMVSIVRVGQSQFVKAPIDEDSIDRIM 626

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           + +  L + S    +++VFL DTR AF  +V                   VQVDD++  R
Sbjct: 627 TSVRSLAEFSEHKDLETVFLDDTRKAFRAMVVAEEKKRAAKEADEKAKTAVQVDDVVSIR 686

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q S++N  D  D  E+DL RATG  A + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 687 QLSRKNATDGIDLAEVDLERATGGDAGASEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 746

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 747 DIVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTG 806

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFRSMWTEFEWENKVN+N+ 
Sbjct: 807 VIFGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPAMCTETQFRSMWTEFEWENKVNINSK 866

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-G 614
              LR +L  +MK+TNM+CLTPE A+ G+C FLSAN+YARS+FGEDALAN+SIEK+ + G
Sbjct: 867 APSLRIFLEGLMKATNMNCLTPEAAMKGECQFLSANLYARSVFGEDALANLSIEKEGEAG 926

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG VRIRS++QG+ALSLG
Sbjct: 927 PITGFVRIRSRSQGLALSLG 946



>gi|119495787|ref|XP_001264671.1| Coatomer subunit beta, putative [Neosartorya fischeri NRRL 181]
 gi|119412833|gb|EAW22774.1| Coatomer subunit beta, putative [Neosartorya fischeri NRRL 181]
          Length = 955

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/618 (63%), Positives = 485/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKEL KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALSIALEMVSSKNVEEVVMLLKKELGKTVDEQYEKNSEYRQLLIQSIHHC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR+SI ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRASIVDRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI EAWK+IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIREAWKRIRSSLGEIPILASEQRLLDEVPDETALKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHTKPSAPTGSRKVLADGTYATESALTSESAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM 
Sbjct: 568 VLSSTLTKLVMRHSEVSQDVARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSIDRIMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLSEFSQRKELETTFLEDTRKAFRDMVQVEDKKRAAKEAVEKAKTAVQVDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K++  + A+E ELDL +ATG   + +   SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FTKKSGLEGAEEMELDLAKATGGDSTVETAASKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLKQLMESTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|429858586|gb|ELA33401.1| coatomer beta subunit [Colletotrichum gloeosporioides Nara gc5]
          Length = 956

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 480/617 (77%), Gaps = 1/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR  I ++L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSAVDVINFVKEVVEKFPKLRKPIVQRLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    +DI +AWK IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEERDIRDAWKSIRSSLGEIPILASEQRLLDGDGEEENKEQVNG 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +V
Sbjct: 508 HSKPAQPTGSRKVLADGTYATETALTSQSSVAAKLEAVKAAQKPPLRQLILDGDYYLATV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L++TL KLV+R++ IS++  +TNALR EAMLIM SIIRVGQSQF   PIDEDS DRIMSC
Sbjct: 568 LSATLVKLVMRHAEISKEAGRTNALRGEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMSC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    +++V+L DTR AF  +V                   +QVDD++  RQ 
Sbjct: 628 VRSLAEFNQHKELETVYLDDTRKAFRAMVQAEEKKRLAKEAVEKAKTAIQVDDVVQIRQL 687

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SK+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 688 SKKNATDGLDEIEVDLERATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV 747

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVIF
Sbjct: 748 LDVLLVNQTMETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIF 807

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 808 GNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAKS 867

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +M +TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 868 LRDFLEQLMAATNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPIT 927

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 928 GFVRIRSRSQGLALSLG 944



>gi|402080899|gb|EJT76044.1| coatomer subunit beta [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 959

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/620 (63%), Positives = 482/620 (77%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALGIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI  +L++T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNASAVDVINFVKEVVEKFPTLRPSIVSRLVDTLAEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXX--XXXXXXXXX 196
           +GK++RG LWI+GEY    KDI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKIYRGILWIIGEYSLEDKDIRDAWKRIRASLGEIPILASEQRLLDNVDGEEEKDKDQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATETA +S S+  AKLEA+KAA KPPLR L+L GD+YL 
Sbjct: 508 NGHNKAAAPTGSRKVLADGTYATETALTSQSAAAAKLEAVKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+ TLTKLV+RYS I    ++TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 TVLSGTLTKLVMRYSEIFPGHERTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + S    ++ V+L D++ AF  +V                   VQVDD++  R
Sbjct: 628 SCVRSLAEFSQRKELEKVYLEDSKKAFRAMVAVEEKKRAAKEAVERAKTAVQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N GD AD  E DL RATG  A + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 688 QLSKKNAGDGADLIEADLERATGGDASAAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 748 DIVLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++++N V+L+D+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 808 VIFGNVVYDGAHSTDTNVVILSDVHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSK 867

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
           +  LR +L  +M++TNM+CLTPE  L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 868 VKTLRGFLDELMRATNMNCLTPEAGLKGDCQFLSANLYARSVFGEDALANLSIEKEGDDG 927

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG VRIRS++QG+ALSLG
Sbjct: 928 PITGFVRIRSRSQGLALSLG 947



>gi|240278792|gb|EER42298.1| coatomer beta subunit [Ajellomyces capsulatus H143]
          Length = 956

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/619 (63%), Positives = 484/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I +E+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIVMEMVSSKNVEEIVMLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIIERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW++GEY     DI EAWK++RA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVIGEYSLEANDIREAWKRVRASLGEIPILASEQRLLDEVPAEDGPLKEQV 507

Query: 199 XXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +  + SR++LADGTYATE+A +S SS  AKLEA+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHSKPSAPTGSRKVLADGTYATESALTSQSSEAAKLEAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIIRVGQSQFVKALIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   VQVDD I  R
Sbjct: 628 SCVRSLAEFAQHKELETTFLEDTRQAFRAMVQVEEKKRAAKEADEKAKAAVQVDDTIPIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K++  + ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKSAEEGADEIELDLAKATGGDSAYEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+ DVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+AT+KVSST+TGV
Sbjct: 748 IVWDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATVKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  ++E++ V+LNDI  DIMDYI+PA+C E+QFR+MWTEFEWENKVN+N+  
Sbjct: 808 IFGNVVYDGASSTETHVVILNDIKADIMDYIHPAHCTESQFRTMWTEFEWENKVNINSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M+STNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEKQ  DG 
Sbjct: 868 KSLREFLSQLMESTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKQGEDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 928 ITGFVRIRSRSQGLALSLG 946



>gi|407926368|gb|EKG19335.1| Clathrin/coatomer adaptor adaptin-like protein [Macrophomina
           phaseolina MS6]
          Length = 956

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/618 (63%), Positives = 483/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL +A+E+V+++NV EVV+ LKKELSKT+D+ YEKN EYR LLI SIH C
Sbjct: 328 SSTDLDVRKKALELAMEMVSSKNVAEVVMLLKKELSKTVDEQYEKNAEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV  LMEF+ D NN +AVDVI+FV+EVVEKFP+LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDSLMEFIADFNNASAVDVISFVKEVVEKFPDLRPSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEPNDIREAWKRIRASLGEIPILASEQRLLEEVPDGQPDPKDQI 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S ++  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHAKSAPTGSRKVLADGTYATESALTSQAAVKAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S IS+D  +TNAL+AEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHSEISQDTARTNALKAEAMLIMISIIRVGQSQFVKTPIDEDSIDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++VFL DTR AF  +V                   VQVDD+I  RQ
Sbjct: 628 CVRALAEFQQKKELETVFLDDTRKAFRTMVQYEEKKRAAKEASEKMKSAVQVDDVIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE ELDL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+DI
Sbjct: 688 LAKKNTVDGGDEMELDLERATGGDHTTEDLSSKLSRVVQLTGFSDQVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  +++SN ++LND+H+DIMDYI PA+C+ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGASSTDSNVIILNDVHVDIMDYIQPAHCSETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M +TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG +
Sbjct: 868 TLRDFLKQLMAATNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPV 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+AL+LG
Sbjct: 928 TGFVRIRSRSQGLALALG 945



>gi|409051995|gb|EKM61471.1| hypothetical protein PHACADRAFT_248107 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 884

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/625 (62%), Positives = 492/625 (78%), Gaps = 10/625 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L L+++RNV+EVV+FLKK+L +T +Q++EK  EYRQLLIQSIH C
Sbjct: 263 SSTDLEVRRKAIGIVLNLISSRNVEEVVLFLKKQLQRTQEQEFEKAPEYRQLLIQSIHVC 322

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A++FSEVAA VVH LM+FLGD+NNP+A+DV+AFVREVVEKFP LRS+I EKL++   ++K
Sbjct: 323 AVRFSEVAATVVHALMDFLGDNNNPSALDVVAFVREVVEKFPQLRSTICEKLIQALSEIK 382

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
            GKV+RG LWI+GEY  +   I++ ++++R  LGEIPILASEQ+LL              
Sbjct: 383 PGKVYRGVLWILGEYAESSIQIQQTFQELRKVLGEIPILASEQKLLDEAGAEDEEKSEVK 442

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                T S+  ++LADGTYATETAF+S SS   +LEA+KAA KPPLR+L+L GDF+ GSV
Sbjct: 443 -----TESTKPKVLADGTYATETAFTSASSV--RLEAVKAAAKPPLRTLILGGDFFTGSV 495

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+S LTKLVLR++ + +D K TN LRAEAMLIMAS+IRVGQS+F + PIDEDS +RIM+C
Sbjct: 496 LSSALTKLVLRHTELGDDKKATNTLRAEAMLIMASVIRVGQSKFVTVPIDEDSSERIMNC 555

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX-XTVQVDDLIVFRQ 377
           +  L ++     +  +FL DT+ A+++++                    +QVDDL+ FRQ
Sbjct: 556 IGTLSELQEKPVVHELFLKDTKTAYSKMLSAQEKKAAEKKEQESAKPAAIQVDDLLTFRQ 615

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+   D  D+ E DL RATG  D+ +D IS LSR+ QLTGFSD +YAEAYV VH +DI
Sbjct: 616 FSKKVADDIIDDRE-DLVRATGTGDANEDFISNLSRISQLTGFSDSIYAEAYVKVHGFDI 674

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           LLDVL+VNQT++TLQNL ++FATLGDLKLVERP+ + +APHSF S+KATIKVSSTETGVI
Sbjct: 675 LLDVLLVNQTADTLQNLCLDFATLGDLKLVERPSTYTIAPHSFQSIKATIKVSSTETGVI 734

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GPG SE  CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV+T ++
Sbjct: 735 FGSILWEGPGMSE-QCVILNDIHIDIMDYIKPAYCTEAQFRSMWTEFEWENRVNVSTAMS 793

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D R+YL H+MK+TNMSCLTPE A+SG+C FLSANMYARS+FGEDALAN+S+E+   G IT
Sbjct: 794 DPRDYLKHVMKATNMSCLTPEGAISGECDFLSANMYARSLFGEDALANLSVEQTEQGTIT 853

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 854 GHVRIRSKTQGIALSLGDRITMAQK 878



>gi|342884986|gb|EGU85102.1| hypothetical protein FOXB_04381 [Fusarium oxysporum Fo5176]
          Length = 957

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 479/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFPNLR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNASAVDVINFVKEVVEKFPNLRTTIIERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHDTEEQTDDHIN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  AKLEA+K A KPPLR L+L GD+YL +
Sbjct: 508 GASKPAAPSGSRKVLADGTYATETALTSQSSAAAKLEAVKTAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLAEFEQKKELETVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  +  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNTTEGLDEIEVDLERATGGEGTAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|299756686|ref|XP_001829526.2| coatomer beta subunit [Coprinopsis cinerea okayama7#130]
 gi|298411786|gb|EAU92486.2| coatomer beta subunit [Coprinopsis cinerea okayama7#130]
          Length = 970

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/624 (63%), Positives = 487/624 (78%), Gaps = 6/624 (0%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           S DIEVRRKA++I L + ++RNV+EVV+FLKK+L +T + D EK+ EYRQLLIQSIH  A
Sbjct: 345 SSDIEVRRKAVKIVLSMTSSRNVEEVVLFLKKQLQRTQESDTEKSPEYRQLLIQSIHVTA 404

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           IKFSEVAA+VVH LM+FLGDSNNP+A+DV++FVREVVEKFP+LR++IT KL+ T  ++KS
Sbjct: 405 IKFSEVAASVVHALMDFLGDSNNPSALDVVSFVREVVEKFPHLRAAITSKLISTLTEIKS 464

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXX 199
           GKVFRG LWI+GEY     +I+EA ++IR  LGEIPILASEQRLL               
Sbjct: 465 GKVFRGVLWIIGEYTEGVDNIQEAMQEIRKVLGEIPILASEQRLLDEASGGAEEESEEKE 524

Query: 200 XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSVL 259
               +T    R+LADGTYATETAFS++S+  A+LEA+KAA KPPLR+L+L GDF+ GSVL
Sbjct: 525 KPAVSTRP--RVLADGTYATETAFSTSSAN-ARLEAVKAAAKPPLRTLILGGDFFTGSVL 581

Query: 260 ASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSCL 319
           +S LTKLVLR++ IS+D   +N LRAEAMLIM SIIRVGQS+F +  IDEDS +RIM+C+
Sbjct: 582 SSALTKLVLRFADISKDAAASNLLRAEAMLIMTSIIRVGQSKFVTVQIDEDSNERIMNCI 641

Query: 320 HILEQISTDYSIKSVFLHDTRAAFARIVXXXXX-XXXXXXXXXXXXXTVQVDDLIVFRQF 378
             L ++ TD  ++  FL DT+ AF +++                    VQVDDL+ FRQF
Sbjct: 642 QTLSELDTDKDVREAFLDDTKNAFTKMLTAQEKRAAEKKEAESEKKVAVQVDDLLSFRQF 701

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SKR   D+  +Y+ D+++ATG  + ++D +S LSR+ QLTGFSDP+YAEA V +H +DIL
Sbjct: 702 SKRQ-ADDVIDYDEDVSKATGATEVQEDFMSNLSRISQLTGFSDPIYAEALVKMHGFDIL 760

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT  TLQNL I+FATLGDLK+VERP+   +APH F S+KATIKVSSTETGVIF
Sbjct: 761 LDVLLVNQTPNTLQNLCIDFATLGDLKIVERPSVFTIAPHGFQSIKATIKVSSTETGVIF 820

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           G+I+++GP   ES CV+LNDIHIDIMDYI PAYCNE QFRSMWTEFEWEN+VNVN+ I D
Sbjct: 821 GSILWEGPNMGES-CVILNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWENRVNVNSPIAD 879

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITG 618
            REYL H+MK TNMSCLTPE A SGDC FLSANMYARS+FGEDALAN+SIE+   G +TG
Sbjct: 880 PREYLQHVMKVTNMSCLTPEGATSGDCDFLSANMYARSLFGEDALANLSIERTEQGTVTG 939

Query: 619 HVRIRSKTQGIALSLGDKITLAQK 642
           HVRIR+KTQGIALSLGD+IT+AQK
Sbjct: 940 HVRIRAKTQGIALSLGDRITMAQK 963



>gi|472588712|gb|EMS26184.1| coatomer protein complex, subunit beta [Rhodosporidium toruloides
           NP11]
          Length = 978

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/659 (61%), Positives = 495/659 (75%), Gaps = 17/659 (2%)

Query: 1   EKHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD 60
           +KH+               SPD++VR+KAL IA+++V  RNV +VV FLKKEL++T D  
Sbjct: 317 QKHEHVLDDLVTDLLRVLASPDMDVRKKALAIAMDMVNGRNVDDVVGFLKKELARTTDPS 376

Query: 61  YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFP 120
           ++K  EYRQLLIQ+IH CAI+ SEVA++VVHVLM+FLGD++N +AVDV+AFVREVVEKFP
Sbjct: 377 FDKATEYRQLLIQTIHTCAIRHSEVASSVVHVLMDFLGDASNASAVDVVAFVREVVEKFP 436

Query: 121 NLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASE 180
           +LR  I  KLL+TF ++KSGKVFRGA+WIVGEY  + +++ +A +Q+R  +GE+PILASE
Sbjct: 437 DLRQGIVAKLLDTFGEIKSGKVFRGAMWIVGEYAGSVEEVRQAMQQVRKVIGEVPILASE 496

Query: 181 QRLLXXXXXXXXXXXX-----XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEA 235
           QRLL                        T +S+ R+LADGTYATET FSS+S+T A    
Sbjct: 497 QRLLDQAEQDAAAEADQVNGDSALVQKPTATSTTRVLADGTYATETVFSSSSATAAASLE 556

Query: 236 -IKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGI--SEDPKKTNALRAEAMLIMA 292
            +KAA KPPLR+L+L GDFY  +VLA+TLTKLV+R+  +  + + +  N LRAE MLIM 
Sbjct: 557 AVKAAAKPPLRALILGGDFYTATVLAATLTKLVMRFKELVGAGEARAVNELRAECMLIMT 616

Query: 293 SIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDYS-------IKSVFLHDTRAAFAR 345
           SIIRVGQS FAS PIDED+ +RIMSCL  L ++    +       ++ +FL DT+AA+A+
Sbjct: 617 SIIRVGQSHFASVPIDEDAQERIMSCLQALAELDNASAGSDRARVVEEIFLRDTQAAYAK 676

Query: 346 IVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIG-DEADEYELDLTRATGQADS- 403
           +V                   VQ DDLI FRQ +K+  G D ADEYE DLT+ATG  D+ 
Sbjct: 677 MVEHEEKKALEKKKREDKAQAVQADDLIQFRQLAKKQPGADAADEYETDLTKATGATDAA 736

Query: 404 RDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGD 463
           +DD +SKL RVVQLTGFSDPVYAEAYV+V  +DILLDVLIVNQT ETLQNL+ EFATLGD
Sbjct: 737 KDDFVSKLQRVVQLTGFSDPVYAEAYVHVQGFDILLDVLIVNQTLETLQNLTCEFATLGD 796

Query: 464 LKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDI 523
           L+L+ERP  + L P SF SVKATIKVSSTETGVIFGNI YDG  T++S+CVVLNDIHIDI
Sbjct: 797 LRLLERPVPYTLGPQSFQSVKATIKVSSTETGVIFGNIFYDGAHTTDSHCVVLNDIHIDI 856

Query: 524 MDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSG 583
           +DYI PAYCNE QFRSMWTEFEWENKVNVNT+I DLR YL HIM STNM+CLTP+ AL G
Sbjct: 857 LDYITPAYCNEGQFRSMWTEFEWENKVNVNTSIDDLRSYLQHIMSSTNMACLTPDAALEG 916

Query: 584 DCGFLSANMYARSIFGEDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           DCGFLSAN+YARS+FGEDALAN+SIEK  DG + GHVRIRSKTQGIALSLGD+IT++QK
Sbjct: 917 DCGFLSANLYARSLFGEDALANLSIEKLADGTLQGHVRIRSKTQGIALSLGDRITISQK 975



>gi|485926729|gb|EOD50948.1| putative coatomer subunit protein [Neofusicoccum parvum UCRNP2]
          Length = 956

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 487/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL +A+E+V+++NV+EVV+ LKKELSKT+D+ YEKN EYR LLI SIH C
Sbjct: 328 SSTDLDVRKKALELAMEMVSSKNVEEVVMLLKKELSKTVDEQYEKNAEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV  LMEF+ D NN +AVDVI+FV+EVVEKFP+LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDSLMEFIADFNNASAVDVISFVKEVVEKFPDLRPSIVERLVSTLNEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEY     DI EAWK+IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEPNDIREAWKRIRSSLGEIPILASEQRLLEEVPDGQPDPKDQI 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S ++  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHAKSAPTGSRKVLADGTYATESALTSQAAVKAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R++ IS++  +TNAL+AEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLTKLVMRHAEISQETARTNALKAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+H L +     +++SVFL DTR AF  +V                   +QVDD+I  RQ
Sbjct: 628 CVHALAEFQQKKALESVFLEDTRKAFRTMVQYEEKKRAAKEASEKMKSAIQVDDVIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D ADE ELDL +ATG  ++ +DL SKLSRVVQLTGFSD VY+EAYV VHQ+DI
Sbjct: 688 LAKKNAVDGADEIELDLEKATGGDNTTEDLSSKLSRVVQLTGFSDQVYSEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N ++LND+H+DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGASSTDTNVIILNDVHVDIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M +TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG +
Sbjct: 868 TLRDFLKQLMAATNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPV 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+AL+LG
Sbjct: 928 TGFVRIRSRSQGLALALG 945



>gi|494830908|gb|EON67419.1| hypothetical protein W97_06672 [Coniosporium apollinis CBS 100218]
          Length = 954

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/619 (62%), Positives = 482/619 (77%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+KAL +A+E+V+++NV+EVV+ LKKELSKT+D+ YEKN EYR LLI SIH C
Sbjct: 328 SSPDIDVRKKALGLAMEMVSSKNVEEVVMLLKKELSKTVDEQYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+ V  LM+F+ D NN +AVDVI+FV+EVVEKFP LRSS+ E+L+ T  +V+
Sbjct: 388 AIKFSEVAASAVESLMDFIADFNNASAVDVISFVKEVVEKFPKLRSSLVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGALWIVGEY     DI EAW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGALWIVGEYSLEANDIREAWRRIRASLGEIPILASEQRLLDEVPEDKPDPRDQV 507

Query: 199 X--XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S ++  AKLEAIKAA KPPLR L+L GD+YL 
Sbjct: 508 NGHAKGAEPTGSRKVLADGTYATESALTSQAAVKAKLEAIKAAQKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R++ IS +  +TNAL+AEAMLIM SIIRVGQSQF  NPIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHAEISNETARTNALKAEAMLIMISIIRVGQSQFVKNPIDEDSIDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      ++++FL DTR AF  +V                   +Q+DD++  R
Sbjct: 628 SCVRSLAEFEQKGVLETIFLDDTRKAFRTMVQAEEKKRSEKEAMEKAKTAIQIDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q +K+N  D A+E+E DL RATG     +DL SKL+RVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLAKKNTVDGAEEFEQDLERATGGDAGAEDLSSKLNRVVQLTGFSDPVYAEAYVKVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT++TLQNLSIEFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGV
Sbjct: 748 IVLDVLLVNQTTDTLQNLSIEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDG  +++SN V+LNDIH+DIMDYI+PAYC ETQFR+MWTEFEWENKVN+ +  
Sbjct: 808 IFGNVVYDGASSTDSNVVILNDIHVDIMDYIHPAYCTETQFRTMWTEFEWENKVNIKSKA 867

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR++L  +M  TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 868 KTLRDFLKQLMAVTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDDGP 927

Query: 616 ITGHVRIRSKTQGIALSLG 634
           +TG VRIRS++QG+ALSLG
Sbjct: 928 VTGFVRIRSRSQGLALSLG 946



>gi|46111797|ref|XP_382956.1| hypothetical protein FG02780.1 [Fusarium graminearum PH-1]
          Length = 957

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 479/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFPNLR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNVSAVDVINFVKEVVEKFPNLRTTIIERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHEGDEKTEDHTN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  A+LEA+K A KPPLR L+L GD+YL +
Sbjct: 508 GTSKPAAPSGSRKVLADGTYATETALTSQSSAAARLEAVKTAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLAEFEEKKELETVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVSIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNTTDGLDEIEVDLERATGGEGAAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 TLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|322693002|gb|EFY84881.1| coatomer beta subunit [Metarhizium acridum CQMa 102]
          Length = 962

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/617 (63%), Positives = 477/617 (77%), Gaps = 1/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL IAL++++++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 334 SSTDIDVRRKALGIALDMISSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 393

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 394 AIKFSEVAASVVDLLMDFIADFNNASAVDVINFVKEVVEKFPALRKTIVERLVSTLSEVR 453

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GK++RG +WI+GEY    KDI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 454 AGKIYRGIMWIIGEYSLEEKDIRDAWKRIRASLGEIPILASEQRLLEDQDGEPIQDQVNG 513

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  S SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +V
Sbjct: 514 NSKPAPPSGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLATV 573

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KLV+R+S IS D  +TNALRAEAMLIM SI+R GQSQF   PIDEDS DRIMSC
Sbjct: 574 LSSTLVKLVMRHSEISADVARTNALRAEAMLIMISILRAGQSQFVKAPIDEDSVDRIMSC 633

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L   ST   +++ +L+DTR AF  +V                   VQVDD++  RQ 
Sbjct: 634 VRSLADFSTKKELENAWLNDTRKAFRAMVQVEEKKREAKEAYERAKSAVQVDDVVQIRQL 693

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SKRN  D  D  ELDL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 694 SKRNATDGIDGIELDLERATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV 753

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVIF
Sbjct: 754 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIF 813

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 814 GNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAKS 873

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +   TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 874 LRDFLDQLTACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPIT 933

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 934 GFVRIRSRSQGLALSLG 950



>gi|408389614|gb|EKJ69053.1| hypothetical protein FPSE_10779 [Fusarium pseudograminearum CS3096]
          Length = 957

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 479/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFPNLR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNVSAVDVINFVKEVVEKFPNLRTTIIERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHEGDEKTEDHIN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  A+LEA+K A KPPLR L+L GD+YL +
Sbjct: 508 GTSKPAAPSGSRKVLADGTYATETALTSQSSAAARLEAVKTAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLAEFEEKKELETVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVSIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNTTDGLDEIEVDLERATGGEGTAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 TLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|58269570|ref|XP_571941.1| ER to Golgi transport-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134113939|ref|XP_774217.1| hypothetical protein CNBG1990 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256852|gb|EAL19570.1| hypothetical protein CNBG1990 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228177|gb|AAW44634.1| ER to Golgi transport-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 952

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/644 (61%), Positives = 495/644 (76%), Gaps = 6/644 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+EV+RKA+ +ALE+V++RNV+EVV+FLKK+L  TLDQD+
Sbjct: 309 KHENVLDGMVMDILKVLSSPDMEVKRKAIGVALEMVSSRNVEEVVLFLKKQLQGTLDQDF 368

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           +KN EYRQLLIQSIH CAI+FSEVAANVV+VLM+FLGDSNNP+AVDVIAFVREVVEKFP 
Sbjct: 369 DKNLEYRQLLIQSIHSCAIRFSEVAANVVYVLMDFLGDSNNPSAVDVIAFVREVVEKFPK 428

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR++ITEKL+ TF ++KSGKVFRGA+WIVGEYC   +DI++A   I+  LGEIPILASEQ
Sbjct: 429 LRTAITEKLISTFGEIKSGKVFRGAMWIVGEYCEQPEDIKQAIAAIQKVLGEIPILASEQ 488

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                    T++  R+LADGTYATET ++S++S  A+LEA+++A K
Sbjct: 489 RLLDEAEAADETPAEQQEQPKAITTT--RVLADGTYATETVYTSSASA-ARLEAVRSASK 545

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGI-SEDPKKTNALRAEAMLIMASIIRVGQS 300
           PPLRSL+L GDF+ GSVLASTLTKLVLRYS + S D +  N LRA+A+LIM S+IRVGQS
Sbjct: 546 PPLRSLILGGDFFTGSVLASTLTKLVLRYSEVTSSDQQSINILRAQAILIMTSVIRVGQS 605

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           +FA+ PIDED+ +RIM+C+  L ++    ++  VFL DT+AA+A++V             
Sbjct: 606 KFAAVPIDEDAEERIMNCIETLAELQGSKALHQVFLKDTKAAYAKMVATEEKKALEKKER 665

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 VQ DDLI FRQ SK+++  + DE + D+ +ATG    +DD +SKLSR+ QLTGF
Sbjct: 666 ESKVSVVQADDLISFRQLSKKSVVGDVDESD-DVVKATGSIHPQDDFVSKLSRITQLTGF 724

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SDPVYAE  V + QYDI+LDVL+VN T+ETLQNL ++FATLGDLKLVERP    LAPH F
Sbjct: 725 SDPVYAETVVTLSQYDIILDVLLVNTTNETLQNLMVDFATLGDLKLVERPAPFTLAPHGF 784

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRS 539
           HS+ AT+KVSSTETGVIFG I Y   G S+++  +V++DIH+DIM +I P Y NE QFRS
Sbjct: 785 HSLSATVKVSSTETGVIFGAITYSKQGASDADVTIVMSDIHVDIMSFIKPNYVNEAQFRS 844

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MWTEFEWENKV V T+I+DLR YL H++KST+M+ LTPE ALSGDC FLSAN+ A+S+FG
Sbjct: 845 MWTEFEWENKVAVQTSISDLRAYLDHLLKSTHMALLTPEAALSGDCDFLSANLAAKSLFG 904

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EDALAN SIE+  DG ITGHVRIRSKTQGIALSLGDKITL+QKA
Sbjct: 905 EDALANASIERTEDGHITGHVRIRSKTQGIALSLGDKITLSQKA 948



>gi|367045178|ref|XP_003652969.1| hypothetical protein THITE_2114850 [Thielavia terrestris NRRL 8126]
 gi|347000231|gb|AEO66633.1| hypothetical protein THITE_2114850 [Thielavia terrestris NRRL 8126]
          Length = 958

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/620 (62%), Positives = 482/620 (77%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 327 SSPDIDVRRKALGIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR  I  +L++T  +V+
Sbjct: 387 AVKFSEVAASVVELLMDFIADFNNASAVDVINFVKEVVEKFPALRPGIVRRLVDTLREVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY  + KDI EAWK IRA LGEIPILASEQRLL              
Sbjct: 447 AGKVYRGILWIIGEYSLDEKDIREAWKGIRASLGEIPILASEQRLLDNMDNEEENKEQEQ 506

Query: 199 XX--XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SRR+LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL 
Sbjct: 507 VNGHAKSAPAGSRRVLADGTYATETALTSQSAAAARLEAVKASSKPPLRQLILDGDYYLA 566

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL++TLTKLV+R+S +S +  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 567 TVLSATLTKLVMRHSELSSEAARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 626

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      +++V+L DTR AF  IV                   VQVDD++  R
Sbjct: 627 SCVRSLAEFQQHGELETVYLEDTRKAFRAIVQVEEKKRAAKEAFEKAKTAVQVDDVVSIR 686

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N  D  D  ELDL RATG  + + +DL  KLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 687 QLSKKNAVDGVDAIELDLERATGGDSSAAEDLSGKLSRVVQLTGFSDPVYAEAYVKVHQF 746

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT++TLQNL++EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 747 DIILDVLLVNQTTDTLQNLTVEFATLGDLKVVERPTSQNLGPHDFHNVQCTIKVSSTDTG 806

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++++N V+LND+H+DIMDYI PA C+ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 807 VIFGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCSETQFRTMWTEFEWENKVNINSK 866

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LR++L  +M  TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  +G
Sbjct: 867 AKSLRDFLDQLMACTNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEEG 926

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG +RIRS++QG+ALSLG
Sbjct: 927 PITGFLRIRSRSQGLALSLG 946



>gi|389751331|gb|EIM92404.1| coatomer beta subunit [Stereum hirsutum FP-91666 SS1]
          Length = 957

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/628 (63%), Positives = 493/628 (78%), Gaps = 8/628 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DIEVRRKA+ IAL + ++RNV++VV+FLKK+L KT DQ+YEK  EYRQLLIQSIH C
Sbjct: 328 SSADIEVRRKAVGIALSMTSSRNVEDVVMFLKKQLQKTQDQEYEKAPEYRQLLIQSIHVC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VVH LMEFLGDSNNP+A+DV+AFVREVVEKFP LR  ITE+L++T  ++K
Sbjct: 388 AVKFSEVAASVVHALMEFLGDSNNPSALDVVAFVREVVEKFPALRPPITERLIQTLPEIK 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG LWI+GEY  N  +I EA++++R  LGEIPILASEQRLL              
Sbjct: 448 SGKVFRGVLWIIGEYVENASEILEAFQEVRKVLGEIPILASEQRLLDEASAEDEPKEKEE 507

Query: 199 XXX---XXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                     +S  ++LADGTYATET  +  S+T A+LEA+KAA KPPLR+LLL GDF+ 
Sbjct: 508 TSTNGHAHGAASKPKVLADGTYATET--AFTSTTTARLEAVKAAAKPPLRTLLLGGDFFT 565

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+VLAS LTKLVLR+S +S DPK+ NALRAEAMLIMAS+IRVGQS+F + PIDEDS++RI
Sbjct: 566 GTVLASALTKLVLRFSEVSSDPKRANALRAEAMLIMASVIRVGQSKFVTVPIDEDSHERI 625

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX-XXXXXXTVQVDDLIV 374
           ++C+  L  +     +  +FL DT+AA++++V                    +QVDD++ 
Sbjct: 626 LNCIQTLSSLEERPVVHEIFLSDTKAAYSKMVAAQEKKAAEKRELEATKEHAIQVDDVLS 685

Query: 375 FRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQ 434
           FRQFSK+   D+  +Y+ D+ RATG A+  +D IS LSR+ QLTGFSDP+YAEAYV VH 
Sbjct: 686 FRQFSKK-AADDVIDYDQDVGRATGAAEVHEDFISNLSRISQLTGFSDPLYAEAYVKVHG 744

Query: 435 YDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTET 494
           +DI+LDVL+VNQTS+TLQNL ++FATLGDLKLVERP  + +APH F S+KATIKVSSTET
Sbjct: 745 FDIMLDVLLVNQTSDTLQNLCLDFATLGDLKLVERPAVYTIAPHGFQSIKATIKVSSTET 804

Query: 495 GVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNT 554
           GVIFG+I+++GP  SE   V+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV+T
Sbjct: 805 GVIFGSILWEGPNLSE-QAVILNDIHIDIMDYIKPAYCTEAQFRSMWTEFEWENRVNVST 863

Query: 555 NITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDG 614
            +++ R+YL HIMKSTNMSCLTPE A+SGD  FLSANMYARS+FGEDALAN+SIE+   G
Sbjct: 864 TMSEPRDYLQHIMKSTNMSCLTPEGAMSGDSDFLSANMYARSLFGEDALANLSIERTEAG 923

Query: 615 AITGHVRIRSKTQGIALSLGDKITLAQK 642
            ITGHVRIRSKTQGIALSLGD+IT+AQK
Sbjct: 924 TITGHVRIRSKTQGIALSLGDRITMAQK 951



>gi|302884432|ref|XP_003041112.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256722008|gb|EEU35399.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 957

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/618 (63%), Positives = 479/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP+LR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFNNVSAVDVINFVKEVVEKFPSLRTTIIERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHDDGEKTDDHIN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GTSKHAAPTGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLAEFEQKKELETVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNASDGLDEIEVDLERATGGEGAAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|353236342|emb|CCA68339.1| probable coatomer complex beta chain [Piriformospora indica DSM
           11827]
          Length = 929

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/642 (63%), Positives = 489/642 (76%), Gaps = 30/642 (4%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              TS D+EVRRKA++IAL +VT RNVQEVV+FLKK+L+KTL+Q+Y
Sbjct: 309 KHEHVLDGLAMDILGVLTSTDMEVRRKAVKIALSMVTGRNVQEVVLFLKKQLTKTLEQEY 368

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           EKN EYRQLLIQSIH CA+KFSEVAA+VVH +MEFLGDS+N AAVDVIAFVREVVEKFPN
Sbjct: 369 EKNVEYRQLLIQSIHICAVKFSEVAASVVHAMMEFLGDSSNSAAVDVIAFVREVVEKFPN 428

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR SITEKLLET  D+KS                   +I EA+ QIR  +GE+PILA+EQ
Sbjct: 429 LRRSITEKLLETLPDIKS-------------------EIHEAFAQIRRTIGEVPILAAEQ 469

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                    T  + ++L DGTYA ETA SS  +  A+LEA+K A K
Sbjct: 470 RLLDAAGGDAPEEPLVK------TGGAPKVLEDGTYAMETAMSS--AVNARLEAVKKASK 521

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQ 301
           PPLR+L+L+GDFY GS LASTL+KLVLRY+    D KK +ALRAEAML+M SIIRVGQS+
Sbjct: 522 PPLRALILNGDFYTGSALASTLSKLVLRYNQGGSDSKKAHALRAEAMLMMTSIIRVGQSK 581

Query: 302 FASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXX 361
           F S PIDEDS +RIM+C+ +L ++S + S+  +FL DT+AA+A++V              
Sbjct: 582 FVSVPIDEDSQERIMNCIRVLSEMSLNKSVNEIFLLDTKAAYAKMVATEEKKAQEKREKE 641

Query: 362 XXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
                VQVDD++ FRQFSKR + D  D+YE+D++RATG  +   D+ S LS VVQLTGFS
Sbjct: 642 SKTTAVQVDDVLTFRQFSKRGLADATDDYEMDVSRATGTGEDSVDVASNLSSVVQLTGFS 701

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEAYV VH +DI+LDVLIVNQT+ T+QNL +EFATLGDLKLVERP+ H LAPHSFH
Sbjct: 702 DPVYAEAYVKVHGFDIMLDVLIVNQTTTTMQNLCLEFATLGDLKLVERPSTHTLAPHSFH 761

Query: 482 SVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMW 541
           S+K +IKVSSTE+GVIFGNI+++  GTSE++ VVL+DIHIDIMDYI PA C E QFRSMW
Sbjct: 762 SIKTSIKVSSTESGVIFGNIIWES-GTSETS-VVLSDIHIDIMDYIKPATCTEHQFRSMW 819

Query: 542 TEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGED 601
           TEFEWEN+VNV T+I+DLR+YL HIMKSTNM+CLTP+ ALSG+C FLSAN+YARS+FGED
Sbjct: 820 TEFEWENRVNVTTDISDLRQYLAHIMKSTNMACLTPDAALSGECDFLSANLYARSVFGED 879

Query: 602 ALANISIEK-QTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           ALAN+SIEK +  G I GHVRIRSKTQGIALSLGDKITL+QK
Sbjct: 880 ALANLSIEKVEGTGHIQGHVRIRSKTQGIALSLGDKITLSQK 921



>gi|310801161|gb|EFQ36054.1| hypothetical protein GLRG_11198 [Glomerella graminicola M1.001]
          Length = 956

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/617 (62%), Positives = 480/617 (77%), Gaps = 1/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++N++EVV+ LKKELSKT+DQ+YEKN EYRQLLI +IH C
Sbjct: 328 SSPDIDVRRKALDIALEMVSSKNIEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHTIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR  I ++L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSAVDVINFVKEVVEKFPKLRKPIVQRLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    +DI +AWK IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEERDIRDAWKSIRSSLGEIPILASEQRLLDGDGEEENNEQVNG 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  + SR++LADGTYATETA +S S+  AKLEA+KAA KPPLR L+L GD+YL +V
Sbjct: 508 HSKPTAPTGSRKVLADGTYATETALTSQSTVAAKLEAVKAAQKPPLRQLILDGDYYLATV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L++TL KLV+R++ IS +  +TNALR EAMLIM SIIRVGQSQF   PIDEDS DRIMSC
Sbjct: 568 LSATLVKLVMRHAEISAEAARTNALRGEAMLIMISIIRVGQSQFVKAPIDEDSIDRIMSC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + + +  +++V+L DTR AF  +V                   +QVDD++  RQ 
Sbjct: 628 VRSLAEFAQNKELETVYLDDTRKAFRAMVQAEEKKKAAKEAVEKAKTAIQVDDVVQIRQL 687

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SK+N  D  D+ E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 688 SKKNASDGLDDVEVDLERATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV 747

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT +TLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVIF
Sbjct: 748 LDVLLVNQTMDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIF 807

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 808 GNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAKS 867

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +M +TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 868 LRDFLEQLMAATNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPIT 927

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 928 GFVRIRSRSQGLALSLG 944



>gi|67518019|ref|XP_658781.1| hypothetical protein AN1177.2 [Aspergillus nidulans FGSC A4]
 gi|40747139|gb|EAA66295.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 gi|259488505|tpe|CBF87992.1| TPA: Coatomer subunit beta, putative (Eurofung) [Aspergillus
           nidulans FGSC A4]
          Length = 950

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 484/617 (78%), Gaps = 5/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKELSKT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVMLLKKELSKTVDEQYEKNSEYRQLLIQSIHNC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI  +L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIVNRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEESDIREAWKKIRASLGEIPILASEQRLLEEVPEDTLPKEQIN 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                   S+ ++LADGTYATE+A +S S+  A+L+A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 GH----GKSAPKVLADGTYATESALTSQSAAAARLQAVKAAQKPPLRQLILDGDYYLATV 563

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F + PIDEDS DRIM+C
Sbjct: 564 LSSTLTKLVMRHSEVSEDSARTNALRAEAMLIMISIIRVGQSPFVAAPIDEDSVDRIMTC 623

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQF
Sbjct: 624 VRSLAEFSERKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKTAVQIDDAIPIRQF 683

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 684 AKKSALEGAEEIELDLAKATGGDSAVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDIV 743

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVIF
Sbjct: 744 LDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVIF 803

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 804 GNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAKS 863

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +M+STNM+CLTPE +L+GDC FLSAN+YARS+FGEDALAN+SIEK+  DG +T
Sbjct: 864 LRDFLKQLMESTNMACLTPEASLTGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPVT 923

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 924 GFVRIRSRSQGLALSLG 940



>gi|303320261|ref|XP_003070130.1| Coatomer beta subunit, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240109816|gb|EER27985.1| Coatomer beta subunit, putative [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 952

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/617 (64%), Positives = 479/617 (77%), Gaps = 2/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIVDFNNNSAVDVITFVKEVVEKFPQLRQSILERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LW+VGEY     DI EAWK+IR  LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGVLWVVGEYSLEQNDIREAWKRIRTSLGEIPILASEQRLLDEDSDETAENNEQL 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  SS  ++LADGTYA ETA +S S+  AKLEAIKAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHP-KPSSGPKVLADGTYAQETALTSQSAAAAKLEAIKAARKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM S+IRVGQSQF    IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSEVSQDVARTNALRAEAMLIMISVIRVGQSQFVKAHIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    +++ FL DTR AF  +V                   VQVDD I  RQF
Sbjct: 627 VRSLAEFTERKDLETTFLEDTRQAFRAMVQVEEKKRATKEAVEKAKAAVQVDDAIPIRQF 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +KR+ GDE DE ELDL +ATG   + +D+ SKLS+VVQLTG+SD VYAEAYVNVHQ+DI+
Sbjct: 687 AKRSGGDEGDEIELDLAKATGGDSTVEDISSKLSKVVQLTGYSDAVYAEAYVNVHQFDIV 746

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 747 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 806

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDGP ++ES+ V+LNDI  DIMDYI P  C ETQFRSMWTEFEWENKVNV++    
Sbjct: 807 GNVVYDGPSSTESHVVILNDIKADIMDYIQPGSCTETQFRSMWTEFEWENKVNVHSKGKS 866

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  IM+ TNMSCLTPE +L GDC FLSAN+YA+SIFGEDALAN+SIEK+  +G IT
Sbjct: 867 LRGFLQQIMERTNMSCLTPEASLEGDCQFLSANLYAKSIFGEDALANVSIEKEGEEGPIT 926

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 927 GFVRIRSRSQGLALSLG 943



>gi|320031983|gb|EFW13940.1| coatomer beta subunit [Coccidioides posadasii str. Silveira]
          Length = 952

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/617 (64%), Positives = 479/617 (77%), Gaps = 2/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIVDFNNNSAVDVITFVKEVVEKFPQLRQSILERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LW+VGEY     DI EAWK+IR  LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGVLWVVGEYSLEQNDIREAWKRIRTSLGEIPILASEQRLLDEDSDETAENNEQL 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  SS  ++LADGTYA ETA +S S+  AKLEAIKAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHP-KPSSGPKVLADGTYAQETALTSQSAAAAKLEAIKAARKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM S+IRVGQSQF    IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSEVSQDVARTNALRAEAMLIMISVIRVGQSQFVKAHIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    +++ FL DTR AF  +V                   VQVDD I  RQF
Sbjct: 627 VRSLAEFTERKDLETTFLEDTRQAFRAMVQVEEKKRATKEAVEKAKAAVQVDDAIPIRQF 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +KR+ GDE DE ELDL +ATG   + +D+ SKLS+VVQLTG+SD VYAEAYVNVHQ+DI+
Sbjct: 687 AKRSGGDEGDEIELDLAKATGGDSTVEDISSKLSKVVQLTGYSDAVYAEAYVNVHQFDIV 746

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 747 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 806

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDGP ++ES+ V+LNDI  DIMDYI P  C ETQFRSMWTEFEWENKVNV++    
Sbjct: 807 GNVVYDGPSSTESHVVILNDIKADIMDYIQPGSCTETQFRSMWTEFEWENKVNVHSKGKS 866

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  IM+ TNMSCLTPE +L GDC FLSAN+YA+SIFGEDALAN+SIEK+  +G IT
Sbjct: 867 LRGFLQQIMERTNMSCLTPEASLEGDCQFLSANLYAKSIFGEDALANVSIEKEGEEGPIT 926

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 927 GFVRIRSRSQGLALSLG 943



>gi|321260991|ref|XP_003195215.1| ER to Golgi transport-related protein [Cryptococcus gattii WM276]
 gi|317461688|gb|ADV23428.1| ER to Golgi transport-related protein, putative [Cryptococcus
           gattii WM276]
          Length = 952

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/643 (61%), Positives = 493/643 (76%), Gaps = 6/643 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+EV+RKA+ IALE+V++RNV+EVV+FLKK+L  TLDQ +
Sbjct: 309 KHENVLDGMVMDILKVLSSPDMEVKRKAIGIALEMVSSRNVEEVVLFLKKQLQGTLDQGF 368

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           +KN EYRQLLIQSIH CAI+FSEVAANVV+VLM+FLGDSNNP+AVDVIAFVREVVEKFP 
Sbjct: 369 DKNLEYRQLLIQSIHSCAIRFSEVAANVVYVLMDFLGDSNNPSAVDVIAFVREVVEKFPK 428

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR++ITEKL+ TF ++KSGKVFRGA+WIVGEYC   +DI++A  +I+  LGEIPILASEQ
Sbjct: 429 LRTAITEKLISTFGEIKSGKVFRGAMWIVGEYCEQPEDIKQAIAEIQKVLGEIPILASEQ 488

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                    T++  R+LADGTYATET ++S++S  A+LEA+++A K
Sbjct: 489 RLLDEAEAADETPAEQQEQPKAITTT--RVLADGTYATETVYTSSASA-ARLEAVRSASK 545

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGI-SEDPKKTNALRAEAMLIMASIIRVGQS 300
           PPLRSL+L GDF+ GSVLASTLTKLVLRYS + S D +  N LRA+A+LIM S+IRVGQS
Sbjct: 546 PPLRSLILGGDFFTGSVLASTLTKLVLRYSEVASSDQQSINVLRAQAILIMTSVIRVGQS 605

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           +FA+ PIDED+ +RIM+C+  L ++    ++  VFL DT+AA+A++V             
Sbjct: 606 KFAAVPIDEDAEERIMNCIETLAELQGSKALHQVFLRDTKAAYAKMVATEEKKALEKKER 665

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 VQ DDL+ FRQ SK++   + DE + D+ +ATG    +DD +SKLSR+ QLTGF
Sbjct: 666 ESKVSVVQADDLLSFRQLSKKSAAGDVDESD-DIVKATGSIHPQDDFVSKLSRITQLTGF 724

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SDPVYAE  V + QYDI+LDVL+VN T+ETLQNL ++FATLGDLKLVERP    LAPH F
Sbjct: 725 SDPVYAETVVTLSQYDIILDVLLVNTTNETLQNLMVDFATLGDLKLVERPAPFTLAPHGF 784

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRS 539
           HS+ AT+KVSSTETGVIFG I Y   G S+++  +V++DIH+DIM +I P Y NE QFRS
Sbjct: 785 HSLSATVKVSSTETGVIFGAITYSKQGASDADVTIVMSDIHVDIMSFIKPNYVNEAQFRS 844

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MWTEFEWENKV V T+I+DLR YL H++KST+M+ LTPE ALSGDC FLSAN+ A+S+FG
Sbjct: 845 MWTEFEWENKVAVQTSISDLRAYLDHLLKSTHMALLTPEAALSGDCDFLSANLAAKSLFG 904

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           EDALAN SIE+  DG ITGHVRIRSKTQGIALSLGDKITL+QK
Sbjct: 905 EDALANASIERTEDGHITGHVRIRSKTQGIALSLGDKITLSQK 947



>gi|346326497|gb|EGX96093.1| coatomer beta subunit [Cordyceps militaris CM01]
          Length = 956

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/618 (63%), Positives = 478/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEK+ EYR LLI SIH C
Sbjct: 328 SSTDIDVRKKALEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKSAEYRSLLIYSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LMEF+ D NN +AVDVI FV+EVVEKFP LR+ I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMEFITDFNNASAVDVINFVKEVVEKFPALRTVIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LWI+GEY    KDI +AW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGILWIIGEYSLEEKDIRDAWRRIRASLGEIPILASEQRLLEEQDGDGNAEQQPN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S SS  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GESKPAAPTGSRKVLADGTYATETALTSQSSVAARLEAVKAAQKPPLRQLVLEGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+S  S D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHSETSSDMSRTNALRAEAMLIMISILRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++V+L DTR AF  +V                   VQVDD+I  RQ
Sbjct: 628 CVRSLAEFSEKKELEAVWLDDTRKAFKAMVLVEEKKRAAKEAHEKAKSAVQVDDVIQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNASDGLDEIEVDLERATGGDSTTEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 TLREFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
            G VRIRS++QG+ALSLG
Sbjct: 928 IGFVRIRSRSQGLALSLG 945



>gi|400592789|gb|EJP60849.1| coatomer beta subunit [Beauveria bassiana ARSEF 2860]
          Length = 956

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/618 (63%), Positives = 476/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRKKALEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNAEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR+ I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFVTDFNNASAVDVINFVKEVVEKFPALRTIIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LWI+GEY    KDI +AW++IRA LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGILWIIGEYSLEEKDIRDAWRRIRASLGEIPILASEQRLLEEQDGDEKELQQPN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR+ILADGTYATETA +S SS  AKLE +KA  KPPLR L+L GD+YL +
Sbjct: 508 GESKPAAPTGSRKILADGTYATETALTSQSSAAAKLEVVKATQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+S L KLV+R+S  S D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSALVKLVMRHSETSSDKSRTNALRAEAMLIMISILRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++V+L DTR AF  +V                   VQVDD+I  RQ
Sbjct: 628 CVRSLAEFSEKKDLEAVWLDDTRKAFKAMVLVEERKRAAKEAHEKAKSAVQVDDVIQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LAKKNASDGLDEIEVDLERATGGDSTAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAN 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIE++  DG I
Sbjct: 868 TLREFLDQLMACTNMSCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEQEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|346973212|gb|EGY16664.1| coatomer subunit beta [Verticillium dahliae VdLs.17]
          Length = 958

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 478/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL + L++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSPDIDVRRKALNLVLDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR  I  +L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFVADFNNASAVDVINFVKEVVEKFPKLRKPIVARLVATLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY  +  D+ +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLDEGDVRDAWKRIRASLGEIPILASEQRLLDDNDDEKKEEEQVN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHSKPAAPSGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL++TLTKLV+R++ IS+D  +TNALR EAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSATLTKLVMRHAQISKDTARTNALRGEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
            +  L + +    I++V+L DTR AF  +V                   +QVDD++  RQ
Sbjct: 628 GVRSLSEFTQHKQIETVYLDDTRKAFRAMVQAEEKKRAAKEAVEKAKTAIQVDDVVQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SK+N G   DE ++DL RATG   + +DL SKLSRVVQLTGFSDPVYAE YV VHQ+DI
Sbjct: 688 LSKKNAGSGVDEIDVDLERATGGESAAEDLSSKLSRVVQLTGFSDPVYAETYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQTSETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTSETLQNLSVEFATLGDLKVVERPTTQNLGPHGFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDVHVDIMDYIQPASCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GAI 616
            LR++L  +M +TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIE+  + G I
Sbjct: 868 TLRDFLEQLMAATNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEQDGEQGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|119184223|ref|XP_001243039.1| hypothetical protein CIMG_06935 [Coccidioides immitis RS]
 gi|392865939|gb|EAS31792.2| coatomer beta subunit [Coccidioides immitis RS]
          Length = 952

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/617 (63%), Positives = 478/617 (77%), Gaps = 2/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIVDFNNNSAVDVITFVKEVVEKFPQLRQSILERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LW+VGEY     DI EAWK+IR  LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGVLWVVGEYSLEQNDIREAWKRIRTSLGEIPILASEQRLLDEDSDETAENNEQL 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  SS  ++LADGTYA ETA +S S+  AKLEAIKAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHP-KPSSGPKVLADGTYAQETALTSQSAAAAKLEAIKAARKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KLV+R+S +S+D  +TNALRAEAMLIM S+IRVGQSQF    IDEDS DRIMSC
Sbjct: 567 LSSTLAKLVMRHSEVSQDVARTNALRAEAMLIMISVIRVGQSQFVKAHIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    +++ FL DTR AF  +V                   VQVDD I  RQF
Sbjct: 627 VRSLAEFTERKELETTFLEDTRQAFRAMVQVEEKKRATKEAVEKAKAAVQVDDAIHIRQF 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +KR+ GDE DE ELDL +ATG   + +D+ SKLS+VVQLTG+SD VYAEAYVNVHQ+DI+
Sbjct: 687 AKRSGGDEGDEIELDLAKATGGDSTVEDISSKLSKVVQLTGYSDAVYAEAYVNVHQFDIV 746

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 747 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 806

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDGP ++ES+ V+LNDI  DIMDYI P  C ETQFRSMWTEFEWENKVNV++    
Sbjct: 807 GNVVYDGPSSTESHVVILNDIKADIMDYIQPGSCTETQFRSMWTEFEWENKVNVHSKGKS 866

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  IM+ TNMSCLTPE +L GDC FLSAN+YA+SIFGEDALAN+SIEK+  +G IT
Sbjct: 867 LRGFLQQIMERTNMSCLTPEASLEGDCQFLSANLYAKSIFGEDALANVSIEKEGEEGPIT 926

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 927 GFVRIRSRSQGLALSLG 943



>gi|477532473|gb|ENH84094.1| coatomer beta subunit [Colletotrichum orbiculare MAFF 240422]
          Length = 956

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/617 (61%), Positives = 477/617 (77%), Gaps = 1/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYRQLLI SIH C
Sbjct: 328 SSTDIDVRRKALGIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR  I ++L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNTSAVDVINFVKEVVEKFPKLRKPIVQRLVATLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    +DI +AW+ IR+ LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIIGEYSLEERDIRDAWRSIRSSLGEIPILASEQRLLDGDGEEENKEQVNG 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  + SR++LADGTYATETA +S S+  AKLEA+KAA KPPLR L+L GD+YL +V
Sbjct: 508 HSKPSQPTGSRKVLADGTYATETALTSQSAVAAKLEAVKAAQKPPLRQLILDGDYYLATV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L++TL KLV+R++ IS +  +TNALR EAMLIM SIIRVGQSQF   PIDEDS DRIMSC
Sbjct: 568 LSATLVKLVMRHAEISAESARTNALRGEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMSC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    +++V+L DTR AF  +V                   +QVDD++  RQ 
Sbjct: 628 VRSLAEFTQHKELETVYLDDTRKAFRAMVQAEEKKRAAKEAVEKAKTAIQVDDVVQIRQL 687

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           SK+N  D  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI+
Sbjct: 688 SKKNATDGLDEVEVDLERATGGEATSEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV 747

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVIF
Sbjct: 748 LDVLLVNQTMETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIF 807

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+    
Sbjct: 808 GNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAKS 867

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR++L  +M +TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIE++  DG I 
Sbjct: 868 LRDFLEQLMAATNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEQEGEDGPIV 927

Query: 618 GHVRIRSKTQGIALSLG 634
           G VRIRS++QG+ALSLG
Sbjct: 928 GFVRIRSRSQGLALSLG 944



>gi|388583435|gb|EIM23737.1| Coatomer, beta subunit [Wallemia sebi CBS 633.66]
          Length = 951

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/631 (61%), Positives = 487/631 (77%), Gaps = 11/631 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD++V++K ++I LE++ +RNV ++V +LK EL KT   QD+E+N EYRQLLIQSIH 
Sbjct: 323 SAPDLQVKKKVIKIILEMINSRNVDQIVDYLKNELLKTTSSQDFERNVEYRQLLIQSIHT 382

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
            +IK+S+VA++VV  LM FLGDSNNP+AVDVI+FVR+VVEKFP+LR +I ++L ETF DV
Sbjct: 383 ISIKYSQVASSVVDTLMRFLGDSNNPSAVDVISFVRQVVEKFPSLRQTIIKRLFETFSDV 442

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KSGKVFRGALWI+GEYC    DI+ A++++R  +G IPILA+EQ+               
Sbjct: 443 KSGKVFRGALWIIGEYCEQTDDIKMAFEKVRLVIGSIPILAAEQKAYDEQDYQNTNEENG 502

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 TT    ++LADGTYATET  SS +   ++L A+KAA KPPLR L+L+GDFY  S
Sbjct: 503 QEQLITTT----KVLADGTYATETKVSS-AEDASRLAAVKAASKPPLRGLILNGDFYTAS 557

Query: 258 VLASTLTKLVLRYSGISE-DPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           VLASTLTKLV+R S     +  + N+++AEAMLIM SIIRVGQS+F S  IDEDS +RI+
Sbjct: 558 VLASTLTKLVMRLSTNQNLEANELNSIKAEAMLIMTSIIRVGQSKFVSTQIDEDSAERIL 617

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L   +   S K +FL+DT+AA+++++                   VQ DDLI FR
Sbjct: 618 SCVQALADEAASNSFKDIFLNDTKAAYSKMIHIEEEKVKEKNIKDSKVVKVQPDDLIAFR 677

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           QF K+ +  +  E+ELDLTRATG  + +DD +SKL R+VQLTGFSD +YAEAYVN+HQ+D
Sbjct: 678 QFKKKTVDLDTKEFELDLTRATGADELKDDFMSKLQRIVQLTGFSDTIYAEAYVNIHQFD 737

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVLIVNQT  T+QNL+IEFATLGDLKLVERP+   L PH+FH+VKAT+KVSSTETGV
Sbjct: 738 IILDVLIVNQTGNTMQNLNIEFATLGDLKLVERPSTLTLGPHAFHNVKATVKVSSTETGV 797

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI YDGPG +ES  +VLNDIH+DIMDYI PAYCNE QFRSMW+EFEWENKV+VNT+I
Sbjct: 798 IFGNIGYDGPGAAESTNIVLNDIHVDIMDYIKPAYCNEAQFRSMWSEFEWENKVHVNTSI 857

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ----T 612
           +DLR YL HIMKSTNMSCLTPE ++SG+CGFLSANMYARS+FGEDALANIS+EK      
Sbjct: 858 SDLRLYLKHIMKSTNMSCLTPEASMSGECGFLSANMYARSVFGEDALANISLEKNEEGVN 917

Query: 613 DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DG I GHVRIRSKTQGIALSLGDKI+LAQK+
Sbjct: 918 DGVIQGHVRIRSKTQGIALSLGDKISLAQKS 948



>gi|358389359|gb|EHK26951.1| adaptor protein [Trichoderma virens Gv29-8]
          Length = 963

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/618 (62%), Positives = 476/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL +AL +V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 334 SSTDIDVRKKALELALAMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 393

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D  N +AVDVI FV+EVVEKFP LR++I  +L+ T  +V+
Sbjct: 394 AIKFSEVAASVVELLMDFIADFTNTSAVDVINFVKEVVEKFPELRTTIVRRLVSTLSEVR 453

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY    KDI +AWK IRA LGEIPI+ASEQRLL              
Sbjct: 454 AGKVYRGILWIIGEYSLEEKDIRDAWKGIRASLGEIPIVASEQRLLEEQDGDEKKDDQTN 513

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 514 GNSKPSAPTGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLST 573

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+S IS +  +TNAL+AEAMLIM SIIRVGQSQF   PIDEDS DRIM+
Sbjct: 574 VLSSTLVKLVMRHSEISAEQARTNALKAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMA 633

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   +QVDD+I  RQ
Sbjct: 634 CVRSLAEFKEKKELEAVWLDDTRKAFRAMVQVEETKRAAKEAREKAKTAIQVDDVIPIRQ 693

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SK+N  D  DE E+DL RATG     +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 694 LSKKNATDGQDEIEMDLERATGGEGGAEDLTSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 753

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 754 ILDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 813

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 814 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 873

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 874 SLREFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 933

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 934 TGFVRIRSRSQGLALSLG 951



>gi|367022052|ref|XP_003660311.1| hypothetical protein MYCTH_2298462 [Myceliophthora thermophila ATCC
           42464]
 gi|347007578|gb|AEO55066.1| hypothetical protein MYCTH_2298462 [Myceliophthora thermophila ATCC
           42464]
          Length = 959

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/620 (62%), Positives = 485/620 (78%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL IALE+++++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 327 SSTDIDVRKKALDIALEMISSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP+LR +I+++L++T  +V+
Sbjct: 387 AVKFSEVAASVVDLLMDFIADFNNASAVDVINFVKEVVEKFPSLRPAISQRLVDTLREVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY  + KDI +AWK IRA LGEIPILASEQRLL              
Sbjct: 447 AGKVYRGILWIIGEYSLDEKDIRDAWKGIRASLGEIPILASEQRLLDNMDNEEENKGEEQ 506

Query: 199 XX--XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                      SR++LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL 
Sbjct: 507 VNGHPKPNPGGSRKVLADGTYATETALTSQSAAAARLEAVKASSKPPLRQLILDGDYYLA 566

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VLA+TLTKLV+R+S IS +  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM
Sbjct: 567 TVLAATLTKLVMRHSEISSEEARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIM 626

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      +++V+L DTR AF  +V                   VQVDD++  R
Sbjct: 627 SCVRSLAEFKEHKQLETVYLEDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVAIR 686

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N  D AD  ELDL RATG  + + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 687 QLSKKNAVDGADAIELDLERATGGDSSASEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 746

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT++TLQNL++EFATLGDLK+VERPT  NL PH F +V+ TIKVSST+TG
Sbjct: 747 DIILDVLLVNQTTDTLQNLTVEFATLGDLKVVERPTSQNLGPHDFQNVQCTIKVSSTDTG 806

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VY+G  ++++N V+LND+H+DIMDYI PA C+ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 807 VIFGNVVYEGAHSTDTNVVILNDLHVDIMDYIQPATCSETQFRTMWTEFEWENKVNINSK 866

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LR++L  +M  TNM+CLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 867 AKSLRDFLDQLMACTNMNCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDG 926

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG +RIRS++QG+ALSLG
Sbjct: 927 PITGFLRIRSRSQGLALSLG 946



>gi|336266400|ref|XP_003347968.1| hypothetical protein SMAC_07343 [Sordaria macrospora k-hell]
 gi|380088218|emb|CCC05020.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 957

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/619 (62%), Positives = 484/619 (78%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+K L IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 327 SSTDIDVRKKGLEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I  +L+ET  +V+
Sbjct: 387 AIKFSEVAASVVGLLMDFIADFNNNSAVDVINFVKEVVEKFPQLRPAIIARLVETLSEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GK++RG LWI+GEY    KDI +AWK+IRA LGEIPI+ASEQRLL              
Sbjct: 447 AGKIYRGILWIIGEYSLEEKDIRDAWKRIRASLGEIPIVASEQRLLDNVDGDAEEKEKEQ 506

Query: 199 XXXXXTTSS-SRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                  ++ SR++LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL +
Sbjct: 507 VNGSRAAATGSRKVLADGTYATETALTSQSTAAARLEAVKASSKPPLRQLILDGDYYLAT 566

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLASTLTKLV+R++ IS +  +TNALRAEAMLIM S+IRVGQSQF   PIDEDS DRIMS
Sbjct: 567 VLASTLTKLVMRHAEISSEEARTNALRAEAMLIMISVIRVGQSQFVKAPIDEDSVDRIMS 626

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    +++V+L DTR AF  +V                    QVDD+ + RQ
Sbjct: 627 CVRSLAEFTAHKELETVYLEDTRKAFRAMVQVEEKKRAAKEAHQKAKTATQVDDVCLIRQ 686

Query: 378 FSKRNIGDEADEYELDLTRATGQADSR-DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
            SK+N+ D AD ++ DL RATG  +S  +DL  KLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 687 LSKKNVTDGADTFDADLDRATGGDNSAGEDLSGKLSRVVQLTGFSDPVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL++EFATLGDLK+VE+PT  NL PH FH+V+ TIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTVEFATLGDLKVVEKPTSQNLGPHDFHNVQCTIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VY+G  +++++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNVVYEGAHSTDTHVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 867 KSLREFLDLLMASTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG +RIRS++QG+ALSLG
Sbjct: 927 ITGFLRIRSRSQGLALSLG 945



>gi|475673873|gb|EMT70984.1| Coatomer subunit beta [Fusarium oxysporum f. sp. cubense race 4]
          Length = 955

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/618 (63%), Positives = 477/618 (77%), Gaps = 4/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+V+  LM+F+ D NN +AVDVI FV+EVVEKFPNLR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVL--LMDFIADFNNASAVDVINFVKEVVEKFPNLRTTIIERLVSTLGEVR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 446 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHDTEEQTDDHIN 505

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  AKLEA+K A KPPLR L+L GD+YL +
Sbjct: 506 GASKPAAPSGSRKVLADGTYATETALTSQSSAAAKLEAVKTAQKPPLRQLILDGDYYLAT 565

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 566 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 625

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD +  RQ
Sbjct: 626 CVRSLAEFEQKKELEAVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDAVQIRQ 685

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  +  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 686 LAKKNTTEGLDEIEVDLERATGGEGTAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 745

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 746 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 805

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 806 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 865

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 866 SLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 925

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 926 TGFVRIRSRSQGLALSLG 943



>gi|392598141|gb|EIW87463.1| coatomer protein [Coniophora puteana RWD-64-598 SS2]
          Length = 955

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/646 (61%), Positives = 491/646 (76%), Gaps = 11/646 (1%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD- 60
           KH+              +S D+EVRRKA+ I L + ++RNV+EVV+FLKK+L +T +QD 
Sbjct: 310 KHEHVLDGLIMDVLQVLSSADMEVRRKAMAIVLSMTSSRNVEEVVLFLKKQLQRTQEQDA 369

Query: 61  -YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKF 119
            Y+K +EYRQLLIQSIH  A+KFSEVAA+VVH LM+FLGDSNNP+A+DV+AFVREVVEKF
Sbjct: 370 SYDKASEYRQLLIQSIHVMAVKFSEVAASVVHALMDFLGDSNNPSALDVVAFVREVVEKF 429

Query: 120 PNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILAS 179
           P LR  I EKL +T  D+KSGKVFRG LWI+GEY     DI+ A ++IR  LGEIPILAS
Sbjct: 430 PKLRQPICEKLTQTLSDIKSGKVFRGVLWILGEYTEEIGDIQVALQEIRKVLGEIPILAS 489

Query: 180 EQRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAA 239
           EQRLL                   T     ++LADGTYATETA+SS  +T A+LEA+KAA
Sbjct: 490 EQRLLEDAGGEEEEEKEKDAAAAGT--GRPKVLADGTYATETAYSS--TTNARLEAVKAA 545

Query: 240 VKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQ 299
            KPPLR+L+L+GDF+ G+ LASTLTKLVLRY G++ D  + NALRAEAMLIM SIIRVGQ
Sbjct: 546 SKPPLRALILNGDFFTGASLASTLTKLVLRYEGLASDAARANALRAEAMLIMTSIIRVGQ 605

Query: 300 SQFASNPIDEDSYDRIMSCLHILEQIS--TDYSIKSVFLHDTRAAFARIVXXXXXXXXXX 357
           S+F + PIDEDS +RI++C+  L +++      +  +FL DT+AA++R++          
Sbjct: 606 SKFVTIPIDEDSNERILNCIQTLSELADRARAPVNEIFLEDTKAAYSRMLSAQEKKAAEK 665

Query: 358 XXXXX-XXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQ 416
                     VQVDDL+ FRQF+K+   D  D  E DL +ATG  + ++D IS LSR+ Q
Sbjct: 666 KEAESPATAAVQVDDLLSFRQFTKKGADDPIDYIE-DLGKATGAGEVKEDFISNLSRISQ 724

Query: 417 LTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLA 476
           LTGFSDP+YAEAYV +H +DI LDVL+VNQT  TLQNL ++FATLGDLK+VERP+ + +A
Sbjct: 725 LTGFSDPIYAEAYVKMHGFDISLDVLLVNQTPNTLQNLCLDFATLGDLKIVERPSMYTIA 784

Query: 477 PHSFHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQ 536
           PH F S+KATIKVSSTETGVIFG+I+++GP  +ES CV+LNDIHIDIMDYI PAYCNETQ
Sbjct: 785 PHGFQSIKATIKVSSTETGVIFGSILWEGPNLAES-CVILNDIHIDIMDYIKPAYCNETQ 843

Query: 537 FRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARS 596
           FRSMWTEFEWEN+VNV+T ++D R+YL H+MKSTNMSCLTPE A+SGDC FLSANMYARS
Sbjct: 844 FRSMWTEFEWENRVNVSTTMSDPRDYLKHVMKSTNMSCLTPEGAMSGDCDFLSANMYARS 903

Query: 597 IFGEDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           +FGEDALAN+SIE+   G I GHVRIRSKTQGIALSLGD+IT++QK
Sbjct: 904 LFGEDALANLSIERTEGGTIIGHVRIRSKTQGIALSLGDRITMSQK 949



>gi|336471233|gb|EGO59394.1| hypothetical protein NEUTE1DRAFT_79445 [Neurospora tetrasperma FGSC
           2508]
 gi|350292324|gb|EGZ73519.1| putative coatomer complex beta chain [Neurospora tetrasperma FGSC
           2509]
          Length = 957

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/619 (62%), Positives = 481/619 (77%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRK L IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 327 SSTDIDVRRKGLEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I  +L++T  +V+
Sbjct: 387 AIKFSEVAASVVGLLMDFIADFNNNSAVDVINFVKEVVEKFPQLRPAIIARLVDTLSEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GK++RG LWI+GEY    KDI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 447 AGKIYRGILWIIGEYSLEEKDIRDAWKRIRASLGEIPILASEQRLLDNVDGGAEEKEKEQ 506

Query: 199 XX-XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL +
Sbjct: 507 VNGSRAAPTGSRKVLADGTYATETALTSQSTAAARLEAVKASSKPPLRQLILDGDYYLAT 566

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLASTLTKLV+R++ IS +  +TNALRAEAMLIM S+IRVGQSQF   PIDEDS DRIMS
Sbjct: 567 VLASTLTKLVMRHAEISSEEARTNALRAEAMLIMISVIRVGQSQFVKAPIDEDSVDRIMS 626

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    +++V+L DTR AF  +V                    QVDD+   RQ
Sbjct: 627 CVRSLAEFTAHKELETVYLEDTRKAFRAMVQVEEKKRAAKEAHQKAKTATQVDDVYQIRQ 686

Query: 378 FSKRNIGDEADEYELDLTRATGQADSR-DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
            SK+N  D AD ++ DL RATG  +S  +DL  KLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 687 LSKKNATDGADAFDADLERATGGDNSSAEDLSGKLSRVVQLTGFSDPVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL++EFATLGDLK+VE+PT  NL PH FH+V+ TIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTVEFATLGDLKVVEKPTSQNLGPHDFHNVQCTIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VY+G  +++++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNVVYEGAHSTDTHVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 867 KSLREFLDLLMASTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG +RIRS++QG+ALSLG
Sbjct: 927 ITGFLRIRSRSQGLALSLG 945



>gi|85085318|ref|XP_957481.1| coatomer beta subunit [Neurospora crassa OR74A]
 gi|28918573|gb|EAA28245.1| coatomer beta subunit [Neurospora crassa OR74A]
 gi|40882217|emb|CAF06042.1| probable coatomer complex beta chain [Neurospora crassa]
          Length = 957

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/619 (62%), Positives = 481/619 (77%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRK L IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKNNEYRQLLI SIH C
Sbjct: 327 SSTDIDVRRKGLEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNNEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I  +L++T  +V+
Sbjct: 387 AIKFSEVAASVVGLLMDFIADFNNNSAVDVINFVKEVVEKFPQLRPAIIARLVDTLSEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GK++RG LWI+GEY    KDI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 447 AGKIYRGILWIIGEYSLEEKDIRDAWKRIRASLGEIPILASEQRLLDNVDGDAEEKEKEQ 506

Query: 199 XX-XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL +
Sbjct: 507 VNGSRAAPTGSRKVLADGTYATETALTSQSTAAARLEAVKASSKPPLRQLILDGDYYLAT 566

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLASTLTKLV+R++ IS +  +TNALRAEAMLIM S+IRVGQSQF   PIDEDS DRIMS
Sbjct: 567 VLASTLTKLVMRHAEISSEEARTNALRAEAMLIMISVIRVGQSQFVKAPIDEDSVDRIMS 626

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    +++V+L DTR AF  +V                    QVDD+   RQ
Sbjct: 627 CVRSLAEFTAHKELETVYLEDTRKAFRAMVQVEEKKRAAKEAHQKAKTATQVDDVYQIRQ 686

Query: 378 FSKRNIGDEADEYELDLTRATGQADSR-DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
            SK+N  D AD ++ DL RATG  +S  +DL  KLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 687 LSKKNATDGADAFDADLERATGGDNSSAEDLSGKLSRVVQLTGFSDPVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL++EFATLGDLK+VE+PT  NL PH FH+V+ TIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTVEFATLGDLKVVEKPTSQNLGPHDFHNVQCTIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VY+G  +++++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNVVYEGAHSTDTHVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 867 KSLREFLDLLMASTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG +RIRS++QG+ALSLG
Sbjct: 927 ITGFLRIRSRSQGLALSLG 945



>gi|116195722|ref|XP_001223673.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88180372|gb|EAQ87840.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 960

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/620 (62%), Positives = 480/620 (77%), Gaps = 4/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+KAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN+EYRQLLI SIH C
Sbjct: 328 SSPDIDVRKKALEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNSEYRQLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I  +L++T  +V+
Sbjct: 388 AVKFSEVAASVVDLLMDFIADFNNTSAVDVINFVKEVVEKFPALRPAIAHRLVDTLREVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY  + KDI +AWK IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGILWIIGEYSLDEKDIRDAWKGIRASLGEIPILASEQRLLDNMDNDEENQDEGQ 507

Query: 199 XX--XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                  T   SR++LADGTYATETA +S S+  A+LEA+KA+ KPPLR L+L GD+YL 
Sbjct: 508 VNGHAKPTPGGSRKVLADGTYATETALTSQSAAAARLEAVKASSKPPLRQLILDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VLA+TLTKLV+R+S IS +  +TNALRAEAML M SIIRVGQSQF   PIDEDS DRIM
Sbjct: 568 TVLAATLTKLVIRHSEISSEAGRTNALRAEAMLAMISIIRVGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      +++V+L DTR AF  +V                   VQVDD++  R
Sbjct: 628 SCVRSLAEFKEHKELETVYLEDTRKAFRAMVQVEEKKREAKAAFEKAKTAVQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N  D AD  ELDL RA G    + DDL  KLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 688 QLSKKNAVDGADAIELDLERAAGGDTSADDDLSGKLSRVVQLTGFSDPVYAEAYVKVHQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT++TLQNL++EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 748 DIILDVLLVNQTTDTLQNLTVEFATLGDLKVVERPTSQNLGPHDFHNVQCTIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN++Y+G  ++++N V+LND+H+DIMDYI PA C ET+FR+MWTEFEWENKVN+N+ 
Sbjct: 808 VIFGNVIYEGAHSTDTNVVILNDLHVDIMDYIQPATCTETEFRTMWTEFEWENKVNINSK 867

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LRE+L  +M  TNM+CLTP+ +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 868 AKTLREFLDQLMACTNMNCLTPDASLKGDCQFLSANLYARSVFGEDALANLSIEKEGDDG 927

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG +RIRS++QG+ALSLG
Sbjct: 928 PITGFLRIRSRSQGLALSLG 947



>gi|171690972|ref|XP_001910411.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945434|emb|CAP71546.1| unnamed protein product [Podospora anserina S mat+]
          Length = 957

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/619 (62%), Positives = 479/619 (77%), Gaps = 3/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+KAL IALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN+EYRQLLI SIH C
Sbjct: 327 SSPDIDVRKKALEIALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNSEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VV +LMEF+ D NN +AVDVI FV+EVVEKFP LR +I  +L++T  +V+
Sbjct: 387 AVKFSEVAASVVELLMEFIADFNNASAVDVINFVKEVVEKFPALRPTIVSRLVDTLKEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY    KDI +AWK IRA LGEIPILASEQRLL              
Sbjct: 447 AGKVYRGILWIIGEYSLEEKDIRDAWKGIRASLGEIPILASEQRLLDNMHSEEENKEQEQ 506

Query: 199 XX-XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   ++SR++ ADGTYATETA +S S+  AKLEA+KA+ KPPLR L+L GD+YL S
Sbjct: 507 TNGHPKPAATSRKVNADGTYATETALTSQSAAAAKLEAVKASQKPPLRQLILDGDYYLAS 566

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLASTLTKLV+RYS +     +TNAL+AEAMLIM S+IRVGQSQF   PIDEDS DRIMS
Sbjct: 567 VLASTLTKLVMRYSEVGSAESRTNALKAEAMLIMISVIRVGQSQFVKAPIDEDSVDRIMS 626

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   +QVDD++  RQ
Sbjct: 627 CVRSLAEFKQHKELETVYLEDTRKAFRAMVQVEEKKREAKAAHEKAKSAIQVDDVVSIRQ 686

Query: 378 FSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
            SK+N G   D  ELDL RA G  + + +DL  KLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 687 LSKKNTGGGEDTVELDLERAAGGDSGAGEDLSGKLSRVVQLTGFSDPVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  +L PH FH+V+ TIKVSST+TGV
Sbjct: 747 IILDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTSQSLGPHDFHNVQCTIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VY+G  ++++N V+LND+H+DIMDYI PA C+ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNVVYEGAHSTDTNVVILNDLHVDIMDYIQPATCSETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGA 615
             LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG 
Sbjct: 867 KTLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG +RIRS++QG+ALSLG
Sbjct: 927 ITGFLRIRSRSQGLALSLG 945



>gi|358395440|gb|EHK44827.1| hypothetical protein TRIATDRAFT_131893 [Trichoderma atroviride IMI
           206040]
          Length = 957

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/618 (61%), Positives = 474/618 (76%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL ++L +V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI +IH C
Sbjct: 328 SSTDIDVRKKALELSLSMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHTIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D  N AAVDVI FV+EVVEKFP LR +I  +L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFKNTAAVDVINFVKEVVEKFPELRPTIVRRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY    KDI +AWK IRA LGEIPI+ASEQRLL              
Sbjct: 448 AGKVYRGILWIIGEYSLEEKDIRDAWKGIRASLGEIPIVASEQRLLEEQDSDEKNEEQTN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GSSKPAAPTGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLST 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R++ IS +  +TNAL+AEAMLIM SIIR GQSQF   PIDEDS DRIM+
Sbjct: 568 VLSSTLVKLVMRHAEISAEKARTNALKAEAMLIMISIIRAGQSQFVKAPIDEDSVDRIMA 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    +++V+L DTR AF  +V                   +QVDD+I  RQ
Sbjct: 628 CVRSLAEFTEKKELEAVWLDDTRKAFRAMVQVEESKRAAQEAHEKAKTAIQVDDIIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SK+N  +  DE E+DL RATG     +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LSKKNATEGLDEIEMDLERATGGEGGAEDLTSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 ILDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|115491503|ref|XP_001210379.1| coatomer beta subunit [Aspergillus terreus NIH2624]
 gi|114197239|gb|EAU38939.1| coatomer beta subunit [Aspergillus terreus NIH2624]
          Length = 955

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/618 (63%), Positives = 483/618 (78%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+E+V+ LKKEL+KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEMVSSKNVEEIVMLLKKELAKTVDEQYEKNSEYRQLLIQSIHSC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR +I ++L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRGAIVQRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIREAWKRIRASLGEIPILASEQRLLEEVPEESVLKEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+L A+KAA KPPLR L+L GDFYL +
Sbjct: 508 GHAKPSAPTGSRKVLADGTYATESALTSESAAAARLAAVKAAQKPPLRQLILDGDFYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DRIM 
Sbjct: 568 VLSSTLTKLVMRHSEVSEDAARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRIMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQ
Sbjct: 628 CVRSLAEFSEKKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQIDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K+N  + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FAKKNALEGAEEIELDLAKATGGESTVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTVETLQNLSVEFATLGDLKVVERPTTHNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M STNM+CLTP+ +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLKQLMDSTNMACLTPDASLKGDCRFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|340515085|gb|EGR45342.1| coatamer complex, beta subunit [Trichoderma reesei QM6a]
          Length = 957

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 475/618 (76%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VR+KAL +AL +V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRKKALELALAMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D  N +AVDVI FV+EVVEKFP LR+ I  +L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMDFIADFTNTSAVDVINFVKEVVEKFPELRTKIVHRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LWI+GEY    KDI +AWK IRA LGEIPI+ASEQRLL              
Sbjct: 448 AGKVYRGILWIIGEYSLEEKDIRDAWKGIRASLGEIPIVASEQRLLEEQDGDDNKDDQTN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHSKPSAPTGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLST 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+S IS +  +TNAL+AEAMLIM SIIRVGQSQF   PIDEDS DRIM+
Sbjct: 568 VLSSTLVKLVMRHSEISAEHARTNALKAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMA 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + +    ++ V+L DTR AF  +V                   +QVDD+I  RQ
Sbjct: 628 CVRSLAEFTQRKELEEVWLDDTRKAFRAMVQVEESKRAAKEAREKAKTAIQVDDVIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SK+N  +  DE E+DL RATG     +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LSKKNATEGLDEIEMDLERATGGEGGAEDLTSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 ILDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|340960441|gb|EGS21622.1| coatomer subunit beta-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 959

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/621 (61%), Positives = 482/621 (77%), Gaps = 5/621 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V+++NV+EVV+ LKKELSKT++Q+YEKN+EYRQLLI SIH C
Sbjct: 327 SSPDIDVRRKALEIALEMVSSKNVEEVVLLLKKELSKTVEQEYEKNSEYRQLLIHSIHQC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KFSEVAA+VV +LM+F+ D NN +AVDVI F +EVVE+FPNLR SI ++L++T  +V+
Sbjct: 387 AVKFSEVAASVVDLLMDFIADFNNASAVDVINFAKEVVERFPNLRPSIVQRLVDTLKEVR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW +GEY    KDI+EAWK IRA LGEIPILASEQRLL              
Sbjct: 447 AGKVYRGILWTIGEYALEEKDIKEAWKGIRASLGEIPILASEQRLLENMENEEENKEQEQ 506

Query: 199 XX---XXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                     + SR++LADGTYATETA +S ++  A+LEA+KA+ KPPLR L+L GD+YL
Sbjct: 507 QVNGHSKPAPAGSRKVLADGTYATETALTSQAAAQARLEAVKASQKPPLRQLILDGDYYL 566

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            +VLASTLTKLV+R++ IS +  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRI
Sbjct: 567 ATVLASTLTKLVMRHAEISSEAARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRI 626

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           MSC+  L +      ++ V+L DT+ AF  +V                   VQVDD++  
Sbjct: 627 MSCVRSLAEFQDHKQLEQVYLEDTKKAFRAMVQVEEKKRAAKEAYEKAKTAVQVDDVVPI 686

Query: 376 RQFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQ 434
           RQ SK+N  D  D +E+DL +ATG  + + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ
Sbjct: 687 RQLSKKNAVDGVDPFEVDLEKATGGDSSTSEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQ 746

Query: 435 YDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTET 494
           +DI+LDVL+VNQT +TLQNL++EFATLGDLK+VERPT  +L PH FH+V+ TIKVSST+T
Sbjct: 747 FDIILDVLLVNQTMDTLQNLTVEFATLGDLKVVERPTSQSLGPHDFHNVQCTIKVSSTDT 806

Query: 495 GVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNT 554
           GVIFGN+VY+G  +++++ V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+
Sbjct: 807 GVIFGNVVYEGAHSTDTHVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINS 866

Query: 555 NITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TD 613
               LRE+L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  D
Sbjct: 867 KAKSLREFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGED 926

Query: 614 GAITGHVRIRSKTQGIALSLG 634
           G ITG +RIRS++QG+ALSLG
Sbjct: 927 GPITGFLRIRSRSQGLALSLG 947



>gi|258568962|ref|XP_002585225.1| coatomer beta subunit [Uncinocarpus reesii 1704]
 gi|237906671|gb|EEP81072.1| coatomer beta subunit [Uncinocarpus reesii 1704]
          Length = 953

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/618 (62%), Positives = 477/618 (77%), Gaps = 3/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEK-NNEYRQLLIQSIHG 77
           +SPDI+VRRKAL IALE+V ++NV+E+V+ LKKEL+KT+D+ YEK NNEYRQLLIQSIH 
Sbjct: 328 SSPDIDVRRKALGIALEMVASKNVEEIVLLLKKELAKTVDEQYEKVNNEYRQLLIQSIHQ 387

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           CAIKFSE+AA+VV +LM+F+ D NN +A+DVI FV+EVVEKFP LR SI E+L+ T  +V
Sbjct: 388 CAIKFSEIAASVVDLLMDFIADFNNNSAIDVITFVKEVVEKFPKLRHSILERLVSTLSEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++G+V+RG LW++GEY     DI EAWK+IRA LGEIPILASEQRLL             
Sbjct: 448 RAGRVYRGVLWVIGEYSLEQNDIREAWKRIRASLGEIPILASEQRLLDEDSDESKEAKEQ 507

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   SS  ++LADGTYA ETA +S S+  AKLEA+KAA KPPLR L+L GD++L +
Sbjct: 508 VNGHP-KASSGPKVLADGTYAQETALTSQSAAAAKLEAVKAAQKPPLRQLILDGDYFLAT 566

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SI+RVGQS F    IDEDS DRIMS
Sbjct: 567 VLSSTLTKLVMRHSELSQDAARTNALRAEAMLIMISIVRVGQSPFVKTNIDEDSVDRIMS 626

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           CL  L + +    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 627 CLRSLAEFTERKELETTFLEDTRQAFRAMVQVEEKKRATREAMEKAKTAVQVDDAISIRQ 686

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F++++ GD+ DE ELDL +ATG   + +DL SKLS+VVQLTG+SD VYAEAYVNVHQ+DI
Sbjct: 687 FTRKSAGDDGDEIELDLAKATGGDSAVEDLSSKLSKVVQLTGYSDAVYAEAYVNVHQFDI 746

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVI
Sbjct: 747 ILDVLLVNQTMETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVI 806

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVNV +   
Sbjct: 807 FGNVVYDGSSSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNVQSKGK 866

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR +L  IM+ TNMSCLTPE +L GDC FLSAN+YA+SIFGEDALAN+SIEK+  DG I
Sbjct: 867 SLRGFLQQIMERTNMSCLTPEASLEGDCQFLSANLYAKSIFGEDALANVSIEKEGEDGPI 926

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 927 TGFVRIRSRSQGLALSLG 944



>gi|255937485|ref|XP_002559769.1| Pc13g13550 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584389|emb|CAP92424.1| Pc13g13550 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 955

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/618 (60%), Positives = 482/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL +A+E+V+++NV+E+++ LKKEL+KT+D+ YE+N+EYRQ+L+QSIH C
Sbjct: 328 SSPDIDVRRKALNLAMEMVSSKNVEEIIMLLKKELAKTVDEQYEQNSEYRQILVQSIHSC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP+LR SI  +L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPDLRGSIVARLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI +AWK IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIRDAWKTIRASLGEIPILASEQRLLDEVPDDNALLMEQA 507

Query: 199 X-XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGQSKAAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S+D  +TNALRAEAMLIM SI+RVGQS F   PIDEDS DRI++
Sbjct: 568 VLSSTLTKLVMRHSEVSQDTARTNALRAEAMLIMISIMRVGQSHFVKAPIDEDSVDRILT 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQ
Sbjct: 628 CVRSLAEFSEKKELEATFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQIDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K+N  +  +E E+DL +ATG   + +D+ SKLSRVVQLTGFSD VYAEAYV VHQ+DI
Sbjct: 688 FTKKNAVEGGEEIEMDLAKATGGDSTVEDVSSKLSRVVQLTGFSDSVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNL +EFATLGDLK+VERP+ +NL P  F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLCVEFATLGDLKVVERPSTNNLGPRDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M STNM+CLTP+ +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 TLRDFLKQLMDSTNMACLTPDASLKGDCRFLSANLYARSVFGEDALANLSIEKEGDDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|425767560|gb|EKV06129.1| Coatomer subunit beta, putative [Penicillium digitatum PHI26]
 gi|425780363|gb|EKV18371.1| Coatomer subunit beta, putative [Penicillium digitatum Pd1]
          Length = 955

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/618 (61%), Positives = 482/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL +A+E+V+++NV+E+++ LKKEL+KT+D+ YE+N+EYRQ+L+QSIH C
Sbjct: 328 SSPDIDVRRKALNLAMEMVSSKNVEEIIMLLKKELAKTVDEQYEQNSEYRQILVQSIHSC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP+LR SI  +L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPDLRGSIVARLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI +AWK IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEEKDIRDAWKTIRASLGEIPILASEQRLLDEVPDDNALLMEQA 507

Query: 199 X-XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 NGHSKAAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +S D  +TNALRAEAMLIM SI+RVGQS F   PIDEDS DRI++
Sbjct: 568 VLSSTLTKLVMRHSEVSHDTARTNALRAEAMLIMISIMRVGQSHFVKAPIDEDSVDRILT 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQVDD I  RQ
Sbjct: 628 CVRSLAEFSEKKELEATFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQVDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K+N  +  +E E+DL +ATG   + +D+ SKLSRVVQLTGFSD VYAEAYV VHQ+DI
Sbjct: 688 FTKKNAVEGGEEIEMDLAKATGGDSTVEDVSSKLSRVVQLTGFSDSVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNL +EFATLGDLK+VERP+ +NL P  F +V+ATIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLCVEFATLGDLKVVERPSTNNLGPRDFLNVQATIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTENHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M+STNM+CLTP+ +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 TLRDFLKQLMESTNMACLTPDASLKGDCRFLSANLYARSVFGEDALANLSIEKEGDDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|453089945|gb|EMF17985.1| Coatomer, beta subunit [Mycosphaerella populorum SO2202]
          Length = 962

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/622 (61%), Positives = 480/622 (77%), Gaps = 6/622 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD++VR+KAL +A+++V+++NV+EVV+ LKKEL+KT+D+ YEKNNEYR LLI SIH C
Sbjct: 328 SSPDLDVRKKALELAMDMVSSKNVEEVVLLLKKELAKTVDEQYEKNNEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+A +VV +LM+F+ D NN +AVDVI+FV+EVVE+FP +RSSI E+L+ T  +V+
Sbjct: 388 AIKFSEIAQSVVGLLMDFISDFNNASAVDVISFVKEVVERFPKMRSSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG+LWIVGEY    KDI +AWK+IRA LGEIPI+ASEQRLL              
Sbjct: 448 AGKVYRGSLWIVGEYSLEEKDIRDAWKRIRASLGEIPIVASEQRLLDEQPDGEAELNGHT 507

Query: 199 X--XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +SN+S  AKL+A+K+A  PPLR L+L GD++L 
Sbjct: 508 NGDAKAAQPTGSRKVLADGTYATESALTSNASVKAKLDAVKSAQNPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIR GQSQF   PIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHSEISNDAARTNALRAEAMLIMISIIRAGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      ++  FL DTR AF  +V                   +QVDDL+  R
Sbjct: 628 SCVRSLAEFQQKKDLEVAFLDDTRQAFKSMVQVEEKKRAAKEALLQAKNAIQVDDLVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q   +N  D ADE ELDL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLKPKNAIDNADEAELDLEKATGGDATTEDLTSKLSRVVQLTGFSDPVYAEAYVQVHQFD 747

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT +TLQNLS+EFATLGDLK+VERPT  NL    F +V+ATIKVSST+TGV
Sbjct: 748 IILDVLLVNQTRDTLQNLSVEFATLGDLKVVERPTTQNLPGLDFLNVQATIKVSSTDTGV 807

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDGP ++ESN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+NT +
Sbjct: 808 IFGNVVYDGPASTESNVVILNDVHVDIMDYIQPASCTETQFRTMWTEFEWENKVNINTKM 867

Query: 557 ---TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-T 612
              + LR++L  +MK TNMSCLTPE +L G+C FLSAN+YARS+FGEDALAN+S+EK+  
Sbjct: 868 PSGSGLRDFLQRLMKVTNMSCLTPEASLEGECQFLSANLYARSVFGEDALANLSVEKEGE 927

Query: 613 DGAITGHVRIRSKTQGIALSLG 634
           +G +TG +RIRS++QG+ALSLG
Sbjct: 928 NGPVTGFMRIRSRSQGLALSLG 949



>gi|328772205|gb|EGF82244.1| hypothetical protein BATDEDRAFT_19102 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 970

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/646 (60%), Positives = 474/646 (73%), Gaps = 5/646 (0%)

Query: 1   EKHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD 60
           EK+D+             +SPDIEVR++ L I +ELV++RNV EVV FLKKEL KT DQD
Sbjct: 309 EKNDRVLEDQVMDVLRIVSSPDIEVRKRCLNIIMELVSSRNVDEVVTFLKKELIKTHDQD 368

Query: 61  YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFP 120
           YEKNNEYRQ++IQSIH CAIKFSEVA +VVHVLMEFLG+SN  +AVDVIAFVREVVEKFP
Sbjct: 369 YEKNNEYRQMIIQSIHACAIKFSEVADSVVHVLMEFLGESNTASAVDVIAFVREVVEKFP 428

Query: 121 NLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASE 180
            LR  I   LLETF D+++G+VFRGALWI+GEY  +   IEEA+KQIR  +GE+PI+A+E
Sbjct: 429 QLRLPIISHLLETFGDMRTGRVFRGALWIIGEYALDTTTIEEAFKQIRESIGEVPIMAAE 488

Query: 181 QRLLXXXXXXXXXXXXXXXXXXX--TTSSSRRILADGTYATETAFSSNSSTLAKLEAIKA 238
           QRLL                        + RR+LADGTYATE+A ++      +L+  K 
Sbjct: 489 QRLLDEDQETTEVVSPTTPKDKKHDVKPAVRRVLADGTYATESALATTQHN-GRLDTGKL 547

Query: 239 AVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVG 298
           + KPPLR+L+L G++++G+VLA+TLTKL LRY+  + +  ++NA + EAMLIM SIIRVG
Sbjct: 548 SSKPPLRALVLGGEYFVGAVLATTLTKLALRYAQTTNNSPQSNAFKIEAMLIMTSIIRVG 607

Query: 299 QSQFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXX 358
           +S F +  IDEDS  RI  CL +L     +  +   FL D R AF  +V           
Sbjct: 608 RSHFVTAHIDEDSSSRIQGCLRVLSSTPAEPIMVDAFLKDCRNAFTNLVISHEKTKQRKT 667

Query: 359 XXXXXXXTVQVDDLIVFRQFSKRNIGDE-ADEYELDLTRATGQADSRDDLISKLSRVVQL 417
                   +Q DD+I +R    + +G E +DE+E DL RATG AD  D+ +SKL+R++QL
Sbjct: 668 KEKRGVK-IQADDVISYRFLKSKKLGGEGSDEFETDLIRATGSADGNDEYVSKLNRIIQL 726

Query: 418 TGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAP 477
           TGFSDP+YAEAYV VHQYDILLD+LIVNQT +TLQNL++EF+TLGDLKLVERP    + P
Sbjct: 727 TGFSDPIYAEAYVTVHQYDILLDILIVNQTDQTLQNLTVEFSTLGDLKLVERPQPQTIGP 786

Query: 478 HSFHSVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQF 537
             FHS+KA IKVSSTETGVI+GNIVYDG  + + NCV+LNDIHIDIMDYI PA CNETQF
Sbjct: 787 RGFHSIKANIKVSSTETGVIYGNIVYDGASSVDINCVILNDIHIDIMDYIKPATCNETQF 846

Query: 538 RSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSI 597
           R MW EFEWENKVNVNTNITDLR YL H+MKSTN++CLTPE AL+G+CGFL+AN+YARSI
Sbjct: 847 RLMWLEFEWENKVNVNTNITDLRMYLDHVMKSTNLNCLTPEHALAGECGFLAANLYARSI 906

Query: 598 FGEDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           FGEDALANI +EK +   ITGH+RIRSKTQGIALSLGDK T  QK 
Sbjct: 907 FGEDALANICLEKISGDKITGHIRIRSKTQGIALSLGDKFTTTQKG 952



>gi|398410555|ref|XP_003856626.1| coatomer subunit beta [Zymoseptoria tritici IPO323]
 gi|339476511|gb|EGP91602.1| hypothetical protein MYCGRDRAFT_67108 [Zymoseptoria tritici IPO323]
          Length = 962

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/623 (61%), Positives = 479/623 (76%), Gaps = 7/623 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD++VRRKAL +A+++V+++NV+EVV+ LKKEL+KT+D+ YEKNNEYR LLI SIH C
Sbjct: 328 SSPDLDVRRKALELAMDMVSSKNVEEVVMLLKKELAKTVDEQYEKNNEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVA +VV +LM+F+ D NN +A+DVI+FV+EVVE+FP +RSSI E+L+ T  +V+
Sbjct: 388 AIKFSEVAQSVVGLLMDFISDFNNASAIDVISFVKEVVERFPKMRSSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG+LWI+GEY     DI EAWK IRA LGEIPI+ASE RLL              
Sbjct: 448 AGKVYRGSLWIIGEYSLEQNDIREAWKTIRASLGEIPIVASEARLLEEQADSETGANSEQ 507

Query: 199 X---XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                     + SR++LADGTYATE+A +S SS  AKL+A+KAA KPPLR L+L GD++L
Sbjct: 508 VNGHAKPAAPTGSRKVLADGTYATESALTSQSSAKAKLDAVKAAQKPPLRQLILDGDYFL 567

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            +VL+STLTKLV+R++ IS+D  +TNALRAEAMLIM SIIR GQSQF   PIDEDS DRI
Sbjct: 568 ATVLSSTLTKLVMRHNEISDDSARTNALRAEAMLIMISIIRAGQSQFVKAPIDEDSVDRI 627

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           MSC+  L + S    ++  FL DTR AF  +V                   VQVDD++  
Sbjct: 628 MSCVRSLAEFSQKKDLEVAFLDDTRKAFVNMVQVEEKKRAEKDAVLKSKSAVQVDDVVTI 687

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQ SK+N  D ADE  +DL +ATG   + +DL SKLSRVVQLTGFSD VYAEAYV V+Q+
Sbjct: 688 RQLSKKNAVDGADEAVVDLEKATGGDATTEDLSSKLSRVVQLTGFSDSVYAEAYVQVNQF 747

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL    F +V+ATIKVSST+TG
Sbjct: 748 DIILDVLLVNQTRETLQNLSVEFATLGDLKVVERPTTQNLPGLDFLNVQATIKVSSTDTG 807

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDGP ++ESN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+NT 
Sbjct: 808 VIFGNVVYDGPSSTESNVVILNDVHVDIMDYIQPANCTETQFRTMWTEFEWENKVNINTK 867

Query: 556 I---TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ- 611
           +   T LR++L  +MK TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+S+EK+ 
Sbjct: 868 MPAGTGLRDFLQRLMKVTNMSCLTPEASLKGDCQFLSANLYARSVFGEDALANLSVEKEG 927

Query: 612 TDGAITGHVRIRSKTQGIALSLG 634
            +G +TG +RIRS++QG+ALSLG
Sbjct: 928 ENGPVTGFMRIRSRSQGLALSLG 950



>gi|392578450|gb|EIW71578.1| hypothetical protein TREMEDRAFT_71204 [Tremella mesenterica DSM
           1558]
          Length = 951

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/644 (59%), Positives = 492/644 (76%), Gaps = 5/644 (0%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+EV+RKAL +ALELVT+RNV++VV+FLKK+L  T++Q+Y
Sbjct: 308 KHEHVLDGMVMDILKVLSSPDMEVKRKALAVALELVTSRNVEDVVLFLKKQLQSTMEQEY 367

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
           +KN EYRQLLIQSIH CAIKFSEVAANVV+VLM+FLGDS+NP+AVDVIAFVREVVEKFP+
Sbjct: 368 DKNIEYRQLLIQSIHSCAIKFSEVAANVVYVLMDFLGDSSNPSAVDVIAFVREVVEKFPD 427

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR +IT+KL+ TF ++KSGKVFRGA+WIVGEYC+   +I+ A  ++R  +GEIPILASEQ
Sbjct: 428 LRPAITDKLISTFSEIKSGKVFRGAMWIVGEYCTGVAEIKHAVHELRKVIGEIPILASEQ 487

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                     +++ R+L DGTYATET ++SN +  A+LE ++AA K
Sbjct: 488 RLLDEAEAADESSTEKPAEQPKAITTT-RVLPDGTYATETVYTSNVAA-ARLEQVRAASK 545

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQ 301
           PPLR+L+L GDF+ GSVLA+TLTKLV+R+S      +  N LRAEA+L+M S+IRVGQS+
Sbjct: 546 PPLRALILGGDFFTGSVLAATLTKLVMRFSESGPPAEDINTLRAEAILMMTSVIRVGQSK 605

Query: 302 FASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXX 361
           F++ PIDEDS +RIM+C+  L Q+     +  VFL DT+AA+A++V              
Sbjct: 606 FSAVPIDEDSQERIMNCIETLAQLQNMGVMTQVFLEDTKAAYAKMVKNEEKKAKAKREKE 665

Query: 362 XXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
                VQVDDLI F Q SK+  G +AD+ + DL RATG  + ++D +SKLSR+VQLTGFS
Sbjct: 666 SKTTIVQVDDLISFAQLSKKTAGGDADDLDYDLVRATG-TEIQEDFVSKLSRIVQLTGFS 724

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEA V +  +D+LLDVLIVNQT+ETLQNL++EFATLGDLKLVERP  H LAPH FH
Sbjct: 725 DPVYAEAVVTIQAFDVLLDVLIVNQTTETLQNLTVEFATLGDLKLVERPAPHTLAPHGFH 784

Query: 482 SVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRSM 540
            + ATIKVSSTETGV+FGNIVYD  G ++++  +V+NDIH DI+ ++ P Y  E+QFRS+
Sbjct: 785 HIAATIKVSSTETGVVFGNIVYDKQGAADASVNIVMNDIHCDILSFVQPNYVPESQFRSL 844

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           WTEFEWENKV VN+ +TDLR +L H++KSTNM CLTP+ AL GDC +LSAN+ A+S+FGE
Sbjct: 845 WTEFEWENKVAVNSTMTDLRAFLDHLVKSTNMLCLTPDAALEGDCQYLSANLAAKSLFGE 904

Query: 601 DALANISIEKQTDG-AITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DALAN SIE   DG  +TGHVR+R+K+QGIALSLGDK+T++QKA
Sbjct: 905 DALANCSIELAEDGQGLTGHVRLRAKSQGIALSLGDKVTVSQKA 948



>gi|322711623|gb|EFZ03196.1| coatomer beta subunit [Metarhizium anisopliae ARSEF 23]
          Length = 963

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/614 (63%), Positives = 469/614 (76%), Gaps = 2/614 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALSIALDMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVDLLMDFIADFNNASAVDVINFVKEVVEKFPALRKTIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WIVGEY    KDI +AWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGIMWIVGEYSLEEKDIRDAWKRIRASLGEIPILASEQRLLEDQDGGEPIQDQVN 507

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  AKLEA+KAA KPPLR L+L GD+YL +
Sbjct: 508 GNSKPAPPSGSRKVLADGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+S IS D  +TNALRAEAMLIM SI+RVGQSQF   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVMRHSEISADVARTNALRAEAMLIMISILRVGQSQFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L   ST   +++V+L+DTR AF  +V                   VQVDD++  RQ
Sbjct: 628 CVRSLADFSTKKELENVWLNDTRKAFRAMVQVEEKKREAKEAHERAKSAVQVDDVVQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SKRN  D  D  ELDL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LSKRNATDGIDGIELDLERATGGEATAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TGHVRIRSKTQGIA 630
           TG   + S   G A
Sbjct: 928 TGISSLESVECGFA 941



>gi|477509668|gb|ENH62958.1| Coatomer subunit beta [Fusarium oxysporum f. sp. cubense race 1]
          Length = 945

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 470/618 (76%), Gaps = 14/618 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL +ALE+V+++NV+EVV+ LKKELSKT+DQ+YEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALGLALEMVSSKNVEEVVLLLKKELSKTVDQEYEKNTEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA            S+N +AVDVI FV+EVVEKFPNLR++I E+L+ T  +V+
Sbjct: 388 AIKFSEVAA------------SDNASAVDVINFVKEVVEKFPNLRTTIIERLVSTLGEVR 435

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG +WI+GEY    KDI EAWK+IRA LGE+PILASEQRLL              
Sbjct: 436 AGKVYRGIMWIIGEYSLEEKDIREAWKRIRASLGEMPILASEQRLLDSHDTEEQTDDHIN 495

Query: 199 -XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S SS  AKLEA+K A KPPLR L+L GD+YL +
Sbjct: 496 GASKPAAPSGSRKVLADGTYATETALTSQSSAAAKLEAVKTAQKPPLRQLILDGDYYLAT 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIMS
Sbjct: 556 VLSSTLVKLVMRHHEISSDKARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSVDRIMS 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L +      +++V+L DTR AF  +V                   VQVDD++  RQ
Sbjct: 616 CVRSLAEFEQKKELETVWLDDTRKAFRAMVQVEEKKRAAKEAFEKAKTAVQVDDVVQIRQ 675

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +K+N  +  DE E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 676 LAKKNTTEGLDEIEVDLERATGGEGTAEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 735

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TGVI
Sbjct: 736 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVI 795

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 796 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAK 855

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR++L  +M  TNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 856 SLRDFLDQLMACTNMNCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 915

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 916 TGFVRIRSRSQGLALSLG 933



>gi|393240816|gb|EJD48341.1| coatomer beta subunit [Auricularia delicata TFB-10046 SS5]
          Length = 950

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/629 (62%), Positives = 476/629 (75%), Gaps = 16/629 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDIEVRR+A+ I L +VT RN +EVV FL K+L +TLDQDYEKN EYRQLLIQSIH  
Sbjct: 327 SSPDIEVRRRAVAIGLSMVTTRNAEEVVAFLNKQLVRTLDQDYEKNLEYRQLLIQSIHAL 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+++SEVA +VV  LMEFL D+N+P+A D IAFVREVVEKFP++R+ + E+LL  F  +K
Sbjct: 387 AVRYSEVAGSVVSALMEFLADANSPSAADAIAFVREVVEKFPHMRAHVIERLLAAFPTIK 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALWIVGEYC+   +I+EA+ ++R+ LGE+PILASEQR L              
Sbjct: 447 SGKVFRGALWIVGEYCATVSEIDEAFAKVRSVLGEVPILASEQRALEESGATEETTAEGS 506

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNS-STLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 T    RILADGTY TETA+S+   S L K      + KP LR+LLL GDFY G+
Sbjct: 507 SKPKGAT----RILADGTYVTETAYSAAPVSGLGK----DISGKPALRALLLGGDFYTGA 558

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VLA+TL+KLVLR+  + E  K  NALRAEAML+M S +R+GQS  A+ PIDED+ +RI+ 
Sbjct: 559 VLAATLSKLVLRHRSLGETGKTHNALRAEAMLVMTSTVRLGQSTLAAQPIDEDASERIIQ 618

Query: 318 CLHIL--EQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           C+  L     +   SI  +FL DT+AA+AR+V                   VQVDDL+ F
Sbjct: 619 CIQTLALSPEAPPASIDEIFLRDTKAAYARMVRAEEKKAREKSELEARKTQVQVDDLLSF 678

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQF+K+  GD  ++   DL RATG  + ++DL+S LSRVVQLTGFSDPVYAEA V VH +
Sbjct: 679 RQFAKKAGGDVVEDA--DLGRATGAGEVKEDLMSNLSRVVQLTGFSDPVYAEAIVKVHGF 736

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DILLDVLIVNQT++TLQNL IEFATLGDLKLVER   H LAPH FHSVKAT+KV+STETG
Sbjct: 737 DILLDVLIVNQTAQTLQNLCIEFATLGDLKLVERMGTHTLAPHGFHSVKATVKVASTETG 796

Query: 496 VIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNT 554
           VIFGNI+++ GPGT E+ CV+LNDIHIDIMDYI PA C E+QFRSMWTEFEWEN+VNV T
Sbjct: 797 VIFGNIIWENGPGTQET-CVILNDIHIDIMDYIKPATCTESQFRSMWTEFEWENRVNVVT 855

Query: 555 NITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD- 613
           +I+DLR YL HIMK TNM+CLTP+ AL GDC FLSANMYARS+FGEDALAN+SIE+  + 
Sbjct: 856 SISDLRAYLAHIMKCTNMNCLTPDAALEGDCDFLSANMYARSLFGEDALANLSIERVPET 915

Query: 614 GAITGHVRIRSKTQGIALSLGDKITLAQK 642
           GA+TG+VRIRSKTQGIALSLGDKITLAQK
Sbjct: 916 GAVTGYVRIRSKTQGIALSLGDKITLAQK 944



>gi|170107540|ref|XP_001884980.1| coatomer protein [Laccaria bicolor S238N-H82]
 gi|164640194|gb|EDR04461.1| coatomer protein [Laccaria bicolor S238N-H82]
          Length = 978

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/626 (61%), Positives = 480/626 (76%), Gaps = 7/626 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           TS D+EVRRKA+ I L + ++RNV+EV +FLKK+L KT + D++K  +YRQLLIQSIH  
Sbjct: 328 TSADMEVRRKAISIVLSMTSSRNVEEVALFLKKQLQKTQEADFDKAADYRQLLIQSIHVM 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VVH LM+FLGDSNNP+A+DV++FVREVVEKFP LR++I EKL+ T  ++K
Sbjct: 388 AIKFSEVAASVVHALMDFLGDSNNPSALDVVSFVREVVEKFPRLRATICEKLISTLPEIK 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG LWI+GEY  +  DI+   ++IR  LGEIPILASEQRLL              
Sbjct: 448 SGKVFRGILWILGEYVESVADIQSTMQEIRKVLGEIPILASEQRLLDAAAGVDGAGDEAS 507

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + R  +LADGTYATETA++  S+T A+LEA+KAA KPPLR+L+L GDF+ G
Sbjct: 508 DKEKPKADGASRPKVLADGTYATETAYT--STTAARLEAVKAAAKPPLRTLILGGDFFTG 565

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVLA  LTKLVLR+   S+DP  +N LRAEAMLIM SIIRVGQ++F +  IDEDS +RIM
Sbjct: 566 SVLAVALTKLVLRFDDKSQDPSASNILRAEAMLIMTSIIRVGQTKFVTVQIDEDSNERIM 625

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIV-XXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           SC+  L ++ +  ++   FL DT+AA+ +++                    VQVDDL+ F
Sbjct: 626 SCIQTLSELKSQPAVHEAFLEDTQAAYTKMLGAQEKRAAEKKESETTKAVVVQVDDLLTF 685

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQFSK+   D+A +Y+ D+ RATG A+ ++D +S LSR+ QLTGFSDP+YAEAYV +H +
Sbjct: 686 RQFSKKT-ADDAIDYDEDVGRATGSAEVQEDFMSNLSRISQLTGFSDPIYAEAYVKMHGF 744

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DILLDVL+VNQT  TLQNL ++FATLGDLK+VERP  + +APH F S+KATIKVSSTETG
Sbjct: 745 DILLDVLLVNQTGNTLQNLCLDFATLGDLKIVERPAVYTIAPHGFQSIKATIKVSSTETG 804

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFG+I+++G   +E+ CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNVN  
Sbjct: 805 VIFGSILWEGQNMAEA-CVILNDIHIDIMDYIKPAYCTEHQFRSMWTEFEWENRVNVNYP 863

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGA 615
           ++D REYL H+MK+TNMSCLTPE A SG+C FLSANMYARS+FGEDALAN+S+E+   G 
Sbjct: 864 LSDPREYLKHVMKTTNMSCLTPEGATSGECDFLSANMYARSLFGEDALANLSVERTEAGT 923

Query: 616 ITGHVRIRSKTQGIALSLGDKITLAQ 641
           ITGHVRIRSKTQGIALSLGD+IT+ +
Sbjct: 924 ITGHVRIRSKTQGIALSLGDRITMGK 949



>gi|452989220|gb|EME88975.1| hypothetical protein MYCFIDRAFT_25877 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 960

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/622 (61%), Positives = 477/622 (76%), Gaps = 7/622 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD++VRRKAL +A+++V+++NV+EVV+ LKKELSKT+D+ YEKNNEYR LLI SIH C
Sbjct: 328 SSPDLDVRRKALELAMDMVSSKNVEEVVMLLKKELSKTVDEQYEKNNEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+A +VV +LM+F+ D NN +AVDVI+FV+EVVEKFP +RSSI E+L+ T  +V+
Sbjct: 388 AIKFSEIAQSVVGLLMDFISDFNNASAVDVISFVKEVVEKFPKMRSSIVERLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RG+LWIVGEY     DI+EAWK+IRA LGEIPI+ASE RLL              
Sbjct: 448 AGKVYRGSLWIVGEYSLEQNDIKEAWKRIRASLGEIPIVASEARLLEEQPDGEAEPNDQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S +S  AKL+A+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHAKPAAPTGSRKVLADGTYATESALTSTASAKAKLDAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S IS D  + NALRAEAMLIM SIIR GQSQF   PIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRFSEISVDQARVNALRAEAMLIMISIIRAGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L +      ++  FL+DTR AF  +V                   +Q+DD++  R
Sbjct: 628 SCVRSLAEFQQKKDLEVAFLNDTRKAFRDMVQVEEKKRAAKEALLQAKNAIQIDDVVTIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q   +N  D  DE E+DL +ATG   + +DL SKL+RVVQLTGFSDPVYAEAYV VHQ+D
Sbjct: 688 QLKPKN-QDGGDEAEIDLEKATGGDATTEDLSSKLNRVVQLTGFSDPVYAEAYVQVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL    F +V+ATIKVSST+TGV
Sbjct: 747 IILDVLLVNQTRETLQNLSVEFATLGDLKVVERPTTQNLPGLDFLNVQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDGP ++ESN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+NT +
Sbjct: 807 IFGNVVYDGPSSTESNVVILNDVHVDIMDYIQPAQCTETQFRTMWTEFEWENKVNINTKM 866

Query: 557 T---DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-T 612
                LRE+L  +MK TNMSCLTPE +L G+C FLSAN+YARS+FGEDALAN+S+EK+  
Sbjct: 867 PAGKGLREFLQALMKVTNMSCLTPEASLEGECQFLSANLYARSVFGEDALANLSVEKEGE 926

Query: 613 DGAITGHVRIRSKTQGIALSLG 634
           +G +TG +RIRS++QG+ALSLG
Sbjct: 927 NGPVTGFMRIRSRSQGLALSLG 948



>gi|426194035|gb|EKV43967.1| coatomer protein [Agaricus bisporus var. bisporus H97]
          Length = 965

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/635 (61%), Positives = 485/635 (76%), Gaps = 15/635 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L + ++RNV+EVV+FLKK+L KT + D+EK  EYRQLLIQSIH  
Sbjct: 328 SSADMEVRRKAMSIVLSMTSSRNVEEVVLFLKKQLQKTQEADFEKAPEYRQLLIQSIHVT 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VVH LMEFLGD+NNP+A+DV+AFVREVVEKFP LR+SI EKL+ T  ++K
Sbjct: 388 AIKFSEVAASVVHALMEFLGDTNNPSALDVVAFVREVVEKFPPLRASICEKLISTLSEIK 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXX-------XXXX 191
           SGKVFRG LWI+GEY      I +A  +IR  LGEIPILASEQ+LL              
Sbjct: 448 SGKVFRGILWILGEYVETLPIISDAMLEIRRVLGEIPILASEQKLLDEAGGNFSGGDEIL 507

Query: 192 XXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                         ++  ++LADGTYATETAF+S +  +A+LEA+K+A KPPLR+L+L G
Sbjct: 508 DEEGGESKEKEKVAAAKPKVLADGTYATETAFTSGA--VARLEAVKSASKPPLRTLILGG 565

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+  SVLAS LTKLV+R+  +SED   +NAL+AEAMLIM S+IRVGQS+F +  IDEDS
Sbjct: 566 DFFTASVLASALTKLVIRFVNLSEDTTASNALKAEAMLIMTSVIRVGQSKFVTIQIDEDS 625

Query: 312 YDRIMSCLHILEQISTDYS---IKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-V 367
            +RIM+C+  L ++  D     +K +FL DT+ AF +++                  T V
Sbjct: 626 NERIMNCIQSLSELDVDADRKVVKEMFLDDTKRAFEKMLGAQEKRAAEKKESESKKATIV 685

Query: 368 QVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAE 427
           QVDDL+ FRQFSK+ + D+  +Y+ D+ RATG A+ ++D +S LS + QLTGFSDP+YAE
Sbjct: 686 QVDDLLTFRQFSKK-MTDDGIDYDEDVGRATGAAEIQEDFMSNLSHITQLTGFSDPIYAE 744

Query: 428 AYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATI 487
           A V +H +DILLDVL+VNQT+ TLQNL ++FATLGDLK+VERP+ + +APH F S+KATI
Sbjct: 745 ALVKMHGFDILLDVLLVNQTANTLQNLCLDFATLGDLKIVERPSVYTIAPHGFQSIKATI 804

Query: 488 KVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWE 547
           KVSSTETGVIFG+I+++GP  SE  CV+LNDIHIDIMDYI PAYCNE QFRSMWTEFEWE
Sbjct: 805 KVSSTETGVIFGSILWEGPNLSE-QCVILNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWE 863

Query: 548 NKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANIS 607
           N+VNV++ ++D REYL  +MK TNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S
Sbjct: 864 NRVNVSSPLSDPREYLKQVMKVTNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLS 923

Query: 608 IEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           IE+   G ITGHVRIRSKTQGIALSLGDKIT+AQK
Sbjct: 924 IERTEGGEITGHVRIRSKTQGIALSLGDKITMAQK 958



>gi|121701799|ref|XP_001269164.1| Coatomer subunit beta, putative [Aspergillus clavatus NRRL 1]
 gi|119397307|gb|EAW07738.1| Coatomer subunit beta, putative [Aspergillus clavatus NRRL 1]
          Length = 955

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/618 (63%), Positives = 481/618 (77%), Gaps = 2/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL I LE+V+++NV+EVV+ LKKEL KT+D+ YEKN+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGITLEMVSSKNVEEVVMLLKKELGKTVDEQYEKNSEYRQLLIQSIHHC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR++I  +L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRAAIVGRLVSTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    +DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEERDIREAWKRIRASLGEIPILASEQRLLDEVPDETIVNEQVN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  AKL A+KAA KPPLR L+L GD+YL +
Sbjct: 508 GHAKASAPTGSRKVLADGTYATESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQSQF   PIDEDS DRIM 
Sbjct: 568 VLSSTLTKLVMRHSEVSEDVARTNALRAEAMLIMISIIRVGQSQFVKAPIDEDSIDRIMC 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQ
Sbjct: 628 CVRSLSEFSQRKELETTFLEDTRKAFRDMVQVEDKKRAAKEAVEKAKTAVQIDDAIPIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           F+K++  + A+E ELDL +ATG   + +   SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 FTKKSGVEGAEEIELDLVKATGGDSTVETTPSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT HNL    F +V+AT+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPTTHNLGARDFLNVQATVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++E++ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNIVYDGASSTETHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M+STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLREFLKQLMESTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGDDGPI 927

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 928 TGFVRIRSRSQGLALSLG 945



>gi|449304842|gb|EMD00849.1| hypothetical protein BAUCODRAFT_29226 [Baudoinia compniacensis UAMH
           10762]
          Length = 966

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/627 (60%), Positives = 481/627 (76%), Gaps = 11/627 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           +SPD++VRRKAL +A+E+V++RNV+EVV+ LKKELSKT+D Q YEKN EYR LLI SIH 
Sbjct: 328 SSPDLDVRRKALELAMEMVSSRNVEEVVMLLKKELSKTVDEQAYEKNTEYRSLLIHSIHQ 387

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           CAIKFSEVA +VV +LM+F+ D NN +AVDVI+FV+EVVE+FP +RS I E+L+ T  +V
Sbjct: 388 CAIKFSEVAQSVVGLLMDFISDFNNASAVDVISFVKEVVERFPKMRSGIVERLVATLSEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RGALWI+GEY    KDI +AWK+IRA LGE+PI+ASE RLL             
Sbjct: 448 RAGKVYRGALWIIGEYSLEEKDIRDAWKRIRASLGEVPIVASEARLLEEQPDGETEPAVD 507

Query: 198 XXXXX-----XTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGD 252
                        S++ R+LADGTYAT+TA +S +ST AKL+A+KAA KPPLR L+L GD
Sbjct: 508 LTQTNGHPRPAAASTASRVLADGTYATQTALTSQASTQAKLDAVKAASKPPLRQLILDGD 567

Query: 253 FYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSY 312
           FYL +VL+STLTKLV+R+S IS D  +TNAL+AEAMLIM SIIR GQS F   PIDEDS 
Sbjct: 568 FYLATVLSSTLTKLVMRHSEISNDKARTNALKAEAMLIMISIIRAGQSHFVKAPIDEDSV 627

Query: 313 DRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDL 372
           DRIMSC+  L + +    +++ FL DTR AF  +V                   VQVDD+
Sbjct: 628 DRIMSCVRSLAEFAQKKDLETAFLDDTRKAFRDMVQVEERKRKEKEDVLKAKSAVQVDDV 687

Query: 373 IVFRQFSKRNIGDEADEYELDLTRATG-QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
           +  RQ SK+N+ D AD+   D+ +ATG  A + ++L SKLSRVVQLTGFSDPVYAEAYV 
Sbjct: 688 VSIRQLSKKNMLDGADDVTEDVEKATGGDASAAENLTSKLSRVVQLTGFSDPVYAEAYVQ 747

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           VHQ+DI+LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL    F +V+AT+KVSS
Sbjct: 748 VHQFDIILDVLLVNQTRETLQNLSVEFATLGDLKVVERPTTQNLPALDFLNVQATVKVSS 807

Query: 492 TETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           T+TGVIFGN+VYDGP ++ESN V+LND+H+DIMDYI+PA C E QFR+MWTEFEWENK+N
Sbjct: 808 TDTGVIFGNVVYDGPSSTESNVVILNDVHVDIMDYIHPAQCTEAQFRTMWTEFEWENKIN 867

Query: 552 VNTNITD---LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           ++T + D   LR++L  +MK TNMSCLTPE +LSGDC FLSAN+YARS+FGEDALAN+S+
Sbjct: 868 ISTKMPDGKGLRDFLQRLMKVTNMSCLTPEASLSGDCQFLSANLYARSVFGEDALANLSV 927

Query: 609 EKQTDGA-ITGHVRIRSKTQGIALSLG 634
           EK  + + +TG +RIRS++QG+ALSLG
Sbjct: 928 EKDGESSLVTGFMRIRSRSQGLALSLG 954



>gi|409078036|gb|EKM78400.1| hypothetical protein AGABI1DRAFT_60588 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 967

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/635 (61%), Positives = 485/635 (76%), Gaps = 15/635 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+EVRRKA+ I L + ++RNV+EVV+FLKK+L KT + D+EK  EYRQLLIQSIH  
Sbjct: 330 SSADMEVRRKAMSIVLSMTSSRNVEEVVLFLKKQLQKTQEADFEKAPEYRQLLIQSIHVT 389

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VVH LMEFLGD+NNP+A+DV+AFVREVVEKFP LR+SI EKL+ T  ++K
Sbjct: 390 AIKFSEVAASVVHALMEFLGDTNNPSALDVVAFVREVVEKFPPLRASICEKLISTLSEIK 449

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXX-------XXXX 191
           SGKVFRG LWI+GEY      I +A  +IR  LGEIPILASEQ+LL              
Sbjct: 450 SGKVFRGILWILGEYVETLPIISDAMLEIRRVLGEIPILASEQKLLDEAGGNFSGGDEIL 509

Query: 192 XXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                         ++  ++LADGTYATETAF+S +  +A+LEA+K+A KPPLR+L+L G
Sbjct: 510 DEEGGESKEKEKVAAAKPKVLADGTYATETAFTSGA--VARLEAVKSASKPPLRTLILGG 567

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+  SVLAS LTKLV+R+  +SED   +NAL+AEAMLIM S+IRVGQS+F +  IDEDS
Sbjct: 568 DFFTASVLASALTKLVIRFVDLSEDTTASNALKAEAMLIMTSVIRVGQSKFVTIQIDEDS 627

Query: 312 YDRIMSCLHILEQISTDYS---IKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-V 367
            +RIM+C+  L ++  D     +K +FL DT+ AF +++                  T V
Sbjct: 628 NERIMNCIQSLSELDVDADRKVVKEMFLDDTKRAFEKMLGAQEKRAAEKKESESKKATIV 687

Query: 368 QVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAE 427
           QVDDL+ FRQFSK+ + D+  +Y+ D+ RATG A+ ++D +S LS + QLTGFSDP+YAE
Sbjct: 688 QVDDLLTFRQFSKK-MTDDGIDYDEDVGRATGAAEIQEDFMSNLSHITQLTGFSDPIYAE 746

Query: 428 AYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATI 487
           A V +H +DILLDVL+VNQ++ TLQNL ++FATLGDLK+VERP+ + +APH F S+KATI
Sbjct: 747 ALVKMHGFDILLDVLLVNQSANTLQNLCLDFATLGDLKIVERPSVYTIAPHGFQSIKATI 806

Query: 488 KVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWE 547
           KVSSTETGVIFG+I+++GP  SE  CV+LNDIHIDIMDYI PAYCNE QFRSMWTEFEWE
Sbjct: 807 KVSSTETGVIFGSILWEGPNLSE-QCVILNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWE 865

Query: 548 NKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANIS 607
           N+VNV++ ++D REYL  +MK TNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S
Sbjct: 866 NRVNVSSPLSDPREYLKQVMKVTNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLS 925

Query: 608 IEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           IE+   G ITGHVRIRSKTQGIALSLGDKIT+AQK
Sbjct: 926 IERTEGGEITGHVRIRSKTQGIALSLGDKITMAQK 960



>gi|452847733|gb|EME49665.1| hypothetical protein DOTSEDRAFT_68445 [Dothistroma septosporum
           NZE10]
          Length = 961

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/622 (60%), Positives = 479/622 (77%), Gaps = 7/622 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           + PD++VR+KAL +A+++V+++NV+EVV+ LKKEL+KT+D+ YEKNNEYR L+I SIH C
Sbjct: 328 SGPDLDVRKKALELAMDMVSSKNVEEVVMLLKKELAKTVDEQYEKNNEYRSLVIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+A +VV +LM+F+ D NN +A+DVI+FV+EVVE+FP +RSSI E+L+ T  +V+
Sbjct: 388 AIKFSEIAQSVVGLLMDFISDFNNASAIDVISFVKEVVERFPKMRSSIVERLVTTLSEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXX 196
           +GKV+RG+LWI+GEY     DI+EAWK IRA LGEIPI+ASE RLL              
Sbjct: 448 AGKVYRGSLWIIGEYSLEQNDIKEAWKCIRASLGEIPIVASEARLLEEQPDGEPELHVQV 507

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S +S  AKL+A+KAA KPPLR L+L GD++L 
Sbjct: 508 NGHAKPAAPTGSRKVLADGTYATESALTSQASAKAKLDAVKAAQKPPLRQLILDGDYFLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+S IS D  +TNALRAEAMLIM SIIR GQSQF   PIDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRFSEISSDSARTNALRAEAMLIMISIIRAGQSQFVKAPIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    +++ FL DTR AF  +V                   +QVDD++  R
Sbjct: 628 SCVRSLAEFAQKKDLETAFLDDTRKAFRDMVQVEEKKRAEKDAVRKAQSAIQVDDVVSIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q SK+   D ADE E+DL +ATG   + +DL SKLSRVVQLTGFSDPVYAEAYV V+Q+D
Sbjct: 688 QLSKKTT-DGADEAEVDLEKATGGDATTEDLTSKLSRVVQLTGFSDPVYAEAYVQVNQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT ETLQNLS+EFATLGDLK+VERPT  NL    F +V+ATIKVSST+TGV
Sbjct: 747 IILDVLLVNQTRETLQNLSVEFATLGDLKVVERPTTQNLPGLDFLNVQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGN+VYDGP  ++SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+NT +
Sbjct: 807 IFGNVVYDGPSATDSNVVILNDVHVDIMDYIQPAQCTETQFRTMWTEFEWENKVNINTKM 866

Query: 557 TD---LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD 613
            +   LR++L  +MK TNMSCLTPE +L G+C FLSAN+YARS+FGEDALAN+S+EK+ +
Sbjct: 867 PEDKGLRDFLQRLMKVTNMSCLTPEASLEGECQFLSANLYARSVFGEDALANLSVEKEGE 926

Query: 614 -GAITGHVRIRSKTQGIALSLG 634
            G +TG +RIRS++QG+ALSLG
Sbjct: 927 HGPVTGFMRIRSRSQGLALSLG 948



>gi|399170809|emb|CCE28350.1| probable coatomer complex beta chain [Claviceps purpurea 20.1]
          Length = 932

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/602 (62%), Positives = 463/602 (76%), Gaps = 2/602 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DI+VRRKAL IAL++V+++NV+EVV+ LKKELSKT+DQDYEKN EYR LLI SIH C
Sbjct: 328 SSTDIDVRRKALDIALDMVSSKNVEEVVLLLKKELSKTVDQDYEKNAEYRSLLIHSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VV +LMEF+ D NN +AVDVI FV+EVVEKFP LR +I E+L+ T  +V+
Sbjct: 388 AIKFSEVAASVVELLMEFIADFNNASAVDVINFVKEVVEKFPTLRKTIVERLVSTLGEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG  WI+GEY  +  DI +AWK+IRA LGEIPILASE+RLL              
Sbjct: 448 AGKVYRGITWIIGEYSLDENDIRDAWKRIRASLGEIPILASEERLLAEQDGDSNNEEHEN 507

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   S SR++LADGTYATETA +S +S +AKLEA+K A KPPLR L+L GD+YL +
Sbjct: 508 GGTRPVAPSGSRKVLADGTYATETALTSQASAIAKLEAVKTARKPPLRQLILDGDYYLAT 567

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STL KLVLR+S IS D  +TNALRAEAMLIM SI+RVGQS+F   PIDEDS DRIMS
Sbjct: 568 VLSSTLVKLVLRHSKISADQARTNALRAEAMLIMISILRVGQSKFVKAPIDEDSVDRIMS 627

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + ++   +++V+L DT+ AF  +V                  +VQVDD++  RQ
Sbjct: 628 CVRSLAEFASKKELETVWLMDTKRAFRAMVQVEDTKREAKEAYEKAKSSVQVDDVVQIRQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            SKRN  D  D  E+DL RATG   + +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 688 LSKRNFCDGIDGMEVDLERATGGEATTEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDI 747

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ T+KVSST+TGVI
Sbjct: 748 VLDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTVKVSSTDTGVI 807

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 808 FGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSKAE 867

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LR +L  +M  TNM CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 868 SLRTFLDELMACTNMKCLTPEASLKGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPI 927

Query: 617 TG 618
           TG
Sbjct: 928 TG 929



>gi|296816567|ref|XP_002848620.1| coatomer subunit beta [Arthroderma otae CBS 113480]
 gi|238839073|gb|EEQ28735.1| coatomer subunit beta [Arthroderma otae CBS 113480]
          Length = 953

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/617 (62%), Positives = 481/617 (77%), Gaps = 2/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +G+V+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGRVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEGPDAGAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  R +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPR-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++++FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELEAIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKNAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +KR+  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKRSGEEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDSVYAEAYVKVHQFDIV 746

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 747 LDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 806

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C+ETQFR+MWTEFEWENKVN+++    
Sbjct: 807 GNVIYDGSSSAETHVVILNDIKADIMDYIQPAHCSETQFRTMWTEFEWENKVNIHSKAKS 866

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 867 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGEDGPIT 926

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 927 GFMRIRSRSQGLALSLG 943



>gi|327293872|ref|XP_003231632.1| coatomer subunit beta [Trichophyton rubrum CBS 118892]
 gi|326466260|gb|EGD91713.1| coatomer subunit beta [Trichophyton rubrum CBS 118892]
          Length = 952

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 479/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVIIFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEGPDASAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGNSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|302497856|ref|XP_003010927.1| hypothetical protein ARB_02824 [Arthroderma benhamiae CBS 112371]
 gi|291174473|gb|EFE30287.1| hypothetical protein ARB_02824 [Arthroderma benhamiae CBS 112371]
          Length = 952

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 479/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVITFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEGPDAGAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|326479208|gb|EGE03218.1| coatomer subunit beta [Trichophyton equinum CBS 127.97]
          Length = 952

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 479/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVITFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEATDIREAWKRIRASLGEIPILASEQRLLDEGPDAGAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|302658469|ref|XP_003020938.1| hypothetical protein TRV_04960 [Trichophyton verrucosum HKI 0517]
 gi|291184809|gb|EFE40320.1| hypothetical protein TRV_04960 [Trichophyton verrucosum HKI 0517]
          Length = 952

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/617 (62%), Positives = 479/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVITFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEANDIREAWKRIRASLGEIPILASEQRLLDEGPDAGAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|315049935|ref|XP_003174342.1| coatomer subunit beta [Arthroderma gypseum CBS 118893]
 gi|311342309|gb|EFR01512.1| coatomer subunit beta [Arthroderma gypseum CBS 118893]
          Length = 952

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/617 (62%), Positives = 479/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNSSAVDVISFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEASDIREAWKRIRASLGEIPILASEQRLLDEGPDAGEAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNALRAEAMLIM SIIRVGQS FA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALRAEAMLIMISIIRVGQSHFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|390604963|gb|EIN14354.1| coatomer beta subunit [Punctularia strigosozonata HHB-11173 SS5]
          Length = 947

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/625 (60%), Positives = 478/625 (76%), Gaps = 13/625 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPD+EVRRKAL I L + ++RNV+EVV+FLKK+L KT D D++K+++YRQLLIQSIH C
Sbjct: 329 SSPDMEVRRKALAIVLSMTSSRNVEEVVLFLKKQLQKTQDADFDKSSDYRQLLIQSIHVC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVA +VV+ LM+FLGDSNNP+A+DV+AFVREVVEKFP+LR +I  +L+ET  ++K
Sbjct: 389 AIKFSEVAGSVVYALMDFLGDSNNPSALDVVAFVREVVEKFPHLRETICSRLVETLPEIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           S KVFRG LWI+GEY  +   +EE +K  R  +GEIPILA EQ+                
Sbjct: 449 SSKVFRGVLWILGEYIEDLAGVEEVFKATRKIIGEIPILAGEQK---AEDEVNGVEGPEQ 505

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                      ++LADGTYATETAFS   S+       K+A KPPLR+L+L GDF+  S+
Sbjct: 506 GDSKEKEGGRPKVLADGTYATETAFSIPKSSG------KSAFKPPLRTLILGGDFFTASI 559

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLVLR++  S+D K +N+LRAEAMLIMASIIRVGQS++ ++PIDEDS +RI+ C
Sbjct: 560 LASALTKLVLRFAAASDDRKTSNSLRAEAMLIMASIIRVGQSKYVAHPIDEDSQERILDC 619

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-VQVDDLIVFRQ 377
           L  L ++    + +  FL DT++A+ +++                    +QVDDL+ FRQ
Sbjct: 620 LKTLSELQDQPAAQKAFLQDTKSAYTKMLTAQEKKAAEKKEAESSKAAIIQVDDLLSFRQ 679

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+   D+  +YE DL RATG  + R+D IS LSR+ QLTGFSDP+YAEAYV V  +DI
Sbjct: 680 FSKKA-ADDVIDYEEDLGRATGATEIREDFISNLSRITQLTGFSDPIYAEAYVKVQGFDI 738

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ TLQNL ++FATLGDLKLVERPT + +APHSF S+KATIKVSSTETGVI
Sbjct: 739 VLDVLLVNQTANTLQNLCLDFATLGDLKLVERPTVYTIAPHSFQSIKATIKVSSTETGVI 798

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++G   SES CV+LNDIHIDIMDYI PAYC E QFRSMWTEFEWEN+VNV T I+
Sbjct: 799 FGSILWEGSNMSES-CVILNDIHIDIMDYIKPAYCTEAQFRSMWTEFEWENRVNVTTTIS 857

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           + R+YL H+MKSTNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S+E+ T+  +T
Sbjct: 858 EPRDYLAHVMKSTNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLSVER-TEIGLT 916

Query: 618 GHVRIRSKTQGIALSLGDKITLAQK 642
           GHVRIRSKTQGIALSLGD+IT++QK
Sbjct: 917 GHVRIRSKTQGIALSLGDRITMSQK 941



>gi|326474250|gb|EGD98259.1| coatomer subunit beta [Trichophyton tonsurans CBS 112818]
          Length = 952

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/617 (62%), Positives = 478/617 (77%), Gaps = 3/617 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+V++RNV+E+V+ LKKEL+KT+D+ YEKNNEYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALFIALEMVSSRNVEEIVLLLKKELAKTVDEQYEKNNEYRQLLIQSIHQC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR SI E+L+ T  +V+
Sbjct: 388 AIKFSEIAASVVDLLMDFIADFNNNSAVDVITFVKEVVEKFPKLRPSIVERLVSTLDEVR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY     DI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 448 AGKVYRGVLWVVGEYSLEATDIREAWKRIRASLGEIPILASEQRLLDEGPDAGAAGQDSV 507

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +T+  + +LADGTYA E+A +S S+  AKL A+KAA KPPLR L+L GD+YL +V
Sbjct: 508 NGHAKSTTGPK-VLADGTYAQESALTSESAAAAKLAAVKAAQKPPLRQLILDGDYYLATV 566

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STLTKLV+R+S +S+D  +TNAL AEAMLIM SIIRVGQSQFA   IDEDS DRIMSC
Sbjct: 567 LSSTLTKLVMRHSELSQDVARTNALCAEAMLIMISIIRVGQSQFAKASIDEDSVDRIMSC 626

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L + +    ++S+FL DTR AF  +V                   VQVDD I  RQ 
Sbjct: 627 VRSLAESAQRKELESIFLEDTRQAFRAMVQVDEKKRAAKEAVEKAKTAVQVDDAIPIRQL 686

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
           +K++  + A+E ELDL +ATG   + +DL SKLSRVVQLTG+SD VYAEAYV VHQ+DI+
Sbjct: 687 AKKS-EEGAEEIELDLAKATGGDSTLEDLTSKLSRVVQLTGYSDAVYAEAYVKVHQFDIV 745

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETLQNLS+EFATLGDLK+VERPT  NL PH F +V+ATIKVSST+TGVIF
Sbjct: 746 LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFLNVQATIKVSSTDTGVIF 805

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GN++YDG  ++E++ V+LNDI  DIMDYI PA+C ETQFR+MWTEFEWENKVN+++    
Sbjct: 806 GNVIYDGSNSTETHVVILNDIKADIMDYIQPAHCTETQFRTMWTEFEWENKVNIHSKAKS 865

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAIT 617
           LR +L  +M  TNMSCLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG IT
Sbjct: 866 LRAFLQQLMDRTNMSCLTPEASLEGDCQFLSANLYARSVFGEDALANLSIEKEGDDGPIT 925

Query: 618 GHVRIRSKTQGIALSLG 634
           G +RIRS++QG+ALSLG
Sbjct: 926 GFMRIRSRSQGLALSLG 942



>gi|405121752|gb|AFR96520.1| coatomer beta subunit [Cryptococcus neoformans var. grubii H99]
          Length = 933

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/644 (59%), Positives = 479/644 (74%), Gaps = 25/644 (3%)

Query: 2   KHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDY 61
           KH+              +SPD+EV+RKA+ IALE+V++RNV+E                 
Sbjct: 309 KHENVLDGMVMDILKVLSSPDMEVKRKAIGIALEMVSSRNVEE----------------- 351

Query: 62  EKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPN 121
             N EYRQLLIQSIH CAI+FSEVAANVV+VLM+FLGDSNNP+AVDVIAFVREVVEKFP 
Sbjct: 352 --NLEYRQLLIQSIHSCAIRFSEVAANVVYVLMDFLGDSNNPSAVDVIAFVREVVEKFPK 409

Query: 122 LRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQ 181
           LR++ITEKL+ TF ++KSGKVFRGA+WIVGEYC   +DI++A  +I+  LGEIPILASEQ
Sbjct: 410 LRTAITEKLISTFGEIKSGKVFRGAMWIVGEYCEQPEDIKQAIAEIQKVLGEIPILASEQ 469

Query: 182 RLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVK 241
           RLL                    T++  R+LADGTYATET ++S++S  A+LEA+++A K
Sbjct: 470 RLLDEAEAADETPAEQQEQPKAITTT--RVLADGTYATETVYTSSASA-ARLEAVRSASK 526

Query: 242 PPLRSLLLSGDFYLGSVLASTLTKLVLRYSGI-SEDPKKTNALRAEAMLIMASIIRVGQS 300
           PPLRSL+L GDF+ GSVLASTLTKLVLRYS + S D +  N LRA+A+LIM S+IRVGQS
Sbjct: 527 PPLRSLILGGDFFTGSVLASTLTKLVLRYSEVASSDQQSINILRAQAILIMTSVIRVGQS 586

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXX 360
           +FA+ PIDED+ +RIM+C+  L ++    ++  VFL DT+AA+A++V             
Sbjct: 587 KFAAVPIDEDAEERIMNCIETLAELQGSKALHQVFLKDTKAAYAKMVATEEKKAREKKER 646

Query: 361 XXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
                 VQ DDL+ FRQ SK+++  + DE + D+ +ATG    +DD +SKLSR+ QLTGF
Sbjct: 647 ESKVSVVQADDLLSFRQLSKKSVVGDVDESD-DVVKATGSIHPQDDFVSKLSRITQLTGF 705

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SDPVYAE  V + QYDI+LDVL+VN T+ETLQNL ++FATLGDLKLVERP    LAPH F
Sbjct: 706 SDPVYAETVVTLSQYDIILDVLLVNTTNETLQNLMVDFATLGDLKLVERPAPFTLAPHGF 765

Query: 481 HSVKATIKVSSTETGVIFGNIVYDGPGTSESNC-VVLNDIHIDIMDYINPAYCNETQFRS 539
           HS+ AT+KVSSTETGVIFG I Y   G S+++  +V++DIH+DIM +I P Y NE QFRS
Sbjct: 766 HSLSATVKVSSTETGVIFGAITYSKQGASDADVTIVMSDIHVDIMSFIKPNYVNEAQFRS 825

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MWTEFEWENKV V T+I+DLR YL H++KST+M+ LTPE ALSGDC FLSAN+ A+S+FG
Sbjct: 826 MWTEFEWENKVAVQTSISDLRAYLDHLLKSTHMALLTPEAALSGDCDFLSANLAAKSLFG 885

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EDALAN SIE+  DG ITGHVRIRSKTQGIALSLGDKITL+QKA
Sbjct: 886 EDALANASIERTEDGHITGHVRIRSKTQGIALSLGDKITLSQKA 929



>gi|451998828|gb|EMD91291.1| hypothetical protein COCHEDRAFT_1175040 [Bipolaris maydis C5]
 gi|477591879|gb|ENI08951.1| hypothetical protein COCC4DRAFT_188868 [Bipolaris maydis ATCC
           48331]
          Length = 956

 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/619 (60%), Positives = 470/619 (75%), Gaps = 4/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN+EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLSIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNSEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRVSIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDEASEGKDSSDQV 507

Query: 198 X-XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR LLL GD+YL 
Sbjct: 508 NGHAKAAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLLLDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHGEISTDAARTNALRAEAMLIMISIIRVGQSQFVKTLIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    I++VFL DTR +F  +V                   V VDD    R
Sbjct: 628 SCVRSLSEFAQRKEIQTVFLEDTRKSFRTMVQTEEKKRAAKEASERAKSAVNVDDAFNIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q  K++  D  DE + DL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+D
Sbjct: 688 QLKKKD-SDGIDEIDQDLERATGGDSATEDLTSKLSRVVQLTGFSDAVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+ PH F +++ATIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVGPHDFINIQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GA 615
             LRE+L  +M STNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+ D G 
Sbjct: 867 KSLREFLSQLMASTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDNGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 927 ITGFVRIRSRSQGLALSLG 945



>gi|238498358|ref|XP_002380414.1| Coatomer subunit beta, putative [Aspergillus flavus NRRL3357]
 gi|220693688|gb|EED50033.1| Coatomer subunit beta, putative [Aspergillus flavus NRRL3357]
          Length = 928

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/618 (61%), Positives = 460/618 (74%), Gaps = 29/618 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VRRKAL IALE+                           N+EYRQLLIQSIH C
Sbjct: 328 SSPDIDVRRKALGIALEM---------------------------NSEYRQLLIQSIHNC 360

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSE+AA+VV +LM+F+ D NN +AVDVI+FV+EVVEKFPNLR+SI ++L+ T  +V+
Sbjct: 361 AIKFSEIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPNLRASIVDRLVSTLSEVR 420

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RG LW+VGEY    KDI EAWK+IRA LGEIPILASEQRLL              
Sbjct: 421 AGKVYRGVLWVVGEYSLEEKDIREAWKKIRASLGEIPILASEQRLLDETPEDSALKEQVN 480

Query: 199 XXXXXTT-SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                +  + SR++LADGTYATE+A +S S+  A+LEA+KAA KPPLR L+L GD+YL +
Sbjct: 481 GHAKPSAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLAT 540

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R+S +SED  +TNALRAEAMLIM SIIRVGQS F   PIDEDS DRIM 
Sbjct: 541 VLSSTLTKLVMRHSEVSEDAARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDRIMC 600

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           C+  L + S    +++ FL DTR AF  +V                   VQ+DD I  RQ
Sbjct: 601 CVRSLAEFSERKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQIDDAIPIRQ 660

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+N  + A+E ELDL +ATG   + + + SKLSRVVQLTGFSDPVYAEAYV VHQ+DI
Sbjct: 661 FSKKNALEGAEEIELDLAKATGGDSTVETVSSKLSRVVQLTGFSDPVYAEAYVTVHQFDI 720

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT ETLQNLS+EFATLGDLK+VERP  HNL P  F +V+AT+KVSST+TGVI
Sbjct: 721 VLDVLLVNQTLETLQNLSVEFATLGDLKVVERPATHNLGPRDFLNVQATVKVSSTDTGVI 780

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  ++ES+ V+LNDIH DIMDYI PA+C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 781 FGNIVYDGASSTESHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEWENKVNINSKAK 840

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M STNM+CLTPE +L GDC FLSAN+YARS+FGEDALAN+SIEK+  DG I
Sbjct: 841 SLREFLKQLMDSTNMACLTPEASLKGDCRFLSANLYARSVFGEDALANLSIEKEGDDGPI 900

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 901 TGFVRIRSRSQGLALSLG 918



>gi|451845130|gb|EMD58444.1| hypothetical protein COCSADRAFT_185821 [Bipolaris sorokiniana
           ND90Pr]
          Length = 956

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/619 (60%), Positives = 470/619 (75%), Gaps = 4/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN+EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLGIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNSEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRVSIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDEASEGKDSSDQV 507

Query: 198 X-XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR LLL GD+YL 
Sbjct: 508 NGHAKAAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLLLDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+  IS D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHGEISTDAARTNALRAEAMLIMISIIRVGQSQFVKTLIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    I++VFL DTR +F  +V                   V VDD    R
Sbjct: 628 SCVRSLSEFAQRKEIQTVFLEDTRKSFRTMVQTEEKKRAAKEASERAKSAVNVDDAFNIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q  K++  D  DE + DL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+D
Sbjct: 688 QLKKKD-SDGIDEIDQDLERATGGDSATEDLTSKLSRVVQLTGFSDAVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+ PH F +++ATIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVGPHDFINIQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GA 615
             LRE+L  +M STNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+ D G 
Sbjct: 867 KSLREFLSQLMASTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDNGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 927 ITGFVRIRSRSQGLALSLG 945



>gi|189210794|ref|XP_001941728.1| coatomer subunit beta [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187977821|gb|EDU44447.1| coatomer subunit beta [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 956

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/619 (60%), Positives = 471/619 (76%), Gaps = 4/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLGIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNPEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR+SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRASIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDEASEGKDPAEQV 507

Query: 198 X-XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR LLL GD+YL 
Sbjct: 508 NGHAKAAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLLLDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+  IS+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHGEISQDAARTNALRAEAMLIMISIIRVGQSQFVKTFIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + S    +++VFL DTR +F  +V                   V VDD    R
Sbjct: 628 SCVRSLSEFSQRKELETVFLEDTRKSFRTMVQTEEKKRAAKEASERAKSAVNVDDSFNIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q  K++  D +DE E DL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+D
Sbjct: 688 QLKKKD-SDGSDEIEQDLERATGGDTATEDLTSKLSRVVQLTGFSDSVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+ PH F +++ATIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVGPHDFINIQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GA 615
             LRE+L  +M  TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+ D G 
Sbjct: 867 KTLREFLKQLMACTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDNGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 927 ITGFVRIRSRSQGLALSLG 945



>gi|396462136|ref|XP_003835679.1| similar to coatomer subunit beta [Leptosphaeria maculans JN3]
 gi|312212231|emb|CBX92314.1| similar to coatomer subunit beta [Leptosphaeria maculans JN3]
          Length = 957

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/620 (60%), Positives = 474/620 (76%), Gaps = 5/620 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L+IA+E++++RNV+EV++ LKKEL KT+D+ YEKN+EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLKIAMEMISSRNVEEVILLLKKELMKTVDEQYEKNSEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRPSIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDEASEGRESDEQV 507

Query: 198 XXXXXXTT--SSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                 T   + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR L+L GD+YL
Sbjct: 508 NGHAKSTAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLVLDGDYYL 567

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            +VL+STLTKLV+R++ +S+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRI
Sbjct: 568 ATVLSSTLTKLVMRHAELSQDTARTNALRAEAMLIMISIIRVGQSQFVKTFIDEDSVDRI 627

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           MSC+  L + +    +++VFL DTR +F  +V                   V VDD    
Sbjct: 628 MSCVRSLSEFAQRKELQTVFLEDTRKSFRTMVQTEEKKRAAKEASEKAKSAVNVDDSFNI 687

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQ  K++  D +DE   DL RATG   + +D+ SKLSRVVQLTGFSD VYAEAYV VHQ+
Sbjct: 688 RQLKKKD-ADGSDEVGEDLERATGGDTATEDMTSKLSRVVQLTGFSDSVYAEAYVKVHQF 746

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+APH F +++ATIKVSST+TG
Sbjct: 747 DIVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVAPHDFINIQATIKVSSTDTG 806

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 807 VIFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSK 866

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDG 614
              LRE+L  +M  TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+  DG
Sbjct: 867 TKTLREFLKQLMACTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGEDG 926

Query: 615 AITGHVRIRSKTQGIALSLG 634
            ITG VRIRS++QG+ALSLG
Sbjct: 927 PITGFVRIRSRSQGLALSLG 946



>gi|330914072|ref|XP_003296483.1| hypothetical protein PTT_06597 [Pyrenophora teres f. teres 0-1]
 gi|311331327|gb|EFQ95412.1| hypothetical protein PTT_06597 [Pyrenophora teres f. teres 0-1]
          Length = 956

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/619 (60%), Positives = 469/619 (75%), Gaps = 4/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLGIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNPEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRVSIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDDASEGKDPAEQV 507

Query: 198 X-XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR LLL GD+YL 
Sbjct: 508 NGHAKAAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLLLDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+  IS+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHGEISQDAARTNALRAEAMLIMISIIRVGQSQFVKTFIDEDSVDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + S    +++VFL DTR +F  +V                   V VDD    R
Sbjct: 628 SCVRSLSEFSHRKELETVFLEDTRKSFRTMVQTEEKKRAAREASERAKSAVNVDDSFNIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q  K++  D  DE E DL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+D
Sbjct: 688 QLKKKD-SDGTDEIEQDLERATGGDTATEDLTSKLSRVVQLTGFSDSVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+ PH F +++ATIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVGPHDFVNIQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GA 615
             LRE+L  +M  TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+ D G 
Sbjct: 867 KTLREFLKQLMACTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDNGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 927 ITGFVRIRSRSQGLALSLG 945



>gi|482804728|gb|EOA81827.1| hypothetical protein SETTUDRAFT_165415 [Setosphaeria turcica Et28A]
          Length = 956

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/619 (60%), Positives = 468/619 (75%), Gaps = 4/619 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN EYR LLI SIH  
Sbjct: 328 SSTDLDVRKKSLGIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNTEYRSLLISSIHSA 387

Query: 79  AIKFSEVAANVVHVLMEFLGD-SNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D S+N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 388 AIKFPEVAASVVGSLMDFISDVSSNASAVDVISFVKEVVERFPDLRVSIIERLVSTLGEV 447

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GE+    KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 448 RAGKVYRGVLWIIGEFSLEAKDIRDAWKGIRSSLGEIPILASEQRLLDEASEGKDSSDQV 507

Query: 198 X-XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR LLL GD+YL 
Sbjct: 508 NGHAKAAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLLLDGDYYLA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL+STLTKLV+R+  IS+D  +TNALRAEAMLIM SIIRVGQS F    IDEDS DRIM
Sbjct: 568 TVLSSTLTKLVMRHGEISQDTARTNALRAEAMLIMISIIRVGQSHFVKTLIDEDSIDRIM 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L + +    I++VFL DTR +F  +V                   V VDD    R
Sbjct: 628 SCVRSLSEFAQRKEIQTVFLEDTRKSFRTMVQTEEKKRAAKEASERAKSAVNVDDSFNIR 687

Query: 377 QFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
           Q  K++  D  DE + DL RATG   + +DL SKLSRVVQLTGFSD VYAEAYV VHQ+D
Sbjct: 688 QLKKKD-ADGIDEIDQDLERATGGDSATEDLTSKLSRVVQLTGFSDSVYAEAYVKVHQFD 746

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           I+LDVL+VNQT+ETLQNL+IEFATLGDLK+VERP+  N+ PH F +++ATIKVSST+TGV
Sbjct: 747 IVLDVLLVNQTTETLQNLTIEFATLGDLKVVERPSTQNVGPHDFINIQATIKVSSTDTGV 806

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+  
Sbjct: 807 IFGNIIYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKA 866

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD-GA 615
             LRE+L  +M  TNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIEK+ D G 
Sbjct: 867 KSLREFLSQLMACTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEKEGDNGP 926

Query: 616 ITGHVRIRSKTQGIALSLG 634
           ITG VRIRS++QG+ALSLG
Sbjct: 927 ITGFVRIRSRSQGLALSLG 945



>gi|443925245|gb|ELU44124.1| coatomer beta subunit [Rhizoctonia solani AG-1 IA]
          Length = 972

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/630 (62%), Positives = 468/630 (74%), Gaps = 40/630 (6%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKN---NEYRQLLIQSIH 76
           SPD++VRRK L IAL +VT+RNV+EVV  LKK L++T + + EK     EYRQLLIQSIH
Sbjct: 356 SPDLDVRRKCLGIALGMVTSRNVEEVVGLLKKALARTTEAEAEKTPGTTEYRQLLIQSIH 415

Query: 77  GCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMD 136
            CAIKFSEVAA+VVH LMEFLGD+NNPAAVDV+AFVREVVEKFPNLR +IT +LLETF +
Sbjct: 416 VCAIKFSEVAASVVHALMEFLGDTNNPAAVDVVAFVREVVEKFPNLRGAITSRLLETFSE 475

Query: 137 VKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXX 196
           +KSGKVFRG LWIVGEYCS   +IE  +++IR  LGEIPILA+EQRLL            
Sbjct: 476 IKSGKVFRGGLWIVGEYCSGASEIESVFEKIREVLGEIPILAAEQRLLDAATAAAAEDDT 535

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                  T SS+ RILADGTYATETA+S+   T A+LEA+K A KPPLR+L+L GDFY G
Sbjct: 536 DKDKKESTKSSAPRILADGTYATETAYSN---TGARLEAVKNANKPPLRALILGGDFYTG 592

Query: 257 SVLASTLTKLVLRYSGISE--DPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           SVLA+TLTKLVLRY G +E  D K+ N+LRAEAMLIM S+IRVGQSQF + PIDEDS +R
Sbjct: 593 SVLAATLTKLVLRY-GEAEGVDVKRANSLRAEAMLIMTSLIRVGQSQFVTVPIDEDSQER 651

Query: 315 IMSCLHILE--QISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDL 372
           IM+C+  L   +++ +  +K +FL DT+AA+A++V                   +Q DDL
Sbjct: 652 IMNCVQTLASTELAKNTRVKEMFLKDTKAAYAKMVAHEEKKAAEKKARDTKKTAIQADDL 711

Query: 373 IVFRQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
           I FRQF+K+   +  D+YEL+++RATG A+    +IS LSRVVQLTGFSDPVYAEAYV +
Sbjct: 712 ITFRQFTKKATNEGLDDYELEVSRATGAAEVGGSIISNLSRVVQLTGFSDPVYAEAYVKI 771

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
             +DILLDVLIVNQT++TLQNL IEFATLGD+KLVERPT H L PHSFHSVKATIKVSST
Sbjct: 772 QGFDILLDVLIVNQTTDTLQNLVIEFATLGDVKLVERPTTHTLGPHSFHSVKATIKVSST 831

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNI+++  GTSE+ CVVLNDIHIDIMDYI PAYCNE QFRSMWTEFEWEN+VNV
Sbjct: 832 ETGVIFGNIIWEA-GTSET-CVVLNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWENRVNV 889

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK-Q 611
           NT IT  R++                          S  +    I GEDALAN+SIEK +
Sbjct: 890 NTTITHSRQF--------------------------SRTVVTHQIKGEDALANLSIEKIE 923

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKITLAQ 641
             G I GHVRIRSKTQGIALSLGDKITL Q
Sbjct: 924 GTGNIQGHVRIRSKTQGIALSLGDKITLVQ 953



>gi|169623680|ref|XP_001805247.1| hypothetical protein SNOG_15084 [Phaeosphaeria nodorum SN15]
 gi|160705025|gb|EAT77627.2| hypothetical protein SNOG_15084 [Phaeosphaeria nodorum SN15]
          Length = 915

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/618 (60%), Positives = 468/618 (75%), Gaps = 14/618 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+K+L IA+E++++RNV+EVV+ LKKEL KT+D+ YEKN+EYR LLI SIH  
Sbjct: 299 SSTDLDVRKKSLNIAMEMISSRNVEEVVLLLKKELMKTVDEQYEKNSEYRSLLISSIHSA 358

Query: 79  AIKFSEVAANVVHVLMEFLGDSN-NPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           AIKF EVAA+VV  LM+F+ D N N +AVDVI+FV+EVVE+FP+LR SI E+L+ T  +V
Sbjct: 359 AIKFPEVAASVVGSLMDFISDVNSNASAVDVISFVKEVVERFPDLRQSIIERLVSTLGEV 418

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++GKV+RG LWI+GEY  + KDI +AWK IR+ LGEIPILASEQRLL             
Sbjct: 419 RAGKVYRGVLWIIGEYSLDAKDIRDAWKGIRSSLGEIPILASEQRLLDDASEGKEAEQVN 478

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                   + SR++LADGTYATE+A +S+++  AKLEA+K + KPPLR L+L GD+YL +
Sbjct: 479 GNGKPAAPTGSRKVLADGTYATESALTSSAAAKAKLEAVKNSQKPPLRQLVLDGDYYLAT 538

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           VL+STLTKLV+R++ IS+D  +TNALRAEAMLIM SIIRVGQSQF    IDEDS DR+MS
Sbjct: 539 VLSSTLTKLVMRHAEISKDAARTNALRAEAMLIMISIIRVGQSQFVKTLIDEDSIDRVMS 598

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
                        +++VFL DTR +FA +V                   V VDD    RQ
Sbjct: 599 -----------KELETVFLEDTRKSFAAMVQTEEKKRAAKEASERAKSAVNVDDSFNIRQ 647

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
             K++  D +DE E DL RATG   + +D+ SKLSRVVQLTGFSD VYAEAYV VHQ+DI
Sbjct: 648 LKKKD-ADSSDEIEQDLERATGGDTATEDMTSKLSRVVQLTGFSDSVYAEAYVKVHQFDI 706

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETLQNL++EFATLGDLK+VERP   N+ PH F +++ATIKVSST+TGVI
Sbjct: 707 VLDVLLVNQTTETLQNLTVEFATLGDLKVVERPPTQNVGPHDFINIQATIKVSSTDTGVI 766

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNI+Y+G    +SN V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+   
Sbjct: 767 FGNILYEGEKGVDSNVVILNDVHVDIMDYIKPAQCTETQFRTMWTEFEWENKVNINSKAK 826

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ-TDGAI 616
            LRE+L  +M STNMSCLTPE ++ GDC FLSAN+YARS+FGEDALAN+SIE++ T G I
Sbjct: 827 TLREFLKQLMASTNMSCLTPEASMKGDCQFLSANLYARSVFGEDALANLSIEQEGTSGPI 886

Query: 617 TGHVRIRSKTQGIALSLG 634
           TG VRIRS++QG+ALSLG
Sbjct: 887 TGFVRIRSRSQGLALSLG 904



>gi|302683943|ref|XP_003031652.1| hypothetical protein SCHCODRAFT_55550 [Schizophyllum commune H4-8]
 gi|300105345|gb|EFI96749.1| hypothetical protein SCHCODRAFT_55550 [Schizophyllum commune H4-8]
          Length = 955

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/626 (59%), Positives = 471/626 (75%), Gaps = 7/626 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S DIEVRRKA+ I L + ++RNV+EVV++LKK+L KT + D+EK  EYRQLLIQSIH  
Sbjct: 332 SSTDIEVRRKAMSIILSMTSSRNVEEVVMYLKKQLQKTQEVDFEKAPEYRQLLIQSIHVT 391

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFSEVAA+VVH LM+FLGD+NNP+A+DV+AFVREVVEKFP LR SIT  L+ T   +K
Sbjct: 392 AIKFSEVAASVVHSLMDFLGDTNNPSALDVVAFVREVVEKFPALRPSITTHLVSTLPSIK 451

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG LWI+GEY +   DI+   +++R  LGEIPILASEQR L              
Sbjct: 452 SGKVFRGVLWILGEYVAEVPDIQATMQEVRKVLGEIPILASEQRALDEAAGTVDAEGGED 511

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                 TS+  ++LADGTYATETA+S+   +   + + K+  KPPLR+L+L GDF+ G+V
Sbjct: 512 AEEGVKTSTRPKVLADGTYATETAYSTAGPS--SVPSTKS--KPPLRALILGGDFFTGAV 567

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LA  LTKLVLR+S +SED    N LRAEAMLIMAS+IRVGQS+F +  IDEDS +RIM C
Sbjct: 568 LAVALTKLVLRFSELSEDKDALNGLRAEAMLIMASVIRVGQSKFVTVQIDEDSNERIMQC 627

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIV-XXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           +  L ++  + ++  +FL D++ A+ R++                    VQVDDLI F Q
Sbjct: 628 IQTLSELEDEKAVHDIFLRDSQTAYTRMLGAQEKRAAEAKAAESAKPAVVQVDDLITFSQ 687

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK+   D+  + + D+ RATG  D ++D IS LSR+ QLTGFSDP+YAEAYV +H +DI
Sbjct: 688 FSKKA-ADDIIDDDEDVIRATGAGDVQEDFISNLSRISQLTGFSDPIYAEAYVKMHGFDI 746

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ TLQNL ++FATLGDLK+VERP  + + PH F S+KATIKVSSTETGVI
Sbjct: 747 ILDVLLVNQTANTLQNLCLDFATLGDLKIVERPAVYTIGPHGFQSIKATIKVSSTETGVI 806

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FG+I+++GP  +ES CV+LNDIHIDIMDYI PAYCNE QFRSMWTEFEWEN+VNV  +  
Sbjct: 807 FGSILWEGPNLAES-CVILNDIHIDIMDYIKPAYCNEAQFRSMWTEFEWENRVNVGNSTI 865

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
           D R+YL  +MK+TNMSCLTPE ALSGDC FLSANMYARS+FGEDALAN+S+E+  +G IT
Sbjct: 866 DPRDYLQLVMKATNMSCLTPEGALSGDCDFLSANMYARSLFGEDALANLSVERTENGTIT 925

Query: 618 GHVRIRSKTQGIALSLGDKITLAQKA 643
           GHVRIRSKTQGIALSLGD+IT+ + +
Sbjct: 926 GHVRIRSKTQGIALSLGDRITMGKSS 951



>gi|505757709|gb|EOR01830.1| Coatomer subunit beta [Wallemia ichthyophaga EXF-994]
          Length = 973

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/639 (59%), Positives = 475/639 (74%), Gaps = 22/639 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EV+RKAL+I LE+VT+RNV +V+ +LKKEL KT   QD E+  EYRQLLIQSIH 
Sbjct: 338 SAPDMEVKRKALKIVLEMVTSRNVDQVIDYLKKELIKTTSSQDLERLVEYRQLLIQSIHN 397

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
            ++K+S+VA++V+  LM FLGDSNNP+A+DVIAFVREVVEKFP LR +I  +L +TF  +
Sbjct: 398 ISVKYSQVASSVIETLMSFLGDSNNPSAIDVIAFVREVVEKFPTLRPTIINQLFKTFHHI 457

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KSGKVFRGALWI+GEY  +  DI+ A++++R  LG+IPILA+EQ+               
Sbjct: 458 KSGKVFRGALWIIGEYAESSDDIQIAFEKMRGVLGQIPILAAEQQAYDAQEYTEDKEATN 517

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 TT    ++LADGTYATET  S+ +   ++L A+KAA KPPLR L+L+GDF+  S
Sbjct: 518 ENKLVTTT----KVLADGTYATETTVST-AEDASRLAAVKAATKPPLRGLVLNGDFFTAS 572

Query: 258 VLASTLTKLVLRY-SGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           VLASTLTKLVLR  S    D    NA +AEAML+M SI+RVGQ++F S  IDEDS +RI+
Sbjct: 573 VLASTLTKLVLRLVSNNDTDSSVQNAHKAEAMLMMTSIVRVGQTKFVSTAIDEDSAERIL 632

Query: 317 SCLHILEQI--STDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            C+  L +   +   S   VFLHDT+ A+A +V                   VQ DD+I 
Sbjct: 633 GCVTALAETNAAASASFTGVFLHDTKQAYATMVADAEAKAAEKARSTERVHKVQPDDVIS 692

Query: 375 FRQFSK-RNIGDEADEYELDLTRATG--QADS-RDDLISKLSRVVQLTGFSDPVYAEAYV 430
           FR F K R++  +  E+ELDL+RATG  +AD+  DD +SKL R+VQLTGFSD VYAEAYV
Sbjct: 693 FRHFKKSRDV--DTREFELDLSRATGGTEADAVGDDFMSKLQRIVQLTGFSDSVYAEAYV 750

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           N+HQ+DI+LDVL+VNQT  TL NL+IEFATLGDLK+VERP+   LAPH+FH++KA++KVS
Sbjct: 751 NIHQFDIILDVLLVNQTGYTLSNLNIEFATLGDLKIVERPSTTTLAPHAFHTLKASVKVS 810

Query: 491 STETGVIFGNIVYDG----PGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEW 546
           STETGVIFGNI +D      G+ E   +VLNDIH+DIMDYI PA C E+QFR+MW+EFEW
Sbjct: 811 STETGVIFGNIAFDALGSGGGSGEGTNIVLNDIHVDIMDYIKPATCTESQFRAMWSEFEW 870

Query: 547 ENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANI 606
           ENKV+VNT I DLR YL HIMKSTNM+CLTP+ ++SG+C FLSANMYARS+FGEDALANI
Sbjct: 871 ENKVHVNTTIDDLRVYLQHIMKSTNMACLTPDASMSGECDFLSANMYARSVFGEDALANI 930

Query: 607 SIEKQTD---GAITGHVRIRSKTQGIALSLGDKITLAQK 642
           S+EK  D   G I GHVRIRSKTQGIALSLGDKI+LAQK
Sbjct: 931 SLEKTVDVGEGCIQGHVRIRSKTQGIALSLGDKISLAQK 969



>gi|465792498|emb|CCU97609.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 963

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/662 (54%), Positives = 462/662 (69%), Gaps = 27/662 (4%)

Query: 1   EKHDQTXXXXXXXXXXXXTSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD 60
           ++HD              +S D++VR+K L +ALE+++ R V+EVV+ L+KEL+KT  Q 
Sbjct: 310 QRHDHVLDPLVIELLRVLSSSDMDVRKKVLDMALEMMSIRTVEEVVLTLRKELTKT-SQS 368

Query: 61  YEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFP 120
            + N +YRQLLI+S+H CA++FSEVA +V+  LM FLGDS++ +AVDVIAFVREVVE+FP
Sbjct: 369 QDANTDYRQLLIKSLHTCAVRFSEVAGDVMRELMNFLGDSSSTSAVDVIAFVREVVERFP 428

Query: 121 NLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASE 180
           ++R +I  KL+ +F D ++GKV+RGALW+VG+YC +   + EA +QIR  LGE+PILA+E
Sbjct: 429 DMRENILAKLISSFSDFRNGKVYRGALWVVGDYCMSINSVNEAMQQIRQVLGEVPILAAE 488

Query: 181 QRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAV 240
           +R                      T  + R+ ADGTYATE+A +      A +E   +  
Sbjct: 489 ER---AAEQTEQPSVEDEPSSAPRTVPTTRVRADGTYATESALTVE----APIEKPSSRS 541

Query: 241 KPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQS 300
           KPPLRSL+L GDFY  SVLA+TL KLVLR+  +S D    N LRAEAMLIM SI+RVGQS
Sbjct: 542 KPPLRSLILFGDFYTASVLAATLVKLVLRFLSLSSDEAANNRLRAEAMLIMTSIVRVGQS 601

Query: 301 QFASNPIDEDSYDRIMSCLHILEQISTDY----SIKSVFLHDTRAAFARIVXXXXXXXXX 356
           ++ +  IDEDS +RIM+CL IL + +T      +   VFL  +R A+A ++         
Sbjct: 602 KYVAATIDEDSKERIMTCLQILGRATTSLDEAQAAAEVFLDASRDAYAHVLQHERQKESE 661

Query: 357 XXXXXXXXXTVQVDDLIVFRQFSKRNIGDEADEYELDLTRATGQ-ADSRDDLISKLSRVV 415
                     +Q    + FR        DE  ++  +L+RATG  A  +DD ISKL RVV
Sbjct: 662 RSNRHQEETLIQPQTQLSFRLLGDSKGQDEEIDFTAELSRATGMSAVPKDDFISKLQRVV 721

Query: 416 QLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNL 475
           QLTGFSDP+YAEAYV+VHQ+DILLD+L+VNQT ET QN+S+E ATLGDLKLVERP+ + L
Sbjct: 722 QLTGFSDPIYAEAYVDVHQFDILLDILVVNQTQETFQNMSVELATLGDLKLVERPSTYTL 781

Query: 476 APHSFHSVKATIKVSSTETGVIFGNIVYD-----GPGTSESNCVVLNDIHIDIMDYINPA 530
           AP+SF S+KATIKVSSTETGVIFGNIVY+        T +S+ VVLNDIH+D+MDYI+P+
Sbjct: 782 APYSFQSIKATIKVSSTETGVIFGNIVYERASGGASSTGDSSYVVLNDIHVDVMDYISPS 841

Query: 531 YCNETQFRSMWTEFEWENKVNVNTNI---------TDLREYLGHIMKSTNMSCLTPEVAL 581
             NETQFRSMWT FEWENKVNV TN+         +D+REYL HIMK+TNM+CLTPE +L
Sbjct: 842 VVNETQFRSMWTGFEWENKVNVKTNLSYVWNKLTCSDVREYLRHIMKATNMACLTPEASL 901

Query: 582 SGDCGFLSANMYARSIFGEDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQ 641
           +G+CGFLSAN+ A S+FGEDALAN+SIE+  DG I GHVRIRSKTQGIALSLGDKITL  
Sbjct: 902 AGECGFLSANLSASSLFGEDALANVSIERLDDGTIQGHVRIRSKTQGIALSLGDKITLGT 961

Query: 642 KA 643
            A
Sbjct: 962 YA 963



>gi|164660098|ref|XP_001731172.1| hypothetical protein MGL_1355 [Malassezia globosa CBS 7966]
 gi|159105072|gb|EDP43958.1| hypothetical protein MGL_1355 [Malassezia globosa CBS 7966]
          Length = 956

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/638 (55%), Positives = 465/638 (72%), Gaps = 23/638 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SPDI+VR+K L +AL++++ R V+EVV+ L+KEL+KT  Q  + +  YR LLI+S+H C
Sbjct: 328 SSPDIDVRKKVLEMALDMLSVRTVEEVVLVLRKELAKT-TQAQDASTPYRHLLIKSLHAC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A++FSEVA +V+  LM FL DS + +AVDVIAFVREVVE+FP++R  I  KL+++F + +
Sbjct: 387 AVRFSEVAGDVMLELMNFLSDSGSTSAVDVIAFVREVVERFPDMRDDILGKLIQSFPEFR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV+RGA+WIVG+Y ++  ++ +A +QIR  LGEIPILASE++ +              
Sbjct: 447 NGKVYRGAMWIVGDYATSISNVNDAMQQIRKVLGEIPILASEKQQMDQSETAGAMTDDNV 506

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSN----SSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                  S +R + ADGTYATE+AF+++     S+L++        KPPLRSL+L GD+Y
Sbjct: 507 ASAPKPVSMTR-VRADGTYATESAFTTDTTTDKSSLSR-------SKPPLRSLILFGDYY 558

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
             SVL++TL KLVLR+  +S D    N LRAEAMLIM SI+RV QS++ +  IDEDS +R
Sbjct: 559 TASVLSATLVKLVLRFMNVSSDEGAKNMLRAEAMLIMTSILRVAQSKYVTAQIDEDSKER 618

Query: 315 IMSCLHILEQISTDY----SIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVD 370
           I++CL IL   +  +    +   VFL ++R A+A ++                    Q  
Sbjct: 619 IVTCLQILGSATQSFEEAEAAAQVFLDESRRAYASMLTHERQRVSKSNETQNRAPIQQPH 678

Query: 371 DLIVFRQFSKRNIGDEADEYELDLTRATGQAD-SRDDLISKLSRVVQLTGFSDPVYAEAY 429
             ++FRQ       D+  +YE DL RATG    S+DD ISKL RVVQLTGFSDPVYAEAY
Sbjct: 679 QQLLFRQLGGPETLDDDIDYETDLNRATGMGTVSKDDFISKLQRVVQLTGFSDPVYAEAY 738

Query: 430 VNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKV 489
           V+VHQ+DILLDVL+VNQT ET QNLSIE ATLGDLKLVERP+ + +AP+SF S+KATIKV
Sbjct: 739 VDVHQFDILLDVLVVNQTDETFQNLSIELATLGDLKLVERPSSYTIAPYSFQSIKATIKV 798

Query: 490 SSTETGVIFGNIVYD----GPGTS-ESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEF 544
           SSTETGVIFGNIVY+    G G+S +S+ VVLN+IHIDIMDYI+P+Y +ET+FRSMWT F
Sbjct: 799 SSTETGVIFGNIVYEKASVGSGSSKDSSYVVLNEIHIDIMDYISPSYVSETEFRSMWTGF 858

Query: 545 EWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALA 604
           EWENKVNV T+I+D+R+YL HIMK+TNM+CLTPE +L+G+CGFLSAN+ A S+FGEDALA
Sbjct: 859 EWENKVNVKTDISDVRQYLEHIMKATNMACLTPEASLAGECGFLSANLSATSLFGEDALA 918

Query: 605 NISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           N+SIE+  +G I GHVRIRSKTQGIALSLGDK+++  +
Sbjct: 919 NVSIERLDNGTIQGHVRIRSKTQGIALSLGDKLSMGTR 956



>gi|512194834|gb|EPE10590.1| coatomer subunit beta [Ophiostoma piceae UAMH 11346]
          Length = 876

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/546 (62%), Positives = 419/546 (76%), Gaps = 4/546 (0%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           SPDI+VRRKAL I LE+V+++NV+EVV+ LKKE+SKT+DQ+YEKN EYRQLLI +IH CA
Sbjct: 329 SPDIDVRRKALEIGLEMVSSKNVEEVVLLLKKEISKTVDQEYEKNAEYRQLLIHNIHQCA 388

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           IKFSEVAA+VV +LM+F+ D NN +AVDVI FV+EVVEKFP LR +I  KL++T  +V++
Sbjct: 389 IKFSEVAASVVDLLMDFVSDFNNASAVDVIDFVKEVVEKFPKLRPTIVRKLVDTLGEVRA 448

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXX--XXXXXXXXX 197
           GKV+RG LWI+GEY  N  DI EAWK+IRA LGEIPILASEQRLL               
Sbjct: 449 GKVYRGILWIIGEYSLNEDDIREAWKRIRASLGEIPILASEQRLLDQGEDDESKDTEKVN 508

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSST-LAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                   + SRR+LADGTYATETAF+S++S   A+LEA+KAA KPPLR L+L GD+YL 
Sbjct: 509 GNGKPAAPTGSRRVLADGTYATETAFTSHTSAATARLEAVKAAQKPPLRQLILDGDYYLA 568

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +VL++TLTKLV+R+S IS D  +TNALRAEAMLIM SI+RVGQS+F   PIDEDS DRIM
Sbjct: 569 TVLSATLTKLVMRHSEISSDVARTNALRAEAMLIMISIVRVGQSKFVKAPIDEDSVDRIM 628

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           + +  L + S    +++VFL DTR AF  +V                   +QVDD++  R
Sbjct: 629 TSVRSLAEFSEHKELETVFLDDTRKAFRAMVVAEEKKRAAKEADEKAKTAIQVDDVVQIR 688

Query: 377 QFSKRNIGDEADEYELDLTRATGQADS-RDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           Q SK+N  D +D  E DL RATG  +S  +DL SKLSRVVQLTGFSDPVYAEAYV VHQ+
Sbjct: 689 QLSKKNALDSSDLAEADLDRATGGDNSGTEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQF 748

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDVL+VNQT++TLQNLS+EFATLGDLK+VERPT  NL PH FH+V+ TIKVSST+TG
Sbjct: 749 DIVLDVLLVNQTTDTLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTG 808

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGN+VYDG  ++++N V+LND+H+DIMDYI PA C ETQFR+MWTEFEWENKVN+N+ 
Sbjct: 809 VIFGNVVYDGAHSTDTNVVILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNINSK 868

Query: 556 ITDLRE 561
              LR+
Sbjct: 869 APTLRK 874



>gi|320581205|gb|EFW95426.1| coatomer beta subunit [Ogataea parapolymorpha DL-1]
          Length = 1458

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/620 (53%), Positives = 434/620 (70%), Gaps = 17/620 (2%)

Query: 19   TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
            ++P ++VR+KA+ I L LVT++NV +VV  LKKEL KT   + EK++EYRQLLI +IH C
Sbjct: 840  SAPSLDVRQKAIEITLSLVTSKNVDDVVKLLKKELQKTTTSNEEKSSEYRQLLISAIHSC 899

Query: 79   AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
            AI+F EVAA+VV +L++F+ + N  AA +VI FV++VVEKFP+LRS I ++L+ +   +K
Sbjct: 900  AIRFHEVAASVVDLLLDFISELNTTAAAEVITFVKQVVEKFPDLRSHIIQRLIVSLKTIK 959

Query: 139  SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
            SGK+FRG+LWI+GEY  + KDI+ AWK IRA +G+IPILA+E++                
Sbjct: 960  SGKIFRGSLWIIGEYSLDEKDIQTAWKAIRASIGDIPILAAEKK---------GHDEEQE 1010

Query: 199  XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                    +  +ILADGTYATE A   + +T     A+  A K PLR+LLL GDFYLGSV
Sbjct: 1011 EEVKTNGHTGPKILADGTYATEVALGDSKTT-----AVSTATKHPLRALLLEGDFYLGSV 1065

Query: 259  LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
            LASTL K+VLR S I+      NAL+AEAMLIM SI+R G+S      IDEDS +RI+SC
Sbjct: 1066 LASTLVKMVLRLSKITSKTDLLNALKAEAMLIMVSILRAGESSLVKKRIDEDSAERILSC 1125

Query: 319  LHILEQISTDYS-IKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
            +  L +   D S I   FL DT+ A+ + +                    QVDD IVFRQ
Sbjct: 1126 VRFLSEEGKDESLIDEAFLDDTKKAYKQQLAAEAQQLKDKEQASVQNNAEQVDDAIVFRQ 1185

Query: 378  FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
             + ++  ++ DE   DLT A G    ++DL S+L ++ QLTGFSDPVYAEAYV VHQ+D+
Sbjct: 1186 LNTKDKVEDLDEE--DLTLAAGATVVKEDLSSRLKKIKQLTGFSDPVYAEAYVKVHQFDV 1243

Query: 438  LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
             LDVL+VNQT+ETL+NLS+EFATLGDLK+V++PT  N+ PH+FH V+ TIKV+S +TGVI
Sbjct: 1244 TLDVLLVNQTTETLRNLSVEFATLGDLKVVDKPTTQNIGPHAFHRVQTTIKVTSADTGVI 1303

Query: 498  FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
            FGNIVYDG    E+  V+L+D+H+DIMDYI PA C E QFR MW EFEWENK++V +N+ 
Sbjct: 1304 FGNIVYDGQHADENTIVILSDLHVDIMDYIKPATCTEAQFRKMWNEFEWENKISVKSNLP 1363

Query: 558  DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
             L+EYL  +++ TNM+ LTP   +  +C FLSAN+Y+RS FGEDALAN+ IEK  +G I 
Sbjct: 1364 TLKEYLDELLEGTNMNNLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKTAEGPIV 1423

Query: 618  GHVRIRSKTQGIALSLGDKI 637
            GHVRIRSK QG+ALSLGDK+
Sbjct: 1424 GHVRIRSKGQGLALSLGDKV 1443



>gi|294658846|ref|XP_461182.2| DEHA2F19272p [Debaryomyces hansenii CBS767]
 gi|202953430|emb|CAG89570.2| DEHA2F19272p [Debaryomyces hansenii CBS767]
          Length = 948

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/630 (51%), Positives = 433/630 (68%), Gaps = 20/630 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KA+ + L+ +T+RNV+EVV  LKKEL +T   + +KN+EYRQLLI +IH  
Sbjct: 326 SSQDLDVRKKAIDVTLQFITSRNVEEVVKLLKKELQRTSSSNEDKNSEYRQLLINAIHQL 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI+F EVAANV+ +L+E + D +  AA +VI F++EVVEKFP+LR SI  +L+E    VK
Sbjct: 386 AIRFVEVAANVIDLLLESMTDLSTAAAYEVITFIKEVVEKFPDLRQSILSRLIEALPSVK 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG+LWI+GEYC   K ++EAW+ IR+ +GE+PILASE++                
Sbjct: 446 SGKVFRGSLWIIGEYCMEDKLVQEAWRYIRSSIGEVPILASEKK-----STEGSEHNDED 500

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                     +R  +L DGTYATE A ++   T    E      KPP+R L+L GDFYLG
Sbjct: 501 ETNGSVEKPKKRPVVLPDGTYATENALTTEIKTSVDEE------KPPIRRLILEGDFYLG 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SVLASTL KLVLR    +   K  NAL+AEA+LIM SI+RVG+S +    IDEDS DRI 
Sbjct: 555 SVLASTLVKLVLRLQRNATQEKYLNALKAEAILIMVSILRVGESSYVEKKIDEDSADRIF 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L   +    I++ FL DT+ AF   +                    QVDD IVFR
Sbjct: 615 SCVKYLTDETDSQLIQTSFLDDTKDAFKSQIETAELKKAEAEAKDFHENAEQVDDSIVFR 674

Query: 377 QFSKRNI--GDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQ 434
           QF K +   G   D    DL+ A G    ++DL S+L++++QLTGFSDP+YAEA+V VHQ
Sbjct: 675 QFDKDSTARGSNLD----DLSLAAGSDLKKEDLSSRLNKILQLTGFSDPIYAEAFVKVHQ 730

Query: 435 YDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTET 494
           YD++LDVL+VNQT+ TL+NLS+EFATLGDLK+V++P   N+ PH FH ++ TIKV+S +T
Sbjct: 731 YDVVLDVLLVNQTTNTLRNLSVEFATLGDLKVVDKPATANIGPHGFHKIQTTIKVTSADT 790

Query: 495 GVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNT 554
           GVIFGNIVYDG  + +S  V+LND+H+DIMDYI PA C E+ FR MW EFEWENK+ +  
Sbjct: 791 GVIFGNIVYDGQHSDDSTIVILNDVHVDIMDYIKPATCTESTFRKMWNEFEWENKITIKA 850

Query: 555 NITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDG 614
            +  L++YL  +MK TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG
Sbjct: 851 QMDSLKDYLEEMMKGTNMNCLTPGAIIGEECQFLSANLYSRSSFGEDALANLCIEKQSDG 910

Query: 615 AITGHVRIRSKTQGIALSLGDKI-TLAQKA 643
            I GHVRIRSK QG+ALSLGD++ ++++KA
Sbjct: 911 PIIGHVRIRSKGQGLALSLGDRVASISRKA 940



>gi|149068231|gb|EDM17783.1| coatomer protein complex, subunit beta 1, isoform CRA_b [Rattus
           norvegicus]
          Length = 947

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/637 (51%), Positives = 448/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 324 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 383

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 384 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 443

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 444 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 494

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 495 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 548

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 549 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 608

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 609 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 666

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 667 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 726

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 727 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 786

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 787 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 846

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+TDL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 847 VTVNTNVTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 906

Query: 610 KQT----DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 907 KPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 943



>gi|507533686|ref|XP_004650903.1| PREDICTED: coatomer subunit beta [Jaculus jaculus]
          Length = 953

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/637 (51%), Positives = 448/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           T+PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 TTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR+ I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVMEFVREAIQRFDNLRTLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPAQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|18158449|ref|NP_542959.1| coatomer subunit beta [Rattus norvegicus]
 gi|116923|sp|P23514.1|COPB_RAT RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|55819|emb|CAA40505.1| beta COP [Rattus norvegicus]
 gi|38197648|gb|AAH61882.1| Coatomer protein complex, subunit beta 1 [Rattus norvegicus]
 gi|149068232|gb|EDM17784.1| coatomer protein complex, subunit beta 1, isoform CRA_c [Rattus
           norvegicus]
          Length = 953

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/637 (51%), Positives = 448/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+TDL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNVTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQT----DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|15426055|ref|NP_203534.1| coatomer subunit beta [Mus musculus]
 gi|13124070|sp|Q9JIF7.1|COPB_MOUSE RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|8571380|gb|AAF76856.1|AF231925_1 COPI coatomer complex, beta subunit [Mus musculus]
 gi|21410372|gb|AAH30837.1| Coatomer protein complex, subunit beta 1 [Mus musculus]
 gi|74186175|dbj|BAE42886.1| unnamed protein product [Mus musculus]
 gi|148685113|gb|EDL17060.1| coatomer protein complex, subunit beta 1, isoform CRA_b [Mus
           musculus]
          Length = 953

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/637 (51%), Positives = 448/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+TDL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQT----DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|327281271|ref|XP_003225372.1| PREDICTED: coatomer subunit beta-like [Anolis carolinensis]
          Length = 953

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDYNEAAAADVLEFVREAIQRFENLRLLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPAQKLVTEMGTYATQSALSSSRP------AKKEEERPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPDAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|354488599|ref|XP_003506455.1| PREDICTED: coatomer subunit beta [Cricetulus griseus]
          Length = 953

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 447/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQT----DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|224285129|gb|ACN40292.1| unknown [Picea sitchensis]
          Length = 948

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/630 (53%), Positives = 422/630 (66%), Gaps = 14/630 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IALEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+L+Q+IH C
Sbjct: 326 SSPNLDIRRKTLDIALELITPRNIDEVVMTLKKEVVKTQSGELEKNGEYRQMLVQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LMEFLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMEFLGDSNLASAMDVVLFVREIIETNPKLRVSIIARLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           S +V   ALWI+GEYC +  ++E     I   LGE+P     +                 
Sbjct: 446 SSRVCSCALWIIGEYCLSLSEVENGISTINQCLGELPFYTVAE-------DAEGLVTNKS 498

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T SSRR  ILADGTYAT++A S  +   A +    AA    LRS+LL+GDF+LG
Sbjct: 499 QPANAITVSSRRPAILADGTYATQSAASEIAVATAAMLPGSAAATGNLRSILLTGDFFLG 558

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +V+A TLTKL+LR   +       N   AEA+LIM S++R+GQS    +PID+DSYDRI 
Sbjct: 559 AVIACTLTKLILRLDEVQPSGVAVNKAAAEALLIMVSMLRLGQSSVLPHPIDDDSYDRIS 618

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
            C+ IL     D   K V+L   R +F  ++                    Q DDLI FR
Sbjct: 619 LCIRILT--CPDDFFKKVWLQSCRESFMNMLADKQFRETEENKAKAQVSHAQPDDLIDFR 676

Query: 377 QFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVH 433
               R    +    DE E DL RATG+       ++KL+R++QLTGFSDPVYAEAYV VH
Sbjct: 677 LLKSRKGMSQLELEDEVEDDLKRATGEFVKDGGSMNKLNRILQLTGFSDPVYAEAYVTVH 736

Query: 434 QYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTE 493
           QYDI+LDV ++N+T +TLQNL +E AT+GDLKLVERP  + LAP S   +KA IKVSSTE
Sbjct: 737 QYDIVLDVTVINRTKDTLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTE 796

Query: 494 TGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVN 553
           TGVIFGNIVY+     + N VVLNDIHIDIMDYI+PA C +  FR+MW EFEWENKV VN
Sbjct: 797 TGVIFGNIVYETTSVLDRNVVVLNDIHIDIMDYISPATCPDVAFRNMWAEFEWENKVAVN 856

Query: 554 TNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD 613
           T I D +E+L HI+ STNM CL P  AL GDCGFL+AN+YA+S+FGEDAL N+S+EKQ D
Sbjct: 857 TTIQDEKEFLTHIVNSTNMKCLAPLSALDGDCGFLAANLYAKSVFGEDALVNVSVEKQPD 916

Query: 614 GAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           G ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 917 GKLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|149634429|ref|XP_001507656.1| PREDICTED: coatomer subunit beta [Ornithorhynchus anatinus]
          Length = 953

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           T+PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 TTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F E+AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPEMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRLLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGE+PI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEVPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KAEEEVTAGPAQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AE+ML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFIAESMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N    + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNETSCKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPDAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|507949063|ref|XP_004683083.1| PREDICTED: coatomer subunit beta [Condylura cristata]
          Length = 953

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|296217627|ref|XP_002755030.1| PREDICTED: coatomer subunit beta isoform 1 [Callithrix jacchus]
 gi|296217629|ref|XP_002755031.1| PREDICTED: coatomer subunit beta isoform 2 [Callithrix jacchus]
 gi|296217631|ref|XP_002755032.1| PREDICTED: coatomer subunit beta isoform 3 [Callithrix jacchus]
          Length = 953

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 447/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|291384667|ref|XP_002708871.1| PREDICTED: coatomer protein complex, subunit beta 1 [Oryctolagus
           cuniculus]
          Length = 953

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEVTVGPVQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|395815306|ref|XP_003781171.1| PREDICTED: coatomer subunit beta isoform 1 [Otolemur garnettii]
 gi|395815308|ref|XP_003781172.1| PREDICTED: coatomer subunit beta isoform 2 [Otolemur garnettii]
 gi|395815310|ref|XP_003781173.1| PREDICTED: coatomer subunit beta isoform 3 [Otolemur garnettii]
          Length = 953

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|82181062|sp|Q66HV4.1|COPB_DANRE RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|51858536|gb|AAH81657.1| Coatomer protein complex, subunit beta 1 [Danio rerio]
          Length = 953

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/637 (50%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           T+PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 TTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           K+ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 KTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENELK---------KEAGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T + + +++ + GTY T++A S++  +       K   +PPLR  L+ GDFY+ 
Sbjct: 501 KPEEEVTAAPAPKLVTEMGTYVTQSALSTSRPSK------KEEDRPPLRGFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  ++ED ++ N+  AEAMLIMA+++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALAEDKRRQNSFVAEAMLIMATVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRRSLSHMLAVRLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMASKEDQFQLSLLAAMGNTQRKEATDPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNITDL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITDLNDYLLHILKSTNMKCLTPEKALSGICGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  + GH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGVDAPVNGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|326920038|ref|XP_003206283.1| PREDICTED: coatomer subunit beta-like [Meleagris gallopavo]
          Length = 953

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEVTVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVSLVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|426244754|ref|XP_004016182.1| PREDICTED: coatomer subunit beta [Ovis aries]
 gi|440912827|gb|ELR62360.1| Coatomer subunit beta [Bos grunniens mutus]
          Length = 953

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|397494753|ref|XP_003818236.1| PREDICTED: coatomer subunit beta isoform 1 [Pan paniscus]
 gi|397494755|ref|XP_003818237.1| PREDICTED: coatomer subunit beta isoform 2 [Pan paniscus]
 gi|397494757|ref|XP_003818238.1| PREDICTED: coatomer subunit beta isoform 3 [Pan paniscus]
          Length = 953

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKETADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|505840234|ref|XP_004613638.1| PREDICTED: coatomer subunit beta [Sorex araneus]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 447/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++ L+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLTLDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPAQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    T+Q DD I 
Sbjct: 615 LCLKVLSECSP--LMNEIFNKECRESLSHMLSAKLEEEKLSQKKESEKRNVTIQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      + A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|114636308|ref|XP_001172089.1| PREDICTED: coatomer subunit beta isoform 5 [Pan troglodytes]
 gi|114636310|ref|XP_001172109.1| PREDICTED: coatomer subunit beta isoform 7 [Pan troglodytes]
 gi|332835915|ref|XP_003312974.1| PREDICTED: coatomer subunit beta [Pan troglodytes]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKETADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|57530020|ref|NP_001006467.1| coatomer subunit beta [Gallus gallus]
 gi|82081062|sp|Q5ZIA5.1|COPB_CHICK RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|53136418|emb|CAG32538.1| hypothetical protein RCJMB04_28l17 [Gallus gallus]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEVTVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVSLVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|504168338|ref|XP_004593816.1| PREDICTED: coatomer subunit beta [Ochotona princeps]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/636 (51%), Positives = 442/636 (69%), Gaps = 28/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK--------KEAGELK 501

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                      + +   GTYAT++A SS+        A K   +PPLR  LL GDF++ +
Sbjct: 502 PEEEVAVGPVQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVAA 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI  
Sbjct: 556 SLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISL 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIVF 375
           CL +L + S    +  +F  + R + + ++                    T+Q DD I F
Sbjct: 616 CLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTIQPDDPISF 673

Query: 376 RQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV+
Sbjct: 674 MQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVH 733

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 734 VNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVAS 793

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENKV
Sbjct: 794 TENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKV 853

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTN+ DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIEK
Sbjct: 854 TVNTNMIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEK 913

Query: 611 Q----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 914 PIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|7705369|ref|NP_057535.1| coatomer subunit beta [Homo sapiens]
 gi|221316630|ref|NP_001137533.1| coatomer subunit beta [Homo sapiens]
 gi|221316632|ref|NP_001137534.1| coatomer subunit beta [Homo sapiens]
 gi|116241311|sp|P53618.3|COPB_HUMAN RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|17432239|gb|AAL39009.1|AF111807_1 MSTP026 [Homo sapiens]
 gi|7018432|emb|CAB66528.1| hypothetical protein [Homo sapiens]
 gi|22713553|gb|AAH37280.1| Coatomer protein complex, subunit beta 1 [Homo sapiens]
 gi|117645586|emb|CAL38259.1| hypothetical protein [synthetic construct]
 gi|119588887|gb|EAW68481.1| coatomer protein complex, subunit beta, isoform CRA_a [Homo
           sapiens]
 gi|119588888|gb|EAW68482.1| coatomer protein complex, subunit beta, isoform CRA_a [Homo
           sapiens]
 gi|119588889|gb|EAW68483.1| coatomer protein complex, subunit beta, isoform CRA_a [Homo
           sapiens]
 gi|119588890|gb|EAW68484.1| coatomer protein complex, subunit beta, isoform CRA_a [Homo
           sapiens]
 gi|119588891|gb|EAW68485.1| coatomer protein complex, subunit beta, isoform CRA_a [Homo
           sapiens]
 gi|123983328|gb|ABM83405.1| coatomer protein complex, subunit beta 1 [synthetic construct]
 gi|123998029|gb|ABM86616.1| coatomer protein complex, subunit beta 1 [synthetic construct]
 gi|307685339|dbj|BAJ20600.1| coatomer protein complex, subunit beta 1 [synthetic construct]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|348559918|ref|XP_003465762.1| PREDICTED: coatomer subunit beta [Cavia porcellus]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++A NV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAGNVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|470631112|ref|XP_004321868.1| PREDICTED: coatomer subunit beta [Tursiops truncatus]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|471358282|ref|XP_004369725.1| PREDICTED: coatomer subunit beta [Trichechus manatus latirostris]
          Length = 953

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|332211837|ref|XP_003255022.1| PREDICTED: coatomer subunit beta isoform 1 [Nomascus leucogenys]
 gi|332211839|ref|XP_003255023.1| PREDICTED: coatomer subunit beta isoform 2 [Nomascus leucogenys]
 gi|332211841|ref|XP_003255024.1| PREDICTED: coatomer subunit beta isoform 3 [Nomascus leucogenys]
 gi|402894155|ref|XP_003910236.1| PREDICTED: coatomer subunit beta isoform 1 [Papio anubis]
 gi|402894157|ref|XP_003910237.1| PREDICTED: coatomer subunit beta isoform 2 [Papio anubis]
 gi|402894159|ref|XP_003910238.1| PREDICTED: coatomer subunit beta isoform 3 [Papio anubis]
 gi|403254300|ref|XP_003919911.1| PREDICTED: coatomer subunit beta isoform 1 [Saimiri boliviensis
           boliviensis]
 gi|403254302|ref|XP_003919912.1| PREDICTED: coatomer subunit beta isoform 2 [Saimiri boliviensis
           boliviensis]
 gi|403254304|ref|XP_003919913.1| PREDICTED: coatomer subunit beta isoform 3 [Saimiri boliviensis
           boliviensis]
 gi|355566704|gb|EHH23083.1| Beta-coat protein [Macaca mulatta]
 gi|355752307|gb|EHH56427.1| Beta-coat protein [Macaca fascicularis]
          Length = 953

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|466055248|ref|XP_004279206.1| PREDICTED: coatomer subunit beta [Orcinus orca]
          Length = 953

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|297689219|ref|XP_002822052.1| PREDICTED: coatomer subunit beta isoform 1 [Pongo abelii]
 gi|395742997|ref|XP_003777852.1| PREDICTED: coatomer subunit beta isoform 2 [Pongo abelii]
 gi|395742999|ref|XP_003777853.1| PREDICTED: coatomer subunit beta isoform 3 [Pongo abelii]
          Length = 953

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|301775861|ref|XP_002923349.1| PREDICTED: coatomer subunit beta-like [Ailuropoda melanoleuca]
          Length = 953

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|75041667|sp|Q5R922.1|COPB_PONAB RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|55730026|emb|CAH91738.1| hypothetical protein [Pongo abelii]
          Length = 953

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLRHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|449280860|gb|EMC88085.1| Coatomer subunit beta [Columba livia]
          Length = 966

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 343 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 402

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 403 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRPLIVEKMLEVFHAI 462

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 463 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 513

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 514 KPEEEVSVGPAQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 567

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 568 ASLATTLTKIALRYVSLVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 627

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 628 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 685

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 686 FMQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 745

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 746 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 805

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 806 STENGIIFGNIVYDISGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 865

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 866 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 925

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 926 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 962



>gi|478488258|ref|XP_004418517.1| PREDICTED: coatomer subunit beta isoform 1 [Ceratotherium simum
           simum]
 gi|478488260|ref|XP_004418518.1| PREDICTED: coatomer subunit beta isoform 2 [Ceratotherium simum
           simum]
          Length = 953

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|512904460|ref|XP_004900324.1| PREDICTED: coatomer subunit beta isoform X1 [Heterocephalus glaber]
 gi|512904462|ref|XP_004900325.1| PREDICTED: coatomer subunit beta isoform X2 [Heterocephalus glaber]
 gi|512904464|ref|XP_004900326.1| PREDICTED: coatomer subunit beta isoform X3 [Heterocephalus glaber]
 gi|512978976|ref|XP_004851523.1| PREDICTED: coatomer subunit beta isoform X1 [Heterocephalus glaber]
 gi|512978978|ref|XP_004851524.1| PREDICTED: coatomer subunit beta isoform X2 [Heterocephalus glaber]
 gi|512978980|ref|XP_004851525.1| PREDICTED: coatomer subunit beta isoform X3 [Heterocephalus glaber]
 gi|351709985|gb|EHB12904.1| Coatomer subunit beta [Heterocephalus glaber]
          Length = 953

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++A NV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAGNVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGDL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|118151108|ref|NP_001071475.1| coatomer subunit beta [Bos taurus]
 gi|145558884|sp|A0JN39.1|COPB_BOVIN RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|117306635|gb|AAI26503.1| Coatomer protein complex, subunit beta 1 [Bos taurus]
 gi|296480130|tpg|DAA22245.1| TPA: coatomer subunit beta [Bos taurus]
          Length = 953

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS   DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKDDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|224050801|ref|XP_002198193.1| PREDICTED: coatomer subunit beta [Taeniopygia guttata]
          Length = 953

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/636 (50%), Positives = 442/636 (69%), Gaps = 28/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFENLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK--------KEAGELK 501

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                    + + +   GTYAT++A SS+        A K   +PPLR  LL GDF++ +
Sbjct: 502 PEEEVPVGPAQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVAA 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI  
Sbjct: 556 SLATTLTKIALRYVSLVQEKKKQNSFNAEAMLLMATILHLGKSSLPKKPITDDDVDRISL 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIVF 375
           CL +L + S    +  +F  + R + + ++                    T+Q DD I F
Sbjct: 616 CLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTIQPDDPISF 673

Query: 376 RQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV+
Sbjct: 674 MQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVH 733

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 734 VNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVAS 793

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGN+VYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENKV
Sbjct: 794 TENGIIFGNVVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKV 853

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIEK
Sbjct: 854 TVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEK 913

Query: 611 Q----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 914 PIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|213983027|ref|NP_001135674.1| coatomer protein complex, subunit beta 1 [Xenopus (Silurana)
           tropicalis]
 gi|197246715|gb|AAI68594.1| Unknown (protein for MGC:185592) [Xenopus (Silurana) tropicalis]
          Length = 953

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 443/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++ALELV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALELVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE V++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAVQRFDNLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++R ALWI+GEYCS  +DI     ++R  LGE+PI+ +E +               
Sbjct: 450 KSVKIYRAALWILGEYCSTKEDINSVMTEVRRSLGEVPIVETELK---------KESGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTY T++A SS+        A K   +PPLR  LL GDFY+ 
Sbjct: 501 KPEEDVTVGPTQKLVTEMGTYPTQSALSSSRP------AKKEEERPPLRGFLLDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ +K N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKRKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNEIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N    + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNETASKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQT +TLQ+ ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTGDTLQSCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C +T+FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDTEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNITDL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|472392711|ref|XP_004415630.1| PREDICTED: coatomer subunit beta isoform 1 [Odobenus rosmarus
           divergens]
 gi|472392713|ref|XP_004415631.1| PREDICTED: coatomer subunit beta isoform 2 [Odobenus rosmarus
           divergens]
          Length = 953

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 447/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR+ LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRAFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|348509611|ref|XP_003442341.1| PREDICTED: coatomer subunit beta-like [Oreochromis niloticus]
          Length = 953

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/637 (50%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           K+ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 KTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVDNEIK---------KETGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 + + +++++ + GTY T++A SS+  +       K   +PPLR  L+ GDFY+ 
Sbjct: 501 KPEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSK------KEEDRPPLRGFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + +D KK N+  AEAMLIM +++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQDKKKQNSFVAEAMLIMVTVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRRSLSHMLAVRLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMTSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNITDL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITDLNEYLQHILKSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  + GH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPLHLGPDAPVNGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|410973239|ref|XP_003993062.1| PREDICTED: coatomer subunit beta [Felis catus]
          Length = 953

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEMTVGPVQKLVTEMGTYATQSALSSSRPTKKEDE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|148223539|ref|NP_001085859.1| coatomer protein complex, subunit beta 1 [Xenopus laevis]
 gi|49118448|gb|AAH73438.1| MGC80934 protein [Xenopus laevis]
          Length = 960

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/638 (50%), Positives = 447/638 (70%), Gaps = 25/638 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++ALELV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALELVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DS+  A+ DV+ FVRE V++F +LR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSSEAASADVLEFVREAVQRFDHLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI     ++R  LGE+PI+ +E +               
Sbjct: 450 KSVKIYRGALWIMGEYCSTKEDINSVMTEVRRSLGEVPIVETELK---------KESGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEA-IKAAVKPPLRSLLLSGDFYL 255
                 +   +++++ + GTY T++A SS+     + E+   A  +PPLR  LL GDFY+
Sbjct: 501 KAEEDVSVGPAQKLVTEMGTYVTQSALSSSRPAKKEEESSTVAPYRPPLRGFLLDGDFYV 560

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            + LA+TLTK+ LRY  + ++ +K N+  AEAML+MA+I+ +G+S     PI +D  DRI
Sbjct: 561 AASLATTLTKIALRYVALVQEKRKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRI 620

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLI 373
             CL +L + S    +  +F  + R + + ++                    TVQ DD I
Sbjct: 621 SLCLKVLSECSP--LMNEIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQADDPI 678

Query: 374 VFRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAY 429
            F Q + +N    + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAY
Sbjct: 679 SFMQLTAKNETASKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAY 738

Query: 430 VNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKV 489
           V+V+QYDI+LDVL+VNQT +TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV
Sbjct: 739 VHVNQYDIVLDVLVVNQTGDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKV 798

Query: 490 SSTETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           +STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C++T+FR MW EFEWEN
Sbjct: 799 ASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCSDTEFRQMWAEFEWEN 858

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNTNITDL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SI
Sbjct: 859 KVTVNTNITDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSI 918

Query: 609 EKQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           EK      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 919 EKPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 956



>gi|344280549|ref|XP_003412045.1| PREDICTED: coatomer subunit beta [Loxodonta africana]
          Length = 953

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|511857334|ref|XP_004752082.1| PREDICTED: coatomer subunit beta [Mustela putorius furo]
 gi|511964842|ref|XP_004800557.1| PREDICTED: coatomer subunit beta [Mustela putorius furo]
          Length = 953

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|345787834|ref|XP_534069.3| PREDICTED: coatomer subunit beta [Canis lupus familiaris]
          Length = 953

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 446/637 (70%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|126332121|ref|XP_001367107.1| PREDICTED: coatomer subunit beta [Monodelphis domestica]
          Length = 953

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/636 (51%), Positives = 442/636 (69%), Gaps = 28/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRLLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK--------KEAGELK 501

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                      + +   GTYAT++A SS+  T       K   +PPLR+ LL GDF++ +
Sbjct: 502 PEEEINVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRAFLLDGDFFVAA 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI  
Sbjct: 556 SLATTLTKIALRYVALVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRISL 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIVF 375
           CL +L + S    +  +F  + R + + ++                    TVQ DD I F
Sbjct: 616 CLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISF 673

Query: 376 RQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q + +N I  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV+
Sbjct: 674 MQLTAKNEINCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVH 733

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 734 VNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVAS 793

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENKV
Sbjct: 794 TENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKV 853

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIEK
Sbjct: 854 TVNTNIIDLNEYLHHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEK 913

Query: 611 Q----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 914 PIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|149719463|ref|XP_001504991.1| PREDICTED: coatomer subunit beta isoform 2 [Equus caballus]
 gi|149719467|ref|XP_001504992.1| PREDICTED: coatomer subunit beta isoform 3 [Equus caballus]
          Length = 953

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRP------AKKEEERPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|297268352|ref|XP_002808121.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit beta-like [Macaca
           mulatta]
          Length = 953

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+  L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKXTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|50300477|ref|NP_001002013.1| coatomer subunit beta [Danio rerio]
 gi|34224013|gb|AAQ63171.1| coatomer protein complex subunit beta 1 [Danio rerio]
          Length = 953

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/637 (50%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           T+PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 TTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           K+ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 KTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENELK---------KEAGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T + + +++ + GTY T++A S++  +       K   +PPLR  L+ GDFY+ 
Sbjct: 501 KPEEEVTAAPAPKLVTEMGTYVTQSALSTSRPSK------KEEDRPPLRGFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  ++ED ++ N+  AEAMLIMA+++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALAEDKRRQNSFVAEAMLIMATVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRRSLSHMLAVRLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMASKEDQFQLSLLAAMGNTQRKEATDPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNITDL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITDLNDYLLHILKSTNMKCLTPEKALSGICGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  + GH+RIR+K+Q +ALSLGDKI L+QK
Sbjct: 913 KPIHLGVDAPVNGHIRIRAKSQVMALSLGDKINLSQK 949



>gi|395543422|ref|XP_003773617.1| PREDICTED: coatomer subunit beta [Sarcophilus harrisii]
          Length = 953

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/636 (51%), Positives = 441/636 (69%), Gaps = 28/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRLLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS   DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKDDIQSVMTEVRRSLGEIPIVESEIK--------KEAGELK 501

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                      + +   GTYAT++A SS+        A K   +PPLR+ LL GDF++ +
Sbjct: 502 PEEEINVGPVQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRAFLLDGDFFVAA 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI  
Sbjct: 556 SLATTLTKIALRYVALVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRISL 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIVF 375
           CL +L + S    +  +F  + R + + ++                    TVQ DD I F
Sbjct: 616 CLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISF 673

Query: 376 RQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q + +N I  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV+
Sbjct: 674 MQLTAKNEINCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVH 733

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 734 VNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVAS 793

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENKV
Sbjct: 794 TENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKV 853

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIEK
Sbjct: 854 TVNTNIIDLNEYLHHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEK 913

Query: 611 Q----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 914 PIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|432851750|ref|XP_004067066.1| PREDICTED: coatomer subunit beta-like [Oryzias latipes]
          Length = 953

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/637 (50%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           K+ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 KTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVDNEIK---------KETGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 + + +++++ + GTY T++A SS+  +       K   +PPLR  L+ GDFY+ 
Sbjct: 501 KPEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSK------KEEDRPPLRGFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  I ED KK N+  AEAMLIM +++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVLIVEDKKKQNSFVAEAMLIMVTVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRKSLSHMLAVRLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMCSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIVDLNEYLQHILKSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|148223736|ref|NP_001090083.1| uncharacterized protein LOC735158 [Xenopus laevis]
 gi|71679873|gb|AAI00180.1| MGC114704 protein [Xenopus laevis]
          Length = 953

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 444/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++ALELV+ RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALELVSTRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE V++F +LR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAVQRFDHLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI     ++R  LGE+PI+ +E +               
Sbjct: 450 KSVKIYRGALWIMGEYCSTKEDINSVMTEVRRSLGEVPIVETELK---------KESGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDFY+ 
Sbjct: 501 KPEDDVTVGPAQKLVTEMGTYATQSALSSSRP------AKKEEERPPLRGFLLDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ +K N+  AEAML+MA+I+ +G+S      I +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKRKQNSFVAEAMLLMATILHLGKSSLPKKQITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNEIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N    + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNETASKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQT +TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTGDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI  A C++T+FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQAASCSDTEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNITDL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      + ++TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEASVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|507685168|ref|XP_004711619.1| PREDICTED: coatomer subunit beta [Echinops telfairi]
          Length = 953

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 443/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  +  + KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVLEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI  L EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIYLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|224143423|ref|XP_002324951.1| predicted protein [Populus trichocarpa]
 gi|222866385|gb|EEF03516.1| predicted protein [Populus trichocarpa]
          Length = 949

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/635 (52%), Positives = 426/635 (67%), Gaps = 23/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP+++++RK L I LEL+T RN+ EVV+ LKKE+ KT + + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIQRKTLDIVLELITPRNINEVVLMLKKEVMKTQNGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV  FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDSNVASAIDVAIFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LGE+P  +  +                 
Sbjct: 446 AARVCCCALWIIGEYCLSLSEVESGIATIKQCLGELPFYSVSEE-----GEAPTDASKNS 500

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SSRR  IL+DGTYAT     ETAFS  S     L A        LRSLLL+G
Sbjct: 501 QQPSSVTVSSRRPAILSDGTYATQSAASETAFSPPSIVQGSLAAGN------LRSLLLTG 554

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKLVLR   +     + N +  +A+LIM S+I++GQS   S+PID DS
Sbjct: 555 DFFLGAVVACTLTKLVLRLEEVQPSRGEVNKVSTQALLIMVSMIQLGQSPVLSHPIDCDS 614

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L   ST   ++ ++L   R +F +++                    Q DD
Sbjct: 615 YDRIVLCIRLL--CSTGDEVRKIWLQSCRQSFVKMLSEKQLRETEELKAKAQVSYAQPDD 672

Query: 372 LIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEA
Sbjct: 673 LIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFIKDRDDANKLNRILQLTGFSDPVYAEA 732

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T+ETLQNL +E AT+GDLKLVERP  + LAP S   +KA IK
Sbjct: 733 YVTVHHYDIVLDVTVINRTTETLQNLCLELATMGDLKLVERPQNYTLAPESSRQIKANIK 792

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E   VVLNDIHIDIMDYI+PA C +T FRSMW EFEWEN
Sbjct: 793 VSSTETGVIFGNIVYEASNVLERTVVVLNDIHIDIMDYISPAVCTDTAFRSMWAEFEWEN 852

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I   +++L HI+KSTNM CLT   AL GDCGFL+AN+YA+S+FGEDAL N+SI
Sbjct: 853 KVAVNTIIQSEKDFLDHIIKSTNMKCLTAPSALDGDCGFLAANLYAKSVFGEDALVNVSI 912

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 913 EKQLDGKLSGYIRIRSKTQGIALSLGDKITLKQKG 947



>gi|288860138|ref|NP_001165837.1| coatomer subunit beta [Sus scrofa]
 gi|334305778|sp|D2SW95.1|COPB_PIG RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|268633765|gb|ACZ15983.1| coatomer protein subunit beta 1 [Sus scrofa]
          Length = 953

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/637 (51%), Positives = 444/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++   GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTKMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ K+ N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKRQNSFVAEAMLLMATILHLGKSSPPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K QG+ALSLGDKI L+QK
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKGQGMALSLGDKINLSQK 949



>gi|498947885|ref|XP_004543244.1| PREDICTED: coatomer subunit beta-like [Maylandia zebra]
          Length = 953

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/637 (50%), Positives = 444/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 RTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENEIK---------KETGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 + + +++++ + GTY T++A SS+  +       K   +PPLR  L+ GDFY+ 
Sbjct: 501 KPEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSK------KEEDRPPLRGFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + +D KK N+  AEAMLIM +++ +G+      PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVALVQDKKKQNSFVAEAMLIMVTVLHLGKCSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRRSLSHMLAVRLEEEKLSQKKESEKRNVTVQADDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMTSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNIT+L EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNITELNEYLQHILKSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D  + GH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPFHLGPDAPVNGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|410913063|ref|XP_003970008.1| PREDICTED: coatomer subunit beta-like [Takifugu rubripes]
          Length = 953

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/637 (50%), Positives = 445/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  + EK+LE F  V
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDNLRPLVIEKMLEVFHAV 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 RTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENEIK---------KETGEV 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 + + +++++ + GTY T++A SS+  +       K   +PPLRS L+ GDFY+ 
Sbjct: 501 KAEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSK------KEEDRPPLRSFLMDGDFYVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  I  D K+ N+  AEAMLIM +++ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKVALRYVEIVPDKKRQNSFVAEAMLIMVTVLHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
            CL +L + S    +  +F  + R + + +  V                  TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRKSLSHMLTVRLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMTSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      +  +TGH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|459370720|gb|EMG48736.1| Coatomer beta subunit [Candida maltosa Xu316]
          Length = 953

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/622 (51%), Positives = 429/622 (68%), Gaps = 11/622 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL + L+ +T RNV++VV  LKKEL  T   + +KN++YRQLLI SIH  
Sbjct: 325 SSQDLDVRKKALDVTLQFITTRNVEDVVKLLKKELQSTALSNDDKNSDYRQLLINSIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N+ AA DVI FV+EVVEKFP+LR SI ++L+     VK
Sbjct: 385 AIKFVEVAANVIDLLLDSIADLNSTAAYDVITFVKEVVEKFPDLRESILKRLILALPHVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALW++GEY      I+++WK IR  +GE+PILASE +                
Sbjct: 445 SGKVFRGALWVIGEYALEESLIQDSWKYIRGSIGEVPILASELKSKKRETSGEAGEVVEE 504

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                       +L DGTYATE+A ++ ++  ++ E+     K PLR  LL+GDFYLG+V
Sbjct: 505 DDENKPRRKGPVVLPDGTYATESALTTETADASESES-----KTPLRKQLLNGDFYLGAV 559

Query: 259 LASTLTKLVLRYSGISEDPKKT-NALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           L+STL KL+LR     + P+K  N L+AEA+LIM SI+RVG+S   +  IDEDS DRI+S
Sbjct: 560 LSSTLVKLILRLQNSKQTPQKILNGLKAEALLIMVSILRVGESNLVTKKIDEDSADRILS 619

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
            + IL        IK+ FL DT+ AF   +                    Q+DD IVFRQ
Sbjct: 620 YVKILNDEEDIEEIKTSFLEDTKDAFRAQITNSELKKTEALAKDLHENAEQIDDAIVFRQ 679

Query: 378 FSKRN-IGDEADEYELDLTRATGQAD-SRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
             K N  G +A +   D+  A+G  +  ++DL S+L++++QLTGFSDP+YAEA+V VHQY
Sbjct: 680 LDKDNKAGKQAID---DVAVASGSNELKKEDLSSRLNKILQLTGFSDPIYAEAFVKVHQY 736

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           D++LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ V+ TIKV+S +TG
Sbjct: 737 DVVLDVLLVNQTTSTLRNLSVEFATLGDLKVVDKPTTANIGPHGFYKVQTTIKVTSADTG 796

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + 
Sbjct: 797 VIFGNIVYDGQHSDESRIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITIKSP 856

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGA 615
           I  L+EYL  +M  TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG 
Sbjct: 857 IESLKEYLDELMAGTNMQCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQSDGP 916

Query: 616 ITGHVRIRSKTQGIALSLGDKI 637
           I GHVRIRSK QG+ALSLGD++
Sbjct: 917 IIGHVRIRSKGQGLALSLGDRV 938



>gi|406606124|emb|CCH42484.1| hypothetical protein BN7_2029 [Wickerhamomyces ciferrii]
          Length = 941

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/625 (49%), Positives = 439/625 (70%), Gaps = 16/625 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++PDI++R++A+ IALE +++RNV EV+   KKEL KT+  D +K  EYRQ+LI +IH  
Sbjct: 323 STPDIDIRKRAIEIALESISSRNVDEVLKLFKKELQKTVTSDADKAVEYRQILISAIHQT 382

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKFS++AA+VV +L++F+ D +  +A DV+AF++EVVEK+P+LRSSI ++LL +  +++
Sbjct: 383 AIKFSQIAASVVDLLLDFIADLSTTSATDVLAFIKEVVEKYPDLRSSIVQRLLNSLDNIR 442

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALWI+GEY    KDI++AWK IR+ +GEIPI+ SE+R +              
Sbjct: 443 SGKVFRGALWIIGEYALTEKDIQDAWKHIRSSVGEIPIIQSERRRIGEPEEEHEDEGKKL 502

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                   S   +L DGTYATE+A +S        +  K   +PPLR  +L G+FY  ++
Sbjct: 503 -----NGQSKPIVLPDGTYATESALTSEK------KVTKEETRPPLRQFILDGEFYTTAI 551

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+ST  KL+LR+  IS++    NAL+AE +LI+ SI+RVGQ+ + S  IDEDS +RI++ 
Sbjct: 552 LSSTFVKLILRFQEISQNATILNALKAEGLLILVSILRVGQTSYVSKKIDEDSGERILTA 611

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  + +      ++  FL  T+ A+   V                  + QVD++I FRQF
Sbjct: 612 ITYIAEGKESKLLEVAFLEATKDAYKEQVEAEDKRKAKLDQAEIQKNSQQVDEVIQFRQF 671

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
            K+    + DE   DLT ATG     +DL S+L+++VQLTGFSDPVYAEAYV VHQ+D++
Sbjct: 672 GKQETTSDVDE---DLTLATG-VKVEEDLSSRLNKIVQLTGFSDPVYAEAYVKVHQFDVV 727

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ETL+NL +EFATLGDLK++++PT  N+  H F  ++ TIKV+S +TGV+F
Sbjct: 728 LDVLLVNQTTETLRNLHVEFATLGDLKVIDKPTTQNIPAHGFFKIQTTIKVTSADTGVVF 787

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GNIVYDG   +E+  V+LND+H+DIMDYI PA C+E +FR+MW EFEWENK+ + +N+  
Sbjct: 788 GNIVYDGGHGAENKVVILNDVHVDIMDYIKPAKCSENKFRTMWNEFEWENKIVIKSNLPS 847

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITG 618
           L++YL  ++K TNMSCLTP   +  +C FLSAN+Y++S FGEDALAN+ IEK+TDG I G
Sbjct: 848 LKDYLDELLKGTNMSCLTPGAVIGEECQFLSANLYSKSSFGEDALANLCIEKKTDGPIVG 907

Query: 619 HVRIRSKTQGIALSLGDKI-TLAQK 642
           HVRIRSK QG+ALSLGD++ ++A+K
Sbjct: 908 HVRIRSKGQGLALSLGDRVASIARK 932



>gi|508781970|gb|EOY29226.1| Coatomer, beta subunit isoform 1 [Theobroma cacao]
 gi|508781971|gb|EOY29227.1| Coatomer, beta subunit isoform 1 [Theobroma cacao]
 gi|508781972|gb|EOY29228.1| Coatomer, beta subunit isoform 1 [Theobroma cacao]
 gi|508781973|gb|EOY29229.1| Coatomer, beta subunit isoform 1 [Theobroma cacao]
          Length = 948

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/635 (51%), Positives = 423/635 (66%), Gaps = 24/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I LEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIVLELITPRNISEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDSNVASAIDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LGE+P  +  +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGIATIKQCLGELPFYSVSEE------GEATDTSKKT 499

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SSRR  ILADGTYAT     ETAFS  +     L +        LRSLLL+G
Sbjct: 500 PQANSITVSSRRPAILADGTYATQSAASETAFSPPAIVQGSLASGN------LRSLLLTG 553

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKL+LR   +     + N    +A+LIM S++++GQS    +PID DS
Sbjct: 554 DFFLGAVVACTLTKLILRLEEVQPSKVEVNKATTQALLIMVSMLQLGQSSVLPHPIDNDS 613

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L   +T   I+ ++L   R +F +++                    Q DD
Sbjct: 614 YDRIVLCMRLL--CNTGDEIRKIWLQSCRQSFVKMLSEKQLRETEELKAKAQVSHAQPDD 671

Query: 372 LIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEA
Sbjct: 672 LIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFVKDADDANKLNRILQLTGFSDPVYAEA 731

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S   +KA IK
Sbjct: 732 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIK 791

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E   VVLNDIHIDIMDYI+PA C +  FR+MW EFEWEN
Sbjct: 792 VSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWEN 851

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I D +E+L HI+KSTNM CLT   AL G+CGFL+AN+YA+S+FGEDAL N+SI
Sbjct: 852 KVAVNTVIQDEKEFLDHIIKSTNMKCLTAPSALDGECGFLAANLYAKSVFGEDALVNVSI 911

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 912 EKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|30689050|ref|NP_194877.2| coatomer subunit beta-2 [Arabidopsis thaliana]
 gi|146286091|sp|Q9SV20.2|COPB2_ARATH RecName: Full=Coatomer subunit beta-2; AltName: Full=Beta-coat
           protein 2; Short=Beta-COP 2
 gi|332660520|gb|AEE85920.1| coatomer subunit beta-2 [Arabidopsis thaliana]
          Length = 948

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/631 (51%), Positives = 430/631 (68%), Gaps = 16/631 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IAL+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIALDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I   LGE+P  +  +                 
Sbjct: 446 AGKVCPCALWIIGEYCLSLSEVESGISTITQCLGELPFYSVSEE------SEPTETSKKI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-LRSLLLSGDFYL 255
                   SSR+  ILADGTYAT++A S   +T +    ++ ++    LR+LLL+GDF+L
Sbjct: 500 QPTSSAMVSSRKPVILADGTYATQSAASE--TTFSSPTVVQGSLTSGNLRALLLTGDFFL 557

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+V+A TLTKLVLR   +     + N   ++A+LIM SI+++GQS  + +PID DSY+RI
Sbjct: 558 GAVVACTLTKLVLRLEEVQSSKTEVNKTVSQALLIMVSILQLGQSPVSPHPIDNDSYERI 617

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           M C+ +L     +  +K ++L   R +F +++                    Q DDLI F
Sbjct: 618 MLCIKLL--CHRNVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTHAQPDDLIDF 675

Query: 376 RQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
                R    +    D+ + DL RATG+    ++  +KL+R++QLTGFSDPVYAEAYV V
Sbjct: 676 FHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSDPVYAEAYVTV 735

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           H YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP     +KA IKVSST
Sbjct: 736 HHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPERSMQIKANIKVSST 795

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW EFEWENKV V
Sbjct: 796 ETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWAEFEWENKVAV 855

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NT I + RE+L HI+KSTNM CLT   A++G+CGFL+AN+YA+S+FGEDAL N+SIEKQT
Sbjct: 856 NTTIQNEREFLDHIIKSTNMKCLTAPSAIAGECGFLAANLYAKSVFGEDALVNLSIEKQT 915

Query: 613 DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 916 DGTLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|225429750|ref|XP_002282410.1| PREDICTED: coatomer subunit beta-1 [Vitis vinifera]
 gi|147845891|emb|CAN82167.1| hypothetical protein VITISV_023269 [Vitis vinifera]
          Length = 948

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/635 (51%), Positives = 425/635 (66%), Gaps = 24/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I LEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIVLELITPRNINEVVLTLKKEVVKTQSGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDSNVASAIDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P  +  +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGITTIKQCLGDLPFFSVSEE------GEASDSSKKV 499

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                TT SSRR  +LADGTYAT     ETAFS  +     L +        LRSLLL+G
Sbjct: 500 QQVNATTVSSRRPAVLADGTYATQSAASETAFSPPTLVQGSLSSGN------LRSLLLTG 553

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKLVLR   +     + N + ++A+LIM S++++GQS    +PID DS
Sbjct: 554 DFFLGAVVACTLTKLVLRLEEVQPSKAEVNKVSSQALLIMVSMLQLGQSSVLPHPIDNDS 613

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L     D  I+ ++L   R ++ +++                    Q DD
Sbjct: 614 YDRIVLCIRLLCNTGDD--IRKIWLQSCRQSYVKMLADKQLRETEEIKAKAQISYAQPDD 671

Query: 372 LIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEA
Sbjct: 672 LIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFIKDGDDANKLNRILQLTGFSDPVYAEA 731

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLV+RP  + LAP S   +KA IK
Sbjct: 732 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTLAPESSKQIKANIK 791

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E   VVLNDIHIDIMDYI+PA C +  FR+MW EFEWEN
Sbjct: 792 VSSTETGVIFGNIVYETSNVHERMVVVLNDIHIDIMDYISPAVCTDVAFRTMWAEFEWEN 851

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT + + +E+L HI+KSTNM CLT   AL GDCGFL+AN+YA+S+FGEDAL NISI
Sbjct: 852 KVAVNTVLQNEKEFLEHIIKSTNMKCLTASSALDGDCGFLAANLYAKSVFGEDALVNISI 911

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 912 EKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|5257007|gb|AAD41240.1| beta-cop homolog [Homo sapiens]
          Length = 953

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/637 (50%), Positives = 443/637 (69%), Gaps = 30/637 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    +IR  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHI+IMDYI PA C + +FR MW E EWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIEIMDYIQPATCTDAEFRQMWAELEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+S E
Sbjct: 853 VTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSSE 912

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           K      D A+T H+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 913 KPLHQGPDAAVTVHIRIRAKSQGMALSLGDKINLSQK 949



>gi|5262760|emb|CAB45908.1| Beta-COP-like protein [Arabidopsis thaliana]
 gi|7270052|emb|CAB79867.1| Beta-COP-like protein [Arabidopsis thaliana]
          Length = 958

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/641 (50%), Positives = 431/641 (67%), Gaps = 26/641 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IAL+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIALDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I   LGE+P  +  +                 
Sbjct: 446 AGKVCPCALWIIGEYCLSLSEVESGISTITQCLGELPFYSVSEE------SEPTETSKKI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-LRSLLLSGDFYL 255
                   SSR+  ILADGTYAT++A S   +T +    ++ ++    LR+LLL+GDF+L
Sbjct: 500 QPTSSAMVSSRKPVILADGTYATQSAASE--TTFSSPTVVQGSLTSGNLRALLLTGDFFL 557

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+V+A TLTKLVLR   +     + N   ++A+LIM SI+++GQS  + +PID DSY+RI
Sbjct: 558 GAVVACTLTKLVLRLEEVQSSKTEVNKTVSQALLIMVSILQLGQSPVSPHPIDNDSYERI 617

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           M C+ +L     +  +K ++L   R +F +++                    Q DDLI F
Sbjct: 618 MLCIKLL--CHRNVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTHAQPDDLIDF 675

Query: 376 RQFSKRNIG-------------DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSD 422
                R +              +  D+ + DL RATG+    ++  +KL+R++QLTGFSD
Sbjct: 676 FHLKSRKMSLLMINFFQGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSD 735

Query: 423 PVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHS 482
           PVYAEAYV VH YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP     
Sbjct: 736 PVYAEAYVTVHHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPERSMQ 795

Query: 483 VKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWT 542
           +KA IKVSSTETGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW 
Sbjct: 796 IKANIKVSSTETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWA 855

Query: 543 EFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDA 602
           EFEWENKV VNT I + RE+L HI+KSTNM CLT   A++G+CGFL+AN+YA+S+FGEDA
Sbjct: 856 EFEWENKVAVNTTIQNEREFLDHIIKSTNMKCLTAPSAIAGECGFLAANLYAKSVFGEDA 915

Query: 603 LANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           L N+SIEKQTDG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 916 LVNLSIEKQTDGTLSGYIRIRSKTQGIALSLGDKITLKQKG 956



>gi|356521768|ref|XP_003529523.1| PREDICTED: coatomer subunit beta-1-like [Glycine max]
          Length = 950

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/643 (50%), Positives = 428/643 (66%), Gaps = 38/643 (5%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++P+ ++RRK L IALEL+T RN+ EVV+ LKKE+ KT   ++EKN EYRQ+L+Q+IH C
Sbjct: 326 STPNHDIRRKTLDIALELITPRNIDEVVMMLKKEVVKTQSGEHEKNGEYRQMLVQAIHTC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDTNVASAMDVVVFVREIIETNPKLRISIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P     +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGIATIKQCLGDLPFYTVTEE------GDGQEASKPI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP------------L 244
                TT SSRR  ILADGTYAT++A            A++ A+ PP            L
Sbjct: 500 QQVNSTTVSSRRPAILADGTYATQSA------------ALETAMSPPTLVQGSLSSIGNL 547

Query: 245 RSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFAS 304
           RSL+LSGDF+LG+V+A TLTKLVLR   +     + N    +A+LI+ S++++GQS    
Sbjct: 548 RSLILSGDFFLGAVVACTLTKLVLRLEEVQTSKAEVNKATTQALLIIVSMLQLGQSSILP 607

Query: 305 NPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX 364
           +PID DSYDRI+ C+ +L   +T   I+ ++L   R +F +++                 
Sbjct: 608 HPIDNDSYDRIVLCIRLL--CNTGDEIRKIWLQSCRQSFVKMLADKQRRETEEIKAKAQI 665

Query: 365 XTVQVDDLIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
              Q DDLI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFS
Sbjct: 666 SNAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFTKDADDANKLNRILQLTGFS 725

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEAYV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S  
Sbjct: 726 DPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSK 785

Query: 482 SVKATIKVSSTETGVIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            +KA IKVSSTETGVIFGNIVY+      E   +VLNDIHIDIMDYI+PA C +  FR+M
Sbjct: 786 QIKANIKVSSTETGVIFGNIVYETSSNVLERTVIVLNDIHIDIMDYISPASCADVAFRTM 845

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           W EFEWENKV VNT + D R++L HI+KSTNM CLTP  AL GDCGFL+AN+YA+S+FGE
Sbjct: 846 WAEFEWENKVAVNTVLQDERDFLNHIIKSTNMKCLTPPSALEGDCGFLAANLYAKSVFGE 905

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DAL N+SIEKQ+DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 906 DALVNVSIEKQSDGKLSGYIRIRSKTQGIALSLGDKITLKQKG 948



>gi|149238742|ref|XP_001525247.1| coatomer beta subunit [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450740|gb|EDK44996.1| coatomer beta subunit [Lodderomyces elongisporus NRRL YB-4239]
          Length = 608

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/605 (53%), Positives = 416/605 (68%), Gaps = 13/605 (2%)

Query: 34  LELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVL 93
           +E +T+RNV++VV  LKKEL  T   + EKN EYRQLLI +IH  AIKFSEVAANV+ +L
Sbjct: 1   MEFITSRNVEDVVKLLKKELQATSTSNDEKNAEYRQLLINAIHQLAIKFSEVAANVIDLL 60

Query: 94  MEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKSGKVFRGALWIVGEY 153
           ++ + D N+ AA +VI FV+EVVEKFP LR +I ++L   F  +KSGKVFRGALW++GEY
Sbjct: 61  LDSIADLNSTAAYEVITFVKEVVEKFPELRDTIIKRLNSAFPHIKSGKVFRGALWVIGEY 120

Query: 154 CSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILA 213
               + ++++WKQIRA +GE+PILASE R                            +L 
Sbjct: 121 ALGEQLLQDSWKQIRASIGEVPILASEIR----AKEPQHESEQGEDSEEHHRKKGPTVLP 176

Query: 214 DGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGI 273
           DGTYATETAFSS S      E+  +  KPPLR  LL+GDFYLG+VL+STL KL+LR   +
Sbjct: 177 DGTYATETAFSSES-----YESQDSESKPPLRKHLLAGDFYLGAVLSSTLVKLILRLQEL 231

Query: 274 SEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDYSIKS 333
           +   +  NA +AEA+LIM SIIR+G+S   S  IDEDS DRI + + IL        I S
Sbjct: 232 NTQERILNASKAEALLIMVSIIRLGESSLVSKKIDEDSADRIATYIRILNDEKDASFITS 291

Query: 334 VFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRN-IGDEADEYEL 392
            FL DT+ AF   +                    Q+DD IVFRQ  K N  G +A +   
Sbjct: 292 SFLDDTKDAFKSQINDAEVKKAEAEAKDMMEHAEQIDDSIVFRQLDKDNRAGTKALD--- 348

Query: 393 DLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQ 452
           D+  A+G    +++L S+L++++QLTGFSDP+YAEA+V VHQYD++LDVL+VNQT+ TL+
Sbjct: 349 DIASASGSDTKKENLSSRLNKILQLTGFSDPIYAEAFVKVHQYDVVLDVLLVNQTTTTLR 408

Query: 453 NLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDGPGTSESN 512
           NLS+EFATLGDLK+V++PT  N+ PH F+ ++ TIKV+S +TGVIFGNIVYDG  + ES 
Sbjct: 409 NLSVEFATLGDLKVVDKPTTANIGPHGFYKMQTTIKVTSADTGVIFGNIVYDGQHSDEST 468

Query: 513 CVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNM 572
            V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + I  LR YL  +MK TNM
Sbjct: 469 IVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITIKSPIGSLRTYLEELMKGTNM 528

Query: 573 SCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITGHVRIRSKTQGIALS 632
            CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I GHVRIRSK QG+ALS
Sbjct: 529 KCLTPGAVIGEECQFLSANLYSRSTFGEDALANLCIEKQSDGPIIGHVRIRSKGQGLALS 588

Query: 633 LGDKI 637
           LGD++
Sbjct: 589 LGDRV 593



>gi|255721367|ref|XP_002545618.1| coatomer beta subunit [Candida tropicalis MYA-3404]
 gi|240136107|gb|EER35660.1| coatomer beta subunit [Candida tropicalis MYA-3404]
          Length = 954

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/625 (51%), Positives = 428/625 (68%), Gaps = 16/625 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++V++KAL + L+ ++ RNV++VV  LKKEL  T   + EKN++YRQLLI +IH  
Sbjct: 325 SSQDLDVKKKALDVTLQFISTRNVEDVVKLLKKELQTTAMSNDEKNSDYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N+ AA +VI FV+EVVEKFP+LR +I ++L+     VK
Sbjct: 385 AIKFVEVAANVIDLLLDSIADLNSTAAYEVITFVKEVVEKFPDLRETILKRLILALPHVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALW++GEY      I+++WK IR  +GE+PIL SE   L              
Sbjct: 445 SGKVFRGALWVIGEYALEESLIQDSWKYIRGSIGEVPILTSE---LKQKKRTTEDGQQIE 501

Query: 199 XXXXXTTSSSRR----ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                     RR    +L DGTYATETA +S ++  ++ E+     K P+R  +L GDFY
Sbjct: 502 GDQEEEDGKPRRKGPVVLPDGTYATETALTSETTDGSESES-----KTPIRKQILGGDFY 556

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKT-NALRAEAMLIMASIIRVGQSQFASNPIDEDSYD 313
           LG+VL+STL KL+LR   +   P+K  N L+AEA+LIM SI+RVG+S   +  IDEDS D
Sbjct: 557 LGAVLSSTLVKLILRLQSLQSTPEKILNGLKAEALLIMVSILRVGESSLVAKKIDEDSAD 616

Query: 314 RIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLI 373
           RI+S + IL        IKS FL DT+ AF   +                    Q+DD I
Sbjct: 617 RILSYVKILNDEEDIKEIKSSFLEDTKDAFKAQIANAELKKADALAKDLHENAEQIDDAI 676

Query: 374 VFRQFSKRNIGDEADEYELDLTRATGQAD-SRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
           VFRQ  K N   +A     D+  A+G  +  ++DL S+L++++QLTGFSDP+YAEA+V V
Sbjct: 677 VFRQLDKDNKASKATVD--DVAVASGSNELKKEDLSSRLNKILQLTGFSDPIYAEAFVKV 734

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           HQYD++LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ V+ TIKV+S 
Sbjct: 735 HQYDVVLDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTANIGPHGFYKVQTTIKVTSA 794

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           +TGVIFGNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ +
Sbjct: 795 DTGVIFGNIVYDGQHSDESRIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITI 854

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
            + I  L+EYL  +MK TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+
Sbjct: 855 KSPIESLKEYLDELMKGTNMQCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQS 914

Query: 613 DGAITGHVRIRSKTQGIALSLGDKI 637
           DG I GHVRIRSK QG+ALSLGD++
Sbjct: 915 DGPIIGHVRIRSKGQGLALSLGDRV 939



>gi|224121310|ref|XP_002330795.1| predicted protein [Populus trichocarpa]
 gi|222872597|gb|EEF09728.1| predicted protein [Populus trichocarpa]
          Length = 949

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/635 (52%), Positives = 425/635 (66%), Gaps = 23/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++++K L IAL+L+T RN+ EVV+ LKKE+ KT + + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIQKKTLDIALDLITPRNITEVVLMLKKEVMKTQNGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV  FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDSNVASAIDVAIFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LGE+P  +  +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGIATIKQCLGELPFYSVSEE-----GEAPTDASKNS 500

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SSRR  IL+DGTYAT     ETAFS  +     L A        LRSLLL+G
Sbjct: 501 QQPSSVTVSSRRPAILSDGTYATQSAASETAFSPPTIVQGSLAAGN------LRSLLLTG 554

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKLVLR   +     + N   A+A+LIM S+I++GQS   S+PID DS
Sbjct: 555 DFFLGAVVACTLTKLVLRLEEVQPSKVEVNKASAQALLIMVSMIQLGQSPVLSHPIDGDS 614

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L   ST   ++ ++L   R +F +++                    Q DD
Sbjct: 615 YDRILLCIRLL--CSTGDEVRKIWLQSCRQSFVKMLSEKQLRETEELKAKAQVSYAQPDD 672

Query: 372 LIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEA
Sbjct: 673 LIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFIKDGDDANKLNRILQLTGFSDPVYAEA 732

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T +TLQNL +E AT+GDLKLVERP  + LAP S   +KA IK
Sbjct: 733 YVTVHHYDIVLDVTVINRTKDTLQNLCLELATMGDLKLVERPQNYILAPESSKQIKANIK 792

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E   VVLNDIHIDIMDYI+PA C +  FR+MW EFEWEN
Sbjct: 793 VSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWEN 852

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I   +++L H++KSTNM CLT   AL GDCGFL+AN+YA+SIFGEDAL NISI
Sbjct: 853 KVAVNTIIQSEKDFLDHVIKSTNMKCLTAPSALDGDCGFLAANLYAKSIFGEDALVNISI 912

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 913 EKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 947



>gi|470121855|ref|XP_004296972.1| PREDICTED: coatomer subunit beta-1-like [Fragaria vesca subsp.
           vesca]
          Length = 948

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/635 (51%), Positives = 423/635 (66%), Gaps = 24/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP+++VRRK L I LELVTNRN+ EVV+ LKKE+ KT + + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDVRRKTLDIVLELVTNRNINEVVLTLKKEVVKTQNGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A DVI FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASATDVIVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWIVGEYC +  ++E     I+  LGE+P  +  +                 
Sbjct: 446 ASRVCACALWIVGEYCLSLSEVESGLATIKQCLGELPFYSRSEE------DEGNDSSKKV 499

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SS+R  IL+DGTYAT     ETAFS  +     L +        LRSLLL+G
Sbjct: 500 QQVNSMTVSSKRPAILSDGTYATQSAASETAFSPPTFVQGSLASGN------LRSLLLTG 553

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKLVLR   +     + +    + +LI  S++++GQS    +PID DS
Sbjct: 554 DFFLGAVVACTLTKLVLRLEEVQPSKVEVHKASTQTLLIFVSMLQLGQSPVLPHPIDNDS 613

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L   +T   I++++L   R +F  ++                    Q DD
Sbjct: 614 YDRIVLCIRLL--CNTSDEIRNIWLQSCRQSFVSMLTEQQLRETEEIRARAQISHAQPDD 671

Query: 372 LIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEA
Sbjct: 672 LIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFIKEGDAANKLNRILQLTGFSDPVYAEA 731

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S   +KA+IK
Sbjct: 732 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKKIKASIK 791

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E   +VLNDIHIDIMDYI+PA C++  FR+MW EFEWEN
Sbjct: 792 VSSTETGVIFGNIVYETSNVHERTVIVLNDIHIDIMDYISPAVCSDGAFRTMWAEFEWEN 851

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I D +E+L HIMKSTNM CLT   AL G CGFL+AN+YA+S+FGEDAL N+SI
Sbjct: 852 KVAVNTVIQDEKEFLDHIMKSTNMKCLTAPSALDGQCGFLAANLYAKSVFGEDALVNVSI 911

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 912 EKQVDGKLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|482551248|gb|EOA15441.1| hypothetical protein CARUB_v10004083mg [Capsella rubella]
          Length = 948

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/631 (50%), Positives = 430/631 (68%), Gaps = 16/631 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IAL+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIALDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV  FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASALDVAVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I+  LGE+P  +  +                 
Sbjct: 446 AGKVCPCALWIIGEYCLSLSEVESGISTIKQCLGELPFYSVSEE------SEPTETSKKI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-LRSLLLSGDFYL 255
                   SSR+  ILADGTYAT++A S   +T +    ++ ++    LR+LLL+GDF+L
Sbjct: 500 QPTSSAMVSSRKPVILADGTYATQSAASE--TTFSSPTVVQGSLTSGNLRALLLTGDFFL 557

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+V+A TLTKLVLR   +     + N    +++LIM S++++GQS  + +PID DSY+RI
Sbjct: 558 GAVVACTLTKLVLRLEEVQPSKSEVNKTVTQSLLIMVSMLQLGQSPVSPHPIDNDSYERI 617

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           + C+ +L     +  +K ++L   R +F +++                    Q DDLI F
Sbjct: 618 VLCIKLL--CHRNDEMKKIWLESCRQSFVKMISEKQLRELEELKAKTQTTHAQPDDLIDF 675

Query: 376 RQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
                R    +    D+ + DL RATG+    ++  +KL+R++QLTGFSDPVYAEAYV V
Sbjct: 676 FHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSDPVYAEAYVTV 735

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           H YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP +   +KA IKVSST
Sbjct: 736 HHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPATSMQIKANIKVSST 795

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW EFEWENKV V
Sbjct: 796 ETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWAEFEWENKVAV 855

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NT I + RE+L HI+KSTNM CLT   A+ G+CGFL+AN+YA+S+FGEDAL N+SIEKQT
Sbjct: 856 NTTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKSVFGEDALVNVSIEKQT 915

Query: 613 DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DGA++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 916 DGALSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|334187061|ref|NP_194876.2| coatomer subunit beta-1 [Arabidopsis thaliana]
 gi|334187063|ref|NP_001190880.1| coatomer subunit beta-1 [Arabidopsis thaliana]
 gi|146286090|sp|Q9SV21.2|COPB1_ARATH RecName: Full=Coatomer subunit beta-1; AltName: Full=Beta-coat
           protein 1; Short=Beta-COP 1
 gi|332660518|gb|AEE85918.1| coatomer subunit beta-1 [Arabidopsis thaliana]
 gi|332660519|gb|AEE85919.1| coatomer subunit beta-1 [Arabidopsis thaliana]
          Length = 948

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/631 (50%), Positives = 429/631 (67%), Gaps = 16/631 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I+L+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDISLDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I   LGE+P  +  +                 
Sbjct: 446 AGKVCPCALWIIGEYCLSLSEVESGISTITQCLGELPFYSVSEE------SEPTETSKKI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-LRSLLLSGDFYL 255
                   SSR+  ILADGTYAT++A S   +T +    ++ ++    LR+LLL+GDF+L
Sbjct: 500 QPTSSAMVSSRKPVILADGTYATQSAASE--TTFSSPTVVQGSLTSGNLRALLLTGDFFL 557

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+V+A TLTKLVLR   +     + N    +A+LIM S++++GQS  + +PID DSY+RI
Sbjct: 558 GAVVACTLTKLVLRLEEVQSSKTEVNKTVTQALLIMVSMLQLGQSPVSPHPIDNDSYERI 617

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           + C+ +L     +  +K ++L   R +F +++                    Q DDLI F
Sbjct: 618 VLCIKLL--CHRNDEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTHAQPDDLIDF 675

Query: 376 RQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
                R    +    D+ + DL RATG+    ++  +KL+R++QLTGFSDPVYAEAYV V
Sbjct: 676 FHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSDPVYAEAYVTV 735

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           H YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP     +KA IKVSST
Sbjct: 736 HHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPERSMQIKANIKVSST 795

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW EFEWENKV V
Sbjct: 796 ETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWAEFEWENKVAV 855

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NT I + RE+L HI+KSTNM CLT   A+ G+CGFL+AN+YA+S+FGEDAL N+SIEKQT
Sbjct: 856 NTTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKSVFGEDALVNVSIEKQT 915

Query: 613 DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DGA++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 916 DGALSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|5262759|emb|CAB45907.1| putative protein [Arabidopsis thaliana]
 gi|7270051|emb|CAB79866.1| putative protein [Arabidopsis thaliana]
          Length = 971

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/631 (50%), Positives = 429/631 (67%), Gaps = 16/631 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I+L+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 349 SSPNLDIRRKTLDISLDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 408

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 409 AVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 468

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I   LGE+P  +  +                 
Sbjct: 469 AGKVCPCALWIIGEYCLSLSEVESGISTITQCLGELPFYSVSEE------SEPTETSKKI 522

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-LRSLLLSGDFYL 255
                   SSR+  ILADGTYAT++A S   +T +    ++ ++    LR+LLL+GDF+L
Sbjct: 523 QPTSSAMVSSRKPVILADGTYATQSAASE--TTFSSPTVVQGSLTSGNLRALLLTGDFFL 580

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           G+V+A TLTKLVLR   +     + N    +A+LIM S++++GQS  + +PID DSY+RI
Sbjct: 581 GAVVACTLTKLVLRLEEVQSSKTEVNKTVTQALLIMVSMLQLGQSPVSPHPIDNDSYERI 640

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           + C+ +L     +  +K ++L   R +F +++                    Q DDLI F
Sbjct: 641 VLCIKLL--CHRNDEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTHAQPDDLIDF 698

Query: 376 RQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
                R    +    D+ + DL RATG+    ++  +KL+R++QLTGFSDPVYAEAYV V
Sbjct: 699 FHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSDPVYAEAYVTV 758

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           H YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP     +KA IKVSST
Sbjct: 759 HHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPERSMQIKANIKVSST 818

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           ETGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW EFEWENKV V
Sbjct: 819 ETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWAEFEWENKVAV 878

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NT I + RE+L HI+KSTNM CLT   A+ G+CGFL+AN+YA+S+FGEDAL N+SIEKQT
Sbjct: 879 NTTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKSVFGEDALVNVSIEKQT 938

Query: 613 DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DGA++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 939 DGALSGYIRIRSKTQGIALSLGDKITLKQKG 969



>gi|449461669|ref|XP_004148564.1| PREDICTED: coatomer subunit beta-1-like [Cucumis sativus]
          Length = 950

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/644 (50%), Positives = 429/644 (66%), Gaps = 40/644 (6%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK + IALEL+T RN+ EVV+ LKKE+ KT   ++EKN EYRQ+L+Q+IH C
Sbjct: 326 SSPNLDIRRKTIDIALELITPRNIDEVVMSLKKEVVKTQSGEHEKNGEYRQMLVQAIHTC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FL D+N  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLSDTNVASAMDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPIL-ASEQRLLXXXXXXXXXXXXX 197
           + +V   ALWI+GEYC +  ++E     I+  LG++P   ASE+                
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGISTIKTCLGDLPFYTASEE-------GEAQESSKT 498

Query: 198 XXXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP------------ 243
                 TT SSRR  ILADGTYAT++A            A++ A+ PP            
Sbjct: 499 SQQVSSTTVSSRRPAILADGTYATQSA------------ALETAMSPPTLVQGSLSSIGN 546

Query: 244 LRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFA 303
           LRSL+LSGDF+LG+V+A TLTKLVLR   +     + N    +A+LIM S++++G+S F 
Sbjct: 547 LRSLILSGDFFLGAVVACTLTKLVLRLEEVQPSKVEVNRTFTQALLIMVSMLQLGESSFL 606

Query: 304 SNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXX 363
            +PID DS DRI+ C+ +L   +T   ++ ++L   R +F +++                
Sbjct: 607 PHPIDSDSRDRIVLCIRLLS--NTGDEVRKIWLQSCRQSFVKMLAEKQRHETEEIKARAQ 664

Query: 364 XXTVQVDDLIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGF 420
               Q DDLI F     R    +    DE + DL RATG+     D  +KL+R++QLTGF
Sbjct: 665 ISHAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFTKEGDDANKLNRILQLTGF 724

Query: 421 SDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSF 480
           SDPVYAEAYV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S 
Sbjct: 725 SDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESS 784

Query: 481 HSVKATIKVSSTETGVIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRS 539
             +KA IKVSSTETGVIFGNIVY+      E   +VLNDIHIDIMDYI+PA C +  FR+
Sbjct: 785 KQIKANIKVSSTETGVIFGNIVYETSSNVLERTVIVLNDIHIDIMDYISPASCTDVAFRA 844

Query: 540 MWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFG 599
           MW EFEWENKV VNT I D +E+L HIMKSTNM CLTP  AL G+CGFL+AN+YA+S+FG
Sbjct: 845 MWAEFEWENKVAVNTIIQDEKEFLNHIMKSTNMKCLTPISALEGECGFLAANLYAKSVFG 904

Query: 600 EDALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EDAL N+SIEKQ D  ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 905 EDALVNVSIEKQVDSKLSGYIRIRSKTQGIALSLGDKITLKQKG 948



>gi|356526314|ref|XP_003531763.1| PREDICTED: coatomer subunit beta-1-like [Glycine max]
          Length = 950

 Score =  639 bits (1647), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 326/643 (50%), Positives = 427/643 (66%), Gaps = 38/643 (5%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++P+ ++RRK L IALEL+T RN+ EVV+ LKKE+ KT   ++EKN EYRQ+L+Q+IH C
Sbjct: 326 STPNHDIRRKTLDIALELITPRNIDEVVMMLKKEVVKTQSGEHEKNGEYRQMLVQAIHTC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDTNVASAMDVVVFVREIIETNPKLRISIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P     +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGIATIKQCLGDLPFYTITEE------GDGQEASKPI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP------------L 244
                TT SSRR  ILADGTYAT++A            A++ A+ PP            L
Sbjct: 500 QQVNSTTVSSRRPAILADGTYATQSA------------ALETAMSPPTLVQGSLSSIGNL 547

Query: 245 RSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFAS 304
           RSL+LSGDF+LG+V+A TLTKLVLR   +     + N    +A+LI+ S++++GQS    
Sbjct: 548 RSLILSGDFFLGAVVACTLTKLVLRLEEVQTSKAEVNKATTQALLIIVSMLQLGQSSILP 607

Query: 305 NPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX 364
           +PID DS+DRI+ C+ +L   +T   I+ ++L   R +F +++                 
Sbjct: 608 HPIDNDSFDRIVLCIRLL--CNTGDEIRKIWLQSCRQSFVKMLADKQCRETEEIKAKAQI 665

Query: 365 XTVQVDDLIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
              Q DDLI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFS
Sbjct: 666 SNAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFTKDADDANKLNRILQLTGFS 725

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEAYV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S  
Sbjct: 726 DPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSK 785

Query: 482 SVKATIKVSSTETGVIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            +KA IKVSSTETGVIFGNIVY+      E   +VLNDIHIDIMDYI+PA C +  FR+M
Sbjct: 786 QIKANIKVSSTETGVIFGNIVYETSSNVLERTVIVLNDIHIDIMDYISPASCADVAFRTM 845

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           W EFEWENKV VNT + D R++L HI+KSTNM CLTP  AL GDCGFL+AN+YA+S+FGE
Sbjct: 846 WAEFEWENKVAVNTVLQDERDFLNHIVKSTNMKCLTPPSALEGDCGFLAANLYAKSVFGE 905

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DAL N+SIEKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 906 DALVNVSIEKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 948



>gi|302816011|ref|XP_002989685.1| hypothetical protein SELMODRAFT_160340 [Selaginella moellendorffii]
 gi|300142462|gb|EFJ09162.1| hypothetical protein SELMODRAFT_160340 [Selaginella moellendorffii]
          Length = 960

 Score =  639 bits (1647), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 318/638 (49%), Positives = 423/638 (66%), Gaps = 18/638 (2%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           SP++++RRK L IAL+L+T RN++EVV+ LKKE+ KT +++ EKN EYRQ+LIQ+IH CA
Sbjct: 327 SPNLDIRRKTLDIALDLITPRNIEEVVMTLKKEVVKTQNKELEKNAEYRQMLIQAIHSCA 386

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           +KF EVA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+ F  + +
Sbjct: 387 VKFPEVASTVVHLLMDFLGDTNLASALDVVCFVREIIETNPKLRESIITRLLDLFYQIPA 446

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXX 199
            +V   ALWI+GEYC +  +IE A   I+  LG++P     +                  
Sbjct: 447 SRVCSCALWIIGEYCQSLPEIESAISAIKQCLGDLPFFTVAEDGEAADQSSASKAPAPTS 506

Query: 200 XXXXTTSSSRRI-LADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
               +  S R + LADGTYA++TA  +    LA   ++ A     LR+LLL+GDF+LGSV
Sbjct: 507 KQTTSVGSKRPVVLADGTYASQTA--AVEIALAVPVSLVAGTSTNLRTLLLTGDFFLGSV 564

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           +  TLTKLVLR   +       N   A+ +L+M SI+R+GQS   ++PID DS DRI  C
Sbjct: 565 ICGTLTKLVLRLEELQTSKVAVNKATADILLVMVSILRLGQSAVVAHPIDNDSVDRITQC 624

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + +L   S D   + ++L   RA+F +++                    Q DDLI F   
Sbjct: 625 IRVL--TSPDEEARCIWLEKCRASFVKMITEKLRRDSEETRAKEQVARAQPDDLIDFYHL 682

Query: 379 SKRNIG-------------DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVY 425
             R +              +  DE + DL RATG+     D   KL+RV+QLTGFSDPVY
Sbjct: 683 KSRKVSSLPSFLLHGMSQLELEDEVQTDLKRATGEFTKDSDDTKKLNRVLQLTGFSDPVY 742

Query: 426 AEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKA 485
           AEAYV VHQYDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP +   ++A
Sbjct: 743 AEAYVTVHQYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPDASKQIRA 802

Query: 486 TIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFE 545
            IKVSSTETGVIFGNIVY+     + N VVLNDIHIDIMDYI+PA C +  FR+MW EFE
Sbjct: 803 NIKVSSTETGVIFGNIVYESTSALDRNVVVLNDIHIDIMDYISPASCPDVAFRNMWAEFE 862

Query: 546 WENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALAN 605
           WENKV+++++I D++++L HI+ STNM CLTP   L GDCGFL+AN+YA+S+FGEDAL N
Sbjct: 863 WENKVSISSSIEDVKQFLDHIVTSTNMKCLTPPSQLDGDCGFLAANLYAKSVFGEDALVN 922

Query: 606 ISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           +S+EK  DG ++G +RIRSKTQGIALSLGDKITL QKA
Sbjct: 923 VSVEKMPDGKLSGFIRIRSKTQGIALSLGDKITLKQKA 960



>gi|168042714|ref|XP_001773832.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674819|gb|EDQ61322.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 961

 Score =  639 bits (1647), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 322/642 (50%), Positives = 434/642 (67%), Gaps = 23/642 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++R+K L IA++L T RN+ EVV+ LKKE+ KT + + EKN EYRQ+L+Q+IH C
Sbjct: 326 SSPNLDIRKKTLDIAMDLTTLRNIDEVVMSLKKEVVKTQNAELEKNGEYRQMLVQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE+++   NLR SI  +L++TF  ++
Sbjct: 386 ALKFPEVASTVVHLLMDFLGDSNVASAIDVVCFVREIIQTNSNLRESIMARLVDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPIL--ASEQRLLXXXXXXXXXXXX 196
           S +V   ALWI+GEY     ++E     I+  LGE+P    + E  ++            
Sbjct: 446 SSRVATCALWIIGEYSLTVSEVEAGISVIKQSLGELPFYTESEEGEVVDTAVSKGPSTPK 505

Query: 197 XXXXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                  +T+SS+R  ILADGTYAT++A    ++++A   +        LRS LL GDF+
Sbjct: 506 AAPPQYASTASSKRPAILADGTYATQSA---AAASVAPFTSAVVGSSVNLRSTLLMGDFF 562

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           LG+V+ASTLTKL+LRY  I  + +  N   AE +L M S++R+GQS   S+PID+D+YDR
Sbjct: 563 LGAVVASTLTKLMLRYEEIENNKEAVNKAEAEILLYMVSMLRLGQSSALSHPIDDDAYDR 622

Query: 315 IMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
           I  C+ +L     D  +K+V+L + R +FA ++                    Q DDLI 
Sbjct: 623 ITLCIRVLSY--KDQLMKTVWLKNCRQSFAMMIKDKLSREMEEKKAKAQDSYAQPDDLID 680

Query: 375 FRQFSKRNIG-------------DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
           F    +  +              +  D+ + DL RATG+     D   KL++V+QLTGFS
Sbjct: 681 FYHLKRSKVSFSDLLLNQGMSQMELEDQVQDDLIRATGEVSKVGD-SKKLNKVLQLTGFS 739

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEAYV VHQYDI+LDV I+N+T+ETLQNL +E AT+GDLKLVERP  + LAP++  
Sbjct: 740 DPVYAEAYVTVHQYDIVLDVTILNRTTETLQNLCLELATMGDLKLVERPQNYALAPNTSK 799

Query: 482 SVKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMW 541
            ++A IKVSSTETG+IFGNIVY+     + N VVLNDIHIDIMDYI+PA C +  FR+MW
Sbjct: 800 QIRANIKVSSTETGIIFGNIVYETSSVLDRNVVVLNDIHIDIMDYISPASCADVAFRNMW 859

Query: 542 TEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGED 601
            EFEWENKV +NT I D+RE+L HI+ STNM CLTP  A+ GDCGFL+AN+YA+S+FGED
Sbjct: 860 AEFEWENKVAINTTIQDVREFLQHIVDSTNMKCLTPPSAMEGDCGFLAANLYAKSVFGED 919

Query: 602 ALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           AL N++IEKQ DG ++G+VRIRSKTQGIALSLGDKITL QK 
Sbjct: 920 ALVNVNIEKQLDGKLSGYVRIRSKTQGIALSLGDKITLKQKG 961



>gi|241958562|ref|XP_002422000.1| beta-coat protein of the COPI coatomer, putative; coatomer subunit,
           putative [Candida dubliniensis CD36]
 gi|223645345|emb|CAX40001.1| beta-coat protein of the COPI coatomer, putative [Candida
           dubliniensis CD36]
          Length = 953

 Score =  637 bits (1644), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 317/621 (51%), Positives = 425/621 (68%), Gaps = 9/621 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++V++KAL + L+ +T RNV++VV  LKKEL  T   + +KN +YRQLLI +IH  
Sbjct: 325 SSQDLDVKKKALDVTLQFITTRNVEDVVKLLKKELQSTALSNDDKNADYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N  AA +VI FV+EVVEKFP+LR +I  +L+     VK
Sbjct: 385 AIKFVEVAANVIDLLLDSIADLNTTAAYEVITFVKEVVEKFPDLRDAILRRLILALPHVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALW++GEY      I+E+WK IR  +GE+PI+ASE +                
Sbjct: 445 SGKVFRGALWVIGEYALEESLIQESWKYIRGSIGEVPIIASELKSKKHEEDTEELQEEEA 504

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                       +L DGTYATE+A +S ++     +++++  K P+R  +L GDFYLG+V
Sbjct: 505 EYDGKPRRKGPVVLPDGTYATESALTSETT-----DSLESDSKTPIRKQILGGDFYLGAV 559

Query: 259 LASTLTKLVLRYSGISEDPKKT-NALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
           LASTL KL+LR   + +  +K  N L+AEA+LIM SI+RVG+S   S  IDEDS DRI+S
Sbjct: 560 LASTLVKLILRLQSLKQTQEKILNGLKAEALLIMVSILRVGESSLVSKKIDEDSADRILS 619

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
            + IL        IK+ FL DT+ AF   +                    Q+DD IVFRQ
Sbjct: 620 YIKILNDEEDLQEIKTSFLEDTKDAFKAQINNAELKKAEALAKDLHDNAEQIDDAIVFRQ 679

Query: 378 FSKRNIGDEADEYELDLTRATGQAD-SRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYD 436
             K N   ++     DL  A+G  +  ++DL S+L++++QLTGFSDP+YAEA+V VHQYD
Sbjct: 680 LDKDN--KKSKTSVDDLAAASGSNELKKEDLSSRLNKIIQLTGFSDPIYAEAFVKVHQYD 737

Query: 437 ILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGV 496
           ++LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ V+ TIKV+S +TGV
Sbjct: 738 VVLDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTANIGPHGFYKVQTTIKVTSADTGV 797

Query: 497 IFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNI 556
           IFGNIVYDG  + +S  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + I
Sbjct: 798 IFGNIVYDGQHSDDSRIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITIKSPI 857

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAI 616
             L+EYL  +MK TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I
Sbjct: 858 ETLKEYLDELMKGTNMQCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQSDGPI 917

Query: 617 TGHVRIRSKTQGIALSLGDKI 637
            GHVRIRSK QG+ALSLGD++
Sbjct: 918 IGHVRIRSKGQGLALSLGDRV 938



>gi|213515116|ref|NP_001133821.1| Coatomer subunit beta [Salmo salar]
 gi|209155448|gb|ACI33956.1| Coatomer subunit beta [Salmo salar]
          Length = 953

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/636 (49%), Positives = 438/636 (68%), Gaps = 28/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  +++RQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKFRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F +LR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEFVREAIQRFDSLRPLIIEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           ++ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ +E +               
Sbjct: 450 RTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENEIK--------KEAGEGK 501

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                    +++ +   GTY T++A SS+  +       K   +PPLR  L+ GDFY+ +
Sbjct: 502 PEEEVSAAPAAKLVTEMGTYVTQSALSSSRPSK------KEEDRPPLRGFLMDGDFYVAA 555

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTK+ LRY  I +D K+ N+  AE+MLIMA+I+ +G+S     PI +D  DRI  
Sbjct: 556 SLATTLTKVALRYVTIVQDKKRQNSFVAESMLIMATILHLGKSSLPKKPITDDDVDRISL 615

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARI--VXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           CL +L + S    +  +F  + R + + +  V                   VQ DD I F
Sbjct: 616 CLKVLSECSP--LMNDIFNKECRKSLSHMLTVRLEEEKLSQKKESEKRNVLVQADDPISF 673

Query: 376 RQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q + +N    + D+++L L  A G   + ++ D + SKL++V QLTGFSDPVYAEAYV+
Sbjct: 674 MQLTAKNETSSKEDQFQLSLLAAMGTTLKKEANDPMASKLNKVTQLTGFSDPVYAEAYVH 733

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVL+VNQT++TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 734 VNQYDIVLDVLVVNQTNDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVAS 793

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENKV
Sbjct: 794 TENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKV 853

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTNI DL EYL HI+ STNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIEK
Sbjct: 854 TVNTNIADLNEYLHHILSSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIEK 913

Query: 611 Q----TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 D  + GH+RIR+K+QG+ALSLGDKI L+QK
Sbjct: 914 PIHLGPDAPVNGHIRIRAKSQGMALSLGDKINLSQK 949



>gi|448527490|ref|XP_003869511.1| Sec26 protein [Candida orthopsilosis Co 90-125]
 gi|380353864|emb|CCG23376.1| Sec26 protein [Candida orthopsilosis]
          Length = 947

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 319/619 (51%), Positives = 423/619 (68%), Gaps = 11/619 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D+ VR+KAL + LE +T+RNV++VV  LKKEL  T   + +KN EYRQLLI +IH  
Sbjct: 325 SSQDVAVRKKALDVTLEFITSRNVEDVVKLLKKELQATSSSNDDKNVEYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N+ +A +VI FV+EVVEKFP+LR SI ++L+    +VK
Sbjct: 385 AIKFVEVAANVIDLLLDSIADLNSTSAYEVITFVKEVVEKFPDLRDSIVKRLILALPNVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGA W+VGEY  N   I++AWK IR+ +GE+PI+ASE +                
Sbjct: 445 SGKVFRGAFWVVGEYALNEHLIQDAWKYIRSSIGEVPIIASELKAKEPANTEGDDGEEHP 504

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                 T     IL DGTYATE+A +++ +        +   K P+R  LL+GDFYLG+V
Sbjct: 505 HKKKGPT-----ILPDGTYATESALTADVNG----NGFEDETKTPIRKQLLAGDFYLGAV 555

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+ST+ KL+LR   ++   K  NAL+AEA+LIM SI+R+G+S   +  IDEDS DRI S 
Sbjct: 556 LSSTIIKLILRLHKLNTQAKILNALKAEALLIMVSILRLGESSLVTKKIDEDSADRIFSY 615

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + IL        I + FL DT+ AF   +                    QVDD IVFRQ 
Sbjct: 616 IRILNDEEDVEEITTSFLDDTKDAFKAQIIDVEAKKAEEEARDLHANADQVDDAIVFRQL 675

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
            K N    A +   DL  A+G    +++L S+L++++QLTGFSDP+YAEA+V VHQYD++
Sbjct: 676 DKDN--KSAKKVVDDLVVASGSDLKKENLSSRLNQILQLTGFSDPIYAEAFVKVHQYDVV 733

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ ++ TIKV+S +TGVIF
Sbjct: 734 LDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTTNIGPHGFYKIQTTIKVTSADTGVIF 793

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + I  
Sbjct: 794 GNIVYDGQHSDESTIVILNDVHVDIMDYIKPAVCSESQFRKMWNEFEWENKITIKSPIES 853

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITG 618
           L+ YL  +MK TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I G
Sbjct: 854 LKNYLDELMKGTNMECLTPGAVIGEECQFLSANLYSRSTFGEDALANLCIEKQSDGPIIG 913

Query: 619 HVRIRSKTQGIALSLGDKI 637
           HVRIRSK QG+ALSLGD++
Sbjct: 914 HVRIRSKGQGLALSLGDRV 932



>gi|260943546|ref|XP_002616071.1| hypothetical protein CLUG_03312 [Clavispora lusitaniae ATCC 42720]
 gi|238849720|gb|EEQ39184.1| hypothetical protein CLUG_03312 [Clavispora lusitaniae ATCC 42720]
          Length = 949

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/628 (50%), Positives = 429/628 (68%), Gaps = 16/628 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ DI+VR+KAL +AL+LV++RNV+++V  LKKELS++     +K +EYRQLLI +IH  
Sbjct: 325 STQDIDVRKKALHVALQLVSSRNVEDIVKLLKKELSRSSTSSEDKGSEYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI F EVA NV+ +L+E +GD ++ AA DV+ FV+E VEKFP+LR S+  KL+++  +VK
Sbjct: 385 AINFGEVATNVIDLLLESIGDLSSSAAYDVVTFVKEAVEKFPDLRQSVIHKLVKSLPEVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGA WI+GEY  +   I+EAWK IR  +GE+PILASE+R L              
Sbjct: 445 SGKVFRGAFWILGEYSEDESLIKEAWKFIRTTIGEVPILASEKRHLEGGDGSDDENDDEK 504

Query: 199 XXXXXTTSSSRR---ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                + S  ++   +L DGTYATE A +S        + ++      +R L+L GDFYL
Sbjct: 505 D----SASKPKKKPVVLPDGTYATENALTSTYENSEDEDIVR------VRKLILGGDFYL 554

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
           GSVLASTL KLVLR   +    K  NAL+AEA+L+M S++RVG+S + +  IDEDS DRI
Sbjct: 555 GSVLASTLVKLVLRLQKLQTAEKFLNALKAEALLMMVSMLRVGESSYVAKKIDEDSADRI 614

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           ++C+  L      + I   FL DT+ A+   V                    Q+DD IVF
Sbjct: 615 LACIAFLTDDEDSHLISQGFLEDTKDAYKEQVKSEQAKKAKAEAKDFHENAEQIDDAIVF 674

Query: 376 RQFSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
           RQF+K + G +      D+T A G     ++L S+L++++QLTGFSDP+YAEAYV VHQ+
Sbjct: 675 RQFAKSDAGSKTSTD--DITLAAGATTKTEELSSRLNKILQLTGFSDPIYAEAYVKVHQF 732

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI LDVL+VNQT+ T++NLS+EFATLGDLK+V++P   N+ PH FH +  T+KV+S +TG
Sbjct: 733 DITLDVLLVNQTTSTMRNLSVEFATLGDLKVVDKPATTNIGPHGFHKISVTVKVTSADTG 792

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNIVYDG  + +S  V+LND+H+DIMDYI PA C E+ FR MW EFEWENK+ + + 
Sbjct: 793 VIFGNIVYDGQHSDDSTIVILNDVHVDIMDYIKPATCTESAFRKMWNEFEWENKITIKSQ 852

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGA 615
           +  L+EYL  +M  TNM+CLTP   +  +C FL+AN+Y+RS FGEDALAN+ IEKQ DG 
Sbjct: 853 MGSLKEYLEELMAGTNMNCLTPGAIVGEECHFLAANLYSRSSFGEDALANLCIEKQADGP 912

Query: 616 ITGHVRIRSKTQGIALSLGDKI-TLAQK 642
           I GHVRIRSK QG+ALSLGD++ T+++K
Sbjct: 913 IIGHVRIRSKGQGLALSLGDRVATISRK 940



>gi|502149433|ref|XP_004507525.1| PREDICTED: coatomer subunit beta-1-like [Cicer arietinum]
          Length = 950

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 325/643 (50%), Positives = 427/643 (66%), Gaps = 38/643 (5%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++P+ ++RRK + IALEL+T +N+ +VV+ LKKE+ KT   ++EKN EYRQ+L+Q+IH C
Sbjct: 326 STPNHDIRRKTIDIALELITAKNIDQVVMMLKKEVVKTQSGEHEKNGEYRQMLVQAIHTC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF +VA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPDVASTVVHLLMDFLGDTNVASAMDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  +IE     I+  LG++P     +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEIESGIVAIKQCLGDLPFYTISE------DGDGQETSKAV 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP------------L 244
                TT SSRR  ILADGTYAT++A            A++ A+ PP            L
Sbjct: 500 QQVNSTTVSSRRPAILADGTYATQSA------------ALETAMSPPTLVQGSLSSIGNL 547

Query: 245 RSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFAS 304
           RSL+LSGDF+LG+V+A TLTKLVLR   +     + N   ++A+LIM S++++GQS    
Sbjct: 548 RSLILSGDFFLGAVVACTLTKLVLRLEEVQTSKVEVNKATSQALLIMVSMLQLGQSSVLP 607

Query: 305 NPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX 364
           +PID DS+DRI+ C+ +L    T   I+ ++L   R +F +++                 
Sbjct: 608 HPIDNDSHDRIILCIRLLSL--TGDEIRKIWLKSCRQSFVKMLADKQRRETEEIKAKAQI 665

Query: 365 XTVQVDDLIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFS 421
              Q DDLI F     R    +    DE + DL RATG+     D  +KL+R++QLTGFS
Sbjct: 666 SNAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFTKDADDANKLNRILQLTGFS 725

Query: 422 DPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFH 481
           DPVYAEAYV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S  
Sbjct: 726 DPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSK 785

Query: 482 SVKATIKVSSTETGVIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSM 540
            +KA IKVSSTETGVIFGNIVY+      E   +VLNDIHIDIMDYI PA C +  FR+M
Sbjct: 786 QIKANIKVSSTETGVIFGNIVYETSSNVLERTVIVLNDIHIDIMDYIAPASCADVAFRTM 845

Query: 541 WTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGE 600
           W EFEWENKV VNT + D RE+LGHI+KSTNM CLTP  AL G+CGFL+AN+YA+S+FGE
Sbjct: 846 WAEFEWENKVAVNTVLQDEREFLGHIIKSTNMKCLTPPSALEGECGFLAANLYAKSVFGE 905

Query: 601 DALANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           DAL N+SIEKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 906 DALVNVSIEKQGDGKLSGYIRIRSKTQGIALSLGDKITLKQKG 948



>gi|460365417|ref|XP_004228599.1| PREDICTED: coatomer subunit beta-1-like [Solanum lycopersicum]
          Length = 949

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 326/641 (50%), Positives = 423/641 (65%), Gaps = 35/641 (5%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I LEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIVLELITPRNINEVVLTLKKEVVKTQSGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AIKFPEVASTVVHLLMDFLGDSNVASAIDVVVFVREIIETNPKLRVSIVTRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P  +  +                 
Sbjct: 446 AARVCSCALWIIGEYCLSLSEVESGIATIKQCLGDLPFFSVSEE-----SEAADSSKKTQ 500

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPP-----------LR 245
                TT SSRR  +LADGTYAT++A S            + A  PP           LR
Sbjct: 501 QANSITTLSSRRPAVLADGTYATQSAAS------------ETAFSPPTVVQGSLTTGNLR 548

Query: 246 SLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASN 305
           SLLL+GDF+LG+V+A TLTKL+LR   +     + N     A+LIM S+I++GQS    +
Sbjct: 549 SLLLTGDFFLGAVVACTLTKLILRLEEVQPSKLELNKATTNALLIMVSMIQLGQSHALPH 608

Query: 306 PIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXX 365
           PID DS+DRI+ C+ +L   +T   ++ ++L   R +F  ++                  
Sbjct: 609 PIDNDSHDRIVLCIRLL--CNTGNEVRKIWLSSCRESFVNMLSDKQLRETEEIKAKAQIS 666

Query: 366 TVQVDDLIVFRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSD 422
             Q DDLI F     R    +    DE + DL RATG+    ++  +KLSRV+QLTGFSD
Sbjct: 667 RSQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFVKDENDANKLSRVLQLTGFSD 726

Query: 423 PVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHS 482
           PVYAEAYV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + +AP S   
Sbjct: 727 PVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTIAPESSKQ 786

Query: 483 VKATIKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWT 542
           +KA IKVSSTETGVIFGNIVY+     E   VVLNDIHIDIMDYI+PA C+E  FR+MW 
Sbjct: 787 IKANIKVSSTETGVIFGNIVYESSNVLERTVVVLNDIHIDIMDYISPAVCSEAAFRTMWA 846

Query: 543 EFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDA 602
           EFEWENKV VNT I D + +L HI+KSTNM CLT   AL  +CGFL+AN+YA+S+FGEDA
Sbjct: 847 EFEWENKVAVNTVIQDEKGFLDHIIKSTNMKCLTAPSALEDECGFLAANLYAKSVFGEDA 906

Query: 603 LANISIEKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           L N+SIEKQ+DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 907 LVNLSIEKQSDGKLSGYIRIRSKTQGIALSLGDKITLKQKG 947



>gi|297802880|ref|XP_002869324.1| coatomer subunit beta-1 [Arabidopsis lyrata subsp. lyrata]
 gi|297315160|gb|EFH45583.1| coatomer subunit beta-1 [Arabidopsis lyrata subsp. lyrata]
          Length = 937

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 320/630 (50%), Positives = 424/630 (67%), Gaps = 25/630 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IAL+L+T+ N+ EVV  LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIALDLITHHNINEVVQMLKKEVVKTQSGELEKNGEYRQMLIQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GKV   ALWI+GEYC +  ++E     I+  LG++P  +  +                 
Sbjct: 446 AGKVCPCALWIIGEYCLSLSEVESGISTIKQCLGDLPFYSVSEE------SEPTETSKKI 499

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                   SSR+  ILADGTYAT++A S   S   +L            +LLL+GDF+LG
Sbjct: 500 QPTSSAMVSSRKPVILADGTYATQSAASEPHSPHLQL------------ALLLTGDFFLG 547

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           +V+A TLTKLVLR   +     + N    +A+LIM S++++GQS  + +PID DSY+RI+
Sbjct: 548 AVVACTLTKLVLRLEEVQSSKTEVNKTVTQALLIMVSMLQLGQSPVSPHPIDNDSYERIV 607

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
            C+ +L     +  +K ++L   R +F +++                    Q DDLI F 
Sbjct: 608 LCIKLL--CHRNDEMKKIWLEYCRQSFVKMISEKQLREMEELKAKTQTTHAQPDDLIDFF 665

Query: 377 QFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVH 433
               R    +    D+ + DL RATG+    ++  +KL+R++QLTGFSDPVYAEAYV VH
Sbjct: 666 HLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQLTGFSDPVYAEAYVTVH 725

Query: 434 QYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTE 493
            YDI L+V ++N+T ETLQNL +E AT+GDLKLVERP  ++LAP     +KA IKVSSTE
Sbjct: 726 HYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAPERSMQIKANIKVSSTE 785

Query: 494 TGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVN 553
           TGVIFGNIVY+     E N VVLNDIHIDIMDYI+PA C+E  FR+MW EFEWENKV VN
Sbjct: 786 TGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAFRTMWAEFEWENKVAVN 845

Query: 554 TNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD 613
           T I + RE+L HI+KSTNM CLT   A+ G+CGFL+AN+YA+S+FGEDAL N+SIEKQTD
Sbjct: 846 TTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKSVFGEDALVNVSIEKQTD 905

Query: 614 GAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           GA++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 906 GALSGYIRIRSKTQGIALSLGDKITLKQKG 935



>gi|168059347|ref|XP_001781664.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666833|gb|EDQ53477.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 956

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 325/634 (51%), Positives = 439/634 (69%), Gaps = 15/634 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++R+K L IA++LVT RN+ EVV+ LKKE+ KT + D EKN EYRQ+L+Q+IH C
Sbjct: 329 SSPNLDIRKKTLDIAMDLVTLRNIDEVVMTLKKEVVKTQNGDLEKNGEYRQMLVQAIHSC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE+++    LR SI  +L++TF  ++
Sbjct: 389 ALKFPEVASTVVHLLMDFLGDSNVASAIDVVCFVREIIQTNTKLRESILARLVDTFYQIR 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQR---LLXXXXXXXXXXX 195
           S +V   ALWI+GEY  +  ++E     I+  LGE+P   S +    +            
Sbjct: 449 SSRVATCALWIIGEYSLSASEVESGISVIKQSLGELPFFTSAEEGDVVDTAVSNKGPSTP 508

Query: 196 XXXXXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDF 253
                   + +SS+R  ILADGTYAT++A +S+++      A+ ++    LR++LL+GDF
Sbjct: 509 KATALQHASLASSKRPAILADGTYATQSAAASSAAPSLTSVAVGSSAN--LRTILLTGDF 566

Query: 254 YLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYD 313
           +LG+V+ASTLTKL+LRY  + E+    N   A+ +L M S++R+GQS   S+PID+D+YD
Sbjct: 567 FLGAVVASTLTKLMLRYEDVQENQVAANRAEADVLLYMVSMLRLGQSSALSHPIDDDAYD 626

Query: 314 RIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLI 373
           RI  C+ +L   + D  +KSV+L + R++FA ++                    Q DDLI
Sbjct: 627 RITLCIRVLA--NKDQVMKSVWLKNCRSSFAMMIDDKICREMEEKKAKAQDSYAQPDDLI 684

Query: 374 VFRQFSKRNIG----DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAY 429
            F    KR  G    +  DE + DL RATG++    D   KL++V+QLTGFSDPVYAEAY
Sbjct: 685 DFYHL-KRTKGMSQMELEDEVQDDLKRATGESTKEGD-SRKLNKVLQLTGFSDPVYAEAY 742

Query: 430 VNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKV 489
           V VHQYDI+LDV + N+T+ETLQNL +E AT+GDLKLVERP  + LAP++   ++A IKV
Sbjct: 743 VTVHQYDIVLDVTVHNRTTETLQNLCLELATMGDLKLVERPQNYALAPNTSKQIRANIKV 802

Query: 490 SSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           SSTETGVIFGNIVY+     + N VVLNDIHIDIMDYI PA C +  FR+MW EFEWENK
Sbjct: 803 SSTETGVIFGNIVYESSTVLDRNVVVLNDIHIDIMDYIAPASCTDIAFRNMWAEFEWENK 862

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V +NT I  +R +L HI+ STNM CLTP  AL GDCGFL+AN+YA+S+FGEDAL N+S+E
Sbjct: 863 VAINTTIQVVRGFLQHIVDSTNMKCLTPPSALEGDCGFLAANLYAKSVFGEDALVNVSVE 922

Query: 610 KQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           KQ+DG ++G+VRIRSKTQGIALSLGDKITL QK 
Sbjct: 923 KQSDGKLSGYVRIRSKTQGIALSLGDKITLKQKG 956



>gi|68477011|ref|XP_717483.1| hypothetical protein CaO19.8161 [Candida albicans SC5314]
 gi|68477196|ref|XP_717391.1| hypothetical protein CaO19.528 [Candida albicans SC5314]
 gi|46439100|gb|EAK98422.1| hypothetical protein CaO19.528 [Candida albicans SC5314]
 gi|46439196|gb|EAK98517.1| hypothetical protein CaO19.8161 [Candida albicans SC5314]
 gi|238879898|gb|EEQ43536.1| coatomer beta subunit [Candida albicans WO-1]
          Length = 952

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 318/625 (50%), Positives = 428/625 (68%), Gaps = 18/625 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++V++KAL + L+ +T RNV++VV  LKKEL  T   + +KN +YRQLLI +IH  
Sbjct: 325 SSQDLDVKKKALDVTLQFITTRNVEDVVKLLKKELQSTALSNDDKNADYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N  AA +VI FV+EVVEKFP+LR +I  +L+     VK
Sbjct: 385 AIKFVEVAANVIDLLLDSIADLNTTAAYEVITFVKEVVEKFPDLRDAILRRLILALPHVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGALW++GEY      I+E+WK IR  +GE+PI+ASE +                
Sbjct: 445 SGKVFRGALWVIGEYALEESLIQESWKYIRGSIGEVPIIASELK-----SKKRDDTEESQ 499

Query: 199 XXXXXTTSSSRR----ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                     RR    +L DGTYATE+A +S ++     +++++  K P+R  +L+GDFY
Sbjct: 500 EEETEYDGKPRRKGPVVLPDGTYATESALTSETT-----DSLESDSKTPIRKQILAGDFY 554

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKT-NALRAEAMLIMASIIRVGQSQFASNPIDEDSYD 313
           LG+VLASTL KL+LR   + +  +K  N L+AEA+LIM SI+RVG+S   S  IDEDS D
Sbjct: 555 LGAVLASTLVKLILRLQSLKQTQEKILNGLKAEALLIMVSILRVGESSLVSKKIDEDSAD 614

Query: 314 RIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLI 373
           RI+S + IL        IK+ FL DT+ AF   +                    Q+DD I
Sbjct: 615 RILSYIKILNDEEDLQEIKTSFLEDTKDAFKAQINNAELKKAEALAKDLHDNAEQIDDAI 674

Query: 374 VFRQFSKRNIGDEADEYELDLTRATGQAD-SRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
           VFRQ  K N   +A     D+  A+G  +  +++L S+L++++QLTGFSDP+YAEA+V V
Sbjct: 675 VFRQLDKDNKKSKASVD--DVAAASGSNELKKENLSSRLNKIIQLTGFSDPIYAEAFVKV 732

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           HQYD++LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ V+ TIKV+S 
Sbjct: 733 HQYDVVLDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTANIGPHGFYKVQTTIKVTSA 792

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           +TGVIFGNIVYDG  + +S  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ +
Sbjct: 793 DTGVIFGNIVYDGQHSDDSRIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITI 852

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
            + I  L+EYL  +MK TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+
Sbjct: 853 KSPIETLKEYLDELMKGTNMQCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQS 912

Query: 613 DGAITGHVRIRSKTQGIALSLGDKI 637
           DG I GHVRIRSK QG+ALSLGD++
Sbjct: 913 DGPIIGHVRIRSKGQGLALSLGDRV 937



>gi|260825750|ref|XP_002607829.1| hypothetical protein BRAFLDRAFT_275075 [Branchiostoma floridae]
 gi|229293178|gb|EEN63839.1| hypothetical protein BRAFLDRAFT_275075 [Branchiostoma floridae]
          Length = 930

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 325/636 (51%), Positives = 437/636 (68%), Gaps = 29/636 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L +AL+LV++RNV+E+V+ LKKE+ KT D  ++E  ++YRQLL++++H 
Sbjct: 308 STPDLEVRKKTLNLALDLVSSRNVEELVLVLKKEVIKTNDITEHEDTDKYRQLLVRTLHS 367

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+IKF ++A  V+ VLMEFL D N  AA DV+ FVRE +++F  L+  I EKLLE F  +
Sbjct: 368 CSIKFPDMAGAVIPVLMEFLSDQNELAAADVLVFVREAIQRFDQLKHVILEKLLEVFPSI 427

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K+ R ALWI+GEYC+  +DI+    +IR  LG+IPI+ SE +               
Sbjct: 428 KSVKIHRAALWILGEYCTTAEDIQALMHEIRHSLGDIPIVESEMK---------KAAGEI 478

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                 T +  + + A+GTYAT++A +S   T+ K    K   +PPLR  L+ GDF++G+
Sbjct: 479 KDEDEFTPTQQKLLTAEGTYATQSALTS---TVKKSSEEK---RPPLRGFLMDGDFFVGA 532

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            LA+TLTKL +RY  I  DPKK N+  AE MLIMA+II +G+S  A+ PI +D  DRI  
Sbjct: 533 SLATTLTKLAIRYGEIVPDPKKHNSFNAECMLIMATIIHLGKSGLATKPITDDDLDRIAL 592

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTV--QVDDLIVF 375
           CL +L   +   ++  +F  + R + + ++                  TV  Q DD I F
Sbjct: 593 CLKVLSDHTP--AVNDIFSRECRHSLSTMLAALHEEEKENQKTVIEKKTVSVQPDDPISF 650

Query: 376 RQF-SKRNIGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
            Q  +K   G   D +EL L +A G   + D+ D   SKL +V QLTGFSDPVYAEAYV+
Sbjct: 651 MQLVNKAEHGTTEDLFELSLLQAVGTPQKKDAADPQASKLQKVNQLTGFSDPVYAEAYVH 710

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVLIVNQTS+TLQ++++E ATLGDLKLVE+P+   LAPH F ++KA +KV+S
Sbjct: 711 VNQYDIVLDVLIVNQTSDTLQSVTLELATLGDLKLVEKPSPIILAPHDFANIKANVKVAS 770

Query: 492 TETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G  S+ NCVVLNDIHIDIMDYI PA C++ +FR MW EFEWENKV
Sbjct: 771 TENGIIFGNIVYDVSGAASDRNCVVLNDIHIDIMDYIVPAQCSDNEFRQMWAEFEWENKV 830

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNT+ITDL  Y+GH++KSTNM  LTPE ALSG+CGF++AN+YARSIFGED LAN+SIEK
Sbjct: 831 TVNTSITDLGIYMGHLLKSTNMKSLTPEKALSGECGFMAANLYARSIFGEDVLANLSIEK 890

Query: 611 QT----DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
                 D  + GH+RIR+K+QG+ALS+GDK+ + QK
Sbjct: 891 MIHLGEDAPVQGHIRIRAKSQGMALSMGDKVNMCQK 926



>gi|354546153|emb|CCE42882.1| hypothetical protein CPAR2_205250 [Candida parapsilosis]
          Length = 948

 Score =  635 bits (1637), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/620 (50%), Positives = 426/620 (68%), Gaps = 12/620 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ D+ VR+KAL + LE +T+RNV++VV  LKKEL  T   + +KN EYRQLLI +IH  
Sbjct: 325 SAQDVAVRKKALDVTLEFITSRNVEDVVKLLKKELQATSSSNDDKNVEYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L++ + D N+ +A +VI FV+EVVEKFPNLR SI ++L++T  +VK
Sbjct: 385 AIKFVEVAANVIDLLLDTIADLNSTSAYEVITFVKEVVEKFPNLRDSIIKRLIQTLPNVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGA W++GEY  +   I++AWK IR+ +GE+PI+ASE +                
Sbjct: 445 SGKVFRGAFWVIGEYALDEHLIQDAWKYIRSSIGEVPIVASELK----GKTPANTEGGDD 500

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                       +L DGTYATE+A +++ ++       +   K P+R  LL+GDFYLG+V
Sbjct: 501 GQEHPHKKKGPVVLPDGTYATESALTADVNS----NGFEDEKKAPIRKQLLAGDFYLGAV 556

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KL+LR   ++   K  NAL+AEA+LIM SI+R+G+S      IDEDS DR+ S 
Sbjct: 557 LSSTLVKLILRLRKLNTQEKILNALKAEALLIMVSILRLGESSLVKKKIDEDSADRVFSY 616

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + IL        I + FL DT+ AF   +                    QVDD I FRQ 
Sbjct: 617 IRILNDEEDVEEITTSFLDDTKDAFKAQITDVETKKAEEEARDLHANADQVDDAIAFRQL 676

Query: 379 SKRNI-GDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            K N  G++A +   DL  A+G    +++L S+L++++QLTGFSDP+YAEA+V VHQYD+
Sbjct: 677 DKDNKSGNKAVD---DLAVASGSDLKKENLSSRLNQILQLTGFSDPIYAEAFVKVHQYDV 733

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ TL+NLS+EFATLGDLK+V++PT  N+ PH F+ ++ TIKV+S +TGVI
Sbjct: 734 VLDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTTNIGPHGFYKIQTTIKVTSADTGVI 793

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + I 
Sbjct: 794 FGNIVYDGQHSDESTIVILNDVHVDIMDYIKPAVCSESQFRKMWNEFEWENKITIKSPID 853

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
            L+ YL  +MK TNM CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I 
Sbjct: 854 SLKNYLDELMKGTNMECLTPGAVIGEECQFLSANLYSRSTFGEDALANLCIEKQSDGPII 913

Query: 618 GHVRIRSKTQGIALSLGDKI 637
           GHVRIRSK QG+ALSLGD++
Sbjct: 914 GHVRIRSKGQGLALSLGDRV 933



>gi|302820254|ref|XP_002991795.1| hypothetical protein SELMODRAFT_448563 [Selaginella moellendorffii]
 gi|300140476|gb|EFJ07199.1| hypothetical protein SELMODRAFT_448563 [Selaginella moellendorffii]
          Length = 956

 Score =  634 bits (1635), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 318/634 (50%), Positives = 423/634 (66%), Gaps = 14/634 (2%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           SP++++RRK L IAL+L+T RN++EVV+ LKKE+ KT +++ EKN EYRQ+LIQ+IH CA
Sbjct: 327 SPNLDIRRKTLDIALDLITPRNIEEVVMTLKKEVVKTQNKELEKNAEYRQMLIQAIHSCA 386

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           +KF EVA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+ F  + +
Sbjct: 387 VKFPEVASTVVHLLMDFLGDTNLASALDVVCFVREIIETNPKLRESIITRLLDLFYQIPA 446

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXX 199
            +V   ALWI+GEYC +  +IE A   I+  LG++P     +                  
Sbjct: 447 SRVCSCALWIIGEYCQSLPEIESAISTIKECLGDLPFFTVAEDGEAADQSSASKAPAPTS 506

Query: 200 XXXXTTSSSRRI-LADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
               +  S R + LADGTYA++TA  +    LA   ++ A     LR+LLL+GDF+LGSV
Sbjct: 507 KQTTSVGSKRPVVLADGTYASQTA--AVEIALAVPVSLVAGTSTNLRTLLLTGDFFLGSV 564

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           +  TLTKLVLR   +       N   A+ +L+M SI+R+GQS   ++PID DS DRI  C
Sbjct: 565 ICGTLTKLVLRLEELQTSKVAVNKATADILLVMVSILRLGQSAVVAHPIDNDSVDRITQC 624

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + +L   S D   + ++L   RA+F +++                    Q DDLI F   
Sbjct: 625 IRVL--TSPDEEARCIWLEKCRASFVKMITEKLRRDSEETRAKEQVARAQPDDLIDFYHL 682

Query: 379 SKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
             R    +    DE + DL RATG+     D   KL+RV+QLTGFSDPVYAEAYV VHQY
Sbjct: 683 KSRKGMSQLELEDEVQTDLKRATGEFTKDSDDTKKLNRVLQLTGFSDPVYAEAYVTVHQY 742

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP +   ++A IKVSSTETG
Sbjct: 743 DIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPDASKQIRANIKVSSTETG 802

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNIVY+     + N VVLNDIHIDIMDYI+PA C +  FR+MW EFEWENKV+++++
Sbjct: 803 VIFGNIVYESTSALDRNVVVLNDIHIDIMDYISPASCPDVAFRNMWAEFEWENKVSISSS 862

Query: 556 ITDLREYLGHIMKSTNMSCLTPEV------ALSGDCGFLSANMYARSIFGEDALANISIE 609
           I D++++L HI+ STNM CLTP +       L GDCGFL+AN+YA+S+FGEDAL N+S+E
Sbjct: 863 IEDVKQFLDHIVTSTNMKCLTPPLFATSRSQLDGDCGFLAANLYAKSVFGEDALVNVSVE 922

Query: 610 KQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           K  DG ++G +RIRSKTQGIALSLGDKITL QKA
Sbjct: 923 KMPDGKLSGFIRIRSKTQGIALSLGDKITLKQKA 956



>gi|168015790|ref|XP_001760433.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688447|gb|EDQ74824.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 953

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 324/632 (51%), Positives = 424/632 (67%), Gaps = 11/632 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L IAL+L+T RN+ EVV+ LKKE+ KT   + EK  EYRQ+L+Q+IH C
Sbjct: 326 SSPNLDIRRKTLDIALDLITPRNIDEVVMTLKKEVVKTQTMELEKCGEYRQMLVQAIHAC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE+ E  P LR SI  +L +TF  ++
Sbjct: 386 ALKFPEVASTVVHLLMDFLGDSNVASALDVVFFVREITETNPKLRESIMSRLSDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPIL--ASEQRLLXXXXXXXXXXXX 196
           S +V   ALWI+GEY  + ++IE +   I+  LG++P    A E                
Sbjct: 446 SSRVCTCALWIIGEYSHSLQEIESSIALIKQSLGDMPFFSAADENDGSVAGDNKSSSGNK 505

Query: 197 XXXXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                  +++SS+R  +LADGTYAT++A   N           +A    LR++LL+GDF+
Sbjct: 506 APPPINVSSASSKRPAVLADGTYATQSAVVDNVHISGTSATSNSAAN--LRAILLTGDFF 563

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           LG+V+++TLTKLV+R   +       N ++AE MLI+ S++R+G+S    +PID DSYDR
Sbjct: 564 LGAVVSATLTKLVMRLEEVQTSGVALNKIKAEIMLILVSMLRLGESSVLPHPIDRDSYDR 623

Query: 315 IMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIV 374
           I  C+ +L   S D  I+SV+L     +F  ++                    Q DDLI 
Sbjct: 624 ISLCIRLLS--SPDDVIRSVWLKSCHDSFVVMLKEKQDRENEDLKAKAMVSYAQPDDLID 681

Query: 375 FRQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
           F     R    +    DE + DL RATG+     +    L+RV+QLTGFSDPVYAEAYV 
Sbjct: 682 FYHLKSRKGMSQLELEDEVQTDLKRATGEISKDGETDRNLNRVLQLTGFSDPVYAEAYVT 741

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           VHQYDI+LDV +VN+TSETLQNL +E AT+GDLKLVERP  + LAP +   +KA IKVSS
Sbjct: 742 VHQYDIVLDVTVVNRTSETLQNLCLELATMGDLKLVERPQNYALAPQTSKQIKANIKVSS 801

Query: 492 TETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           TETGVIFGNIVY+     + N VVLNDIHIDIMDYI+PA C +  FR+MW EFEWENKV 
Sbjct: 802 TETGVIFGNIVYETTSALDRNVVVLNDIHIDIMDYISPASCADVVFRNMWAEFEWENKVA 861

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ 611
           VNTNI D++E+L H++ STNM CLTP  AL GDCGFL+AN+YA+S+FGEDAL N+SIEKQ
Sbjct: 862 VNTNIQDVQEFLNHVVASTNMKCLTPPSALEGDCGFLAANLYAKSVFGEDALVNVSIEKQ 921

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
            DG + G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 922 PDGKLGGYIRIRSKTQGIALSLGDKITLKQKG 953



>gi|150866782|ref|XP_001386493.2| hypothetical protein PICST_91200 [Scheffersomyces stipitis CBS
           6054]
 gi|149388038|gb|ABN68464.2| coatomer beta subunit [Scheffersomyces stipitis CBS 6054]
          Length = 947

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 315/619 (50%), Positives = 419/619 (67%), Gaps = 11/619 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL + L+ VT+RNV++VV  LK EL +T   + +K+ EYRQLLI +IH  
Sbjct: 325 SSQDLDVRKKALDVTLQFVTSRNVEDVVKLLKTELQRTSSANEDKSAEYRQLLINAIHQL 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANV+ +L+E + D N  AA +VI FV+EVVEKFP+LR +I  +L+     +K
Sbjct: 385 AIKFVEVAANVIDLLLESMSDLNTTAAYEVITFVKEVVEKFPDLRKTIITRLISVLPSIK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGA WI+GEY      ++EAWK IR+ +GE+PI+ASE+R                
Sbjct: 445 SGKVFRGAFWIIGEYALEESLVQEAWKYIRSSIGEVPIVASEKR---AAEGNAPDVEEYS 501

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                 T     +L DGTYATE+A ++     +  E      KPP+R  +L GDFYL +V
Sbjct: 502 NGSTEHTKKGPVVLPDGTYATESALTAEVKDTSNDE------KPPVRKHILDGDFYLAAV 555

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KLVLR   +       NA +AEA+LIM SI+R G+S + +  IDEDS DRI+S 
Sbjct: 556 LSSTLVKLVLRLHRLKASQSVLNASKAEALLIMVSILRAGESSYVAKKIDEDSADRILSY 615

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + +L +      I + FL +T+ AF   +                    QVD  IVFRQF
Sbjct: 616 IKVLNEEDDLELISAGFLDETKDAFTAQIQSAELKKAEEQARDFHENAEQVDGSIVFRQF 675

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
            K N    A     D++ A+G A  ++DL S+L++++QLTGFSDP+YAEA+V VHQYD+ 
Sbjct: 676 DKDNAAKSAAVD--DVSLASGSALKKEDLSSRLNKILQLTGFSDPIYAEAFVKVHQYDVT 733

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ TL+NLSIEFATLGDLK+V++P   N+ PH F+ ++ T+KV+S +TGVIF
Sbjct: 734 LDVLLVNQTTATLRNLSIEFATLGDLKVVDKPATANVGPHGFYKIQTTVKVTSADTGVIF 793

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+QFR MW EFEWENK+ + + I  
Sbjct: 794 GNIVYDGQHSDESTIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITIKSQIPT 853

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITG 618
           L+EYL  +MK TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I G
Sbjct: 854 LKEYLDELMKGTNMNCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQSDGPIIG 913

Query: 619 HVRIRSKTQGIALSLGDKI 637
           HVRIRSK QG+ALSLGD++
Sbjct: 914 HVRIRSKGQGLALSLGDRV 932



>gi|47230461|emb|CAF99654.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 979

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 321/663 (48%), Positives = 445/663 (67%), Gaps = 56/663 (8%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEV--------------------------VVFLKKE 52
           ++PD+EVR+K L++AL+LV++RNV+EV                          V+ LKKE
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEEVGGHTAGVCPPAASLLSIKRRLSVSQLVIVLKKE 389

Query: 53  LSKTLD-QDYEKNNEYRQLLIQSIHGCAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAF 111
           + KT +  ++E  ++YRQLL++++H C+++F ++AANV+ VLMEFL D+N  AA DV+ F
Sbjct: 390 VIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDTNEAAAADVLEF 449

Query: 112 VREVVEKFPNLRSSITEKLLETFMDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGL 171
           VRE +++F NLR  + EK+LE F  +K+ K++RGALWI+GEYCS  +DI+    ++R  L
Sbjct: 450 VREAIQRFDNLRPLVIEKMLEVFHAIKTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSL 509

Query: 172 GEIPILASEQRLLXXXXXXXXXXXXXXXXXXXTTSSSRRILAD-GTYATETAFSSNSSTL 230
           GEIPI+ +E +                     + + +++++ + GTY T++A SS+  + 
Sbjct: 510 GEIPIVENEIK---------KETGEVKPEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSK 560

Query: 231 AKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLI 290
                 K   +PPLR  L+ GDFY+ + LA+TLTK+ LRY  I +D K+ N+  AEAMLI
Sbjct: 561 ------KEEDRPPLRGFLMDGDFYVAACLATTLTKVALRYVDIVQDKKRQNSFVAEAMLI 614

Query: 291 MASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARI--VX 348
           M +++ +G+S     PI +D  DRI  CL +L + S    +  +F  + R + + +  V 
Sbjct: 615 MVTVLHLGKSSLPKKPITDDDVDRISLCLKVLSERSP--LMNDIFNKECRKSLSHMLTVR 672

Query: 349 XXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRN-IGDEADEYELDLTRATG---QADSR 404
                            TVQ DD I F Q + +N +  + D+++L L  A G   + ++ 
Sbjct: 673 LEEEKLSQKKESEKRNVTVQADDPISFMQLTAKNEMTSKEDQFQLSLLAAMGNTQRKEAA 732

Query: 405 DDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDL 464
           D L SKL++V QLTGFSDPVYAEAYV+V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDL
Sbjct: 733 DPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDL 792

Query: 465 KLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIVYDGPGT-SESNCVVLNDIHIDI 523
           KLVE+P+   LAPH F ++KA +KV+STE G+IFGNIVYD  G  S+ NCVVL+DIHIDI
Sbjct: 793 KLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDI 852

Query: 524 MDYINPAYCNETQFRSMWTEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSG 583
           MDYI PA C + +FR MW EFEWENKV VNTNI DL +YL HI+KSTNM CLTPE ALSG
Sbjct: 853 MDYIQPASCTDAEFRQMWAEFEWENKVTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSG 912

Query: 584 DCGFLSANMYARSIFGEDALANISIEKQ----TDGAITGHVRIRSKTQGIALSLGDKITL 639
            CGF++AN+YARSIFGEDALAN+SIEK      +  +TGH+RIR+K+QG+ALSLGDKI L
Sbjct: 913 FCGFMAANLYARSIFGEDALANVSIEKPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINL 972

Query: 640 AQK 642
           +QK
Sbjct: 973 SQK 975



>gi|19112195|ref|NP_595403.1| coatomer beta subunit (predicted) [Schizosaccharomyces pombe 972h-]
 gi|46396039|sp|Q9UUF7.1|COPB_SCHPO RecName: Full=Coatomer subunit beta; AltName: Full=Beta-coat
           protein; Short=Beta-COP
 gi|5441496|emb|CAB46767.1| coatomer beta subunit (predicted) [Schizosaccharomyces pombe]
          Length = 940

 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 316/618 (51%), Positives = 432/618 (69%), Gaps = 6/618 (0%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D +V  KA+ I + LV++RNV++++   +KEL+K+ + + EK++  R+ L ++IH C
Sbjct: 324 SSSDFDVCEKAISIIMGLVSSRNVEDILNHFQKELTKS-NGETEKDDGRRRALTKAIHSC 382

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI F   AA  +  L+  + D  + +A  V++F++EV+EKFP+LRSS   KLL +  +++
Sbjct: 383 AINFPHTAATAIQYLLSHISDFQSKSASSVLSFIKEVMEKFPDLRSSNITKLLLSLKELR 442

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           +GK+FRG +WI GEYC    DI  AWK IRA LGE+PILASE++LL              
Sbjct: 443 AGKIFRGVIWIAGEYCLTEDDIRVAWKSIRASLGEVPILASEEQLLKDVSNVPEDDLLID 502

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                +TS  R++L DGTYATE+A +S + + A+LEA+KA+ KPPLR+ +LSGD+YL +V
Sbjct: 503 ISAPASTS--RKVLPDGTYATESAVTSEALSAARLEAVKASKKPPLRTQILSGDYYLAAV 560

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LAS LTKLV+R++ +S D ++ NAL+AEA LIM SIIRVGQS+F    ID+DS +RIM+C
Sbjct: 561 LASALTKLVMRFARLSFDKERLNALKAEACLIMTSIIRVGQSKFVKYTIDDDSVERIMNC 620

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  +         ++VFL D R AF+ +V                   VQ D+L+  RQF
Sbjct: 621 IRAIYSFEELPEFQTVFLDDMRKAFSSLVAQSDKRQKEADLLVNGSDAVQADELLNIRQF 680

Query: 379 SKRNIGDEAD-EYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
            +R I ++ D  +E D+ +AT      +DL SKL  +VQL GF+DPVY EAYV + Q+DI
Sbjct: 681 -QRVIEEKQDLNFESDIIQATNDGMVVEDLASKLDHIVQLAGFTDPVYCEAYVKIQQFDI 739

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LD+L+VN+T  TLQNLS++ ATLGDLK+VERP   NL PH+F SV+AT+KVSSTE+ VI
Sbjct: 740 ILDILLVNRTDTTLQNLSVDLATLGDLKVVERPPPMNLGPHAFKSVQATVKVSSTESAVI 799

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN-I 556
           FGNIVY G  + E   VVLN I ++I+DYI PA+  E+QFRSMWTEFEWENKV++++N  
Sbjct: 800 FGNIVYGGKASDEDKIVVLNGIPVNIIDYIKPAFIPESQFRSMWTEFEWENKVDISSNED 859

Query: 557 TDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAI 616
             L ++L  IMK TNM+CLTP+ +L GDCGFLSAN+YA SIFGEDAL ++S+EK   G I
Sbjct: 860 ISLYDFLHKIMKKTNMNCLTPDASLRGDCGFLSANLYACSIFGEDALMSLSVEKSVSGPI 919

Query: 617 TGHVRIRSKTQGIALSLG 634
           +GHVRIRSKTQGIALSLG
Sbjct: 920 SGHVRIRSKTQGIALSLG 937



>gi|344243210|gb|EGV99313.1| Coatomer subunit beta [Cricetulus griseus]
          Length = 870

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 315/622 (50%), Positives = 433/622 (69%), Gaps = 30/622 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 253 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 312

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 313 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 372

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 373 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 423

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 424 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 477

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 478 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 537

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + ++++                    TVQ DD I 
Sbjct: 538 LCLKVLSECSP--LMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 595

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 596 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 655

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 656 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 715

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 716 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 775

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 776 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 835

Query: 610 KQT----DGAITGHVRIRSKTQ 627
           K      D A+TGH+RIR+K+Q
Sbjct: 836 KPVHQGPDAAVTGHIRIRAKSQ 857



>gi|483511397|gb|EOB00260.1| Coatomer subunit beta, partial [Anas platyrhynchos]
          Length = 937

 Score =  629 bits (1622), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 432/622 (69%), Gaps = 30/622 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRPLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 +   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEVSVGPAQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVSLVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMSSKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQ 627
           K      D  +TGH+RIR+K+Q
Sbjct: 913 KPIHLGPDAPVTGHIRIRAKSQ 934



>gi|444730394|gb|ELW70780.1| Coatomer subunit beta [Tupaia chinensis]
          Length = 986

 Score =  629 bits (1621), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 315/623 (50%), Positives = 432/623 (69%), Gaps = 30/623 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T       K   +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTK------KEEDRPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTN+ DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNMIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQG 628
           K      D A+TGH+RIR+K+Q 
Sbjct: 913 KPIHQGPDAAVTGHIRIRAKSQA 935



>gi|448106229|ref|XP_004200694.1| Piso0_003290 [Millerozyma farinosa CBS 7064]
 gi|448109348|ref|XP_004201325.1| Piso0_003290 [Millerozyma farinosa CBS 7064]
 gi|359382116|emb|CCE80953.1| Piso0_003290 [Millerozyma farinosa CBS 7064]
 gi|359382881|emb|CCE80188.1| Piso0_003290 [Millerozyma farinosa CBS 7064]
          Length = 949

 Score =  629 bits (1621), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 315/619 (50%), Positives = 422/619 (68%), Gaps = 11/619 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ D++VR+KA+ + L+L+T+RNV++VV   KKEL +T   + + N EYRQ+LI +IH  
Sbjct: 326 STQDLDVRKKAIGVTLQLITSRNVEDVVKLFKKELQRTASSNEDNNAEYRQVLINAIHKL 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI F EVAANV+ +L+E +GD    AA +VI FV+EVVEK+P+LR SI   L+++   +K
Sbjct: 386 AIDFVEVAANVIDLLLESVGDLTTTAAHEVITFVKEVVEKYPDLRQSIVSTLIKSLSLIK 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRGA WIVGEY    K I++AWK IR+ +GE+PILASE+R +              
Sbjct: 446 SGKVFRGAFWIVGEYALEDKLIQDAWKFIRSSIGEVPILASEKRAVDSGKEGASESEVNG 505

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                 T     IL DGTYATE+A      T+   +      KPPLR L+L GDFYLG+V
Sbjct: 506 SGEK--TKKKPTILPDGTYATESAL-----TVEVHDTSADQNKPPLRKLILEGDFYLGAV 558

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L++TL KL+ R    +   K  NAL AEA+L M SI+RVG+S F +  IDEDS DRI++ 
Sbjct: 559 LSTTLVKLIFRLHRNATPAKLLNALTAEAILTMVSILRVGESSFVAKKIDEDSADRILNS 618

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + +L        I++ FL DT+ AF   +                    QVDD I FRQF
Sbjct: 619 IRLLTNDKEAKLIETAFLDDTKDAFKAQLNTIEKSKIEAEAKDFHNNAEQVDDSISFRQF 678

Query: 379 SKRNIGDEADEYELDLTR-ATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           S+ +IG E    ++D  R A G + S+++L S+L+++VQLTGFSDP+YAEAY+ VHQ+D+
Sbjct: 679 SRDDIGIEK---QVDDVRTAAGSSVSKENLSSRLNKIVQLTGFSDPIYAEAYIKVHQFDV 735

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           ++D+L+VNQT  TL+NLS+EFATLGDLK+V++P   N+ PH F+ ++ TIKV+S +TG+I
Sbjct: 736 VMDILLVNQTINTLRNLSVEFATLGDLKVVDKPATANIGPHGFYKLQTTIKVTSADTGII 795

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNIVYDG  + ES  V+LND+HIDIMDYI PA C E+ FR MW EFEWENK+ V + + 
Sbjct: 796 FGNIVYDGQHSDESTIVILNDVHIDIMDYIKPATCTESAFRKMWNEFEWENKITVKSEMG 855

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
            L+E+L  +M  TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQTDG I 
Sbjct: 856 SLKEFLDALMAGTNMNCLTPGAIIGEECQFLSANLYSRSSFGEDALANLCIEKQTDGPII 915

Query: 618 GHVRIRSKTQGIALSLGDK 636
           GHVRIRSK QG+ALSLGD+
Sbjct: 916 GHVRIRSKGQGLALSLGDR 934



>gi|465990125|gb|EMP38286.1| Coatomer subunit beta [Chelonia mydas]
          Length = 922

 Score =  628 bits (1620), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 315/628 (50%), Positives = 435/628 (69%), Gaps = 30/628 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 312 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVTEHEDTDKYRQLLVRTLHS 371

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL D+N  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 372 CSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRLLIVEKMLEVFHAI 431

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           K+ K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 432 KTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGDL 482

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T   +++++ + GTYAT++A SS+        A K   +PPLR  LL GDF++ 
Sbjct: 483 KPEEEVTVGPTQKLVTEMGTYATQSALSSSRP------AKKEEDRPPLRGFLLDGDFFVA 536

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 537 ASLATTLTKIALRYMALVQEKKKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 596

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 597 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 654

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 655 FMQLTAKNEMNSKEDQFQLSLLAAMGTTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 714

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 715 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 774

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 775 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENK 834

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL EYL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 835 VTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 894

Query: 610 KQ----TDGAITGHVRIRSKTQGIALSL 633
           K      D  +TGH+RIR+K+Q + +S 
Sbjct: 895 KPIHLGPDAPVTGHIRIRAKSQVMMVSF 922



>gi|190344474|gb|EDK36153.2| hypothetical protein PGUG_00251 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 993

 Score =  628 bits (1620), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 320/629 (50%), Positives = 426/629 (67%), Gaps = 29/629 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KA+ + L L+++RNV++VV  LKKEL K+   + EK+ EYRQLLI +IH  
Sbjct: 379 SSQDLDVRKKAIDVTLSLISSRNVEDVVKLLKKELQKSSSSEEEKSAEYRQLLINAIHQL 438

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI+F EVAA+VV +L+E +G  N  AA +VI FV+EVVEKFP+LR SI  +L++    VK
Sbjct: 439 AIRFVEVAASVVDLLLESMGTINTAAAYEVITFVKEVVEKFPDLRQSIITRLIDALPSVK 498

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG+ WI+GEYC   K I EAWK +R+ +GE+PI+ASE+RL               
Sbjct: 499 SGKVFRGSFWIIGEYCEEEKLIREAWKYLRSSIGEVPIVASEKRL---------QEKDNE 549

Query: 199 XXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                +  S+++  +L DGTYATE A + +          +   KPP+R LLL GDFYL 
Sbjct: 550 QEEESSGKSTKKPVVLPDGTYATENAMTVDVVH-------QEEEKPPVRKLLLGGDFYLA 602

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           SV +STL KL+LR   +    K  NAL+AEA+LIM SI+R+G+S + +  IDEDS DRI 
Sbjct: 603 SVFSSTLVKLILRLQRLQTPDKLVNALKAEALLIMVSILRLGESSYVTKKIDEDSADRIF 662

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFR 376
           SC+  L        I+  FL +T+ AF   +                    QVDDLI+FR
Sbjct: 663 SCIKYLSDEEDVELIQKSFLDETKDAFRSQIKISEERKAEAEAKDFHDNAEQVDDLILFR 722

Query: 377 QFSK---RNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVH 433
           Q  K   RN+ +E      D+T     A+ ++DL S+L++++QLTGFSDP+YAEAYV VH
Sbjct: 723 QLEKDVARNVENE------DVTLMG--ANKKEDLSSRLNKILQLTGFSDPIYAEAYVKVH 774

Query: 434 QYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTE 493
           QYD++LDVL+VNQT+ TL+NLS+EFATLGDL +V++    N+ PH FH V+ TIKVSS +
Sbjct: 775 QYDVVLDVLLVNQTTSTLRNLSVEFATLGDLTVVDKAASANIGPHGFHKVQTTIKVSSAD 834

Query: 494 TGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVN 553
           TGVIFGNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+ FR MW EFEWENK+ + 
Sbjct: 835 TGVIFGNIVYDGQHSDESTIVILNDVHVDIMDYIKPAVCSESSFRKMWNEFEWENKITIK 894

Query: 554 TNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTD 613
           + +  L+EYL  +M  TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IE+Q+D
Sbjct: 895 SQMKSLKEYLDVLMSGTNMNCLTPGAVVGQECSFLSANLYSRSSFGEDALANLCIEQQSD 954

Query: 614 GAITGHVRIRSKTQGIALSLGDKITLAQK 642
           G I GHVRIRSK QG+ALSLGD++    K
Sbjct: 955 GPIIGHVRIRSKGQGLALSLGDRVAAISK 983



>gi|460407939|ref|XP_004249406.1| PREDICTED: coatomer subunit beta-1-like [Solanum lycopersicum]
          Length = 948

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 322/635 (50%), Positives = 426/635 (67%), Gaps = 24/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I LEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 326 SSPNLDIRRKTLDIVLELITPRNINEVVLTLKKEVMKTQSGELEKNGEYRQMLIQAIHSC 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH+LM+FLGD+N  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 386 AVKFPEVASTVVHLLMDFLGDNNVASAIDVVVFVREIIETNPKLRVSIVTRLLDTFYQIR 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P  ++ +                 
Sbjct: 446 AARVCSCALWIIGEYCISLSEVESGIATIKQCLGDLPFYSASEE------GEANDSSKKS 499

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                TT SSRR  +LADGTYAT     ETAFS  +     L A        LRSLLL+G
Sbjct: 500 QQVNSTTVSSRRPAVLADGTYATQSAASETAFSPPTVVQGSLTA------GNLRSLLLTG 553

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+LG+V+A TLTKL+LR   +     + N     A+LI+ S+I++GQS    +PID DS
Sbjct: 554 DFFLGAVVACTLTKLILRLEEVQPSKVEVNKTTTNALLIIVSMIQLGQSSALPHPIDNDS 613

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDR++ C+ +L   +T   ++ ++L+    +F +++                    Q DD
Sbjct: 614 YDRMVLCVRLL--CNTGNEVRKIWLNSCHESFVKMLSDKQMRETEEIKAKAQISHSQPDD 671

Query: 372 LIVFRQF-SKRNIG--DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F    S+R +   +  D  + DL RATG+    +   +KL+RV+QLTGFSDPVYAEA
Sbjct: 672 LIDFYHLKSRRGMSQLELEDAVQDDLKRATGEFVKDETDANKLNRVLQLTGFSDPVYAEA 731

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S   +KA IK
Sbjct: 732 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIK 791

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     +   VVLNDIHIDIMDYI+PA C++  FR+MW EFEWEN
Sbjct: 792 VSSTETGVIFGNIVYETSNVFDRMVVVLNDIHIDIMDYISPAVCSDAAFRTMWAEFEWEN 851

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I D +++L HI+KSTNM CLT   AL G+CGFL+AN+YA+S+FGEDAL N+SI
Sbjct: 852 KVAVNTVIQDEKDFLDHIIKSTNMKCLTALSALEGECGFLAANLYAKSVFGEDALVNVSI 911

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ D  ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 912 EKQADSKLSGYIRIRSKTQGIALSLGDKITLKQKG 946



>gi|281341607|gb|EFB17191.1| hypothetical protein PANDA_012478 [Ailuropoda melanoleuca]
          Length = 934

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 432/622 (69%), Gaps = 30/622 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQ 627
           K      +  +TGH+RIR+K+Q
Sbjct: 913 KPIQQGPEAPVTGHIRIRAKSQ 934



>gi|431919659|gb|ELK18047.1| Coatomer subunit beta [Pteropus alecto]
          Length = 945

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 432/622 (69%), Gaps = 30/622 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLD-QDYEKNNEYRQLLIQSIHG 77
           ++PD+EVR+K L++AL+LV++RNV+E+V+ LKKE+ KT +  ++E  ++YRQLL++++H 
Sbjct: 330 STPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHS 389

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C+++F ++AANV+ VLMEFL DSN  AA DV+ FVRE +++F NLR  I EK+LE F  +
Sbjct: 390 CSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAI 449

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS K++RGALWI+GEYCS  +DI+    ++R  LGEIPI+ SE +               
Sbjct: 450 KSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIK---------KEAGEL 500

Query: 198 XXXXXXTTSSSRRILAD-GTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                 T    ++++ + GTYAT++A SS+  T  + E      +PPLR  LL GDF++ 
Sbjct: 501 KPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEE------RPPLRGFLLDGDFFVA 554

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + LA+TLTK+ LRY  + ++ KK N+  AEAML+MA+I+ +G+S     PI +D  DRI 
Sbjct: 555 ASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRIS 614

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXX--XTVQVDDLIV 374
            CL +L + S    +  +F  + R + + ++                    TVQ DD I 
Sbjct: 615 LCLKVLSECSP--LMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPIS 672

Query: 375 FRQFSKRN-IGDEADEYELDLTRATG---QADSRDDLISKLSRVVQLTGFSDPVYAEAYV 430
           F Q + +N +  + D+++L L  A G   + ++ D L SKL++V QLTGFSDPVYAEAYV
Sbjct: 673 FMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYV 732

Query: 431 NVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVS 490
           +V+QYDI+LDVL+VNQTS+TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA +KV+
Sbjct: 733 HVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA 792

Query: 491 STETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENK 549
           STE G+IFGNIVYD  G  S+ NCVVL+DIHIDIMDYI PA C + +FR MW EFEWENK
Sbjct: 793 STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENK 852

Query: 550 VNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIE 609
           V VNTNI DL +YL HI+KSTNM CLTPE ALSG CGF++AN+YARSIFGEDALAN+SIE
Sbjct: 853 VTVNTNIIDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIE 912

Query: 610 KQ----TDGAITGHVRIRSKTQ 627
           K      +  +TGH+RIR+K+Q
Sbjct: 913 KPIHQGPEAPVTGHIRIRAKSQ 934



>gi|405964798|gb|EKC30244.1| Coatomer subunit beta [Crassostrea gigas]
          Length = 963

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 318/635 (50%), Positives = 438/635 (68%), Gaps = 26/635 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++PD+EVR+K L +AL+LV++RN++E+V+ LKKE+ KT + ++E   +YRQLL++++H C
Sbjct: 340 SAPDLEVRKKTLTLALDLVSSRNIEEMVLVLKKEVVKTNNVEHEDTGKYRQLLVRTLHQC 399

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
            IKF ++AA ++ VL+EFLGD N  AA+DV+ FVRE +++F +LR  I  KL E F  +K
Sbjct: 400 CIKFQDIAATIIPVLIEFLGDQNELAALDVLVFVREAIQRFESLRGLIISKLQEIFPSIK 459

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + K+ R ALWI+GEYC    DI+     IR  LGEIPI+  E +                
Sbjct: 460 AMKIHRAALWILGEYCETNDDIQNVMTMIRQALGEIPIVDDEIK--------KAAGEVAD 511

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                     + + ADGTYAT++AFSS  S+  K E      +PP+R  ++ GDF++G+ 
Sbjct: 512 DEMQSGGQVQKLVTADGTYATQSAFSSAPSSAKKEE------RPPMRQYMMDGDFFVGAA 565

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LA+TLTKL L+Y   + D K+ N+L AE+MLIMA+II +G+S   + PI +D  DRI +C
Sbjct: 566 LATTLTKLALKYIANTPDVKRQNSLVAESMLIMAAIIHLGKSGLPTKPITDDDVDRIATC 625

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXT-VQVDDLIVFRQ 377
           L +L + +    +  +F  D R + + ++                    VQ DD I F Q
Sbjct: 626 LKVLAEKTP--LMGEIFNTDCRQSLSLMLAAKMEEEKELQRASEKRTVKVQADDPISFAQ 683

Query: 378 F-SKRNIGDEADEYELDLTRATGQADSRD-DLI--SKLSRVVQLTGFSDPVYAEAYVNVH 433
             +K  +G   + +EL L++A G +  +D D I  SKL++V QLTGFSDPVY+EAYVNV+
Sbjct: 684 LVNKAEMGATENMFELTLSQALGMSGKKDGDPIGASKLNKVTQLTGFSDPVYSEAYVNVN 743

Query: 434 QYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTE 493
           Q+DI+LD+L+VNQTS+TLQNL++E ATLGDLKLVE+PT   +APH F ++KA +KV+STE
Sbjct: 744 QFDIVLDILVVNQTSDTLQNLTVELATLGDLKLVEKPTPMTMAPHDFCNIKANVKVASTE 803

Query: 494 TGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
            G+IFGNIVYD  G  S+ NCVVLNDIHIDIMDYI PA C++T+FR MW EFEWENKV V
Sbjct: 804 NGIIFGNIVYDISGAGSDRNCVVLNDIHIDIMDYIVPASCDDTEFRQMWAEFEWENKVAV 863

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NTN++DL E+L H++K TNM CLTPE AL GDCGF++ANMYA+SIFGE+ LAN+SIEK  
Sbjct: 864 NTNVSDLAEFLQHVIKITNMRCLTPEKALKGDCGFMAANMYAKSIFGENVLANLSIEKPA 923

Query: 613 ----DGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
               D  + GH+RIR+K+QG+ALS+GDKI L+QK+
Sbjct: 924 HLSKDSPVQGHIRIRAKSQGMALSMGDKINLSQKS 958



>gi|344303982|gb|EGW34231.1| hypothetical protein SPAPADRAFT_135572 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 943

 Score =  626 bits (1615), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 313/619 (50%), Positives = 421/619 (68%), Gaps = 15/619 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL + L+ +T+RNV++VV  LKKEL      + EK  EYRQLLI +IH  
Sbjct: 325 SSQDLDVRKKALDVTLKFITSRNVEDVVKLLKKELQAASSSNDEKAAEYRQLLINAIHQM 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAA+V+ +L++ + + N  AA +VI FV+EVVEKFPNLR SI  +L++    VK
Sbjct: 385 AIKFVEVAADVIDLLLDSIANLNTTAAYEVITFVKEVVEKFPNLRESILARLIDALPFVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV RGALWI+GEY      ++ +WK IR+ +GE+PI+A+E++ L              
Sbjct: 445 SGKVLRGALWIIGEYALEQSLVQLSWKYIRSSVGEVPIIAAEKKSLNAENEEDEHSDN-- 502

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                       IL DGTYATE+A +      A++     A K P+R  +++GDFYLG+V
Sbjct: 503 -----KVKRGPVILPDGTYATESALT------AEVHDSDDASKTPIRKQIMAGDFYLGAV 551

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KL+LR   +    K  NAL+AEA+LIM SI+RVG+S   S  IDEDS DRI+S 
Sbjct: 552 LSSTLVKLILRLQKLGTSEKIMNALKAEALLIMVSILRVGESSLVSKKIDEDSADRILSY 611

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + IL       +I + FL DT+ AF   +                    QVDD IVFRQ 
Sbjct: 612 IKILNDEEDVDTINTGFLEDTKDAFRAQIESAEVKKQQALAKDFHDNAEQVDDAIVFRQL 671

Query: 379 SKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDIL 438
            K     +A+    D+  A+G    +++L S+L++++ LTGFSDP+YAEA+V VHQYD++
Sbjct: 672 DKNTRKSKANVD--DVVAASGGNVKKENLSSRLNKILPLTGFSDPIYAEAFVKVHQYDVV 729

Query: 439 LDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIF 498
           LDVL+VNQT+ TL+NLS+EFATLGDLK+V++P   N+ PH FH V+ TIKV+S +TGVIF
Sbjct: 730 LDVLLVNQTTTTLRNLSVEFATLGDLKVVDKPATANIGPHGFHKVQTTIKVTSADTGVIF 789

Query: 499 GNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNITD 558
           GNIVYDG  ++ES  V+LND+H+DIMDYI PA C+ETQFR MW EFEWENK+ + + +  
Sbjct: 790 GNIVYDGQHSNESTIVILNDVHVDIMDYIKPATCSETQFRKMWNEFEWENKITIKSQMDS 849

Query: 559 LREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITG 618
           L++Y+  +MK TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IEKQ+DG I G
Sbjct: 850 LKDYMDELMKGTNMNCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQSDGPIIG 909

Query: 619 HVRIRSKTQGIALSLGDKI 637
           HVRIRSK QG+ALSLGD++
Sbjct: 910 HVRIRSKGQGLALSLGDRV 928



>gi|344234745|gb|EGV66613.1| hypothetical protein CANTEDRAFT_100553 [Candida tenuis ATCC 10573]
          Length = 948

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 322/632 (50%), Positives = 427/632 (67%), Gaps = 26/632 (4%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KAL + L+ VT+RNV++VV  LKKEL  T   D +K++EYRQ LI +IH  
Sbjct: 326 SSQDLDVRKKALAVTLQFVTSRNVEDVVKLLKKELQATSTSDEDKSSEYRQTLINAIHQL 385

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVAANVV +L+E + + N  AA +VI FV+EVVEKFP+LR +I + L+ T  D K
Sbjct: 386 AIKFVEVAANVVDLLLESMKELNTSAAYEVITFVKEVVEKFPDLRPNIIKGLIATLPDSK 445

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV RGALWI+GEYC     I++AWK IR G+GE+PILASE+R +              
Sbjct: 446 SGKVLRGALWIIGEYCLEESLIQDAWKYIRNGVGEVPILASEKRAVEPKSTEAEADSDDT 505

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                T      +L DGTYATE AF++ S++  + E      KP +R L+LSGDFYL +V
Sbjct: 506 K----THKKGPVVLPDGTYATENAFTAESTSPEESED-----KPAIRKLILSGDFYLAAV 556

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L STL KL+LR   +    K  N L+AEA+L M SI+RVG+S++ +  IDEDS DRI S 
Sbjct: 557 LCSTLVKLILRLQRLDVAQKLLNGLKAEALLTMVSILRVGESKYVAKKIDEDSADRIFSY 616

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L        I+  FL DT+ AF   V                    QVD+ I+FRQF
Sbjct: 617 IKYLNDEKDAEVIQRGFLDDTKDAFKSQVRESELKKAEEVAKDLHANAEQVDEAILFRQF 676

Query: 379 SK------RNIGDEADEYELDLTRATGQADSRDDLIS-KLSRVVQLTGFSDPVYAEAYVN 431
            K      +N+ DE +            +D + DL+S KLS+++QLTGFSDPVYAEA++ 
Sbjct: 677 DKNGGIATKNLDDEVN--------GLSTSDIKKDLVSSKLSKIIQLTGFSDPVYAEAFLT 728

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           VHQYD++LDVL+VNQT+ TL+N+S+EFATLGDLK+V++P   ++APH F+ V+ TIKV+S
Sbjct: 729 VHQYDVVLDVLLVNQTTTTLRNVSVEFATLGDLKVVDKPATADIAPHGFYKVQCTIKVTS 788

Query: 492 TETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
            +TGVIFGNIVYDG  + ES  V+ ND+HIDI+DYI PA C E+ FR MW EFEWENK+ 
Sbjct: 789 ADTGVIFGNIVYDGVHSDESTIVIFNDVHIDILDYIKPATCTESAFRKMWNEFEWENKIT 848

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ 611
           + + +  L+EYL  +M+ TNM+CLTP  A+  +C FLSAN+Y++S FGEDALAN+ IE Q
Sbjct: 849 IKSEMGSLKEYLEELMRGTNMNCLTPGAAVGEECQFLSANLYSKSSFGEDALANLCIE-Q 907

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKI-TLAQK 642
           + G I GHVRIRSK QG+ALSLGDK+ T+++K
Sbjct: 908 SQGQIIGHVRIRSKGQGLALSLGDKVATISRK 939



>gi|254574274|ref|XP_002494246.1| Essential beta-coat protein of the COPI coatomer [Komagataella
           pastoris GS115]
 gi|238034045|emb|CAY72067.1| Essential beta-coat protein of the COPI coatomer [Komagataella
           pastoris GS115]
 gi|328353931|emb|CCA40328.1| Coatomer subunit beta-2 [Komagataella pastoris CBS 7435]
          Length = 948

 Score =  625 bits (1612), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 314/620 (50%), Positives = 427/620 (68%), Gaps = 12/620 (1%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           T+ D+ VR+KAL ++L++ ++ NV +VV FLKKEL+K++  + +K+ EYRQLLI +IH C
Sbjct: 325 TTSDLGVRKKALDLSLDITSSGNVDDVVKFLKKELTKSISSNEDKSIEYRQLLITAIHKC 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+ F+ VAA+VV +L+ F+   N+ AA +V++F +EVVEKFP LRS I  +LL    +VK
Sbjct: 385 ALNFNSVAADVVDLLLGFIEQLNSAAASEVVSFAKEVVEKFPALRSKIINRLLHALENVK 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKV+RG+LWI+ EY    KDI++ W+ IR  +GE+PIL++E+RL               
Sbjct: 445 SGKVYRGSLWILSEYAEEEKDIQDVWRHIRNKIGELPILSTEKRL---QNKEAVVSNEND 501

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  SS   IL DG+YATE AF++       +E      +P LR+L+L GDFYL +V
Sbjct: 502 ENGYTNGSSKPIILPDGSYATENAFTAELEK--HVEDKTGEERPTLRALILDGDFYLAAV 559

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           L+STL KL+L +  IS + K  NA++AEAMLIM SI+RVG++ F+   IDEDS +RI S 
Sbjct: 560 LSSTLLKLILSFQKISSNTKILNAMKAEAMLIMVSILRVGETSFSKKKIDEDSQERIFSI 619

Query: 319 LHILEQISTDYS-IKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQ 377
           +  L +  TD   I+  FL DT+ AF  ++                    Q  D I FRQ
Sbjct: 620 VRFLAENKTDDDFIQHAFLDDTKTAFRNLLIEADKKKAQKDKSKLQQAAQQPYDSISFRQ 679

Query: 378 FSKRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQYDI 437
           FSK     + +EY L+   A   A ++DDL SKL ++VQLTGFSD VYAEAYV VHQ+D+
Sbjct: 680 FSKEV---DTEEYSLEEQLA---ASTKDDLSSKLKKIVQLTGFSDSVYAEAYVKVHQFDV 733

Query: 438 LLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVI 497
           +LDVL+VNQT+ETL+NL++EFA LGDLK++++P   N+ PH F  ++ATIKV+S +TGVI
Sbjct: 734 VLDVLLVNQTTETLRNLTVEFAALGDLKVIDKPGTQNVGPHGFLRIQATIKVTSADTGVI 793

Query: 498 FGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTNIT 557
           FGNI+YDG   ++SN V+LNDI++DIMDYI PA C+E QFR MW EFEWENK+ V +N+ 
Sbjct: 794 FGNIIYDGEKANDSNIVILNDINVDIMDYIKPATCSEAQFRKMWNEFEWENKIIVKSNVA 853

Query: 558 DLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAIT 617
            L+EYL  ++K TNM+CLTP   +  +C FLSAN+Y+ S FGEDALAN+ IEKQ DG I 
Sbjct: 854 TLKEYLDVLLKGTNMNCLTPGAIIGEECQFLSANLYSHSSFGEDALANLCIEKQADGPII 913

Query: 618 GHVRIRSKTQGIALSLGDKI 637
           GHVRIRSK QG+ALS+GD++
Sbjct: 914 GHVRIRSKGQGLALSMGDRV 933



>gi|499004084|ref|XP_004535246.1| PREDICTED: coatomer subunit beta-like [Ceratitis capitata]
          Length = 954

 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 321/633 (50%), Positives = 434/633 (68%), Gaps = 24/633 (3%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           +PDIEVRRK L +A++LV++RN++E+V+ LKKE+SKT + ++E   +YRQLL++++H C+
Sbjct: 330 APDIEVRRKTLALAMDLVSSRNIEEMVLVLKKEVSKTHNVEHEDTGKYRQLLVRTLHSCS 389

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           IKF +VAANV+ VL+EFL D+N  AA DV+ F+RE ++KFP+LR+ I E+L+E F  +KS
Sbjct: 390 IKFPDVAANVIPVLVEFLSDTNELAAADVLIFIREAIQKFPSLRALIIERLIEAFPQIKS 449

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXX 199
            K+ R A+WI+GEY  N + I E  + I   LGEIP++ +EQ+ L               
Sbjct: 450 SKIHRAAVWILGEYVDNKEQILEVTEAIIQTLGEIPMVEAEQKRL---AGEQSDEGEKPT 506

Query: 200 XXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSVL 259
               T  +  ++ +DGTYAT++AFS   + +AK E      +PPLR  L+ GDF++G+ L
Sbjct: 507 GEGNTKVAGNKVTSDGTYATQSAFS--LAPVAKKEK-----RPPLRQYLMDGDFFIGAAL 559

Query: 260 ASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSCL 319
           ++TLTKL LRY+ + +D ++ N L  + MLIM+SI+ +G+S F + PI  D  DRI  CL
Sbjct: 560 SATLTKLALRYAELEDDVRQQNRLTTQVMLIMSSILHLGKSGFPTKPITNDDIDRIFICL 619

Query: 320 HILEQISTDYSIKSVFLHDTRAAFARIV-XXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
             L + + +     VF H  R A  +++                    VQ DD + F Q 
Sbjct: 620 RTLSERTKEAV--EVFQHYCRDALGKMLDAQHEEDQRIMKEKQRAAAKVQPDDPVAFAQL 677

Query: 379 SK---RNIGDEADEYELDLTRATGQADSRDDLIS---KLSRVVQLTGFSDPVYAEAYVNV 432
           S      +G+   E  L+   A  ++ +  D+ S   KL++V QLTGFSDPVYAEAYVNV
Sbjct: 678 SNGRDNQLGENVFETSLNQALAGTKSTNLSDITSPNNKLNKVTQLTGFSDPVYAEAYVNV 737

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           +QYDI+LDVLIVNQT++TLQN ++E ATLGDLKLVERP    LAPH F ++KA +KVSST
Sbjct: 738 NQYDIVLDVLIVNQTNDTLQNCTLELATLGDLKLVERPHPVVLAPHDFCNIKANVKVSST 797

Query: 493 ETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNV 552
           E G+IFGNIVYD   +  +N VVLN IHIDIMDYI PA C +T+FR MW +FEWENKV V
Sbjct: 798 ENGIIFGNIVYD--TSINTNVVVLNTIHIDIMDYIIPASCTDTEFRQMWQDFEWENKVTV 855

Query: 553 NTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQT 612
           NT  TDL EYL H++KSTNM CLTPE ALSG CGF++ANMYA+SIFGE+ALAN+SIEK  
Sbjct: 856 NTTFTDLHEYLKHLLKSTNMKCLTPEKALSGQCGFMAANMYAKSIFGENALANLSIEKPV 915

Query: 613 ---DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
              D  +TGH+RIR+K+QG+ALSLGDKI+ +QK
Sbjct: 916 DDPDSKVTGHIRIRAKSQGMALSLGDKISSSQK 948



>gi|146421861|ref|XP_001486874.1| hypothetical protein PGUG_00251 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 993

 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 316/627 (50%), Positives = 419/627 (66%), Gaps = 25/627 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +S D++VR+KA+ + L L+++RNV++VV  LKKEL K+   + EK+ EYRQLLI +IH  
Sbjct: 379 SSQDLDVRKKAIDVTLLLISSRNVEDVVKLLKKELQKSSLSEEEKSAEYRQLLINAIHQL 438

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AI+F EVAA+VV +L+E +G  N  AA +VI FV+EVVEKFP+LR  I  +L++    VK
Sbjct: 439 AIRFVEVAASVVDLLLESMGTINTAAAYEVITFVKEVVEKFPDLRQLIITRLIDALPSVK 498

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           SGKVFRG+ WI+GEYC   K I EAWK +R+ +GE+PI+ASE+RL               
Sbjct: 499 SGKVFRGSFWIIGEYCEEEKLIREAWKYLRSSIGEVPIVASEKRL-------QEKDNEQE 551

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                  +    +L DGTYATE A + +          +   KPP+R LLL GDFYL  V
Sbjct: 552 EESSGKLTKKPVVLPDGTYATENAMTVDVVH-------QEEEKPPVRKLLLGGDFYLALV 604

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
            +STL KL+LR   +    K  NAL+AEA+LIM  I+R+G+S + +  IDEDS DRI SC
Sbjct: 605 FSSTLVKLILRLQRLQTPDKLVNALKAEALLIMVLILRLGESSYVTKKIDEDSADRIFSC 664

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           +  L        I+  FL +T+ AF   +                    QVDDLI+FRQ 
Sbjct: 665 IKYLSDEEDVELIQKSFLDETKDAFRSQIKISEERKAEAEAKDFHDNAEQVDDLILFRQL 724

Query: 379 SK---RNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
            K   RN+ +E      D+T     A+ ++DL S+L++++QLTGFSDP+YAEAYV VHQY
Sbjct: 725 EKDVARNVENE------DVTLMG--ANKKEDLSSRLNKILQLTGFSDPIYAEAYVKVHQY 776

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           D++LDVL+VNQT+ TL+NLS+EFATLGDL +V++    N+ PH FH V+ TIKVSS +TG
Sbjct: 777 DVVLDVLLVNQTTSTLRNLSVEFATLGDLTVVDKAASANIGPHGFHKVQTTIKVSSADTG 836

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNIVYDG  + ES  V+LND+H+DIMDYI PA C+E+ FR MW EFEWENK+ + + 
Sbjct: 837 VIFGNIVYDGQHSDESTIVILNDVHVDIMDYIKPAVCSESSFRKMWNEFEWENKITIKSQ 896

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGA 615
           +  L+EYL  +M  TNM+CLTP   +  +C FLSAN+Y+RS FGEDALAN+ IE+Q+DG 
Sbjct: 897 MKSLKEYLDVLMSGTNMNCLTPGAVVGQECLFLSANLYSRSSFGEDALANLCIEQQSDGP 956

Query: 616 ITGHVRIRSKTQGIALSLGDKITLAQK 642
           I GHVRIRSK QG+ALSLGD++    K
Sbjct: 957 IIGHVRIRSKGQGLALSLGDRVAAISK 983



>gi|296081749|emb|CBI20754.3| unnamed protein product [Vitis vinifera]
          Length = 883

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 316/628 (50%), Positives = 412/628 (65%), Gaps = 48/628 (7%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I LEL+T RN+ EVV+ LKKE+ KT   + EKN EYRQ+LIQ+IH C
Sbjct: 299 SSPNLDIRRKTLDIVLELITPRNINEVVLTLKKEVVKTQSGELEKNGEYRQMLIQAIHSC 358

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           AIKF EVA+ VVH+LM+FLGDSN  +A+DV+ FVRE++E  P LR SI  +LL+TF  ++
Sbjct: 359 AIKFPEVASTVVHLLMDFLGDSNVASAIDVVVFVREIIETNPKLRVSIITRLLDTFYQIR 418

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEYC +  ++E     I+  LG++P  +S                   
Sbjct: 419 AARVCSCALWIIGEYCLSLSEVESGITTIKQCLGDLPFFSSA------------------ 460

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                              A+ETAFS  +     L +        LRSLLL+GDF+LG+V
Sbjct: 461 -------------------ASETAFSPPTLVQGSLSS------GNLRSLLLTGDFFLGAV 495

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           +A TLTKLVLR   +     + N + ++A+LIM S++++GQS    +PID DSYDRI+ C
Sbjct: 496 VACTLTKLVLRLEEVQPSKAEVNKVSSQALLIMVSMLQLGQSSVLPHPIDNDSYDRIVLC 555

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQF 378
           + +L     D  I+ ++L   R ++ +++                    Q DDLI F   
Sbjct: 556 IRLLCNTGDD--IRKIWLQSCRQSYVKMLADKQLRETEEIKAKAQISYAQPDDLIDFYHL 613

Query: 379 SKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNVHQY 435
             R    +    DE + DL RATG+     D  +KL+R++QLTGFSDPVYAEAYV VH Y
Sbjct: 614 KSRKGMSQLELEDEVQDDLKRATGEFIKDGDDANKLNRILQLTGFSDPVYAEAYVTVHHY 673

Query: 436 DILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETG 495
           DI+LDV ++N+T ETLQNL +E AT+GDLKLV+RP  + LAP S   +KA IKVSSTETG
Sbjct: 674 DIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTLAPESSKQIKANIKVSSTETG 733

Query: 496 VIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVNTN 555
           VIFGNIVY+     E   VVLNDIHIDIMDYI+PA C +  FR+MW EFEWENKV VNT 
Sbjct: 734 VIFGNIVYETSNVHERMVVVLNDIHIDIMDYISPAVCTDVAFRTMWAEFEWENKVAVNTV 793

Query: 556 ITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGA 615
           + + +E+L HI+KSTNM CLT   AL GDCGFL+AN+YA+S+FGEDAL NISIEKQ DG 
Sbjct: 794 LQNEKEFLEHIIKSTNMKCLTASSALDGDCGFLAANLYAKSVFGEDALVNISIEKQADGK 853

Query: 616 ITGHVRIRSKTQGIALSLGDKITLAQKA 643
           ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 854 LSGYIRIRSKTQGIALSLGDKITLKQKG 881



>gi|157106589|ref|XP_001649392.1| coatomer beta subunit [Aedes aegypti]
 gi|108879811|gb|EAT44036.1| AAEL004546-PA [Aedes aegypti]
          Length = 956

 Score =  622 bits (1604), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 325/635 (51%), Positives = 426/635 (67%), Gaps = 25/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ DIEVRRK L +A+ELV++RN++E+V+ LKKE+SKT + ++E   +YRQLL++++H C
Sbjct: 329 SATDIEVRRKTLTLAMELVSSRNIEEMVLVLKKEVSKTHNIEHEDTGKYRQLLVRTLHSC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
            IKF +VAA V+ VL+EFL DSN  AA DV+ FVRE ++KFP+L+  + EKLLE F  +K
Sbjct: 389 CIKFPDVAATVIPVLVEFLSDSNELAAADVLIFVREAIQKFPHLQELVIEKLLEAFPAIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           S K+ R ALWI+GEY ++ KDI +    +   LGE+PI+ +EQR L              
Sbjct: 449 SSKIQRAALWILGEYATSAKDIMDVIAIVNQTLGEVPIVEAEQRRLAGDESENDENKTPN 508

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                    + ++ +DGTYAT++AFS    +       K   +PPLR  L+ GDF++G+ 
Sbjct: 509 AGAV----PNNKVTSDGTYATQSAFSVAPVS-------KKVERPPLRQYLMDGDFFIGAT 557

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LASTLTKLVLR+  +  + KK N L   AMLIM+SI+ +G+S   +  I  D  DRI  C
Sbjct: 558 LASTLTKLVLRFIDLEPNEKKQNRLCTSAMLIMSSILHLGKSGLPTKAITNDDMDRIFLC 617

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX-XXXXXXTVQVDDLIVFRQ 377
           L  L Q + +  +  +F    R A A ++                    +Q DD I F Q
Sbjct: 618 LKTLSQRTPE--VVHIFKQSCRDALAGMLNAQNAEEQQTQKDKQKTAAKIQPDDPIAFTQ 675

Query: 378 FS---KRNIGDEADEYELDLTRATGQADSRDDLIS---KLSRVVQLTGFSDPVYAEAYVN 431
            +      +G+   E  L+   A  +  +  D+ S   KL++V QLTGFSDPVYAEAYV+
Sbjct: 676 LANGKNDQLGENVFESSLNQALAGTKNTTLSDVASPNNKLNKVTQLTGFSDPVYAEAYVH 735

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVLIVNQTS+TLQN ++E AT+GDLKLVERP    LAPH F ++KA +KVSS
Sbjct: 736 VNQYDIVLDVLIVNQTSDTLQNCTLELATVGDLKLVERPHPVVLAPHDFCNIKANVKVSS 795

Query: 492 TETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           TE G+IFGNIVYD  G+  SN VVLN IHIDIMDYI PA C +T+FRSMW EFEWENKV+
Sbjct: 796 TENGIIFGNIVYDTTGS--SNVVVLNTIHIDIMDYILPASCTDTEFRSMWVEFEWENKVS 853

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK- 610
           VNT +TDL EYL  ++KSTNM CLTPE ALSG CGF++ANMYARSIFGEDALAN+SIEK 
Sbjct: 854 VNTTLTDLHEYLKMLLKSTNMKCLTPEKALSGQCGFMAANMYARSIFGEDALANLSIEKP 913

Query: 611 --QTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
             + D  +TGH+RIR+K+QG+ALSLGDKI   QK 
Sbjct: 914 LDRPDAPVTGHIRIRAKSQGMALSLGDKINHTQKC 948



>gi|462413219|gb|EMJ18268.1| hypothetical protein PRUPE_ppa000957mg [Prunus persica]
          Length = 951

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 315/632 (49%), Positives = 424/632 (67%), Gaps = 16/632 (2%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP++++RRK L I L+L+T+RN+ +VV+ LKKE+ KT   + EKN EYRQ+L+Q+I+ C
Sbjct: 327 SSPNVDIRRKTLDIVLDLITSRNINQVVMMLKKEVVKTQSGELEKNGEYRQMLVQAIYAC 386

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+KF EVA+ VVH LM+FLGD+N  +A+DV AFVRE++E  P LR S+  +LL+TF  ++
Sbjct: 387 AVKFPEVASTVVHPLMDFLGDTNVASALDVAAFVREIIETNPKLRVSVITRLLDTFYQIR 446

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPIL-ASEQRLLXXXXXXXXXXXXX 197
           + +V   +LWI+GEYC +  ++E     I+  LG++P   ASE++               
Sbjct: 447 NSRVCTHSLWIIGEYCLSLSEVESGIATIKQCLGDLPFYTASEEK-------EAQDATKN 499

Query: 198 XXXXXXTTSSSRR--ILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYL 255
                 TT SSRR  ILADGTYAT++A    + +   L     A    LRSL+LSGDF+L
Sbjct: 500 SQVVSSTTVSSRRPVILADGTYATQSAALETAMSAPVLVQGSLASVGNLRSLILSGDFFL 559

Query: 256 GSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRI 315
            +V+A TLTKLVLR   I     + N    +A+LIM S++++GQS    +PID DS DRI
Sbjct: 560 ETVVACTLTKLVLRLEEIQPSKAEVNKATTQALLIMVSMLQLGQSSVLPHPIDNDSRDRI 619

Query: 316 MSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVF 375
           + C+ +L     +  ++ ++L   R +F +++                  + Q DDLI F
Sbjct: 620 VLCIRLLCHKGEE--VRKIWLESCRQSFVKMLADKQLLETEETKAKAQILSAQPDDLIDF 677

Query: 376 RQFSKRNIGDE---ADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
                R    +    D  + DL RATG+     D  +KL+R++QLTGFSDPVYAEAYV V
Sbjct: 678 YHLKSRKGLSQLELEDAVQDDLKRATGEFTKDRDDANKLNRILQLTGFSDPVYAEAYVTV 737

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           + YDI+LDV ++N+T ETLQNL +E AT+GDLKLVERP  + LAP S   +KA IKVSST
Sbjct: 738 NHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSST 797

Query: 493 ETGVIFGNIVYD-GPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           ETGVIFGNIVY+      E   +VLNDIHIDIMDYI+PA C +  FR+MW EFEWENKV 
Sbjct: 798 ETGVIFGNIVYETSSNVLERTVIVLNDIHIDIMDYISPASCADVSFRTMWAEFEWENKVA 857

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ 611
           VNT I D +E+L H++K+TNM CLTP +AL G+CG L+AN+YA+S+FGEDAL N+S+EKQ
Sbjct: 858 VNTVIQDEKEFLNHVVKATNMKCLTPPLALEGECGVLAANLYAKSVFGEDALVNVSVEKQ 917

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
            DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 918 ADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 949



>gi|321475505|gb|EFX86468.1| hypothetical protein DAPPUDRAFT_313075 [Daphnia pulex]
          Length = 986

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 316/636 (49%), Positives = 431/636 (67%), Gaps = 20/636 (3%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQ-DYEKNNEYRQLLIQSIHGC 78
           +PD+EVR+K L + L+LV++RN++++V+ LKKE++KT +  ++E   +YRQLL++++H C
Sbjct: 352 TPDLEVRKKTLSLILDLVSSRNIEDIVLVLKKEVTKTHNTTEHEDTGKYRQLLVRTLHSC 411

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
            IKF +++A V+ VL EFL D+N  AA DV+ FVRE ++KF  LR  I EKLLE F+ +K
Sbjct: 412 CIKFPDISATVIPVLTEFLSDTNELAAADVLVFVREAIQKFEGLRPLIIEKLLEAFLSIK 471

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLX--XXXXXXXXXXX 196
           S KV R A+WI+GEY ++  DI     ++R  LGEIPI+  E R                
Sbjct: 472 SVKVHRAAIWILGEYATSADDIRSVMSKVRQSLGEIPIVDDEIRKAAGEQTDAENPLAQG 531

Query: 197 XXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLG 256
                    SS+R + ADGTYAT++ FS+  +T  K E      +PPLR  L+ GDF++G
Sbjct: 532 TGSVTNPVASSARLVTADGTYATQSIFSAAVTTAKKEE------RPPLRKYLMEGDFFIG 585

Query: 257 SVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIM 316
           + +A+T+TKL LR+     +P+  N   AEAML++A+I+ +G+S     PI  D  +R+ 
Sbjct: 586 ASMATTMTKLALRFVQQVSNPQTQNQFCAEAMLVIAAILHLGRSGLPQKPISNDDAERLG 645

Query: 317 SCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXX-XXTVQVDDLIVF 375
            CL +L   S    +  VF    R + + ++                   ++Q DDL+ F
Sbjct: 646 LCLKVLSDRSP--ILVEVFTDACRRSISLMLAAKAEEEAAAQKNLEKNSRSIQADDLVSF 703

Query: 376 RQFSKRN-IGDEADEYELDLTRA---TGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVN 431
           +Q   RN +G   D +E  L++A   + Q    D  +SKL++V QLTGFSDPVYAEAYVN
Sbjct: 704 KQLLSRNELGGLEDVFESSLSQALVGSAQRTGLDLSVSKLNKVTQLTGFSDPVYAEAYVN 763

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVLIVNQT++TLQN ++E ATLGDLKLVE+P+   LAPH F ++KA++KV+S
Sbjct: 764 VNQYDIVLDVLIVNQTADTLQNCTLELATLGDLKLVEKPSAIILAPHDFANIKASVKVAS 823

Query: 492 TETGVIFGNIVYDGPG-TSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKV 550
           TE G+IFGNIVYD  G TS+ N VVLNDIHIDIMDYI PA C + +FR MW +FEWENKV
Sbjct: 824 TENGIIFGNIVYDVTGSTSDRNVVVLNDIHIDIMDYIMPASCTDAEFRQMWADFEWENKV 883

Query: 551 NVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK 610
            VNTNI DL  YL H++KSTNM CLTPE AL+GDCGF++AN+YARS+FGEDALAN+S+EK
Sbjct: 884 TVNTNINDLNLYLQHLLKSTNMKCLTPEKALAGDCGFMAANLYARSVFGEDALANLSLEK 943

Query: 611 ---QTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
              + D  +TGH+RIR+K+QG+ALSLGDKI   QKA
Sbjct: 944 PFGKPDAPVTGHIRIRAKSQGMALSLGDKINTIQKA 979



>gi|195400901|ref|XP_002059054.1| GJ15202 [Drosophila virilis]
 gi|194141706|gb|EDW58123.1| GJ15202 [Drosophila virilis]
          Length = 960

 Score =  619 bits (1597), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 321/639 (50%), Positives = 428/639 (66%), Gaps = 28/639 (4%)

Query: 20  SPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCA 79
           +PDIEVRRK L +A++LV +RN+ E+V  L+KE++KT + ++E   +YRQLL++++H C+
Sbjct: 328 APDIEVRRKTLALAMDLVYSRNINEMVQVLQKEVAKTHNVEHEDTGKYRQLLVRTLHTCS 387

Query: 80  IKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKS 139
           IKF +VA+NV+ VL+EFL D+N  AAVDV+ F+RE ++KFP LR  I + L+E F  +KS
Sbjct: 388 IKFPDVASNVIPVLVEFLSDTNELAAVDVLIFIREAIQKFPALRGLIIKHLIEAFPQIKS 447

Query: 140 GKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLX------XXXXXXXX 193
            K+ R A+WI+GEY    + + E  + I+  LGEIP++ +EQR L               
Sbjct: 448 SKIHRAAVWILGEYVEG-ELMLEVIEAIQQTLGEIPMVDAEQRRLAGDQTEEQLQQQQQQ 506

Query: 194 XXXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDF 253
                     T SSS ++ +DGTYAT++A+S    T       K   +PPLR  L+ GDF
Sbjct: 507 QSGTAASGEATISSSNKVTSDGTYATQSAYSLAPVT-------KKEKRPPLRQYLMDGDF 559

Query: 254 YLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYD 313
           ++G+ L++TLTKL LRY+ +  DP+  N +  + MLIM+SI+ +G+S F S PI  D  D
Sbjct: 560 FIGAALSATLTKLALRYAKLEPDPRAQNRVTTQVMLIMSSILHLGKSGFPSKPITYDDSD 619

Query: 314 RIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXX-XXXXXXXXXXXXTVQVDDL 372
           RIM CL  L + + +    +VF+HD R A  +++                    VQ D  
Sbjct: 620 RIMICLRTLSERTPEAV--AVFMHDCRDALGKMLDAQSEEDQRMLKEKQRATAKVQPDSP 677

Query: 373 IVFRQFSK---RNIGDEADEYELDLTRA---TGQADSRDDLISKLSRVVQLTGFSDPVYA 426
           ++F Q S      +G+   E  L+   A   T Q        SKL++V QLTGFSDPVYA
Sbjct: 678 VLFAQLSNGRDNQLGENVFESSLNQALAGTKTAQLSDMSSPNSKLNKVTQLTGFSDPVYA 737

Query: 427 EAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKAT 486
           EAYVNV+QYDI+LDVLIVNQT++TLQN ++E ATLGDLKLVERP    LAPH F ++KA 
Sbjct: 738 EAYVNVNQYDIVLDVLIVNQTNDTLQNCTLELATLGDLKLVERPHPVVLAPHDFCNIKAN 797

Query: 487 IKVSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEW 546
           +KVSSTE G+IFGNIVYD      +N VVLN IHIDIMDYI PA C +T+FR MW +FEW
Sbjct: 798 VKVSSTENGIIFGNIVYDT--ALNTNVVVLNTIHIDIMDYIIPASCTDTEFRQMWQDFEW 855

Query: 547 ENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANI 606
           ENKV VNT+ TDL EYL H++KSTNM CLTPE ALSG CGF++ANMYA+SIFGE+ALAN+
Sbjct: 856 ENKVTVNTSFTDLHEYLKHLLKSTNMKCLTPEKALSGQCGFMAANMYAKSIFGENALANL 915

Query: 607 SIEKQT---DGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           SIEK     D  +TGH+RIR+K+QG+ALSLGDKI+ +QK
Sbjct: 916 SIEKPVDDPDSKVTGHIRIRAKSQGMALSLGDKISSSQK 954



>gi|170034388|ref|XP_001845056.1| coatomer subunit beta [Culex quinquefasciatus]
 gi|167875689|gb|EDS39072.1| coatomer subunit beta [Culex quinquefasciatus]
          Length = 956

 Score =  619 bits (1595), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 323/635 (50%), Positives = 425/635 (66%), Gaps = 25/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           ++ DIEVRRK L +A++LV++RN++E+V+ LKKE+SKT + ++E   +YRQLL++++H C
Sbjct: 329 SATDIEVRRKTLTLAMDLVSSRNIEEMVLVLKKEVSKTHNIEHEDTGKYRQLLVRTLHSC 388

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
            IKF +VAA V+ VL+EFL DSN  AA DV+ FVRE ++KFP+L+  + EKLLE F  +K
Sbjct: 389 CIKFPDVAATVIPVLVEFLSDSNELAAADVLIFVREAIQKFPHLQPLVIEKLLEAFPAIK 448

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           S K+ R  LWI+GEY +  KDI +    I   LGE+PI+ +EQR L              
Sbjct: 449 SSKIQRATLWILGEYATTVKDILDVITSINQTLGEVPIVEAEQRRL----AGEGNENDEN 504

Query: 199 XXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSV 258
                    + ++ +DGTYAT++AFS    +       K   +PPLR  L+ GDF++G+ 
Sbjct: 505 KAPNSVAVPNNKVTSDGTYATQSAFSVAPVS-------KKVERPPLRQYLMDGDFFIGTT 557

Query: 259 LASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSC 318
           LA+TLTKLVLR+  +  + KK N L + AMLIM+SI+ +G+S   +  I  D  DRI  C
Sbjct: 558 LAATLTKLVLRFIELESNEKKQNRLCSSAMLIMSSILHLGKSGLPTKAITNDDMDRIFLC 617

Query: 319 LHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXX-XXXXXXTVQVDDLIVFRQ 377
           L  L   + +  I  +F    R A A ++                    +Q DD I F Q
Sbjct: 618 LKTLSLRTPE--IVEIFRKSCRNALANMLSAQNEEEQQTQKDKQKVAAKIQPDDPIAFTQ 675

Query: 378 FS---KRNIGDEADEYELDLTRATGQADSRDDLIS---KLSRVVQLTGFSDPVYAEAYVN 431
            S      +G+   E  L+   A  ++ +  D+ S   KL++V QLTGFSDPVYAEAYV+
Sbjct: 676 LSSGKNDQLGENVFESSLNQALAGTKSTALSDVASPNNKLNKVTQLTGFSDPVYAEAYVH 735

Query: 432 VHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSS 491
           V+QYDI+LDVLIVNQTS+TLQN ++E AT+GDLKLVERP    LAPH F ++KA +KVSS
Sbjct: 736 VNQYDIVLDVLIVNQTSDTLQNCTLELATVGDLKLVERPHPVVLAPHDFCNIKANVKVSS 795

Query: 492 TETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           TE G+IFGNIVYD  G+  SN VVLN IHIDIMDYI PA C +T+FR+MW EFEWENKV+
Sbjct: 796 TENGIIFGNIVYDTTGS--SNVVVLNTIHIDIMDYILPASCTDTEFRTMWVEFEWENKVS 853

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEK- 610
           VNT +TDL EYL  ++KSTNM CLTPE ALSG CGF++ANMYARSIFGEDALAN+SIEK 
Sbjct: 854 VNTTLTDLHEYLKMLLKSTNMKCLTPEKALSGQCGFMAANMYARSIFGEDALANLSIEKP 913

Query: 611 --QTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
             + D  +TGH+RIR+K+QG+ALSLGDKI   QK 
Sbjct: 914 LDRPDAPVTGHIRIRAKSQGMALSLGDKINHTQKC 948



>gi|242005067|ref|XP_002423396.1| Coatomer subunit beta, putative [Pediculus humanus corporis]
 gi|212506440|gb|EEB10658.1| Coatomer subunit beta, putative [Pediculus humanus corporis]
          Length = 966

 Score =  618 bits (1594), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 322/644 (50%), Positives = 432/644 (67%), Gaps = 35/644 (5%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQ-DYEKNNEYRQLLIQSIHG 77
           +SPD+EVR+K L +A+ELV++RN++E+V+ LKKE++KT +  ++E   +YRQLL++++H 
Sbjct: 331 SSPDLEVRKKTLNLAMELVSSRNIEEMVLVLKKEVTKTHNVVEHEDTGKYRQLLVRTLHS 390

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDV 137
           C IKF ++AA V+ VL+EFL DSN  AA DV+ F+RE + KF NLR  I EKLLE+F  +
Sbjct: 391 CCIKFPDIAATVIPVLIEFLSDSNELAATDVLVFIREAIHKFENLRPLIIEKLLESFTSI 450

Query: 138 KSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXX 197
           KS KV R ALWI+GEY    +DI+    Q+R  LGEIPI+  E +               
Sbjct: 451 KSVKVHRAALWILGEYAYLPEDIQTVMTQVRQTLGEIPIVEDELKRAAGEKSEDDLSFSQ 510

Query: 198 XXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGS 257
                  TS       DGTYAT+++F++ S+      A K   +PPLR  L+ GDF++G+
Sbjct: 511 GPVQKLVTS-------DGTYATQSSFNTLST------AKKNEARPPLRQYLIDGDFFIGA 557

Query: 258 VLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMS 317
            L +TL KL LRY+ + +D  K N    EAMLIM+S++ +G+S   S  I  D  DR++ 
Sbjct: 558 ALGTTLAKLALRYNSLVKDTVKRNRFTTEAMLIMSSVLHLGKSGIPSKAITNDDADRLLL 617

Query: 318 CLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTV-------QVD 370
           CL +L     +  I+++F    R A + ++                           + D
Sbjct: 618 CLRVLS--DANREIETIFSEKCRKALSVMLVANALQESSLQKVKIYKKKEKNFFTMNEAD 675

Query: 371 DLIVFRQFSKRNIGDE---ADEYELDLTRAT--GQADSRDDLI---SKLSRVVQLTGFSD 422
           D I F Q S    G++    + +EL L+RA   G+     D     SKL++V+QLTGFSD
Sbjct: 676 DPITFLQLSALRGGEDFGGENLFELSLSRAVAGGKQTGSGDFTPASSKLNKVIQLTGFSD 735

Query: 423 PVYAEAYVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHS 482
           PVY+EAYV+V+QYDI+LDVLIVNQT +TLQN ++E ATLGDLKLVE+P    LAPH F +
Sbjct: 736 PVYSEAYVHVNQYDIVLDVLIVNQTGDTLQNCTLELATLGDLKLVEKPQPVVLAPHDFCN 795

Query: 483 VKATIKVSSTETGVIFGNIVYDGPGT-SESNCVVLNDIHIDIMDYINPAYCNETQFRSMW 541
           +KA++KV+STE G+IFGNIVYD  G  S+ N VVLNDIHIDIMDYI PA CN+T+FR MW
Sbjct: 796 IKASVKVASTENGIIFGNIVYDISGAASDRNVVVLNDIHIDIMDYIVPASCNDTEFRQMW 855

Query: 542 TEFEWENKVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGED 601
            EFEWENKV+V+TN+TDL EYL H++KSTNM CLTPE ALSG CGF++ANMYA+SIFGED
Sbjct: 856 AEFEWENKVSVSTNLTDLHEYLQHLIKSTNMKCLTPEKALSGQCGFMAANMYAKSIFGED 915

Query: 602 ALANISIEK---QTDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
           ALAN+SIEK   + + A+ GH+RIR+K+QG+ALSLGDKI +AQK
Sbjct: 916 ALANLSIEKPFNKPEAAVIGHIRIRAKSQGMALSLGDKIKMAQK 959



>gi|297611333|ref|NP_001065875.2| Os11g0174000 [Oryza sativa Japonica Group]
 gi|75283240|sp|Q53PC7.1|COPB1_ORYSJ RecName: Full=Coatomer subunit beta-1; AltName: Full=Beta-coat
           protein 1; Short=Beta-COP 1
 gi|62701950|gb|AAX93023.1| Adaptin N terminal region, putative [Oryza sativa Japonica Group]
 gi|62733667|gb|AAX95778.1| Adaptin N terminal region, putative [Oryza sativa Japonica Group]
 gi|77548943|gb|ABA91740.1| Adaptin N terminal region family protein, expressed [Oryza sativa
           Japonica Group]
 gi|222615602|gb|EEE51734.1| hypothetical protein OsJ_33144 [Oryza sativa Japonica Group]
 gi|255679838|dbj|BAF27720.2| Os11g0174000 [Oryza sativa Japonica Group]
          Length = 953

 Score =  618 bits (1594), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 320/635 (50%), Positives = 426/635 (67%), Gaps = 22/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP+++VRRK L + L+L+T RNV+EVV++LKKE+ KT   D EK  EYRQ+L+Q+IH C
Sbjct: 328 SSPNVDVRRKVLDLVLDLLTPRNVEEVVMYLKKEVVKTQAGDLEKGGEYRQMLVQAIHSC 387

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+++ EVA +VVH+LM+FLGD+N  AAVDV+ FVRE++E  P LR S+ ++L++TF  ++
Sbjct: 388 AVEYPEVAGSVVHLLMDFLGDTNVAAAVDVVLFVREIIETNPKLRVSMIQRLIDTFYQIR 447

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEY  +  ++E A   I+  LG++P     +                 
Sbjct: 448 ASRVCSCALWILGEYSLSLSEVESAISTIKQCLGDLPFYTVSEE-----GESTDASKPAQ 502

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SSRR  +LADGTYAT     ETA SS +     L + +      LRSL+LSG
Sbjct: 503 PVVNSVTVSSRRPVVLADGTYATQSAATETAISSPAVAPGSLSSTQN-----LRSLILSG 557

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+L +V+A TLTKLVLR   +     + N     A+LIM SI+++GQS +  +PID DS
Sbjct: 558 DFFLAAVVACTLTKLVLRLEEVQPSKAEANKASTGALLIMVSILQLGQSSYLPHPIDNDS 617

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L     D  ++ V+L   R +F +++                    Q DD
Sbjct: 618 YDRIVLCVRLLCNTGDD--VRKVWLQSCRQSFTKMLAEKQFRETEEMKAKAQISHAQPDD 675

Query: 372 LIVFRQF-SKRNIG--DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F    S+R +   +  D  + DL  ATG+     D  ++L+R++QLTGFSDPVYAEA
Sbjct: 676 LIDFYHLKSRRGMSQLELEDAVQDDLKAATGEFTKDADDANRLNRILQLTGFSDPVYAEA 735

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLV+RP  + LAP S   ++A IK
Sbjct: 736 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTLAPESSKQIRANIK 795

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E + VVLNDIHIDIMDYI+PA C +  FR+MW EFEWEN
Sbjct: 796 VSSTETGVIFGNIVYETSNVMERSVVVLNDIHIDIMDYISPATCADVAFRNMWAEFEWEN 855

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I D +E+L HI+KSTNM CLTP  AL G+CGF++AN+YA+S+FGEDAL NIS+
Sbjct: 856 KVAVNTVIQDEKEFLDHIIKSTNMKCLTPPSALDGECGFIAANLYAKSVFGEDALVNISV 915

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 916 EKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 950



>gi|218185340|gb|EEC67767.1| hypothetical protein OsI_35302 [Oryza sativa Indica Group]
          Length = 950

 Score =  618 bits (1594), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 320/635 (50%), Positives = 426/635 (67%), Gaps = 22/635 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGC 78
           +SP+++VRRK L + L+L+T RNV+EVV++LKKE+ KT   D EK  EYRQ+L+Q+IH C
Sbjct: 325 SSPNVDVRRKVLDLVLDLLTPRNVEEVVMYLKKEVVKTQAGDLEKGGEYRQMLVQAIHSC 384

Query: 79  AIKFSEVAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVK 138
           A+++ EVA +VVH+LM+FLGD+N  AAVDV+ FVRE++E  P LR S+ ++L++TF  ++
Sbjct: 385 AVEYPEVAGSVVHLLMDFLGDTNVAAAVDVVLFVREIIETNPKLRVSMIQRLIDTFYQIR 444

Query: 139 SGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXX 198
           + +V   ALWI+GEY  +  ++E A   I+  LG++P     +                 
Sbjct: 445 ASRVCSCALWILGEYSLSLSEVESAISTIKQCLGDLPFYTVSEE-----GESTDASKPAQ 499

Query: 199 XXXXXTTSSSRR--ILADGTYAT-----ETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSG 251
                 T SSRR  +LADGTYAT     ETA SS +     L + +      LRSL+LSG
Sbjct: 500 PVVNSVTVSSRRPVVLADGTYATQSAATETAISSPAVAPGSLSSTQN-----LRSLILSG 554

Query: 252 DFYLGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDS 311
           DF+L +V+A TLTKLVLR   +     + N     A+LIM SI+++GQS +  +PID DS
Sbjct: 555 DFFLAAVVACTLTKLVLRLEEVQPSKAEANKASTGALLIMVSILQLGQSSYLPHPIDNDS 614

Query: 312 YDRIMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDD 371
           YDRI+ C+ +L     D  ++ V+L   R +F +++                    Q DD
Sbjct: 615 YDRIVLCVRLLCNTGDD--VRKVWLQSCRQSFTKMLAEKQFRETEEMKAKAQISHAQPDD 672

Query: 372 LIVFRQF-SKRNIG--DEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEA 428
           LI F    S+R +   +  D  + DL  ATG+     D  ++L+R++QLTGFSDPVYAEA
Sbjct: 673 LIDFYHLKSRRGMSQLELEDAVQDDLKAATGEFTKDADDANRLNRILQLTGFSDPVYAEA 732

Query: 429 YVNVHQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIK 488
           YV VH YDI+LDV ++N+T ETLQNL +E AT+GDLKLV+RP  + LAP S   ++A IK
Sbjct: 733 YVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTLAPESSKQIRANIK 792

Query: 489 VSSTETGVIFGNIVYDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWEN 548
           VSSTETGVIFGNIVY+     E + VVLNDIHIDIMDYI+PA C +  FR+MW EFEWEN
Sbjct: 793 VSSTETGVIFGNIVYETSNVMERSVVVLNDIHIDIMDYISPATCADVAFRNMWAEFEWEN 852

Query: 549 KVNVNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISI 608
           KV VNT I D +E+L HI+KSTNM CLTP  AL G+CGF++AN+YA+S+FGEDAL NIS+
Sbjct: 853 KVAVNTVIQDEKEFLDHIIKSTNMKCLTPPSALDGECGFIAANLYAKSVFGEDALVNISV 912

Query: 609 EKQTDGAITGHVRIRSKTQGIALSLGDKITLAQKA 643
           EKQ DG ++G++RIRSKTQGIALSLGDKITL QK 
Sbjct: 913 EKQADGKLSGYIRIRSKTQGIALSLGDKITLKQKG 947



>gi|326430367|gb|EGD75937.1| coatomer beta subunit [Salpingoeca sp. ATCC 50818]
          Length = 945

 Score =  618 bits (1593), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 319/631 (50%), Positives = 417/631 (66%), Gaps = 23/631 (3%)

Query: 19  TSPDIEVRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQD-YEKNNEYRQLLIQSIHG 77
           ++PD+ VRRK L + +ELV+NRNV EVV+FL+KEL+KT  Q+ +EKN+EY+Q+L++++H 
Sbjct: 327 SAPDLTVRRKTLDLVMELVSNRNVSEVVMFLQKELAKTSSQEGFEKNSEYKQVLVRTLHQ 386

Query: 78  CAIKFSEVAANVVHVLMEFLGDSNNPA---AVDVIAFVREVVEKFPNLRSSITEKLLETF 134
             ++F +VA+ +V  LMEFL DS+  A   AVDVI FVRE  E+ P LRS +   LL +F
Sbjct: 387 LGVRFPDVASTIVPQLMEFLSDSDEKAVASAVDVIVFVREAFERLPALRSEMLGSLLSSF 446

Query: 135 MDVKSGKVFRGALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXX 194
             +   K+ R  +WI+GEY +  +DIE A  +I+  LG +PI+ +E              
Sbjct: 447 SQISVAKILRATVWIIGEYANTQRDIEAAIAEIKRSLGSLPIVDTELAEAAEAEAAEEEQ 506

Query: 195 XXXXXXXXXTTSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFY 254
                    T     RI ADGTYATE+ ++S           K   KPP R LLL GDF+
Sbjct: 507 GSEPKVVTRT-----RITADGTYATESVYTSTDK--------KKEEKPPTRKLLLGGDFF 553

Query: 255 LGSVLASTLTKLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDR 314
           + S +++ LTKL L+Y   S      N L A AML+M S+  +G++     P   D    
Sbjct: 554 VASAISTALTKLALKYGHTSASDADKNKLTATAMLMMVSMAHLGKTNIPEKPCPADCASH 613

Query: 315 IMSCLHILEQISTDYSIKSVFLHDTRAAFARIVXXXXXXXXX-XXXXXXXXXTVQVDDLI 373
           IM+C+H L   + +  ++ +FL     AF  ++                     Q DD I
Sbjct: 614 IMACVHTLASPTPE--LEQLFLDRCHRAFVDMLETLKSHHEHFKAKETSKVIKAQADDPI 671

Query: 374 VFRQFS-KRNIGDEADEYELDLTRATGQADSRDDLISKLSRVVQLTGFSDPVYAEAYVNV 432
            FR    K       D+ E+ L++ATG AD++++  SKLS+V QL+GFSDPVYAEAYVNV
Sbjct: 672 TFRALRVKAEDEFMDDDDEMLLSKATG-ADTKEESSSKLSKVFQLSGFSDPVYAEAYVNV 730

Query: 433 HQYDILLDVLIVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSST 492
           HQYDI LDVL+VNQT +TLQNL++E ATLGDLKL E+P  + L PH F ++KA +KVSST
Sbjct: 731 HQYDIHLDVLVVNQTPDTLQNLTLELATLGDLKLTEKPQSYTLGPHDFRNIKANVKVSST 790

Query: 493 ETGVIFGNIVYDGPG-TSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVN 551
           ETG+IFGNIVYD  G TS+ NCV+LNDIHIDIMDYI PA C+E +FR+MW EFEWENKV+
Sbjct: 791 ETGIIFGNIVYDVSGATSDRNCVILNDIHIDIMDYITPAMCSEVEFRAMWAEFEWENKVS 850

Query: 552 VNTNITDLREYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQ 611
           V T+ITDL  YL HI ++TNM CLTP+ AL+GDC FL+AN+YA+S+FGEDALAN+SIEK 
Sbjct: 851 VRTSITDLNAYLNHIKQTTNMQCLTPDSALTGDCNFLAANLYAKSVFGEDALANLSIEKG 910

Query: 612 TDGAITGHVRIRSKTQGIALSLGDKITLAQK 642
            DG ITGH+RIRSKTQGIALSLGDKITL QK
Sbjct: 911 PDGQITGHIRIRSKTQGIALSLGDKITLHQK 941



>gi|430813538|emb|CCJ29123.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 956

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 315/617 (51%), Positives = 431/617 (69%), Gaps = 11/617 (1%)

Query: 25  VRRKALRIALELVTNRNVQEVVVFLKKELSKTLDQDYEKNNEYRQLLIQSIHGCAIKFSE 84
           VR+KAL  ++E++++RNV++VV+ LKKEL KT+ QD+E++ EY QLL  S+H CA K+ +
Sbjct: 344 VRKKALDTSIEMLSSRNVEDVVLLLKKELVKTIKQDHEES-EYLQLLTHSLHLCATKYPK 402

Query: 85  VAANVVHVLMEFLGDSNNPAAVDVIAFVREVVEKFPNLRSSITEKLLETFMDVKSGKVFR 144
               V+ +LMEF+ + N  +A+DVI F ++V EKF   R SI +KLL    ++KSG++ R
Sbjct: 403 TLGIVIDILMEFISNFNTISAIDVILFAKKVAEKFIVFRKSIIKKLLLKLGEIKSGRISR 462

Query: 145 GALWIVGEYCSNCKDIEEAWKQIRAGLGEIPILASEQRLLXXXXXXXXXXXXXXXXXXXT 204
           G LWI+GEYC + +DI+  W+ IR  +GE+PIL  EQ+L                     
Sbjct: 463 GILWIIGEYCIDEEDIQNVWEHIRNNIGEMPILTIEQKL-AEKIQDDINKGIHDSSESNL 521

Query: 205 TSSSRRILADGTYATETAFSSNSSTLAKLEAIKAAVKPPLRSLLLSGDFYLGSVLASTLT 264
            SSSR+IL DGTYATE+A  S +  +  LE+ K + KP LRSL+L GD+YLGSVL+STL 
Sbjct: 522 LSSSRKILPDGTYATESALISETQMIDNLESEKVSEKPLLRSLILDGDYYLGSVLSSTLV 581

Query: 265 KLVLRYSGISEDPKKTNALRAEAMLIMASIIRVGQSQFASNPIDEDSYDRIMSCLHILEQ 324
           KL++RYS IS++  K N + AE MLIM  IIRVGQS++    IDEDS DRI+ CL  L +
Sbjct: 582 KLIMRYSEISKNTSKLNFMCAEGMLIMTGIIRVGQSKYVKMHIDEDSIDRILICLRSLIE 641

Query: 325 ISTDYSIKSVFLHDTRAAFARIVXXXXXXXXXXXXXXXXXXTVQVDDLIVFRQFSKRNIG 384
              + SIK +FL DT+ AF  ++                   +Q DD I+    + ++  
Sbjct: 642 YQNNPSIKDIFLKDTKNAFINMLSIEENKEKTSNSLKKKD-ILQPDDAIIPSLLASKSNI 700

Query: 385 DEADEYELDLTRA-TGQADSRDDLIS-KLSRVVQLTGFSDPVYAEAYVNVHQYDILLDVL 442
           +E D  +L++++A  G+A+S  D  S    ++VQLTGFSDP+Y EAY+ VHQ+DI+LD+L
Sbjct: 701 EEMDLVQLEISKAINGEANS--DFFSLNFKKIVQLTGFSDPIYVEAYIKVHQFDIILDIL 758

Query: 443 IVNQTSETLQNLSIEFATLGDLKLVERPTQHNLAPHSFHSVKATIKVSSTETGVIFGNIV 502
           +VNQ S TLQNLSIEFATLG+LK+VERP  +NLAP+ F  V+  IKV ST+TG+IFGN  
Sbjct: 759 LVNQLSVTLQNLSIEFATLGNLKIVERPPMYNLAPYDFLKVQVVIKVLSTDTGIIFGNCA 818

Query: 503 YDGPGTSESNCVVLNDIHIDIMDYINPAYCNETQFRSMWTEFEWENKVNVN--TNITDLR 560
           Y+G G+ +SN ++ ND+H+D++DYI P+YC+E QFRSMWTEFEWENKVNV+  TN  +L+
Sbjct: 819 YEGVGSQDSNIIIFNDVHVDVVDYIRPSYCSENQFRSMWTEFEWENKVNVSSLTN-QNLK 877

Query: 561 EYLGHIMKSTNMSCLTPEVALSGDCGFLSANMYARSIFGEDALANISIEKQTDGAITGHV 620
           E+L  +M  TNM+CL+ E  L  DCGFLSAN+YA+SIFGEDAL N+SI+KQ++  I GH+
Sbjct: 878 EFLNELMTRTNMACLSSE-TLKEDCGFLSANLYAKSIFGEDALMNVSIQKQSNNCIIGHI 936

Query: 621 RIRSKTQGIALSLGDKI 637
           RIRSKTQGIALS+G+ I
Sbjct: 937 RIRSKTQGIALSIGELI 953