BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10027_c0_seq1-m.11 5prime_partial 109-1008(-) 300 (-)
         (299 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|358059051|dbj|GAA95181.1| hypothetical protein E5Q_01836 [Mix...   295   1e-77   Mixia osmundae IAM 14324
gi|392577797|gb|EIW70926.1| hypothetical protein TREMEDRAFT_2164...   280   5e-73   Tremella mesenterica DSM 1558
gi|471915336|emb|CCO26479.1| LON peptidase N-terminal domain and...   273   3e-71   Rhizoctonia solani AG-1 IB
gi|402226150|gb|EJU06210.1| hypothetical protein DACRYDRAFT_1947...   272   6e-71   Dacryopinax primogenitus
gi|170090930|ref|XP_001876687.1| predicted protein [Laccaria bic...   272   9e-71   Laccaria bicolor S238N-H82
gi|389747252|gb|EIM88431.1| hypothetical protein STEHIDRAFT_1464...   270   3e-70   Stereum hirsutum FP-91666 SS1
gi|302693563|ref|XP_003036460.1| hypothetical protein SCHCODRAFT...   266   6e-69   Schizophyllum commune H4-8
gi|472582265|gb|EMS19961.1| ATP-dependent peptidase [Rhodosporid...   253   6e-65   Rhodotorula toruloides NP11
gi|393215676|gb|EJD01167.1| hypothetical protein FOMMEDRAFT_1583...   250   3e-64   Fomitiporia mediterranea MF3/22
gi|336373606|gb|EGO01944.1| hypothetical protein SERLA73DRAFT_71...   245   1e-62   Serpula lacrymans var. lacrymans S7.3
gi|512200898|gb|EPE29730.1| PUA [Glarea lozoyensis ATCC 20868]        236   6e-60   Glarea lozoyensis ATCC 20868
gi|409079674|gb|EKM80035.1| hypothetical protein AGABI1DRAFT_127...   234   3e-59   Agaricus bisporus var. burnettii JB137-S8
gi|328863460|gb|EGG12559.1| hypothetical protein MELLADRAFT_7621...   233   5e-59   Melampsora larici-populina 98AG31
gi|407927683|gb|EKG20570.1| Zinc finger RING-type protein [Macro...   231   1e-58   Macrophomina phaseolina MS6
gi|426198563|gb|EKV48489.1| hypothetical protein AGABI2DRAFT_117...   231   2e-58   Agaricus bisporus var. bisporus H97
gi|169610461|ref|XP_001798649.1| hypothetical protein SNOG_08329...   231   2e-58   Parastagonospora nodorum SN15
gi|393246223|gb|EJD53732.1| hypothetical protein AURDEDRAFT_8031...   230   3e-58   Auricularia subglabra TFB-10046 SS5
gi|482805765|gb|EOA82851.1| hypothetical protein SETTUDRAFT_9630...   228   1e-57   Setosphaeria turcica Et28A
gi|451847562|gb|EMD60869.1| hypothetical protein COCSADRAFT_2367...   228   2e-57   Bipolaris sorokiniana ND90Pr
gi|189204358|ref|XP_001938514.1| hypothetical protein PTRG_08182...   227   3e-57   Pyrenophora tritici-repentis Pt-1C-BFP
gi|330930933|ref|XP_003303199.1| hypothetical protein PTT_15329 ...   225   9e-57   Pyrenophora teres f. teres 0-1
gi|451996630|gb|EMD89096.1| hypothetical protein COCHEDRAFT_1157...   225   9e-57   Bipolaris maydis C5
gi|396490955|ref|XP_003843457.1| similar to ATP-dependent protea...   224   2e-56   Leptosphaeria maculans JN3
gi|310798415|gb|EFQ33308.1| ATP-dependent protease La domain-con...   223   3e-56   Colletotrichum graminicola M1.001
gi|121715472|ref|XP_001275345.1| ATP-dependent protease (CrgA), ...   223   6e-56   Aspergillus clavatus NRRL 1
gi|380486553|emb|CCF38627.1| ATP-dependent protease La domain-co...   222   9e-56   Colletotrichum higginsianum
gi|115384684|ref|XP_001208889.1| conserved hypothetical protein ...   222   1e-55   Aspergillus terreus NIH2624
gi|429863466|gb|ELA37917.1| ATP-dependent protease [Colletotrich...   219   7e-55   Colletotrichum gloeosporioides Nara gc5
gi|494828486|gb|EON65298.1| hypothetical protein W97_04536 [Coni...   219   7e-55   Coniosporium apollinis CBS 100218
gi|378734090|gb|EHY60549.1| hypothetical protein, variant [Exoph...   219   8e-55   Exophiala dermatitidis NIH/UT8656
gi|255950408|ref|XP_002565971.1| Pc22g20710 [Penicillium chrysog...   218   2e-54   Penicillium rubens Wisconsin 54-1255
gi|477529398|gb|ENH81162.1| ATP-dependent protease [Colletotrich...   217   3e-54   Colletotrichum orbiculare MAFF 240422
gi|317027643|ref|XP_001399743.2| ATP-dependent protease (CrgA) [...   217   4e-54   Aspergillus niger CBS 513.88
gi|440636673|gb|ELR06592.1| hypothetical protein GMDG_08065 [Geo...   216   4e-54   Pseudogymnoascus destructans 20631-21
gi|378734091|gb|EHY60550.1| hypothetical protein HMPREF1120_0850...   216   5e-54   Exophiala dermatitidis NIH/UT8656
gi|119480997|ref|XP_001260527.1| ATP-dependent protease (CrgA), ...   216   5e-54   Aspergillus fischeri NRRL 181
gi|317157063|ref|XP_003190799.1| ATP-dependent protease (CrgA) [...   216   7e-54   Aspergillus oryzae RIB40
gi|452977192|gb|EME76965.1| hypothetical protein MYCFIDRAFT_2127...   216   7e-54   Cercospora fijiensis CIRAD86
gi|238493275|ref|XP_002377874.1| ATP-dependent protease (CrgA), ...   216   7e-54   Aspergillus flavus NRRL3357
gi|408394345|gb|EKJ73553.1| hypothetical protein FPSE_06171 [Fus...   215   1e-53   Fusarium pseudograminearum CS3096
gi|452839866|gb|EME41805.1| hypothetical protein DOTSEDRAFT_4670...   214   2e-53   Dothistroma septosporum NZE10
gi|398406647|ref|XP_003854789.1| hypothetical protein MYCGRDRAFT...   213   4e-53   Zymoseptoria tritici IPO323
gi|46122409|ref|XP_385758.1| hypothetical protein FG05582.1 [Fus...   213   6e-53   
gi|134056662|emb|CAK37655.1| unnamed protein product [Aspergillu...   213   6e-53   Aspergillus niger
gi|350634602|gb|EHA22964.1| hypothetical protein ASPNIDRAFT_1749...   211   2e-52   Aspergillus niger ATCC 1015
gi|302409218|ref|XP_003002443.1| ATP-dependent protease [Vertici...   210   4e-52   Verticillium alfalfae VaMs.102
gi|71001398|ref|XP_755380.1| ATP-dependent protease (CrgA) [Aspe...   210   4e-52   Aspergillus fumigatus Af293
gi|342873554|gb|EGU75718.1| hypothetical protein FOXB_13737 [Fus...   209   7e-52   Fusarium oxysporum Fo5176
gi|358365518|dbj|GAA82140.1| ATP-dependent protease [Aspergillus...   208   2e-51   Aspergillus kawachii IFO 4308
gi|67539582|ref|XP_663565.1| hypothetical protein AN5961.2 [Aspe...   208   2e-51   Aspergillus nidulans FGSC A4
gi|449296608|gb|EMC92627.1| hypothetical protein BAUCODRAFT_7762...   207   3e-51   Baudoinia panamericana UAMH 10762
gi|453083306|gb|EMF11352.1| hypothetical protein SEPMUDRAFT_1503...   206   8e-51   Sphaerulina musiva SO2202
gi|302902876|ref|XP_003048739.1| hypothetical protein NECHADRAFT...   203   4e-50   Nectria haematococca mpVI 77-13-4
gi|400595143|gb|EJP62953.1| ATP-dependent protease La domain-con...   201   2e-49   Beauveria bassiana ARSEF 2860
gi|406864831|gb|EKD17874.1| putative ATP-dependent protease (Crg...   200   5e-49   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|346319502|gb|EGX89103.1| S16 family peptidase [Cordyceps mili...   198   2e-48   Cordyceps militaris CM01
gi|322709349|gb|EFZ00925.1| hypothetical protein MAA_03521 [Meta...   197   4e-48   
gi|303323719|ref|XP_003071851.1| ATP-dependent protease La domai...   196   6e-48   Coccidioides posadasii C735 delta SOWgp
gi|320031795|gb|EFW13753.1| LON peptidase domain and ring finger...   196   7e-48   Coccidioides posadasii str. Silveira
gi|389639008|ref|XP_003717137.1| hypothetical protein MGG_06430 ...   196   7e-48   Magnaporthe oryzae 70-15
gi|392867809|gb|EAS33505.2| ATP-dependent protease [Coccidioides...   196   8e-48   
gi|119188589|ref|XP_001244901.1| hypothetical protein CIMG_04342...   196   8e-48   
gi|242787204|ref|XP_002480957.1| ATP-dependent protease (CrgA), ...   194   2e-47   Talaromyces stipitatus ATCC 10500
gi|345563618|gb|EGX46605.1| hypothetical protein AOL_s00097g621 ...   192   7e-47   Arthrobotrys oligospora ATCC 24927
gi|501751544|emb|CCG84244.1| protein of unknown function [Taphri...   192   9e-47   Taphrina deformans PYCC 5710
gi|296412536|ref|XP_002835980.1| hypothetical protein [Tuber mel...   191   2e-46   Tuber melanosporum Mel28
gi|212543597|ref|XP_002151953.1| ATP-dependent protease (CrgA), ...   188   1e-45   Talaromyces marneffei ATCC 18224
gi|390601239|gb|EIN10633.1| LON-domain-containing protein [Punct...   187   2e-45   Punctularia strigosozonata HHB-11173 SS5
gi|296821342|ref|XP_002850091.1| LON peptidase N-terminal domain...   187   2e-45   Arthroderma otae CBS 113480
gi|443927335|gb|ELU45838.1| LON domain-containing protein [Rhizo...   186   6e-45   Rhizoctonia solani AG-1 IA
gi|409049604|gb|EKM59081.1| hypothetical protein PHACADRAFT_8786...   185   1e-44   Phanerochaete carnosa HHB-10118-sp
gi|258575785|ref|XP_002542074.1| predicted protein [Uncinocarpus...   185   1e-44   Uncinocarpus reesii 1704
gi|336386424|gb|EGO27570.1| hypothetical protein SERLADRAFT_4353...   182   1e-43   Serpula lacrymans var. lacrymans S7.9
gi|392568745|gb|EIW61919.1| hypothetical protein TRAVEDRAFT_2735...   181   2e-43   Trametes versicolor FP-101664 SS1
gi|449549731|gb|EMD40696.1| hypothetical protein CERSUDRAFT_1112...   181   3e-43   Gelatoporia subvermispora B
gi|149577008|ref|XP_001520684.1| PREDICTED: LON peptidase N-term...   179   6e-43   Ornithorhynchus anatinus [duck-billed platypus]
gi|395328876|gb|EJF61266.1| hypothetical protein DICSQDRAFT_1808...   179   1e-42   Dichomitus squalens LYAD-421 SS1
gi|326470631|gb|EGD94640.1| hypothetical protein TESG_02149 [Tri...   178   2e-42   Trichophyton tonsurans CBS 112818
gi|351695688|gb|EHA98606.1| LON peptidase and RING finger protei...   177   2e-42   Heterocephalus glaber [naked mole rat]
gi|513012700|ref|XP_004867722.1| PREDICTED: LON peptidase N-term...   177   2e-42   Heterocephalus glaber [naked mole rat]
gi|331245356|ref|XP_003335315.1| hypothetical protein PGTG_17095...   177   2e-42   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|326479548|gb|EGE03558.1| ATP-dependent protease CrgA [Trichop...   177   2e-42   Trichophyton equinum CBS 127.97
gi|512814589|ref|XP_004877829.1| PREDICTED: LON peptidase N-term...   177   3e-42   
gi|511951853|ref|XP_004794312.1| PREDICTED: LON peptidase N-term...   177   3e-42   
gi|504165563|ref|XP_004592740.1| PREDICTED: LON peptidase N-term...   177   3e-42   Ochotona princeps [southern American pika]
gi|511875733|ref|XP_004757878.1| PREDICTED: LON peptidase N-term...   177   3e-42   Mustela putorius furo [black ferret]
gi|426256550|ref|XP_004021903.1| PREDICTED: LON peptidase N-term...   176   5e-42   
gi|346972040|gb|EGY15492.1| ATP-dependent protease [Verticillium...   176   6e-42   Verticillium dahliae VdLs.17
gi|315054609|ref|XP_003176679.1| hypothetical protein MGYG_00767...   176   6e-42   Microsporum gypseum CBS 118893
gi|440913153|gb|ELR62640.1| hypothetical protein M91_20015, part...   176   6e-42   Bos mutus
gi|297491233|ref|XP_002698738.1| PREDICTED: LON peptidase N-term...   176   6e-42   Bos taurus [bovine]
gi|358421624|ref|XP_003585046.1| PREDICTED: LON peptidase N-term...   176   6e-42   
gi|194679204|ref|XP_001788603.1| PREDICTED: LON peptidase N-term...   176   7e-42   
gi|507619089|ref|XP_004696240.1| PREDICTED: LON peptidase N-term...   176   8e-42   Echinops telfairi [lesser hedgehog tenrec]
gi|260781357|ref|XP_002585782.1| hypothetical protein BRAFLDRAFT...   176   9e-42   Branchiostoma floridae
gi|466045355|ref|XP_004277206.1| PREDICTED: LON peptidase N-term...   175   1e-41   Orcinus orca [Orca]
gi|301768341|ref|XP_002919591.1| PREDICTED: LON peptidase N-term...   175   1e-41   
gi|350594537|ref|XP_003134232.3| PREDICTED: LON peptidase N-term...   175   1e-41   
gi|345781662|ref|XP_540001.3| PREDICTED: LON peptidase N-termina...   175   1e-41   Canis lupus familiaris [dogs]
gi|472387641|ref|XP_004413159.1| PREDICTED: LON peptidase N-term...   175   1e-41   Odobenus rosmarus divergens
gi|507946646|ref|XP_004682255.1| PREDICTED: LON peptidase N-term...   175   1e-41   Condylura cristata
gi|281351750|gb|EFB27334.1| hypothetical protein PANDA_008229 [A...   175   1e-41   Ailuropoda melanoleuca
gi|410956143|ref|XP_003984704.1| PREDICTED: LON peptidase N-term...   175   1e-41   Felis catus [cat]
gi|478509170|ref|XP_004428863.1| PREDICTED: LON peptidase N-term...   175   2e-41   
gi|194373867|dbj|BAG62246.1| unnamed protein product [Homo sapiens]   175   2e-41   Homo sapiens [man]
gi|505851010|ref|XP_004622914.1| PREDICTED: LOW QUALITY PROTEIN:...   175   2e-41   Sorex araneus [Eurasian shrew]
gi|431902296|gb|ELK08797.1| LON peptidase N-terminal domain and ...   174   2e-41   Pteropus alecto
gi|18676903|dbj|BAB85052.1| unnamed protein product [Homo sapiens]    174   3e-41   Homo sapiens [man]
gi|67969038|dbj|BAE00874.1| unnamed protein product [Macaca fasc...   174   3e-41   Macaca fascicularis [crab eating macaque]
gi|87080813|ref|NP_689484.3| LON peptidase N-terminal domain and...   174   3e-41   Homo sapiens [man]
gi|114618856|ref|XP_519609.2| PREDICTED: LON peptidase N-termina...   174   3e-41   Pan troglodytes
gi|194386354|dbj|BAG59741.1| unnamed protein product [Homo sapiens]   174   3e-41   Homo sapiens [man]
gi|402877572|ref|XP_003902497.1| PREDICTED: LON peptidase N-term...   174   3e-41   
gi|426358896|ref|XP_004046725.1| PREDICTED: LON peptidase N-term...   174   3e-41   Gorilla gorilla gorilla [lowland gorilla]
gi|395739406|ref|XP_002818872.2| PREDICTED: LON peptidase N-term...   174   3e-41   
gi|332825576|ref|XP_003311659.1| PREDICTED: LON peptidase N-term...   174   3e-41   Pan troglodytes
gi|109658896|gb|AAI17386.1| LONRF1 protein [Homo sapiens] >gi|10...   174   3e-41   Homo sapiens [man]
gi|403288865|ref|XP_003935597.1| PREDICTED: LON peptidase N-term...   174   3e-41   
gi|402877570|ref|XP_003902496.1| PREDICTED: LON peptidase N-term...   174   3e-41   Papio anubis [Doguera baboon]
gi|297298947|ref|XP_002805308.1| PREDICTED: LON peptidase N-term...   174   3e-41   
gi|332215214|ref|XP_003256737.1| PREDICTED: LON peptidase N-term...   174   3e-41   
gi|390473648|ref|XP_002756978.2| PREDICTED: LON peptidase N-term...   174   4e-41   
gi|470618650|ref|XP_004317899.1| PREDICTED: LOW QUALITY PROTEIN:...   174   4e-41   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|149742647|ref|XP_001494772.1| PREDICTED: LON peptidase N-term...   173   4e-41   
gi|444706580|gb|ELW47914.1| LON peptidase N-terminal domain and ...   173   4e-41   Tupaia chinensis
gi|507566586|ref|XP_004666937.1| PREDICTED: LON peptidase N-term...   173   4e-41   
gi|469832261|ref|NP_001264163.1| LON peptidase N-terminal domain...   173   5e-41   Danio rerio [leopard danio]
gi|471399766|ref|XP_004382852.1| PREDICTED: LON peptidase N-term...   173   5e-41   Trichechus manatus latirostris
gi|432117305|gb|ELK37692.1| LON peptidase N-terminal domain and ...   173   6e-41   Myotis davidii
gi|507653327|ref|XP_004633337.1| PREDICTED: LON peptidase N-term...   173   6e-41   Octodon degus
gi|354471552|ref|XP_003498005.1| PREDICTED: LON peptidase N-term...   173   6e-41   
gi|348553712|ref|XP_003462670.1| PREDICTED: LON peptidase N-term...   173   6e-41   
gi|395850291|ref|XP_003797726.1| PREDICTED: LON peptidase N-term...   172   7e-41   
gi|443716928|gb|ELU08221.1| hypothetical protein CAPTEDRAFT_1975...   172   7e-41   Capitella teleta
gi|148703520|gb|EDL35467.1| mCG122352 [Mus musculus]                  172   7e-41   Mus musculus [mouse]
gi|291409154|ref|XP_002720877.1| PREDICTED: LON peptidase N-term...   172   8e-41   
gi|149057966|gb|EDM09209.1| LON peptidase N-terminal domain and ...   172   9e-41   Rattus norvegicus [brown rat]
gi|397471861|ref|XP_003846201.1| PREDICTED: LOW QUALITY PROTEIN:...   172   1e-40   
gi|293342466|ref|XP_001066614.2| PREDICTED: LOW QUALITY PROTEIN:...   172   1e-40   
gi|392354018|ref|XP_224907.6| PREDICTED: LOW QUALITY PROTEIN: LO...   172   1e-40   
gi|124487241|ref|NP_001074619.1| LON peptidase N-terminal domain...   171   2e-40   Mus musculus [mouse]
gi|355779521|gb|EHH63997.1| RING finger protein 191, partial [Ma...   171   2e-40   Macaca fascicularis [crab eating macaque]
gi|472371601|ref|XP_004405298.1| PREDICTED: LON peptidase N-term...   171   2e-40   
gi|498936553|ref|XP_004541190.1| PREDICTED: LON peptidase N-term...   170   4e-40   Maylandia zebra
gi|119584264|gb|EAW63860.1| LON peptidase N-terminal domain and ...   170   5e-40   Homo sapiens [man]
gi|348516870|ref|XP_003445960.1| PREDICTED: LON peptidase N-term...   169   6e-40   Oreochromis niloticus
gi|113931418|ref|NP_001039158.1| LON peptidase N-terminal domain...   169   8e-40   Xenopus tropicalis [western clawed frog]
gi|156382456|ref|XP_001632569.1| predicted protein [Nematostella...   169   1e-39   Nematostella vectensis
gi|507575992|ref|XP_004671537.1| PREDICTED: LON peptidase N-term...   169   1e-39   Jaculus jaculus
gi|507575990|ref|XP_004671536.1| PREDICTED: LON peptidase N-term...   169   1e-39   Jaculus jaculus
gi|465952885|gb|EMP25121.1| LON peptidase N-terminal domain and ...   169   1e-39   Chelonia mydas [green seaturtle]
gi|291407849|ref|XP_002720257.1| PREDICTED: LON peptidase N-term...   169   1e-39   
gi|291229803|ref|XP_002734860.1| PREDICTED: LON peptidase N-term...   168   2e-39   
gi|302659405|ref|XP_003021393.1| ATP-dependent protease (CrgA), ...   168   2e-39   Trichophyton verrucosum HKI 0517
gi|300798556|ref|NP_001178063.1| LON peptidase N-terminal domain...   168   2e-39   Bos taurus [bovine]
gi|296471328|tpg|DAA13443.1| TPA: LON peptidase N-terminal domai...   168   2e-39   Bos taurus [bovine]
gi|488534041|ref|XP_004458738.1| PREDICTED: LON peptidase N-term...   168   2e-39   Dasypus novemcinctus
gi|488534043|ref|XP_004458739.1| PREDICTED: LON peptidase N-term...   168   2e-39   
gi|512910574|ref|XP_004901858.1| PREDICTED: LON peptidase N-term...   167   2e-39   
gi|512002345|ref|XP_004818680.1| PREDICTED: LON peptidase N-term...   167   2e-39   
gi|348563693|ref|XP_003467641.1| PREDICTED: LON peptidase N-term...   167   2e-39   
gi|351710907|gb|EHB13826.1| LON peptidase and RING finger protei...   167   3e-39   Heterocephalus glaber [naked mole rat]
gi|511884703|ref|XP_004762181.1| PREDICTED: LON peptidase N-term...   167   3e-39   
gi|513021878|ref|XP_004872205.1| PREDICTED: LON peptidase N-term...   167   3e-39   Heterocephalus glaber [naked mole rat]
gi|327307894|ref|XP_003238638.1| hypothetical protein TERG_00629...   167   3e-39   Trichophyton rubrum CBS 118892
gi|345807557|ref|XP_003435631.1| PREDICTED: LON peptidase N-term...   167   3e-39   
gi|513021880|ref|XP_004872206.1| PREDICTED: LON peptidase N-term...   167   3e-39   Heterocephalus glaber [naked mole rat]
gi|512859453|ref|XP_002934588.2| PREDICTED: LON peptidase N-term...   167   3e-39   Xenopus tropicalis [western clawed frog]
gi|410989317|ref|XP_004000909.1| PREDICTED: LON peptidase N-term...   167   3e-39   
gi|335306474|ref|XP_003135396.2| PREDICTED: LON peptidase N-term...   167   4e-39   Sus scrofa [pigs]
gi|327284914|ref|XP_003227180.1| PREDICTED: LON peptidase N-term...   167   4e-39   Anolis carolinensis [Carolina anole]
gi|470644222|ref|XP_004326482.1| PREDICTED: LON peptidase N-term...   167   4e-39   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|335306476|ref|XP_003360480.1| PREDICTED: LON peptidase N-term...   167   4e-39   
gi|344281401|ref|XP_003412468.1| PREDICTED: LON peptidase N-term...   167   4e-39   
gi|410928474|ref|XP_003977625.1| PREDICTED: LON peptidase N-term...   167   4e-39   Takifugu rubripes [tiger puffer]
gi|507957527|ref|XP_004685987.1| PREDICTED: LON peptidase N-term...   167   5e-39   Condylura cristata
gi|475673004|gb|EMT70127.1| LON peptidase N-terminal domain and ...   167   5e-39   Fusarium oxysporum f. sp. cubense race 4
gi|470644225|ref|XP_004326483.1| PREDICTED: LON peptidase N-term...   166   5e-39   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|426257665|ref|XP_004022445.1| PREDICTED: LON peptidase N-term...   166   5e-39   
gi|426257663|ref|XP_004022444.1| PREDICTED: LON peptidase N-term...   166   5e-39   Ovis aries [domestic sheep]
gi|477518428|gb|ENH70653.1| LON peptidase N-terminal domain and ...   166   6e-39   Fusarium oxysporum f. sp. cubense race 1
gi|301761420|ref|XP_002916133.1| PREDICTED: LOW QUALITY PROTEIN:...   166   6e-39   
gi|440462078|gb|ELQ32481.1| hypothetical protein OOU_Y34scaffold...   166   6e-39   Magnaporthe oryzae Y34
gi|466038608|ref|XP_004275848.1| PREDICTED: LON peptidase N-term...   166   6e-39   Orcinus orca [Orca]
gi|466038613|ref|XP_004275849.1| PREDICTED: LON peptidase N-term...   166   6e-39   Orcinus orca [Orca]
gi|507705618|ref|XP_004645745.1| PREDICTED: LON peptidase N-term...   166   7e-39   Octodon degus
gi|449474913|ref|XP_002195040.2| PREDICTED: LON peptidase N-term...   166   7e-39   
gi|507705622|ref|XP_004645746.1| PREDICTED: LON peptidase N-term...   166   8e-39   Octodon degus
gi|505842082|ref|XP_004614549.1| PREDICTED: LON peptidase N-term...   166   8e-39   
gi|432105304|gb|ELK31601.1| LON peptidase N-terminal domain and ...   166   8e-39   Myotis davidii
gi|478536384|ref|XP_004442312.1| PREDICTED: LON peptidase N-term...   166   8e-39   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|432880159|ref|XP_004073581.1| PREDICTED: LON peptidase N-term...   166   9e-39   
gi|478536386|ref|XP_004442313.1| PREDICTED: LON peptidase N-term...   166   9e-39   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|302508831|ref|XP_003016376.1| ATP-dependent protease (CrgA), ...   166   1e-38   Arthroderma benhamiae CBS 112371
gi|363733701|ref|XP_420695.3| PREDICTED: LOW QUALITY PROTEIN: LO...   165   1e-38   
gi|395848815|ref|XP_003797038.1| PREDICTED: LON peptidase N-term...   165   1e-38   Otolemur garnettii
gi|483520330|gb|EOB05844.1| LON peptidase N-terminal domain and ...   165   2e-38   Anas platyrhynchos [duck]
gi|395848817|ref|XP_003797039.1| PREDICTED: LON peptidase N-term...   165   2e-38   Otolemur garnettii
gi|149744890|ref|XP_001487924.1| PREDICTED: LON peptidase N-term...   165   2e-38   Equus caballus [domestic horse]
gi|449280791|gb|EMC88017.1| LON peptidase N-terminal domain and ...   165   2e-38   Columba livia [carrier pigeon]
gi|149744893|ref|XP_001487934.1| PREDICTED: LON peptidase N-term...   164   2e-38   Equus caballus [domestic horse]
gi|449267125|gb|EMC78091.1| LON peptidase N-terminal domain and ...   164   2e-38   Columba livia [carrier pigeon]
gi|326912597|ref|XP_003202635.1| PREDICTED: LON peptidase N-term...   164   3e-38   
gi|344240340|gb|EGV96443.1| hypothetical protein I79_003640 [Cri...   164   3e-38   Cricetulus griseus [Chinese hamsters]
gi|465956895|gb|EMP27167.1| LON peptidase N-terminal domain and ...   164   3e-38   Chelonia mydas [green seaturtle]
gi|431921507|gb|ELK18873.1| LON peptidase N-terminal domain and ...   164   4e-38   Pteropus alecto
gi|513164530|ref|XP_416903.4| PREDICTED: LON peptidase N-termina...   164   4e-38   
gi|321455609|gb|EFX66737.1| hypothetical protein DAPPUDRAFT_1303...   164   4e-38   Daphnia pulex
gi|507678992|ref|XP_004710174.1| PREDICTED: LON peptidase N-term...   163   5e-38   Echinops telfairi [lesser hedgehog tenrec]
gi|301610356|ref|XP_002934710.1| PREDICTED: LON peptidase N-term...   163   5e-38   Xenopus tropicalis [western clawed frog]
gi|158261419|dbj|BAF82887.1| unnamed protein product [Homo sapiens]   163   7e-38   Homo sapiens [man]
gi|296236256|ref|XP_002763252.1| PREDICTED: LON peptidase N-term...   162   7e-38   Callithrix jacchus [common marmoset]
gi|296236258|ref|XP_002763253.1| PREDICTED: LON peptidase N-term...   162   7e-38   Callithrix jacchus [common marmoset]
gi|449483669|ref|XP_002194059.2| PREDICTED: LON peptidase N-term...   162   7e-38   Taeniopygia guttata
gi|353236097|emb|CCA68098.1| hypothetical protein PIIN_01966 [Pi...   162   8e-38   Serendipita indica DSM 11827
gi|471390139|ref|XP_004379865.1| PREDICTED: LON peptidase N-term...   162   1e-37   Trichechus manatus latirostris
gi|71043955|ref|NP_083170.1| LON peptidase N-terminal domain and...   162   1e-37   Mus musculus [mouse]
gi|344286296|ref|XP_003414895.1| PREDICTED: LOW QUALITY PROTEIN:...   162   1e-37   
gi|471390142|ref|XP_004379866.1| PREDICTED: LON peptidase N-term...   162   1e-37   Trichechus manatus latirostris
gi|425771032|gb|EKV09487.1| ATP-dependent protease (CrgA), putat...   162   1e-37   Penicillium digitatum Pd1
gi|403279122|ref|XP_003931115.1| PREDICTED: LON peptidase N-term...   162   1e-37   
gi|354475734|ref|XP_003500082.1| PREDICTED: LON peptidase N-term...   162   1e-37   
gi|449498900|ref|XP_002191244.2| PREDICTED: LON peptidase N-term...   162   1e-37   
gi|327273722|ref|XP_003221629.1| PREDICTED: LON peptidase N-term...   162   1e-37   Anolis carolinensis [Carolina anole]
gi|402911228|ref|XP_003918239.1| PREDICTED: LON peptidase N-term...   162   1e-37   Papio anubis [Doguera baboon]
gi|119610292|gb|EAW89886.1| LON peptidase N-terminal domain and ...   162   1e-37   Homo sapiens [man]
gi|426397207|ref|XP_004064815.1| PREDICTED: LON peptidase N-term...   162   2e-37   Gorilla gorilla gorilla [lowland gorilla]
gi|402911226|ref|XP_003918238.1| PREDICTED: LON peptidase N-term...   162   2e-37   Papio anubis [Doguera baboon]
gi|403279120|ref|XP_003931114.1| PREDICTED: LON peptidase N-term...   161   2e-37   
gi|426397205|ref|XP_004064814.1| PREDICTED: LON peptidase N-term...   161   2e-37   Gorilla gorilla gorilla [lowland gorilla]
gi|73747840|ref|NP_001027026.1| LON peptidase N-terminal domain ...   161   2e-37   Homo sapiens [man]
gi|224049868|ref|XP_002192219.1| PREDICTED: LON peptidase N-term...   161   2e-37   Taeniopygia guttata
gi|37622896|ref|NP_079054.3| LON peptidase N-terminal domain and...   161   2e-37   Homo sapiens [man]
gi|149059996|gb|EDM10812.1| similar to ring finger protein 127 (...   161   2e-37   Rattus norvegicus [brown rat]
gi|355705097|gb|EHH31022.1| RING finger protein 127 [Macaca mula...   161   2e-37   Macaca mulatta [rhesus macaque]
gi|10439066|dbj|BAB15419.1| unnamed protein product [Homo sapiens]    161   2e-37   Homo sapiens [man]
gi|297710864|ref|XP_002832080.1| PREDICTED: LON peptidase N-term...   161   2e-37   Pongo abelii [Orang-utan]
gi|355757648|gb|EHH61173.1| RING finger protein 127 [Macaca fasc...   161   2e-37   Macaca fascicularis [crab eating macaque]
gi|513181434|ref|XP_004940903.1| PREDICTED: LON peptidase N-term...   161   2e-37   Gallus gallus [bantam]
gi|75072991|sp|Q8HXH0.1|LONF3_MACFA RecName: Full=LON peptidase ...   161   2e-37   Macaca fascicularis [crab eating macaque]
gi|332226230|ref|XP_003262292.1| PREDICTED: LON peptidase N-term...   161   2e-37   Nomascus leucogenys [White-cheeked Gibbon]
gi|322697143|gb|EFY88926.1| hypothetical protein MAC_05020 [Meta...   161   2e-37   Metarhizium acridum CQMa 102
gi|363732675|ref|XP_420345.3| PREDICTED: LON peptidase N-termina...   161   2e-37   
gi|300797540|ref|NP_001178514.1| LON peptidase N-terminal domain...   161   2e-37   Rattus norvegicus [brown rat]
gi|297710866|ref|XP_002832081.1| PREDICTED: LON peptidase N-term...   161   2e-37   Pongo abelii [Orang-utan]
gi|345306671|ref|XP_001513421.2| PREDICTED: LON peptidase N-term...   161   2e-37   
gi|483512038|gb|EOB00665.1| LON peptidase N-terminal domain and ...   161   2e-37   Anas platyrhynchos [duck]
gi|332226228|ref|XP_003262291.1| PREDICTED: LON peptidase N-term...   160   3e-37   Nomascus leucogenys [White-cheeked Gibbon]
gi|340379279|ref|XP_003388154.1| PREDICTED: LON peptidase N-term...   160   3e-37   Amphimedon queenslandica
gi|438688539|emb|CCP50075.1| RING finger protein [Fusarium fujik...   160   3e-37   Fusarium fujikuroi
gi|114689958|ref|XP_001135253.1| PREDICTED: LON peptidase N-term...   160   4e-37   Pan troglodytes
gi|326924620|ref|XP_003208523.1| PREDICTED: LON peptidase N-term...   160   4e-37   
gi|397482969|ref|XP_003812682.1| PREDICTED: LON peptidase N-term...   160   4e-37   Pan paniscus [bonobo]
gi|397482967|ref|XP_003812681.1| PREDICTED: LON peptidase N-term...   160   4e-37   Pan paniscus [bonobo]
gi|114689960|ref|XP_529131.2| PREDICTED: LON peptidase N-termina...   160   4e-37   Pan troglodytes
gi|410914189|ref|XP_003970570.1| PREDICTED: LON peptidase N-term...   160   4e-37   
gi|334350182|ref|XP_001371945.2| PREDICTED: hypothetical protein...   160   6e-37   
gi|432880399|ref|XP_004073678.1| PREDICTED: LON peptidase N-term...   159   6e-37   Oryzias latipes [Japanese rice fish]
gi|465979957|gb|EMP35391.1| LON peptidase N-terminal domain and ...   159   6e-37   Chelonia mydas [green seaturtle]
gi|47216793|emb|CAG10115.1| unnamed protein product [Tetraodon n...   159   8e-37   Tetraodon nigroviridis
gi|348534951|ref|XP_003454965.1| PREDICTED: LON peptidase N-term...   159   9e-37   
gi|390342076|ref|XP_001180621.2| PREDICTED: LON peptidase N-term...   159   1e-36   Strongylocentrotus purpuratus [purple urchin]
gi|118097440|ref|XP_414581.2| PREDICTED: LON peptidase N-termina...   158   2e-36   Gallus gallus [bantam]
gi|499036752|ref|XP_004569039.1| PREDICTED: LON peptidase N-term...   158   2e-36   Maylandia zebra
gi|348533582|ref|XP_003454284.1| PREDICTED: LON peptidase N-term...   158   2e-36   
gi|327279430|ref|XP_003224459.1| PREDICTED: LON peptidase N-term...   157   2e-36   
gi|410897557|ref|XP_003962265.1| PREDICTED: LON peptidase N-term...   157   3e-36   Takifugu rubripes [tiger puffer]
gi|465986236|gb|EMP37063.1| hypothetical protein UY3_05767 [Chel...   157   4e-36   Chelonia mydas [green seaturtle]
gi|126337219|ref|XP_001369239.1| PREDICTED: LON peptidase N-term...   157   4e-36   
gi|432846716|ref|XP_004065909.1| PREDICTED: LON peptidase N-term...   157   4e-36   Oryzias latipes [Japanese rice fish]
gi|348528663|ref|XP_003451836.1| PREDICTED: LON peptidase N-term...   157   5e-36   Oreochromis niloticus
gi|498979577|ref|XP_004549603.1| PREDICTED: LON peptidase N-term...   156   6e-36   Maylandia zebra
gi|498979581|ref|XP_004549604.1| PREDICTED: LON peptidase N-term...   156   6e-36   
gi|355751526|gb|EHH55781.1| hypothetical protein EGM_05050 [Maca...   156   8e-36   Macaca fascicularis [crab eating macaque]
gi|355565937|gb|EHH22366.1| hypothetical protein EGK_05611 [Maca...   156   8e-36   Macaca mulatta [rhesus macaque]
gi|297266625|ref|XP_001104504.2| PREDICTED: LON peptidase N-term...   155   1e-35   
gi|213406537|ref|XP_002174040.1| ubiquitin-protein ligase E3 [Sc...   154   2e-35   Schizosaccharomyces japonicus yFS275
gi|432931016|ref|XP_004081573.1| PREDICTED: LON peptidase N-term...   154   2e-35   
gi|332813942|ref|XP_003309201.1| PREDICTED: LON peptidase N-term...   154   2e-35   
gi|344242273|gb|EGV98376.1| hypothetical protein I79_006213 [Cri...   154   2e-35   
gi|34534021|dbj|BAC86883.1| unnamed protein product [Homo sapien...   154   2e-35   
gi|499024911|ref|XP_004563210.1| PREDICTED: LON peptidase N-term...   154   3e-35   
gi|219521499|gb|AAI43469.1| LONRF2 protein [Homo sapiens]             154   3e-35   
gi|119622251|gb|EAX01846.1| LON peptidase N-terminal domain and ...   154   3e-35   
gi|119622253|gb|EAX01848.1| LON peptidase N-terminal domain and ...   154   3e-35   
gi|395547126|ref|XP_003775152.1| PREDICTED: uncharacterized prot...   154   4e-35   
gi|68032982|gb|AAY84832.1| neuroblastoma apoptosis-related prote...   154   4e-35   
gi|332251526|ref|XP_003274896.1| PREDICTED: LON peptidase N-term...   154   4e-35   
gi|148528975|ref|NP_940863.3| LON peptidase N-terminal domain an...   154   4e-35   
gi|426336602|ref|XP_004031557.1| PREDICTED: LON peptidase N-term...   153   5e-35   
gi|156408680|ref|XP_001641984.1| predicted protein [Nematostella...   153   5e-35   
gi|470422001|ref|XP_004337456.1| zinc finger, C3HC4 type (RING f...   153   5e-35   
gi|326663985|ref|XP_001340443.4| PREDICTED: LON peptidase N-term...   153   6e-35   
gi|297666903|ref|XP_002811742.1| PREDICTED: LON peptidase N-term...   152   7e-35   
gi|71274158|ref|NP_001025049.1| LON peptidase N-terminal domain ...   152   9e-35   
gi|326433286|gb|EGD78856.1| hypothetical protein PTSG_01834 [Sal...   152   1e-34   
gi|478523417|ref|XP_004435911.1| PREDICTED: LON peptidase N-term...   151   2e-34   
gi|403301389|ref|XP_003941373.1| PREDICTED: LON peptidase N-term...   151   2e-34   
gi|198437128|ref|XP_002129989.1| PREDICTED: LON peptidase N-term...   151   2e-34   
gi|390474127|ref|XP_003734728.1| PREDICTED: LOW QUALITY PROTEIN:...   151   2e-34   
gi|410954675|ref|XP_003983988.1| PREDICTED: LON peptidase N-term...   151   2e-34   
gi|504150600|ref|XP_004587692.1| PREDICTED: LON peptidase N-term...   151   3e-34   
gi|504150598|ref|XP_004587691.1| PREDICTED: LON peptidase N-term...   150   3e-34   
gi|344255885|gb|EGW11989.1| hypothetical protein I79_010110 [Cri...   150   3e-34   
gi|281337620|gb|EFB13204.1| hypothetical protein PANDA_007847 [A...   150   3e-34   
gi|402891696|ref|XP_003909078.1| PREDICTED: LON peptidase N-term...   150   4e-34   
gi|354482394|ref|XP_003503383.1| PREDICTED: LON peptidase N-term...   150   4e-34   
gi|301767630|ref|XP_002919232.1| PREDICTED: LON peptidase N-term...   150   4e-34   
gi|511860377|ref|XP_004753079.1| PREDICTED: LON peptidase N-term...   150   5e-34   
gi|511860374|ref|XP_004753078.1| PREDICTED: LON peptidase N-term...   150   5e-34   
gi|472361148|ref|XP_004400172.1| PREDICTED: LON peptidase N-term...   150   5e-34   
gi|345777223|ref|XP_538457.3| PREDICTED: LON peptidase N-termina...   150   6e-34   
gi|293349746|ref|XP_001058206.2| PREDICTED: LON peptidase N-term...   149   6e-34   
gi|326673720|ref|XP_689262.3| PREDICTED: LON peptidase N-termina...   149   9e-34   
gi|501306937|dbj|GAC95931.1| hypothetical protein PHSY_003509 [P...   149   1e-33   
gi|395843198|ref|XP_003794383.1| PREDICTED: LON peptidase N-term...   148   2e-33   
gi|512921937|ref|XP_004929996.1| PREDICTED: LON peptidase N-term...   148   2e-33   
gi|343425831|emb|CBQ69364.1| conserved hypothetical protein [Spo...   146   7e-33   
gi|443894085|dbj|GAC71435.1| predicted E3 ubiquitin ligase [Pseu...   146   7e-33   
gi|388856291|emb|CCF50100.1| uncharacterized protein [Ustilago h...   145   9e-33   
gi|71021727|ref|XP_761094.1| hypothetical protein UM04947.1 [Ust...   145   1e-32   
gi|42601320|gb|AAS21347.1| hypothetical protein FLJ22612-like pr...   144   2e-32   
gi|414867311|tpg|DAA45868.1| TPA: putative RING zinc finger doma...   144   2e-32   
gi|194705368|gb|ACF86768.1| unknown [Zea mays] >gi|414867310|tpg...   144   2e-32   
gi|384496262|gb|EIE86753.1| hypothetical protein RO3G_11464 [Rhi...   144   3e-32   
gi|148682600|gb|EDL14547.1| LON peptidase N-terminal domain and ...   143   7e-32   
gi|313224371|emb|CBY20160.1| unnamed protein product [Oikopleura...   142   1e-31   
gi|226503839|ref|NP_001145128.1| uncharacterized protein LOC1002...   142   2e-31   
gi|466048315|ref|XP_004277797.1| PREDICTED: LON peptidase N-term...   141   2e-31   
gi|399167946|emb|CCE31316.1| uncharacterized protein CPUR_05167 ...   140   3e-31   
gi|119622252|gb|EAX01847.1| LON peptidase N-terminal domain and ...   140   3e-31   
gi|55468848|emb|CAE51310.1| crgA protein [Blakeslea trispora]         140   3e-31   
gi|383854414|ref|XP_003702716.1| PREDICTED: LON peptidase N-term...   139   7e-31   
gi|195017041|ref|XP_001984525.1| GH16513 [Drosophila grimshawi] ...   139   7e-31   
gi|299747660|ref|XP_002911202.1| hypothetical protein CC1G_14633...   139   8e-31   
gi|307167420|gb|EFN61005.1| LON peptidase N-terminal domain and ...   138   1e-30   
gi|357121347|ref|XP_003562382.1| PREDICTED: LON peptidase N-term...   138   2e-30   
gi|222625211|gb|EEE59343.1| hypothetical protein OsJ_11426 [Oryz...   137   2e-30   
gi|218193137|gb|EEC75564.1| hypothetical protein OsI_12235 [Oryz...   137   3e-30   
gi|195379050|ref|XP_002048294.1| GJ11426 [Drosophila virilis] >g...   137   3e-30   
gi|322797331|gb|EFZ19443.1| hypothetical protein SINV_00469 [Sol...   137   5e-30   
gi|332027519|gb|EGI67596.1| LON peptidase N-terminal domain and ...   136   6e-30   
gi|498964679|ref|XP_004525445.1| PREDICTED: uncharacterized prot...   136   6e-30   
gi|307191752|gb|EFN75194.1| LON peptidase N-terminal domain and ...   136   6e-30   
gi|350415011|ref|XP_003490502.1| PREDICTED: LON peptidase N-term...   136   8e-30   
gi|380017069|ref|XP_003692488.1| PREDICTED: LON peptidase N-term...   136   8e-30   
gi|340714815|ref|XP_003395919.1| PREDICTED: LON peptidase N-term...   136   9e-30   
gi|195126651|ref|XP_002007784.1| GI12194 [Drosophila mojavensis]...   135   1e-29   
gi|189235477|ref|XP_967202.2| PREDICTED: similar to conserved hy...   135   1e-29   
gi|195436112|ref|XP_002066022.1| GK10598 [Drosophila willistoni]...   135   1e-29   
gi|328791939|ref|XP_395138.3| PREDICTED: LON peptidase N-termina...   135   1e-29   
gi|157109247|ref|XP_001650585.1| hypothetical protein AaeL_AAEL0...   135   1e-29   
gi|19113528|ref|NP_596736.1| ubiquitin-protein ligase E3 (predic...   135   2e-29   
gi|194749639|ref|XP_001957246.1| GF24151 [Drosophila ananassae] ...   134   2e-29   
gi|345497763|ref|XP_001599271.2| PREDICTED: LON peptidase N-term...   134   4e-29   
gi|328794198|ref|XP_001123162.2| PREDICTED: LON peptidase N-term...   133   5e-29   
gi|170054153|ref|XP_001862997.1| conserved hypothetical protein ...   133   7e-29   
gi|242017611|ref|XP_002429281.1| conserved hypothetical protein ...   132   1e-28   
gi|25013159|gb|AAN71692.1| SD22693p, partial [Drosophila melanog...   130   3e-28   
gi|24660416|ref|NP_729296.1| CG32369, isoform A [Drosophila mela...   130   4e-28   
gi|361131938|gb|EHL03553.1| putative LON peptidase N-terminal do...   130   4e-28   
gi|511006074|gb|EPB87394.1| hypothetical protein HMPREF1544_0582...   130   5e-28   
gi|17944185|gb|AAL47988.1| GH21463p [Drosophila melanogaster] >g...   130   6e-28   
gi|18996299|emb|CAC83819.1| CrgA protein [Expression vector pEUK...   129   7e-28   
gi|431902455|gb|ELK08954.1| LON peptidase N-terminal domain and ...   129   8e-28   
gi|154147345|emb|CAB61339.2| carotenoid regulatory protein [Muco...   129   1e-27   
gi|194865383|ref|XP_001971402.1| GG14936 [Drosophila erecta] >gi...   129   1e-27   
gi|502128607|ref|XP_004500017.1| PREDICTED: LON peptidase N-term...   128   1e-27   
gi|444515334|gb|ELV10840.1| LON peptidase N-terminal domain and ...   128   2e-27   
gi|449666698|ref|XP_004206397.1| PREDICTED: LON peptidase N-term...   128   2e-27   
gi|471357751|ref|XP_004369464.1| PREDICTED: LON peptidase N-term...   128   2e-27   
gi|21554128|gb|AAM63208.1| unknown [Arabidopsis thaliana]             127   3e-27   
gi|198462704|ref|XP_001352523.2| GA16849 [Drosophila pseudoobscu...   127   5e-27   
gi|478260130|gb|ENN79915.1| hypothetical protein YQE_03734, part...   125   1e-26   
gi|224119058|ref|XP_002317975.1| predicted protein [Populus tric...   125   1e-26   
gi|18394639|ref|NP_564060.1| zinc finger (C3HC4-type RING finger...   125   1e-26   
gi|356508525|ref|XP_003523006.1| PREDICTED: LON peptidase N-term...   125   2e-26   
gi|508774683|gb|EOY21939.1| Zinc finger (C3HC4-type RING finger)...   125   2e-26   
gi|482576071|gb|EOA40258.1| hypothetical protein CARUB_v10008983...   124   2e-26   
gi|508774682|gb|EOY21938.1| Zinc finger (C3HC4-type RING finger)...   124   3e-26   
gi|426226508|ref|XP_004023638.1| PREDICTED: LOW QUALITY PROTEIN:...   124   4e-26   
gi|195492670|ref|XP_002094091.1| GE20387 [Drosophila yakuba] >gi...   124   4e-26   
gi|356516824|ref|XP_003527093.1| PREDICTED: LON peptidase N-term...   122   2e-25   
gi|158286663|ref|XP_308856.3| AGAP006900-PA [Anopheles gambiae s...   120   3e-25   
gi|405970387|gb|EKC35296.1| LON peptidase N-terminal domain and ...   120   3e-25   
gi|340384080|ref|XP_003390543.1| PREDICTED: LON peptidase N-term...   120   4e-25   
gi|328710285|ref|XP_003244215.1| PREDICTED: LON peptidase N-term...   120   6e-25   
gi|42571537|ref|NP_973859.1| zinc finger (C3HC4-type RING finger...   120   6e-25   
gi|470130488|ref|XP_004301135.1| PREDICTED: probable receptor-li...   120   6e-25   
gi|357614852|gb|EHJ69325.1| hypothetical protein KGM_10898 [Dana...   119   7e-25   
gi|344284015|ref|XP_003413766.1| PREDICTED: LOW QUALITY PROTEIN:...   119   9e-25   
gi|297844822|ref|XP_002890292.1| zinc finger family protein [Ara...   118   2e-24   
gi|449440816|ref|XP_004138180.1| PREDICTED: LON peptidase N-term...   117   3e-24   
gi|290983525|ref|XP_002674479.1| predicted protein [Naegleria gr...   117   3e-24   
gi|358414328|ref|XP_003582807.1| PREDICTED: LOW QUALITY PROTEIN:...   117   5e-24   
gi|462405691|gb|EMJ11155.1| hypothetical protein PRUPE_ppa004836...   115   1e-23   
gi|462405690|gb|EMJ11154.1| hypothetical protein PRUPE_ppa004836...   115   1e-23   
gi|293336194|ref|NP_001169658.1| uncharacterized LOC100383539 [Z...   114   3e-23   
gi|47222002|emb|CAG08257.1| unnamed protein product [Tetraodon n...   114   4e-23   
gi|384252284|gb|EIE25760.1| hypothetical protein COCSUDRAFT_6077...   113   6e-23   
gi|460381486|ref|XP_004236480.1| PREDICTED: probable receptor-li...   112   1e-22   
gi|297733938|emb|CBI15185.3| unnamed protein product [Vitis vini...   112   1e-22   
gi|350582107|ref|XP_003481196.1| PREDICTED: LON peptidase N-term...   112   2e-22   
gi|359491313|ref|XP_002284678.2| PREDICTED: probable receptor-li...   112   2e-22   
gi|388492518|gb|AFK34325.1| unknown [Lotus japonicus]                 111   3e-22   
gi|255547323|ref|XP_002514719.1| kinase, putative [Ricinus commu...   110   3e-22   
gi|403279124|ref|XP_003931116.1| PREDICTED: LON peptidase N-term...   110   4e-22   
gi|395529826|ref|XP_003767007.1| PREDICTED: LON peptidase N-term...   110   4e-22   
gi|149046315|gb|EDL99208.1| LON peptidase N-terminal domain and ...   110   5e-22   
gi|402911230|ref|XP_003918240.1| PREDICTED: LON peptidase N-term...   109   7e-22   
gi|21750228|dbj|BAC03744.1| unnamed protein product [Homo sapien...   109   7e-22   
gi|297304644|ref|XP_001105370.2| PREDICTED: LON peptidase N-term...   109   8e-22   
gi|397482971|ref|XP_003812683.1| PREDICTED: LON peptidase N-term...   109   8e-22   
gi|332861515|ref|XP_003317700.1| PREDICTED: LON peptidase N-term...   109   9e-22   
gi|395754353|ref|XP_003779759.1| PREDICTED: LON peptidase N-term...   107   3e-21   
gi|428183694|gb|EKX52551.1| hypothetical protein GUITHDRAFT_1017...   102   1e-19   
gi|171687100|ref|XP_001908491.1| hypothetical protein [Podospora...   100   6e-19   
gi|470622297|ref|XP_004319045.1| PREDICTED: LON peptidase N-term...   100   7e-19   
gi|474135607|gb|EMS56326.1| LON peptidase N-terminal domain and ...   100   7e-19   
gi|507957772|ref|XP_004686068.1| PREDICTED: LOW QUALITY PROTEIN:...    99   1e-18   
gi|511008398|gb|EPB89664.1| hypothetical protein HMPREF1544_0346...    99   1e-18   
gi|384485768|gb|EIE77948.1| hypothetical protein RO3G_02652 [Rhi...    99   2e-18   
gi|255071741|ref|XP_002499545.1| predicted protein [Micromonas s...    96   8e-18   
gi|358338140|dbj|GAA56452.1| LON peptidase N-terminal domain and...    93   1e-16   
gi|495185975|ref|WP_007910765.1| peptidase S16 lon domain protei...    93   1e-16   
gi|449673910|ref|XP_002169668.2| PREDICTED: LON peptidase N-term...    91   5e-16   
gi|470300815|ref|XP_004347015.1| hypothetical protein CAOG_05330...    90   6e-16   
gi|403415016|emb|CCM01716.1| predicted protein [Fibroporia radic...    87   4e-15   
gi|242035411|ref|XP_002465100.1| hypothetical protein SORBIDRAFT...    87   5e-15   
gi|359069922|ref|XP_003586660.1| PREDICTED: LOW QUALITY PROTEIN:...    87   7e-15   
gi|39644695|gb|AAH04538.2| LONRF1 protein, partial [Homo sapiens]      80   9e-13   
gi|303277961|ref|XP_003058274.1| predicted protein [Micromonas p...    79   1e-12   
gi|497469023|ref|WP_009783221.1| ATP-dependent protease [Lyngbya...    78   3e-12   
gi|511011120|gb|EPB92334.1| hypothetical protein HMPREF1544_0090...    77   7e-12   
gi|498000463|ref|WP_010314619.1| ATP-dependent protease [Synecho...    75   3e-11   
gi|449018179|dbj|BAM81581.1| hypothetical protein, conserved [Cy...    74   4e-11   
gi|90084970|dbj|BAE91226.1| unnamed protein product [Macaca fasc...    74   5e-11   


>gi|358059051|dbj|GAA95181.1| hypothetical protein E5Q_01836 [Mixia osmundae IAM 14324]
          Length = 877

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 198/306 (64%), Gaps = 11/306 (3%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ RSLDH+  CP+CR     +  Y  HP N  I   +  +Y  L++ R   
Sbjct: 573 CGHTFCRACLMRSLDHSDKCPLCRSDFVGFAHYKDHPSNGAIDVVLEKVYTQLHATRISD 632

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLAC--S 119
           +  E     QD PIFV + L FP MP FLHVFEP+YRLM+RR M    + FGMVL     
Sbjct: 633 IQREQAEAAQDVPIFVCS-LAFPNMPTFLHVFEPRYRLMMRRAMDG-NKLFGMVLPSRQP 690

Query: 120 NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISPXXX 179
               ++GTMLEI+S + L DGRS++ET+G Y+FKV+ +G+ DGY +G+VER+DDI+    
Sbjct: 691 GGLYEYGTMLEIKSLQLLQDGRSMIETVGMYRFKVLSRGTLDGYTIGKVERIDDITEEQE 750

Query: 180 XXXXXXX-----XXXXXIYNTSNPLNNPI--REYTTSELIGISRDFIETLRNGNSPWLLQ 232
                            + + SN ++ P   +E TT+ELI + RDFIE LR+G++PWLLQ
Sbjct: 751 RALEEAALARSISGASALASESNNVHIPAQPKEQTTAELIEVCRDFIEVLRSGSAPWLLQ 810

Query: 233 RLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWF 292
           RLN+ +G MP+ P+DFS+W+A+VIPI + EK KLL++ S R RL+L+V WI+ +R  WW+
Sbjct: 811 RLNNTFGPMPESPADFSFWMAAVIPIDQYEKAKLLQITSARLRLRLLVFWINQMRTSWWW 870

Query: 293 ARGCSI 298
            RGC++
Sbjct: 871 NRGCTV 876



>gi|392577797|gb|EIW70926.1| hypothetical protein TREMEDRAFT_21645, partial [Tremella
           mesenterica DSM 1558]
          Length = 301

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 189/298 (63%), Gaps = 28/298 (9%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC HSFC  C++RSLDH+  CP+CRQ L +   +    +N+ + + IR  +P+ Y++R+ 
Sbjct: 25  PCQHSFCSKCLSRSLDHSPRCPLCRQDLPSLAFFQDQFVNRVLLTVIRTAFPTEYADRQA 84

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            ++ +  +   DTPIFV   L FP MP  LHVFEP+YRLMIRRC++S   +FGMVL    
Sbjct: 85  AIERDERDARLDTPIFVCT-LAFPGMPTILHVFEPRYRLMIRRCIESSSPRFGMVLPARG 143

Query: 121 T-------YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
                     ++GTMLEI S + L DGRS+VET+GT++FK++EKG+ DGY VGR+E+++D
Sbjct: 144 GPDSGMQGVMEYGTMLEINSVQMLPDGRSMVETVGTHRFKLLEKGTLDGYTVGRIEKIED 203

Query: 174 ISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
           ISP                              TT + + +   FI+ L++G++PWLLQR
Sbjct: 204 ISPEEEARLELLA--------------------TTHQYMLLCTGFIDQLKSGSAPWLLQR 243

Query: 234 LNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
           LN  YG MPDDPS+FSYW+A V+PI E EK +LL +RS R RLKLIV W+ +LR  WW
Sbjct: 244 LNHTYGSMPDDPSEFSYWMALVMPIDEYEKARLLPIRSPRLRLKLIVHWVETLRSSWW 301



>gi|471915336|emb|CCO26479.1| LON peptidase N-terminal domain and RING finger protein 1 AltName:
           Full=RING finger protein 191 [Rhizoctonia solani AG-1
           IB]
          Length = 307

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 191/305 (62%), Gaps = 13/305 (4%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+  CP+CR  L   + +  H  N+ I   +   +P L  ER  
Sbjct: 10  PCQHTFCSTCLERSLDHSPKCPLCRLDLPPNSYFYQHAHNEVIVQIVAKAFPKLLEERAS 69

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
           + +++  ++  DTPIFV   L +P MP  LH FEP+YRLM+RRC+ S   +FGMV+   N
Sbjct: 70  IAETDGRDSRLDTPIFVCQ-LSYPGMPTLLHFFEPRYRLMLRRCLASATPRFGMVMPRQN 128

Query: 121 TYQ----DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                  D+GTMLEI++ + L+DGRS+VET GT++F+++E+G+ DGY VGR+ER+DD  P
Sbjct: 129 ANNTDGNDYGTMLEIKNVQMLSDGRSMVETYGTFRFRILERGTLDGYLVGRIERIDDYPP 188

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIR--EYTTSELIGISRDFIETLRNGNSPWLLQRL 234
                          + N S   +  +R  E +  EL+ + R F++ LRNG +PW++QRL
Sbjct: 189 EVEAEIERIA-----LMNPSEG-DAALRGIERSNQELVDVCRRFLDQLRNGTAPWVVQRL 242

Query: 235 NSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWFAR 294
           N+ YG MP D + FS+WVA V+PI E EK KLL +RS R RL+L+V WI  L + WWF+ 
Sbjct: 243 NNTYGPMPTDVASFSFWVALVLPIDEQEKAKLLPIRSPRMRLRLVVHWIEQLNNNWWFSS 302

Query: 295 GCSIS 299
           GC + 
Sbjct: 303 GCVVG 307



>gi|402226150|gb|EJU06210.1| hypothetical protein DACRYDRAFT_19479 [Dacryopinax sp. DJM-731 SS1]
          Length = 475

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 195/331 (58%), Gaps = 34/331 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH +ACP+CR+ +  ++ +  H  NK + S I   +P  Y ERR 
Sbjct: 147 PCQHTFCAKCLQRSLDHGTACPLCREEMPGFSYHQDHANNKVVLSLILTAFPEAYIERRT 206

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            L+ E  N+  DTPIF    L FP  P  LH+FEP+YRLM+RR M+ R  +FG + A S 
Sbjct: 207 QLEQEGRNSRLDTPIFYP-LLAFPSTPTMLHLFEPRYRLMLRRVMEDRTYRFGAI-AQSR 264

Query: 121 TYQ---DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD---- 173
           T+    ++GTM+EIRS +   DGRS++ET+GT++F+++E+G  DGY V ++ER+DD    
Sbjct: 265 THSEGMEYGTMMEIRSVQMFPDGRSMLETVGTWRFRIVERGLLDGYIVAKIERIDDYPGE 324

Query: 174 ----------------------ISPXXXXXXXXXXXXXXXI---YNTSNPLNNPIREYTT 208
                                   P               +    + ++PL   +   T 
Sbjct: 325 VEVEVEQSALPFTPGLPLARAPTPPSALVTPTSEEPAPLTLPVALSETSPLLAEVPNPTI 384

Query: 209 SELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLE 268
            EL+   R F+ TLR+G++PW++QRL++ YGD P DPS +S+W+A+++PI E EK KLL 
Sbjct: 385 DELMDKCRAFVHTLRSGSAPWVVQRLDTTYGDAPTDPSAYSFWIAAIMPIDEAEKAKLLP 444

Query: 269 LRSVRERLKLIVEWISSLRDQWWFARGCSIS 299
           +RS R RL+LIV WI  L + WWF+ GC I+
Sbjct: 445 IRSTRLRLRLIVHWIEQLSNNWWFSNGCVIA 475



>gi|170090930|ref|XP_001876687.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648180|gb|EDR12423.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 495

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 189/295 (64%), Gaps = 26/295 (8%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH +ACP+CR P  +Y+ +  HP+NKTIYS I   +  +Y ER  
Sbjct: 193 PCQHTFCSKCLHRSLDHKNACPVCRHPQPDYSYFRDHPLNKTIYSIILKAFALVYIERGE 252

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA--- 117
           ++  E  +   DTPIFV   L FP +P FLH FEPKYRLM+RRC++S   QFGM+++   
Sbjct: 253 IIQQEERDARLDTPIFVCQ-LSFPGVPTFLHFFEPKYRLMLRRCLESPHPQFGMIMSPKS 311

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N+  D+GTML+IR  + L+DGRS VET+G+Y+F+V+E+G+ DGY VGR+ER++D   
Sbjct: 312 GVPNSQIDYGTMLQIRRVQMLSDGRSYVETMGSYRFRVLERGTLDGYTVGRIERINDCP- 370

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          + +TS        + T  +L+ I + F+E L+ G +PW++QRL++
Sbjct: 371 --------------DLPSTST------LQPTIEDLMDICKSFLERLQLGTAPWVVQRLSN 410

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
             G MP DPS FS+WVA ++PI E EK KL  +R+ R RL L+V WI  L D W+
Sbjct: 411 TIGPMPTDPSIFSFWVALILPIDEHEKAKLFPIRNTRLRLLLVVHWIEQLNDNWY 465



>gi|389747252|gb|EIM88431.1| hypothetical protein STEHIDRAFT_146434 [Stereum hirsutum FP-91666
           SS1]
          Length = 346

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/327 (42%), Positives = 192/327 (58%), Gaps = 30/327 (9%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+S CP+CRQ L  +  +  HP N+T+   +   +P +Y+ER  
Sbjct: 20  PCQHTFCAKCLQRSLDHSSQCPLCRQDLSGFTYFQDHPFNQTVLKIVLEAFPDVYAERGR 79

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
           LLD E      DTPIFV   L FP M   LH FEP+YRLM+RRC+ S    FGM++   +
Sbjct: 80  LLDEEARIARLDTPIFV-GQLSFPGMSVILHFFEPRYRLMLRRCLASPTPCFGMIMPSRS 138

Query: 121 TYQ----DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDI-- 174
           T Q    D+GTMLEIRS   LADGRSL+ET GT++F+++E+G+ DGY +GRVER+DD   
Sbjct: 139 TSQSTSNDYGTMLEIRSVRMLADGRSLIETWGTHRFRIMERGTLDGYMLGRVERIDDFPR 198

Query: 175 ---SPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGIS---------------- 215
                               + +  + L +  +     E + I+                
Sbjct: 199 DLGDSEASLTAVLNDAESSSLASNPSSLRSGPQPPPPPENLRIASVFQRARQTVPNNEAL 258

Query: 216 ----RDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRS 271
               R+F++ L+ G +PW++QRLN+ YG MP DPS+FS+W+A V+PI E EK KLL ++S
Sbjct: 259 MEFCRNFVDQLQAGAAPWVVQRLNNTYGPMPTDPSNFSFWMALVLPIDEIEKSKLLPIKS 318

Query: 272 VRERLKLIVEWISSLRDQWWFARGCSI 298
            R RL+L+V WI  L+  WWF  GC I
Sbjct: 319 PRLRLRLVVYWIEQLKSNWWFTSGCII 345



>gi|302693563|ref|XP_003036460.1| hypothetical protein SCHCODRAFT_62971 [Schizophyllum commune H4-8]
 gi|300110157|gb|EFJ01558.1| hypothetical protein SCHCODRAFT_62971 [Schizophyllum commune H4-8]
          Length = 496

 Score =  266 bits (679), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 187/314 (59%), Gaps = 37/314 (11%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH++ACPICRQ L  Y+ +  HP+N+T+ S I+     LY  R  
Sbjct: 203 PCQHTFCTKCLQRSLDHSAACPICRQELPGYSYFQDHPVNQTVLSIIQLTNKDLYDARAA 262

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            ++ E  +   DTPIFV   L FP MP  LH FEP+YRLM+RRC+ S  + FGM+    +
Sbjct: 263 AIEQEEKDGRLDTPIFVCQ-LAFPGMPTLLHFFEPRYRLMLRRCLASPNKSFGMITPPRS 321

Query: 121 -------------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
                        T  ++GTMLEIRS + L DGRS+VET GT++F+++E+G  DGY VGR
Sbjct: 322 SGPPARQTSVPYPTSHEYGTMLEIRSVQMLPDGRSMVETWGTHRFRILERGVLDGYMVGR 381

Query: 168 VERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNS 227
           VER+DD+                    + + L+ P      S+L+    +FI TLR G +
Sbjct: 382 VERIDDVEEDF----------------SRDGLDTP----PLSQLVHTCLEFISTLRKGTA 421

Query: 228 PWLLQRLNSVYGDMPDDP---SDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWIS 284
           PW++QRL+S YG MP      S+FS+W+  V+PI + EK +LL +RSVR RL +   WI 
Sbjct: 422 PWVVQRLSSTYGPMPSPRTHISEFSFWMGLVLPIGDEEKARLLPVRSVRMRLVMCCWWIE 481

Query: 285 SLRDQWWFARGCSI 298
            LR  WWF+ GC +
Sbjct: 482 GLRASWWFSSGCVV 495



>gi|472582265|gb|EMS19961.1| ATP-dependent peptidase [Rhodosporidium toruloides NP11]
          Length = 934

 Score =  253 bits (645), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 124/318 (38%), Positives = 184/318 (57%), Gaps = 20/318 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFC+ C+ RS DH+  CP+CR  L     +     N  +   I    P   +ER  
Sbjct: 618 PCGHSFCRQCLARSYDHSDKCPLCRADLPPLAYFRWQRSNIALTKIIETALPQQAAERAA 677

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL---- 116
            +  E    +   P+FV     +P + CFLH+FEP+YRLM+RR +++ +R FGMVL    
Sbjct: 678 TVKEEELALLASVPVFVCTT-AWPGIKCFLHIFEPRYRLMVRRVLETPERSFGMVLPLRS 736

Query: 117 ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
           A  +   ++GTML + S + L DGR ++ETIGTY+F+++E+   DGY+VG+VERVDD+SP
Sbjct: 737 AGPDAVNEYGTMLRVTSCQMLEDGRLILETIGTYRFRLLERSMVDGYNVGKVERVDDVSP 796

Query: 177 XXXXXXXXXX-----------XXXXXIYNTSNPLNNPIR----EYTTSELIGISRDFIET 221
                                     +     PL+ P      E +T +L+ I  DF+ T
Sbjct: 797 EQEAELERVALARNDTLQDEYAEPEPVGPDGVPLSRPPMTGNIELSTDQLMQICLDFLTT 856

Query: 222 LRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVE 281
           LR  ++PW+++RLN   G++P++P DFS++ A V P+ +  K  LL++ SVRERL+LIV 
Sbjct: 857 LRASSAPWIIERLNRTVGEVPNNPHDFSWFAAEVFPVEDHVKVTLLQITSVRERLRLIVF 916

Query: 282 WISSLRDQWWFARGCSIS 299
           WI   R  WW++RGC+I+
Sbjct: 917 WIEQFRSSWWYSRGCNIA 934



>gi|393215676|gb|EJD01167.1| hypothetical protein FOMMEDRAFT_158302 [Fomitiporia mediterranea
           MF3/22]
          Length = 719

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 184/339 (54%), Gaps = 50/339 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH S CP+CRQ L  ++ +  HP NK + + +   +P  Y+ER  
Sbjct: 382 PCQHTFCAKCLQRSLDHGSKCPLCRQDLPPFSYFQDHPFNKAVLAVLLKAFPEFYTERGR 441

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKY----------------------- 97
            ++ E  +   +TPIFV   L FP +P  LH +EP+Y                       
Sbjct: 442 TIEEEERDGRLNTPIFVCQ-LSFPGIPTLLHFYEPRYVCILCADSFLSLAPIFGHCVPGC 500

Query: 98  ----------------RLMIRRCMQSRQRQFGMVL---ACSNTYQDFGTMLEIRSAEFLA 138
                           RLM+RRC++S    FGM++          D+GTMLEIRS + L 
Sbjct: 501 RNSRAITHTSPIIISYRLMLRRCLESTTPCFGMIMPQRTVGAGSNDYGTMLEIRSVQMLP 560

Query: 139 DGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDI-------SPXXXXXXXXXXXXXXX 191
           DGRS+VET+GT++F+++E G+ DGY VGR+ERVDDI       +                
Sbjct: 561 DGRSMVETMGTHRFRIMETGTLDGYMVGRIERVDDIPQALEEEAERSISSLLTSQVESSE 620

Query: 192 IYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYW 251
             ++    ++ I   TT ELI +   F+E LRNG +PW+++RLN+ YG MPDD S F +W
Sbjct: 621 QGSSEESSSSRIPAPTTEELIAVCHAFVEQLRNGTAPWVVERLNNTYGPMPDDVSTFGFW 680

Query: 252 VASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQW 290
           +A V+PI E EK KLL +RS + RL+L+V WI  L   W
Sbjct: 681 MAQVLPIEESEKAKLLVIRSPKARLRLVVHWIEQLNSNW 719



>gi|336373606|gb|EGO01944.1| hypothetical protein SERLA73DRAFT_71102 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 565

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 185/340 (54%), Gaps = 43/340 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC HSFC  C+ RSLDH+  CP+CR+ L     +   P NK I S +   +P  Y+ER  
Sbjct: 226 PCQHSFCSKCLQRSLDHSMFCPLCRKDLPGNAIFQDSPTNKVILSILLKAFPESYAERGE 285

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            L +E  +   DTPIFV   L FP MP  LH FEP+YRLM+RRC++S    FGMVL    
Sbjct: 286 TLRAEERDMRLDTPIFVCQ-LSFPGMPTLLHFFEPRYRLMLRRCLESPHPIFGMVLPPRP 344

Query: 121 TYQ-DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVD------- 172
             Q +FGTMLEIRS + L+DGRS+VET GT++F+++E+G  DGY VGRVER+D       
Sbjct: 345 DGQCEFGTMLEIRSVQMLSDGRSMVETWGTHRFRILERGVLDGYMVGRVERIDDFDDDLE 404

Query: 173 ------------DISPXXXXXXXXXXXX---------XXXIYNTSNP-----------LN 200
                       D +P                           +++P           L 
Sbjct: 405 EWAFGTAEEDTEDTAPSEDTQDTNQHHLLSRLVSSLSQVQTPTSASPHSANAQSQLPSLY 464

Query: 201 NPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMP--DDPSDFSYWVASVIPI 258
           +P R  +TS L+     F+  L +G +PW++QRL   YG+ P   D S FS+++A V+PI
Sbjct: 465 SPTRVPSTSTLLATCHTFLSQLHSGTAPWVVQRLQHTYGNPPPSSDLSAFSFYMALVLPI 524

Query: 259 AEGEKYKLLELRSVRERLKLIVEWISSLRDQWWFARGCSI 298
            E EK KLL +RS R RL ++  W+  LR  WWF+ GC +
Sbjct: 525 DEHEKAKLLPVRSARLRLCVVCRWVEVLRGNWWFSSGCVV 564



>gi|512200898|gb|EPE29730.1| PUA [Glarea lozoyensis ATCC 20868]
          Length = 490

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 181/321 (56%), Gaps = 29/321 (9%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYL--HHPINKTIYSFIRALYPSLYSER 58
           PCGH+FC+ C  R LDH+  CPICR+ +    A      P N  +   +  L P     R
Sbjct: 164 PCGHTFCRTCTHRLLDHSRLCPICRRTISTPPASTSTQAPSNMLLVKLLMGLCPDALEAR 223

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             ++ +E  N++   DTP+FV   L FP  P FLH+FEP+YRLMIRR M++  R+FGM+L
Sbjct: 224 AEMVKTENLNSIGELDTPLFVCT-LSFPTAPTFLHIFEPRYRLMIRRAMETGDRKFGMIL 282

Query: 117 ACSN----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                          + ++GT+L I +   L DGRSL+ET+G  +F+++E  + DGY VG
Sbjct: 283 PNPRREPQGDLGPVPFYEYGTLLHIITMHVLPDGRSLIETVGVSRFRILEHATLDGYMVG 342

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSN------PLNNP--------IREYTTSELI 212
           +VER++D+S                    S+      P ++P        +   +T +L+
Sbjct: 343 KVERIEDMSLAAEETLEAAETSISSARPLSSQDHFGAPPDHPRTSPPQLDLTSLSTQQLM 402

Query: 213 GISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSV 272
            I   F+E +R  ++PWL  R+ + YG+MP DP+ F +W ASV+PIAE EKY+LL+L+SV
Sbjct: 403 EIGTSFVEKMRRQSAPWLHTRVFTTYGEMPTDPATFPWWFASVLPIAESEKYRLLQLQSV 462

Query: 273 RERLKLIVEWISSLRDQWWFA 293
           RERLK    WI+ L  Q W+A
Sbjct: 463 RERLKYCAGWIAQLEAQRWYA 483



>gi|409079674|gb|EKM80035.1| hypothetical protein AGABI1DRAFT_127711 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 619

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 181/309 (58%), Gaps = 20/309 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+ ACP+CRQ L  +  +  HP NKT+ S I   +P LY ER  
Sbjct: 287 PCQHTFCAKCLHRSLDHSPACPLCRQDLPGFAYFQDHPTNKTLLSIILKTWPMLYRERGE 346

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA--- 117
            L +E  +   DTPIFV   L FP  P  LH FEP+YRLM+RRC++S+  +FGM++A   
Sbjct: 347 ALAAEERDARLDTPIFVCQ-LSFPGAPTLLHFFEPRYRLMLRRCLESQNPRFGMIMAPKP 405

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              +   D+GTMLEIRS + L DGRS+VET GT++F++ E+G+ DG D    E +D  S 
Sbjct: 406 GAGSPQTDYGTMLEIRSVQMLPDGRSMVETWGTFRFRIFERGTLDGID-DYPEDLDASSF 464

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREY--------------TTSELIGISRDFIETL 222
                            ++++  ++P                  T  EL+   R F+  L
Sbjct: 465 LFPSNSIITSPETPSSSSSASTPSDPAHPPTPPSLPIPIHPNSPTNEELMTTCRTFLHRL 524

Query: 223 RNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEW 282
           + G +PW++QRL+S YG MP DPS FS+WVA V+PI E EK KLL LRS R RL L+V W
Sbjct: 525 QRGTAPWVVQRLSSTYGTMPTDPSAFSFWVALVLPIDEHEKAKLLPLRSARLRLLLLVHW 584

Query: 283 ISSLRDQWW 291
           I  L  QW+
Sbjct: 585 IEQLNSQWY 593



>gi|328863460|gb|EGG12559.1| hypothetical protein MELLADRAFT_76217 [Melampsora larici-populina
           98AG31]
          Length = 456

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 169/292 (57%), Gaps = 23/292 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FCK C+ RSLD+ + CP+CRQ L          I++TI   I   + + +   R  
Sbjct: 154 CGHTFCKGCLERSLDYTNRCPVCRQSLIRQTL----SIDQTIQELIMKCFSTRFQTTRSS 209

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLAC-SN 120
             SE         +F+   L FPK+P FLHVFEP YR +IRR + S  R+FG+VL   + 
Sbjct: 210 NPSESQELSNQVSLFIC-GLAFPKLPTFLHVFEPHYRFLIRRSL-STNRRFGIVLPTETG 267

Query: 121 TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISPXXXX 180
               FGT++EI+S EFL DGRSLVETIG  +F+++     DGY V  V+ ++DI P    
Sbjct: 268 AINQFGTLVEIKSIEFLQDGRSLVETIGIIRFEILNLTCLDGYQVANVKWIEDIDPSIES 327

Query: 181 XXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGD 240
                               N  +E +  +LI +   F+E LR+G++PW+LQRLN+ +G 
Sbjct: 328 ELDI----------------NVEKEESIEDLIQVCNGFVEVLRSGSTPWVLQRLNNTFGP 371

Query: 241 MPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWF 292
            P DP+ FSYW+A V+P+++  K +LL + SVR RLKLIV WI   + QWWF
Sbjct: 372 TPTDPAQFSYWMAMVLPMSDQHKSQLLPITSVRLRLKLIVHWIHGFKTQWWF 423



>gi|407927683|gb|EKG20570.1| Zinc finger RING-type protein [Macrophomina phaseolina MS6]
          Length = 557

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 176/311 (56%), Gaps = 23/311 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R+LDH   CP+CR+ L    +    P N+ + + + +L P L + R   
Sbjct: 249 CGHTFCRKCMVRALDHTLHCPVCRRSLTIPPSLDGQPSNRCLVALLTSLCPELVAARAEA 308

Query: 62  LDSELFNTMQ-DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
           +  E     + +TP+FV   L FP MP FLH+FEP+YRLM+RR ++     FGM++   +
Sbjct: 309 VAQEERGAAELNTPLFVCT-LGFPAMPTFLHIFEPRYRLMVRRALEGNG-TFGMLMYNRS 366

Query: 121 T----------YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                      ++++GTML+I +A+ L DGRSL+ET GT +F+V   G  DGY VG VER
Sbjct: 367 GADQGNLGPVHFKEYGTMLQIVNAQMLPDGRSLIETRGTTRFRVRAHGPHDGYTVGNVER 426

Query: 171 VDDISPXX----------XXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIE 220
           ++D+S                          + + SN     I   +T E++ I  +FIE
Sbjct: 427 IEDVSLAEEERLEAEDLRAAQATREARIAEGLLDGSNAPEPTIDSLSTREMLLIGVNFIE 486

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL QR+   YG  PDDP+ F YW AS++PIAE EKY LL   SVRERLK++V
Sbjct: 487 RMRANSAPWLHQRILDAYGGPPDDPALFPYWFASILPIAEEEKYLLLPTTSVRERLKIVV 546

Query: 281 EWISSLRDQWW 291
            WI  +  Q W
Sbjct: 547 SWIRRIESQRW 557



>gi|426198563|gb|EKV48489.1| hypothetical protein AGABI2DRAFT_117313 [Agaricus bisporus var.
           bisporus H97]
          Length = 625

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/315 (43%), Positives = 180/315 (57%), Gaps = 30/315 (9%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+ ACP+CRQ L  +  +  HP NKT+ S I   +P LY ER  
Sbjct: 291 PCQHTFCAKCLHRSLDHSPACPLCRQDLPGFAYFQDHPTNKTLLSIILKTWPMLYRERGE 350

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA--- 117
            L +E  +   DTPIFV   L FP  P  LH FEP+YRLM+RRC++S+  +FGM++A   
Sbjct: 351 ALAAEERDARLDTPIFVCQ-LSFPGAPTLLHFFEPRYRLMLRRCLESQNPRFGMIMAPKP 409

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS- 175
              +   D+GTMLEIRS + L DGRS+VET GT++F++ E+G+ DG D    E +D  S 
Sbjct: 410 GAGSPQTDYGTMLEIRSVQMLPDGRSMVETWGTFRFRIFERGTLDGID-DYPEDLDASSF 468

Query: 176 -----PXXXXXXXXXXXXXXXIYNTSNPL--------------NNPIREYTTSELIGISR 216
                                    S+P               N+P  E    EL+   R
Sbjct: 469 LFPSNSIITSPETPSSSSSSSASTPSDPAHPPTPPSLPIPIHPNSPTNE----ELMTTCR 524

Query: 217 DFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERL 276
            F+  L+ G +PW++QRL+S YG MP DPS FS+WVA V+PI E EK KLL LRS R RL
Sbjct: 525 TFLHRLQRGTAPWVVQRLSSTYGTMPTDPSAFSFWVALVLPIDEHEKAKLLPLRSARLRL 584

Query: 277 KLIVEWISSLRDQWW 291
            L+V WI  L  QW+
Sbjct: 585 LLLVHWIEQLNSQWY 599



>gi|169610461|ref|XP_001798649.1| hypothetical protein SNOG_08329 [Phaeosphaeria nodorum SN15]
 gi|160702072|gb|EAT84605.2| hypothetical protein SNOG_08329 [Phaeosphaeria nodorum SN15]
          Length = 428

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 175/311 (56%), Gaps = 23/311 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C++R +DH++ CP CR+ LH   +  H P N  + S +  L P L + R   
Sbjct: 120 CGHTFCRRCLSRVMDHSNICPFCRRGLHVPASLQHQPGNAILNSLLNGLCPDLITARAEA 179

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
           L +E    + M   P+F+   L  P MP FLHVFEP+YRLM+RR ++   +QFGMV+   
Sbjct: 180 LKAEEQAGDNMFSMPLFICT-LSLPAMPTFLHVFEPRYRLMMRRVIEG-NKQFGMVMYNR 237

Query: 120 NT----------YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           ++          + ++GT+LEI + E L DGRS +E+ G  +FKV + G  DGY+VGRVE
Sbjct: 238 SSASQGNLGTAPFLEYGTLLEIVNYELLRDGRSFIESRGIGRFKVRDHGMLDGYNVGRVE 297

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           R++D+S                 Y          +  P +  I   +T +L+     F+ 
Sbjct: 298 RIEDVSLAEEGAAEQRETTMARDYAEVFFREHPQSPLPTDVAIEALSTQQLLDSCTSFVR 357

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL +R+  VYG+ P+DP+ F YW ASV+PI E EKY LL    VRERLK++ 
Sbjct: 358 EMREASAPWLRERIIQVYGEPPEDPALFPYWFASVVPIVEEEKYVLLRTTRVRERLKIVY 417

Query: 281 EWISSLRDQWW 291
            WI  +R Q W
Sbjct: 418 SWIGRIRGQRW 428



>gi|393246223|gb|EJD53732.1| hypothetical protein AURDEDRAFT_80317 [Auricularia delicata
           TFB-10046 SS5]
          Length = 420

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 176/309 (56%), Gaps = 14/309 (4%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RS DH+  CP+CR+PL   +  L    ++ I + +   +   Y++R+ 
Sbjct: 116 PCQHTFCADCLERSSDHHLGCPLCRKPLPVSSYLLGSWKHRLINAMVALAFSETYAQRKR 175

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLAC-- 118
            +++   +   + PIF  + L FP +P +LH+FEPKYRLMIRRC+ S + +FGM++    
Sbjct: 176 AIEASQHHYYYNKPIFRCS-LSFPGLPTYLHIFEPKYRLMIRRCICSPEPRFGMMMPSLA 234

Query: 119 --------SNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                    ++  D+GTML ++S +   DGRS+VET+G  +F+++E G  DGY VGRVER
Sbjct: 235 PAPSPGEPEHSAADYGTMLLVKSVQMFPDGRSMVETVGVSRFRLLEAGLHDGYHVGRVER 294

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWL 230
           +DD+                       P    I   ++ EL+   + F+  LR+  +PW+
Sbjct: 295 IDDVEDTDCRPAGEAAVDADLQLLKLAP---EIAAQSSEELMAQCQAFLRQLRHATAPWV 351

Query: 231 LQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQW 290
            Q+L+S +G  PDDP+ FS+W+A V+PI E EK +LL LRS R RL LI  WI  L    
Sbjct: 352 GQKLDSAHGPPPDDPASFSFWMAQVLPIHEREKARLLPLRSARARLGLIAAWIEQLSCNS 411

Query: 291 WFARGCSIS 299
             A GC I+
Sbjct: 412 EMATGCVIA 420



>gi|482805765|gb|EOA82851.1| hypothetical protein SETTUDRAFT_96302 [Setosphaeria turcica Et28A]
          Length = 558

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 172/311 (55%), Gaps = 23/311 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  + P N  + S +  L P L S R   
Sbjct: 250 CGHTFCRRCLARVMDHSSICPFCRRGLHVPASLQNQPSNAILNSLLNGLCPDLVSARADA 309

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           L +E    + + + P+F+   L  P MP FLHVFEP+YRLM+RR ++   RQFGMV+   
Sbjct: 310 LKAEEQAGDNVLNVPLFICT-LSLPSMPTFLHVFEPRYRLMMRRVIEG-NRQFGMVMYNR 367

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                    +  + ++GT+LEI + E L DGRS +ET G  +FKV   G  DGY+V RVE
Sbjct: 368 TRAPQGDLGAVPFLEYGTLLEIVNYELLRDGRSFIETRGIGRFKVRAHGMLDGYNVSRVE 427

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           R++D+S                 Y          T  P    I   +T +L+     F+ 
Sbjct: 428 RIEDVSLAEEAILEQRETTMARDYAEAFFRDHPQTQLPGEVAIETLSTQQLLDSCTAFVR 487

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL +R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 488 EMREASAPWLRERIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYVLLQTERVRERLKIVY 547

Query: 281 EWISSLRDQWW 291
            WI  +R Q W
Sbjct: 548 SWIGRIRGQRW 558



>gi|451847562|gb|EMD60869.1| hypothetical protein COCSADRAFT_236757 [Bipolaris sorokiniana
           ND90Pr]
          Length = 568

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 174/319 (54%), Gaps = 24/319 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  + P N  + S +  L P L   R   
Sbjct: 251 CGHTFCRRCLARVMDHSSICPFCRRGLHVPASLQNQPSNVILNSLLNGLCPDLVGARADA 310

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           L +E    + + + P+F+   L  P MP FLHVFEP+YRLM+RR ++   RQFGMV+   
Sbjct: 311 LKAEEQAGDNVLNVPLFICT-LSLPSMPTFLHVFEPRYRLMMRRVIEG-NRQFGMVMYNR 368

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                    S  + ++GT+LEI + E L DGRS +ET G  +FKV   G  DGY V R+E
Sbjct: 369 TRAPQGDLGSVPFLEYGTLLEIVNYELLRDGRSFIETRGVGRFKVRAHGMLDGYHVSRIE 428

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           RV+D+S                 Y          T  P    I   +T +L+     F+ 
Sbjct: 429 RVEDVSLAEEGILEQRETTMARDYAEAFFRDHPQTQLPTEVAIETLSTQQLLDSCTAFVR 488

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL +R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 489 EMREASAPWLRERIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYILLQTERVRERLKIVY 548

Query: 281 EWISSLRDQWWFA-RGCSI 298
            WI  +R Q W +   CSI
Sbjct: 549 SWIGRIRGQRWSSGNSCSI 567



>gi|189204358|ref|XP_001938514.1| hypothetical protein PTRG_08182 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187985613|gb|EDU51101.1| hypothetical protein PTRG_08182 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 567

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 175/319 (54%), Gaps = 24/319 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  + P N  + S +  L P L + R   
Sbjct: 250 CGHTFCRRCLARVMDHSSICPFCRRGLHVPASLQNQPSNVLLNSLLNGLCPDLVTARADA 309

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
           L +E    + + + P+F+   L  P MP FLHVFEP+YRLM+RR ++   RQFGMV+   
Sbjct: 310 LKAEEQAGDNVLNLPLFICT-LSLPAMPTFLHVFEPRYRLMMRRVIEG-NRQFGMVMYNR 367

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       + ++GT+LEI + E L DGRS +ET G  +FKV   G  DGY+V RVE
Sbjct: 368 THAPQGDLGVMPFLEYGTLLEIVNYELLRDGRSFIETRGIGRFKVRAHGMLDGYNVSRVE 427

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           RV+D+S                 Y          T  P    I   +T +L+     F+ 
Sbjct: 428 RVEDVSLAEEAALEQRETTMARDYAEAFFRDHPQTQLPTAVAIETLSTQQLLESCTAFVR 487

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL +R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 488 EMREASAPWLRERIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYVLLQTERVRERLKIVY 547

Query: 281 EWISSLRDQWWFA-RGCSI 298
            WI  +R Q W +   CSI
Sbjct: 548 SWIGRIRGQRWSSGSSCSI 566



>gi|330930933|ref|XP_003303199.1| hypothetical protein PTT_15329 [Pyrenophora teres f. teres 0-1]
 gi|311320930|gb|EFQ88706.1| hypothetical protein PTT_15329 [Pyrenophora teres f. teres 0-1]
          Length = 579

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 171/312 (54%), Gaps = 23/312 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  + P N  + S +  L P L + R   
Sbjct: 250 CGHTFCRRCLARVMDHSSICPFCRRGLHVPASLQNQPSNVLLNSLLNGLCPDLVTARADA 309

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
           L +E    + + + P+F+   L  P MP FLHVFEP+YRLM+RR ++   RQFGMV+   
Sbjct: 310 LKAEEQAGDNVLNLPLFICT-LSLPAMPTFLHVFEPRYRLMMRRVIEG-NRQFGMVMYNR 367

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       + ++GT+LEI + E L DGRS +ET G  +FKV   G  DGY+V RVE
Sbjct: 368 THAPQGELGVMPFLEYGTLLEIVNYELLRDGRSFIETRGIGRFKVRAHGMLDGYNVSRVE 427

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           R++D+S                 Y          T  P    I   +T +L+     F+ 
Sbjct: 428 RIEDVSLAEEAALEQRETTMARDYAEAFFRDHPQTQLPTAVAIETLSTQQLLESCTAFVR 487

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL  R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 488 EMREASAPWLRDRIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYVLLQTERVRERLKIVY 547

Query: 281 EWISSLRDQWWF 292
            WI  +R Q W+
Sbjct: 548 SWIGRIRGQRWY 559



>gi|451996630|gb|EMD89096.1| hypothetical protein COCHEDRAFT_1157926 [Bipolaris maydis C5]
 gi|477588104|gb|ENI05184.1| hypothetical protein COCC4DRAFT_61016 [Bipolaris maydis ATCC 48331]
          Length = 568

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 173/319 (54%), Gaps = 24/319 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  +   N  + S +  L P L   R   
Sbjct: 251 CGHTFCRRCLARVMDHSSICPFCRRGLHVPASLQNQSSNVILNSLLNGLCPDLVGARADA 310

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           L +E    + + + P+F+   L  P MP FLHVFEP+YRLM+RR ++   RQFGMV+   
Sbjct: 311 LKAEEQAGDNVLNVPLFICT-LSLPSMPTFLHVFEPRYRLMMRRVIEG-NRQFGMVMYNR 368

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                    S  + ++GT+LEI + E L DGRS +ET G  +FKV   G  DGY V R+E
Sbjct: 369 TRAPQGDLGSVPFLEYGTLLEIVNYELLRDGRSFIETRGVGRFKVRAHGMLDGYHVSRIE 428

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY---------NTSNPLNNPIREYTTSELIGISRDFIE 220
           RV+D+S                 Y          T  P    I   +T +L+     F+ 
Sbjct: 429 RVEDVSLAEEAILEQRETTMARDYAEAFFRDHPQTQLPTEVAIETLSTQQLLDSCTAFVR 488

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL +R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 489 EMREASAPWLRERIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYILLQTERVRERLKIVY 548

Query: 281 EWISSLRDQWWFA-RGCSI 298
            WI  +R Q W +   CSI
Sbjct: 549 SWIGRIRGQRWSSGNSCSI 567



>gi|396490955|ref|XP_003843457.1| similar to ATP-dependent protease (CrgA) [Leptosphaeria maculans
           JN3]
 gi|312220036|emb|CBX99978.1| similar to ATP-dependent protease (CrgA) [Leptosphaeria maculans
           JN3]
          Length = 566

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 174/319 (54%), Gaps = 24/319 (7%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R +DH+S CP CR+ LH   +  +   NK + S +  L P L + R   
Sbjct: 249 CGHTFCRRCLGRVMDHSSICPFCRRGLHVPASLQNQSSNKILNSLLNGLCPDLVTARAAA 308

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           L +E    +   + P+F+   L  P MP FLHVFEP+YRLM+RR ++   +QFGMV+   
Sbjct: 309 LKAEEQAGDDTYNVPLFICT-LSLPSMPTFLHVFEPRYRLMMRRVIEG-NKQFGMVMYNR 366

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       + ++GT+LEI + E L DGRS +ET G  +FKV E    DGY V R+E
Sbjct: 367 THAPQGDLGPTQFLEYGTLLEIVNYELLRDGRSFIETRGIGRFKVKEHAMHDGYHVSRIE 426

Query: 170 RVDDISPXXXXXXXXXXXXXXXIY-------NTSNPLNN--PIREYTTSELIGISRDFIE 220
           RV+D+S                 Y       +   PL N   I   +T +L+     F+ 
Sbjct: 427 RVEDVSLAEEGMLEQRETTMARDYAEIFMREHPQMPLPNEIAIETLSTQQLLDSCTAFVR 486

Query: 221 TLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
            +R  ++PWL  R+  VYG+ P+DP+ F YW ASV+PI E EKY LL+   VRERLK++ 
Sbjct: 487 EMREASAPWLRDRIIQVYGEPPEDPAIFPYWFASVVPIVEEEKYVLLQTERVRERLKIVY 546

Query: 281 EWISSLRDQWWFA-RGCSI 298
            WI  +R Q W +   CSI
Sbjct: 547 SWIGRIRGQRWSSGSACSI 565



>gi|310798415|gb|EFQ33308.1| ATP-dependent protease La domain-containing protein [Glomerella
           graminicola M1.001]
          Length = 551

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 176/316 (55%), Gaps = 29/316 (9%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+S CPICR+ L + +  L+    P N+ + + I   +      R
Sbjct: 239 CGHTFCRSCLHRVLDHSSYCPICRRGL-SVSPLLYRESCPSNEYLKTIIETFWADAVLTR 297

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
              L +E  N  +  D PIFV   L FP MP FLHVFEP+YRLMIRR ++   R FGMVL
Sbjct: 298 GDALAAEALNRHREFDIPIFVCT-LSFPMMPTFLHVFEPRYRLMIRRALEG-DRTFGMVL 355

Query: 117 ------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                 A    + ++GT+L I +AE+ ADGRSL+ET+G  +F++   G  DGY VG++ER
Sbjct: 356 PQRPRTANDTHFVEYGTLLRIVNAEYFADGRSLIETVGVSRFRITRHGILDGYLVGKIER 415

Query: 171 VDDISPXXXXXXXX------------XXXXXXXIYNTSNP---LNNPIREYTTSELIGIS 215
           +DDIS                               TS P    +  + +  TSEL+   
Sbjct: 416 LDDISIAEEEDLEANETQHALERFDSAATHQSEDSTTSGPPMTTSEDLAKMPTSELLSFG 475

Query: 216 RDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRER 275
             F+E +R  + PWL QR+ ++YG+ P+DP+ F +W AS++P  E EKYKLLE RSVRER
Sbjct: 476 VSFVERMRQQSVPWLAQRMLTIYGECPNDPALFPWWFASILPAKEYEKYKLLETRSVRER 535

Query: 276 LKLIVEWISSLRDQWW 291
           LK+   WI       W
Sbjct: 536 LKICCGWILEWESSSW 551



>gi|121715472|ref|XP_001275345.1| ATP-dependent protease (CrgA), putative [Aspergillus clavatus NRRL
           1]
 gi|119403502|gb|EAW13919.1| ATP-dependent protease (CrgA), putative [Aspergillus clavatus NRRL
           1]
          Length = 546

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 172/305 (56%), Gaps = 16/305 (5%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLH-HPINKTIYSFIRALYPSLYSERR 59
           PCGH+FC+ C+   LDH+  CPICR+ L N +  +H  P N+ I      L+P   + ++
Sbjct: 234 PCGHTFCRGCVATVLDHSDLCPICRRKL-NMSLTVHLEPTNRRIVGLAELLFPEQVAAQK 292

Query: 60  YLL--DSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
             L  +   F+     P+FV N+L FP MP FLH+FEP+YRLM+RR M+S  R+FGM++ 
Sbjct: 293 QSLGQNQAEFDAETVLPLFV-NSLAFPTMPTFLHIFEPRYRLMMRRVMESPDRKFGMLMY 351

Query: 117 ---------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
                         +  +GT+L I   E L DGRSLV   G  +FKV +    DGY VG+
Sbjct: 352 NRSGVRQGSLGDAQFLQYGTVLRIERFELLPDGRSLVFANGVSRFKVAKFDIVDGYHVGQ 411

Query: 168 VERVDDISPXXXXXXXXXXXXXXXIYNTSNPL-NNPIREYTTSELIGISRDFIETLRNGN 226
           ++RVDD+                   +T + L N P+   +T EL  +  DF+   R+  
Sbjct: 412 IQRVDDVPLAEEERLESLETLTVSDTSTESTLANQPLESMSTQELFQLGLDFVRKRRSEG 471

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+ + YGD+P DP++FS+W+ASV P++E EKY L+   SVRERLK+  +W+   
Sbjct: 472 ARWLQPRVLTAYGDIPTDPANFSWWLASVFPVSEEEKYALILATSVRERLKITAQWVRKA 531

Query: 287 RDQWW 291
            ++ W
Sbjct: 532 ENREW 536



>gi|380486553|emb|CCF38627.1| ATP-dependent protease La domain-containing protein [Colletotrichum
           higginsianum]
          Length = 549

 Score =  222 bits (566), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 127/314 (40%), Positives = 175/314 (55%), Gaps = 27/314 (8%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+S CPICR+ L + +  L+    P N+ + + I+  +      R
Sbjct: 239 CGHTFCRSCLHRVLDHSSYCPICRRGL-SVSPLLYRESCPSNEHLKTIIQTFWADAVLTR 297

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
              L +E  N  +  D PIFV   L FP MP FLHVFEP+YRLMIRR ++   R FGMVL
Sbjct: 298 GDALAAEALNRHREFDIPIFVCT-LSFPMMPTFLHVFEPRYRLMIRRALEG-DRTFGMVL 355

Query: 117 ------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                 A    + ++GT+L I +AE+ ADGRSL+ETIG  +F++   G  DGY VG +ER
Sbjct: 356 PQRPRTANDTHFVEYGTLLRIVNAEYFADGRSLIETIGISRFRITRNGILDGYLVGSIER 415

Query: 171 VDDIS------------PXXXXXXXXXXXXXXXIYNTSNPLN-NPIREYTTSELIGISRD 217
           +DDIS                               TS P     + +  TSEL+ +   
Sbjct: 416 IDDISIAEEEDLEATETQQALERYESAATHMSEDSTTSRPTTPEDLSKMPTSELLSLGVS 475

Query: 218 FIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLK 277
           F+  ++  + PWL QR+ ++YG+ P+DP+ F +W AS++P  E EKYKLLE RSVRERLK
Sbjct: 476 FVTRMQQQSVPWLAQRMLTIYGECPNDPALFPWWFASILPAKEYEKYKLLETRSVRERLK 535

Query: 278 LIVEWISSLRDQWW 291
           +   WI       W
Sbjct: 536 ICCGWILEWESSTW 549



>gi|115384684|ref|XP_001208889.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114196581|gb|EAU38281.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 614

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 161/296 (54%), Gaps = 13/296 (4%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+   L H+  CP+CR+ L+  +     P+N+ I + I AL+P   + RR  
Sbjct: 218 CGHTFCQRCVAMVLGHSDLCPVCRRKLNMSSTLQSEPVNQRIAALIEALFPEQVAARRET 277

Query: 62  LDSELFNTMQDT-PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL---- 116
              E  N  + T P+FV++ L  P MP FLH+FEP+YRLMIRR MQSR R+FGMV+    
Sbjct: 278 SALEESNPNETTLPLFVSS-LSLPTMPTFLHIFEPRYRLMIRRVMQSRGRRFGMVMYNRA 336

Query: 117 ------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                    + +  +GT+L +   E L DGRSLV   G  +FKV+     DGY VGR++R
Sbjct: 337 GRLQEGLGRSQFLQYGTVLVVDRYELLPDGRSLVVATGVSRFKVLGSVVVDGYQVGRIQR 396

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWL 230
           VDDIS                + +       P+   +T EL  +  DF+       + WL
Sbjct: 397 VDDISITEEEAREALETSATAV-DVEGSAERPLESMSTQELFQLGLDFVRRQHGQGAVWL 455

Query: 231 LQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
             R    YGD+P DP+ F +W AS++P+ E EKY LL   SVRERLK+   WI  L
Sbjct: 456 RPRALLAYGDIPTDPARFPWWFASILPVWEEEKYALLSATSVRERLKITARWIRKL 511



>gi|429863466|gb|ELA37917.1| ATP-dependent protease [Colletotrichum gloeosporioides Nara gc5]
          Length = 552

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 176/316 (55%), Gaps = 29/316 (9%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+S CPICR+ L + +  L+    P N+ + + I+  +      R
Sbjct: 240 CGHTFCRSCLHRVLDHSSYCPICRRGL-SVSPLLYRESCPSNEHLKTIIQTFWADAVLTR 298

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
              L +E  N  +  D PIFV   L FP MP FLHVFEP+YRLMIRR ++   R FGMVL
Sbjct: 299 GDALAAEALNRHREFDIPIFVCT-LSFPMMPTFLHVFEPRYRLMIRRALEG-DRTFGMVL 356

Query: 117 ------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                 A    +++ GT+L I +AE+ ADGRSL+ET G  +F++   G  DGY VG++ER
Sbjct: 357 PQRPRTANDTHFKEQGTLLRIVNAEYFADGRSLIETTGISRFRITRHGILDGYLVGKIER 416

Query: 171 VDDIS-PXXXXXXXXXXXXXXXIYNTSNPLNNP--------------IREYTTSELIGIS 215
           +DDIS                  Y ++N   +               + +  TSEL+   
Sbjct: 417 IDDISIAEEEDLEAGETQLALERYESANTHQSEDSTTTPTVTTTPEDLSKMPTSELLSFG 476

Query: 216 RDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRER 275
             F+E +R  + PWL QR+ ++YG+ P+DP+ F +W AS++P  E EKYKLL  RSVRER
Sbjct: 477 VSFVERMRQQSVPWLAQRMLAIYGECPNDPALFPWWFASILPAKEYEKYKLLGTRSVRER 536

Query: 276 LKLIVEWISSLRDQWW 291
           LK+   W+       W
Sbjct: 537 LKICCGWVLEWESSRW 552



>gi|494828486|gb|EON65298.1| hypothetical protein W97_04536 [Coniosporium apollinis CBS 100218]
          Length = 476

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 174/316 (55%), Gaps = 28/316 (8%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R LDH+S CP+CR+ L    +    P N  + + +  L P L + R   
Sbjct: 119 CGHTFCRICLARVLDHSSHCPVCRRTLPIPPSLNRQPSNARLVALLNGLCPELVAARAEA 178

Query: 62  LDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           +  E   T+   D P+FV   L FP MP FLH+FEP+YRLMIRR ++    QFGM++   
Sbjct: 179 VALEERGTVGELDCPLFVCT-LSFPAMPTFLHIFEPRYRLMIRRALEGNG-QFGMLVYNR 236

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                     + + ++GTML+I + + L DGRSL+ET G  +FKV   G  DGY VGRVE
Sbjct: 237 AQTPQGDLGVSRFMEYGTMLQILNVQMLPDGRSLIETRGVSRFKVKAYGQVDGYTVGRVE 296

Query: 170 RVDDISPXXXXXXXXXXXXXXXI---YNTSNPLNNP----------IREYTTSELIGISR 216
           RV+DIS                +   + T  P              +   +T +L+ I  
Sbjct: 297 RVEDISLAEEERMESEEIGASDVGPLFGTPPPSPQAPDTLEAHMLRVDRLSTRQLLMIGV 356

Query: 217 DFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERL 276
            F+E +R  ++PWL + +   +G  PDDP+ F YW AS++PIAE EKY LL+  SVR+RL
Sbjct: 357 TFVEKMRAHSAPWLSRGILDAFGGPPDDPALFPYWFASILPIAEEEKYLLLKTTSVRQRL 416

Query: 277 KLIVEWISSLRDQ-WW 291
           K++V WI  +  Q WW
Sbjct: 417 KIVVGWIRRIEGQRWW 432



>gi|378734090|gb|EHY60549.1| hypothetical protein, variant [Exophiala dermatitidis NIH/UT8656]
          Length = 539

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 162/301 (53%), Gaps = 13/301 (4%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C  R++DH+S CP CR+ L    A L    NK +    R L P   + R+ +
Sbjct: 228 CGHTFCRKCFGRAMDHSSYCPTCRRRLPRLPATLSMASNKLLNDLSRILLPDQLAARQAI 287

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSNT 121
            D E     Q+        L FP+M  FLH+FEP+YRLM+RR M S  R+FGM++    +
Sbjct: 288 HDEEERIDEQNRLPLFPCTLAFPQMLTFLHIFEPRYRLMVRRVMDSGSRKFGMLVPRGQS 347

Query: 122 Y-----------QDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
           +             FGT+L I   E L DGRSL+ET G YKF+V+E    DGY VG+V+R
Sbjct: 348 FSVPDGTGTPRFHPFGTVLYIERMELLPDGRSLIETRGLYKFRVLETDVYDGYLVGKVQR 407

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWL 230
           VDDI                 +   S      I+  +T  L+     F+E  R+ ++ WL
Sbjct: 408 VDDIHIREEEMKEAEETSREAVPGESE--AGRIQRMSTQALLEYGLAFVERARSRSARWL 465

Query: 231 LQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQW 290
            QR+ + YG+   DP+ F YW ASV+PIAEGEKY+LL   SVRERLK+   W+  L    
Sbjct: 466 HQRVLAAYGEPSTDPAVFPYWFASVLPIAEGEKYQLLPATSVRERLKITALWVERLERTR 525

Query: 291 W 291
           W
Sbjct: 526 W 526



>gi|255950408|ref|XP_002565971.1| Pc22g20710 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592988|emb|CAP99359.1| Pc22g20710 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 692

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 169/314 (53%), Gaps = 27/314 (8%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERR- 59
           PCGH+FC+ C+ R LDH   CPICR+ L   N     P+N+T+   +  L+P   S RR 
Sbjct: 283 PCGHTFCRKCVARVLDHTDLCPICRRKLGMPNDLQSQPVNQTVTRLVDYLFPDQISLRRE 342

Query: 60  -YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL-- 116
               D       ++ P+FV   L FP MP FLHVFEP+YRLMIRR + S   +FGMV+  
Sbjct: 343 TSAQDETGPGYEKNLPLFVCT-LSFPTMPTFLHVFEPRYRLMIRRVLASGNGKFGMVMHN 401

Query: 117 ----ACSNTYQD-----FGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
               A     +D     +GT+L I   E L DGRSLV   G  +F++++ G +DGY V R
Sbjct: 402 RQRRALPGQREDVPFVQYGTLLMIERYELLPDGRSLVVATGVSRFRILDSGMRDGYFVAR 461

Query: 168 VERVDDISPXXXXXXXXXXXXXXXI-----YNTSNPLNNPIREYTTSELIGISRDFIETL 222
            ERVDD+S                +      N S+P   P+   +T +L+ ++R+FI   
Sbjct: 462 TERVDDVSLAEEERLESMETSTDGVNALPEENESDP---PLDSMSTQQLLLLAREFISNQ 518

Query: 223 RNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEW 282
           R   +PWL  R+   YG +P D + F +W AS++PI+E EKY +L   SVRERLK+  +W
Sbjct: 519 RISGAPWLHPRVMLAYGPIPTDAALFPWWFASILPISEEEKYPILAATSVRERLKISAKW 578

Query: 283 ISSLRDQWWFARGC 296
              L      AR C
Sbjct: 579 ARQLE-----ARDC 587



>gi|477529398|gb|ENH81162.1| ATP-dependent protease [Colletotrichum orbiculare MAFF 240422]
          Length = 551

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 172/316 (54%), Gaps = 29/316 (9%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+S CPICR+ L + +  L+    P N  + + I+  +      R
Sbjct: 239 CGHTFCRSCLHRVLDHSSYCPICRRAL-SVSPLLYQESCPSNNHLKTIIQTFWADAVLTR 297

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
              L +E  N  +  D PIFV   L FP MP FLHVFEP+YRLMIRR ++   R FGMVL
Sbjct: 298 GDALAAEALNRHREFDIPIFVCT-LSFPMMPTFLHVFEPRYRLMIRRALEG-DRTFGMVL 355

Query: 117 A------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                      +++ GT+L I +AE+ ADGRSL+ET G  +F++   G  DGY VG++ER
Sbjct: 356 PQRPRTPNDAHFKEHGTLLRIVNAEYFADGRSLIETTGISRFRITRHGILDGYLVGKIER 415

Query: 171 VDDIS---------PXXXXXXXXXXXXXXXIYNTSNPLNNPIREYT------TSELIGIS 215
           +DDIS                           + S P   P+          TSEL+ + 
Sbjct: 416 LDDISIAEEEDLEAAETQQALERYESAETHQSDDSAPARPPLTTVEDLSAMPTSELLALG 475

Query: 216 RDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRER 275
             F+E +R  + PWL QR+ ++YG+ P+DP+ F +W AS++P  E EKY LL  RSVRER
Sbjct: 476 VSFVERMRQQSVPWLAQRMLAIYGECPNDPALFPWWFASILPAKEFEKYNLLGTRSVRER 535

Query: 276 LKLIVEWISSLRDQWW 291
           LK+   WI       W
Sbjct: 536 LKICCGWILEWESSRW 551



>gi|317027643|ref|XP_001399743.2| ATP-dependent protease (CrgA) [Aspergillus niger CBS 513.88]
          Length = 559

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 168/308 (54%), Gaps = 16/308 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+   L+H+  CP+CR+ L+  +     P N+ I + + AL+P   + RR  
Sbjct: 244 CGHTFCRGCVAMVLNHSDLCPLCRRKLNMASTVRAEPANRRISNLVEALFPEQVASRREG 303

Query: 62  LDSE-----LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             +E       +  +  P+FV++ L FP MP FLH+FEP+YR MI R MQ+R ++FGMV+
Sbjct: 304 SSNEDGVAATGDGERTIPLFVSS-LSFPTMPTFLHIFEPRYRTMIHRVMQTRDKKFGMVM 362

Query: 117 ----------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                          +  +GT+L +   E L DGRSLV   G  +FKVI     DGY VG
Sbjct: 363 YNRSGRLQEGLGRAQFMQYGTVLVVERFELLPDGRSLVIASGVSRFKVISFEMVDGYHVG 422

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           R++RVDDI+                   + +P ++P+    T +L  I+ DFI+  R   
Sbjct: 423 RIQRVDDIAISEEERLESLETSSSETEESLSPASSPLESLPTQQLFQIALDFIDKSRREG 482

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+   YG+ P DP+ F +W A V+P+ E EKY+LL   SVR+RLK +V W+   
Sbjct: 483 AAWLHPRVLLAYGEAPTDPAVFPWWFACVLPLWEDEKYQLLATTSVRDRLKKVVRWVRKS 542

Query: 287 RDQWWFAR 294
             + W AR
Sbjct: 543 ESREWLAR 550



>gi|440636673|gb|ELR06592.1| hypothetical protein GMDG_08065 [Geomyces destructans 20631-21]
          Length = 562

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 116/300 (38%), Positives = 171/300 (57%), Gaps = 20/300 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQ--PLHNYNAYLHHPINKTIYSFIRALYPSLYSERR 59
           CGH+FC+ C+ R LDH+S CPICR+   L +  +   +P N  + S +  L+PSL + RR
Sbjct: 247 CGHTFCRKCLQRVLDHSSYCPICRRLLDLSHTISPTQYPSNARLASLLAGLWPSLLTARR 306

Query: 60  YLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
            L  +E   +  D   P+F+   + FP MP FLHVFEP+YRLM+RR + S  R+FGM+L 
Sbjct: 307 ALFATEESPSPPDLNLPLFICT-ISFPTMPTFLHVFEPRYRLMMRRVLDS-DRRFGMLLH 364

Query: 117 ----------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                     A +  + ++GT+L I SA+ L DGRSL+ET+G   F+V+  G +DGY VG
Sbjct: 365 NPEQIPQPGLATTPLFFEYGTLLHIVSAQLLPDGRSLIETVGISLFRVLRHGVRDGYLVG 424

Query: 167 RVERVDDI---SPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLR 223
            VERV+D+                        ++   NP    +T +L+ +   F+  +R
Sbjct: 425 SVERVEDLPLADEEALEIADTAITVDADADAGADVDANPFAALSTQDLMALCTAFVRRMR 484

Query: 224 NGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWI 283
             ++PW+  R   VYG+ P  P+ F +W ASV+P+ E +KY LL+  SVRERLK+   W+
Sbjct: 485 AASAPWMDARTLRVYGECPTSPAQFPWWFASVLPLPERDKYALLQTTSVRERLKICAAWV 544



>gi|378734091|gb|EHY60550.1| hypothetical protein HMPREF1120_08505 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 548

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 161/296 (54%), Gaps = 13/296 (4%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C  R++DH+S CP CR+ L    A L    NK +    R L P   + R+ +
Sbjct: 228 CGHTFCRKCFGRAMDHSSYCPTCRRRLPRLPATLSMASNKLLNDLSRILLPDQLAARQAI 287

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSNT 121
            D E     Q+        L FP+M  FLH+FEP+YRLM+RR M S  R+FGM++    +
Sbjct: 288 HDEEERIDEQNRLPLFPCTLAFPQMLTFLHIFEPRYRLMVRRVMDSGSRKFGMLVPRGQS 347

Query: 122 Y-----------QDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
           +             FGT+L I   E L DGRSL+ET G YKF+V+E    DGY VG+V+R
Sbjct: 348 FSVPDGTGTPRFHPFGTVLYIERMELLPDGRSLIETRGLYKFRVLETDVYDGYLVGKVQR 407

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWL 230
           VDDI                 +   S      I+  +T  L+     F+E  R+ ++ WL
Sbjct: 408 VDDIHIREEEMKEAEETSREAVPGESE--AGRIQRMSTQALLEYGLAFVERARSRSARWL 465

Query: 231 LQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
            QR+ + YG+   DP+ F YW ASV+PIAEGEKY+LL   SVRERLK+   W+  L
Sbjct: 466 HQRVLAAYGEPSTDPAVFPYWFASVLPIAEGEKYQLLPATSVRERLKITALWVERL 521



>gi|119480997|ref|XP_001260527.1| ATP-dependent protease (CrgA), putative [Neosartorya fischeri NRRL
           181]
 gi|119408681|gb|EAW18630.1| ATP-dependent protease (CrgA), putative [Neosartorya fischeri NRRL
           181]
          Length = 543

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 168/309 (54%), Gaps = 14/309 (4%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC+ C+   LDH+  CPICR+ L+  +     P+NK I    +  +P   + +R 
Sbjct: 235 PCGHTFCRGCVATVLDHSDLCPICRRKLNMSSTINSEPVNKRISDITQLFFPDQIASQRQ 294

Query: 61  LLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL-- 116
            L  E  ++   T  P+FV N+L FP MP FL +FEP+Y LMIRR M+SR+R+FGMV+  
Sbjct: 295 SLAEEQSDSDAGTILPLFV-NSLSFPTMPTFLRIFEPRYCLMIRRVMESRERKFGMVMYN 353

Query: 117 --------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                     ++ +  +G +L +   E L  GRSL+   G  +FKVI+    DGY VG++
Sbjct: 354 RLGRPQGQLGASQFMQYGVVLRVERFEPLPGGRSLIFANGVSRFKVIKSHIVDGYHVGQI 413

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNT-SNPLNNPIREYTTSELIGISRDFIETLRNGNS 227
           +RVDDI                   +T + P   P+   +T EL  ++ DF+   R   +
Sbjct: 414 QRVDDIPIAEEENLESWETSTISHRSTEARPSQQPLDSMSTQELFQMALDFVRKRRGEGA 473

Query: 228 PWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
            WL  R+   YGD+P DP+ F +W+A V P++E EKY LL   SVR+RLK+  +W     
Sbjct: 474 RWLHPRVLMAYGDIPSDPAQFPWWLACVFPVSEEEKYALLSATSVRKRLKITAQWARRAE 533

Query: 288 DQWWFARGC 296
            + W+   C
Sbjct: 534 AREWYVLKC 542



>gi|317157063|ref|XP_003190799.1| ATP-dependent protease (CrgA) [Aspergillus oryzae RIB40]
          Length = 547

 Score =  216 bits (550), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 163/305 (53%), Gaps = 18/305 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+  +LDH+  CP CR+ L+  +     P NK I   I  LYP   + RR  
Sbjct: 240 CGHTFCRRCVAMALDHSDLCPACRRKLNMASTVKSEPTNKRISDIIETLYPEQVALRRDT 299

Query: 62  LDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
              E+     +   P+FV+ +L  P MP FLHVFE +YRLM++R MQSR R+FGMV+   
Sbjct: 300 SAQEVTALDDEAILPLFVS-SLSLPTMPTFLHVFEARYRLMMQRVMQSRGRRFGMVMFNR 358

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                     + +  +GT L +   E L DGRSLV   G Y+FKV+     D Y VG+++
Sbjct: 359 AGRFQQGLGRSQFMQYGTALVVDRYELLPDGRSLVVATGLYRFKVLSSYMLDMYYVGKIQ 418

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           RVDDIS                + + S     P+   +T +L  +  DF+       +PW
Sbjct: 419 RVDDIS---VIEEENREALETSVADASG--EQPLESMSTQQLFQLGLDFVRKQHRQAAPW 473

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQ 289
           L  R+   YGD+P +PS F +W ASV+P+ E EKY LL   SVRERLK+   W+  L  +
Sbjct: 474 LHPRVLLAYGDIPTEPSHFPWWFASVLPVWEEEKYTLLSTTSVRERLKITARWVRKLESR 533

Query: 290 WWFAR 294
            W AR
Sbjct: 534 EWTAR 538



>gi|452977192|gb|EME76965.1| hypothetical protein MYCFIDRAFT_212760 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 315

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 169/301 (56%), Gaps = 18/301 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+ C+ C+ R LDH+  CP+CR+ L    A    P NKT+ S +  L P + S R   
Sbjct: 9   CGHTLCRECMARVLDHSLHCPVCRRDLALPPALFRQPSNKTLVSLLNGLCPEMISSRAEA 68

Query: 62  LDSELFNT--MQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV---- 115
           + +E   +  + + P+FV  AL FP  P FL +FEP+YRLM+RR ++   RQFGM+    
Sbjct: 69  VAAEERGSRGLSNVPLFVC-ALGFPHQPTFLRIFEPRYRLMLRRALEG-NRQFGMLMYNR 126

Query: 116 -------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                  L   + YQ +GTML I  A+ LADG SL+ET G Y+F+V   GS DGY VG +
Sbjct: 127 YGEPQGDLGTVHFYQ-YGTMLHIVHAQLLADGTSLIETRGLYRFRVKSHGSLDGYTVGDI 185

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSP 228
           ER+DD+S                  +    +   +   +T EL  + + FI  ++  ++ 
Sbjct: 186 ERLDDVSLVEEERIEAEETSLPPAQD--GDIAGQVTRMSTQELHMLGQTFITRMQGRSAN 243

Query: 229 WLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRD 288
           WL QR+  ++G  P+D + F YW ASV+PI+E EKYKLL  R+VRERLK+   WI  +  
Sbjct: 244 WLQQRVLDIHGQPPEDAALFPYWFASVLPISEEEKYKLLGTRTVRERLKITATWIRRMET 303

Query: 289 Q 289
           Q
Sbjct: 304 Q 304



>gi|238493275|ref|XP_002377874.1| ATP-dependent protease (CrgA), putative [Aspergillus flavus
           NRRL3357]
 gi|220696368|gb|EED52710.1| ATP-dependent protease (CrgA), putative [Aspergillus flavus
           NRRL3357]
          Length = 547

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 163/305 (53%), Gaps = 18/305 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+  +LDH+  CP CR+ L+  +     P NK I   I  LYP   + RR  
Sbjct: 240 CGHTFCRRCVAMALDHSDLCPACRRKLNMASTVKSEPTNKRISDIIETLYPEQVALRRDT 299

Query: 62  LDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
              E+     +   P+FV+ +L  P MP FLHVFE +YRLM++R MQSR R+FGMV+   
Sbjct: 300 SAQEVTALDDEAILPLFVS-SLSLPTMPTFLHVFEARYRLMMQRVMQSRGRRFGMVMFNR 358

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                     + +  +GT L +   E L DGRSLV   G Y+FKV+     D Y VG+++
Sbjct: 359 AGRFQQGLGRSQFMQYGTALVVDRYELLPDGRSLVVATGLYRFKVLSSYMLDMYYVGKIQ 418

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           RVDDIS                + + S     P+   +T +L  +  DF+       +PW
Sbjct: 419 RVDDIS---VIEEENREALETSVADASG--EQPLESMSTQQLFQLGLDFVRKQHRQAAPW 473

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQ 289
           L  R+   YGD+P +PS F +W ASV+P+ E EKY LL   SVRERLK+   W+  L  +
Sbjct: 474 LHPRVLLAYGDIPTEPSHFPWWFASVLPVWEEEKYTLLSTTSVRERLKITARWVRKLESR 533

Query: 290 WWFAR 294
            W AR
Sbjct: 534 EWTAR 538



>gi|408394345|gb|EKJ73553.1| hypothetical protein FPSE_06171 [Fusarium pseudograminearum CS3096]
          Length = 601

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 176/331 (53%), Gaps = 44/331 (13%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHN---YNAYLHHPINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+  CPICR+PL      N  L  P N+TI   I   +    + R
Sbjct: 264 CGHTFCRSCLHRILDHSRYCPICRRPLAISPLLNQILSPP-NQTIKRIIETFWLEEVNAR 322

Query: 59  RYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
           +  LD+E    MQD  T +F+   L FP MP FLH+FEP+YRLMIRR M+   R FGMV+
Sbjct: 323 KEALDAERTAQMQDHDTSLFICT-LSFPHMPTFLHIFEPRYRLMIRRAMEEGHRTFGMVI 381

Query: 117 A------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                    + + + GT+L I + +F +DGRSL+ET+G  +F+V+E    DGY VG+ ER
Sbjct: 382 PKRRQFPGDSDFHELGTLLRIVNVQFYSDGRSLIETVGLSRFRVLEHDFLDGYMVGKTER 441

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYT----------------------- 207
           VDD+S                + +   P+    +E T                       
Sbjct: 442 VDDVSLEDEEAAEAAEASPIELESNQAPMLEGDKESTEPTSPLPRSSSSSPHMPTSVADI 501

Query: 208 ----TSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEK 263
               T  L+  +  F+  +R  + PWL +R+ ++YG+ P+DP+ F +W AS++P+ + EK
Sbjct: 502 DIMSTQSLMHFASSFVARMRQQSVPWLAERMLTIYGECPEDPAIFPWWFASILPVKDIEK 561

Query: 264 YKLLELRSVRERLKLIVEWISSLRDQWWFAR 294
           Y+LL   SVRERLK+   WI     +W  AR
Sbjct: 562 YRLLGTSSVRERLKICCIWIV----EWQMAR 588



>gi|452839866|gb|EME41805.1| hypothetical protein DOTSEDRAFT_46704 [Dothistroma septosporum
           NZE10]
          Length = 516

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/303 (38%), Positives = 170/303 (56%), Gaps = 18/303 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY- 60
           CGH+ C+ C+ R LDH+  CP+CR+ L    + +  P NKT+   +  L P + + R   
Sbjct: 219 CGHTLCRKCLARVLDHSLHCPVCRRGLAIPPSLMKQPSNKTLVKLLDGLCPEVVAARAQA 278

Query: 61  -LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV---- 115
            LL+    +   + P+FV   L FP  P FL +FEP+YRLM+RR ++S  RQFG++    
Sbjct: 279 SLLEEHGADGNANVPLFVCT-LGFPNQPTFLRIFEPRYRLMLRRALES-NRQFGLLMYNR 336

Query: 116 -------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                  L   + YQ +GTMLEI  A+ LADG SL+ET G ++F+V      DGY VG V
Sbjct: 337 YGEPQGDLGTIHFYQ-YGTMLEIVQAQLLADGTSLIETRGLFRFRVKSHDVLDGYTVGTV 395

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSP 228
           ER+DD +                       +   I   +T EL+ ++++F+E ++  ++ 
Sbjct: 396 ERLDDYN--LAEEERIEAEETSLPVEEDEDIAAQINHMSTQELLHVAQEFVERMQARSAN 453

Query: 229 WLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRD 288
           WL QR+  ++G  PDD + F YW ASV+PI+E EKYKLL  R+VRERLK+   WI  +  
Sbjct: 454 WLQQRVLDIHGQPPDDAALFPYWFASVLPISEEEKYKLLGTRTVRERLKITTVWIRRIES 513

Query: 289 QWW 291
           Q W
Sbjct: 514 QRW 516



>gi|398406647|ref|XP_003854789.1| hypothetical protein MYCGRDRAFT_35590 [Zymoseptoria tritici IPO323]
 gi|339474673|gb|EGP89765.1| hypothetical protein MYCGRDRAFT_35590 [Zymoseptoria tritici IPO323]
          Length = 517

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 115/303 (37%), Positives = 169/303 (55%), Gaps = 18/303 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERR-- 59
           CGH+ C+ C+ R  DH+  CP+CR+ L    + +  P NK + S +  L P   + R   
Sbjct: 220 CGHTLCRKCMARVFDHSLHCPVCRRELAIPPSLVKQPSNKALVSLLNGLCPDTIAARAEA 279

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV---- 115
             L+    +   + P+FV   L FP  P FL +FEP+YRLM+RR M+   R+FGM+    
Sbjct: 280 MALEERGSDGRSNVPLFVCT-LGFPNQPTFLRIFEPRYRLMLRRAMEG-NREFGMLMYNR 337

Query: 116 -------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                  L   + YQ +GTML I  A+ LADG SL+ET G Y+F+V    + DGY +G V
Sbjct: 338 YNEPQGSLGTVHFYQ-YGTMLHIIHAQVLADGTSLIETQGMYRFRVKSSDTLDGYLIGEV 396

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSP 228
           ER+DD++                  +T   + + I   +T +L   S++FI  ++  ++ 
Sbjct: 397 ERLDDVN--LAEEERIEAEETAVPASTEEDMASQINRMSTQDLFAFSKEFIVKMQARSAN 454

Query: 229 WLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRD 288
           WL QR+  ++G  PDDP+ F+YW ASV+PI++ EKYKLL  R+VRERLK+   WI  +  
Sbjct: 455 WLQQRVLDIHGQPPDDPALFAYWFASVLPISDEEKYKLLGTRTVRERLKITATWIRRIES 514

Query: 289 QWW 291
           Q W
Sbjct: 515 QRW 517



>gi|46122409|ref|XP_385758.1| hypothetical protein FG05582.1 [Fusarium graminearum PH-1]
          Length = 601

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 176/331 (53%), Gaps = 44/331 (13%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHN---YNAYLHHPINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LD++  CPICR+PL      N  L  P N+TI   I   +    + R
Sbjct: 264 CGHTFCRSCLHRILDYSRYCPICRRPLAISPLLNQILSPP-NQTIKRIIETFWLEEVNAR 322

Query: 59  RYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
           +  LD+E    MQD  T +F+   L FP MP FLH+FEP+YRLMIRR M+   R FGMV+
Sbjct: 323 KEALDAERAAQMQDHDTSLFICT-LSFPHMPTFLHIFEPRYRLMIRRAMEEGHRTFGMVI 381

Query: 117 A------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                    + + + GT+L I + +F +DGRSL+ET+G  +F+V+E    DGY VG+ ER
Sbjct: 382 PKRRQFPGDSDFHELGTLLRIVNVQFYSDGRSLIETVGLSRFRVLEHDFLDGYMVGKTER 441

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYT----------------------- 207
           VDD+S                + +   P+    +E T                       
Sbjct: 442 VDDVSLEDEEAAEAAEASPMELESNQGPMLEGDKESTEPTSPLPRSSSSSPHMPTSVADI 501

Query: 208 ----TSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEK 263
               T  L+  +  F+  +R  + PWL +R+ ++YG+ P+DP+ F +W AS++P+ + EK
Sbjct: 502 DIMSTQSLMHFASSFVARMRQQSVPWLAERMLTIYGECPEDPAIFPWWFASILPVKDIEK 561

Query: 264 YKLLELRSVRERLKLIVEWISSLRDQWWFAR 294
           Y+LL   SVRERLK+   WI     +W  AR
Sbjct: 562 YRLLGTSSVRERLKICCIWIV----EWQMAR 588



>gi|134056662|emb|CAK37655.1| unnamed protein product [Aspergillus niger]
          Length = 618

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 112/305 (36%), Positives = 166/305 (54%), Gaps = 16/305 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+   L+H+  CP+CR+ L+  +     P N+ I + + AL+P   + RR  
Sbjct: 315 CGHTFCRGCVAMVLNHSDLCPLCRRKLNMASTVRAEPANRRISNLVEALFPEQVASRREG 374

Query: 62  LDSE-----LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             +E       +  +  P+FV+ +L FP MP FLH+FEP+YR MI R MQ+R ++FGMV+
Sbjct: 375 SSNEDGVAATGDGERTIPLFVS-SLSFPTMPTFLHIFEPRYRTMIHRVMQTRDKKFGMVM 433

Query: 117 ----------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                          +  +GT+L +   E L DGRSLV   G  +FKVI     DGY VG
Sbjct: 434 YNRSGRLQEGLGRAQFMQYGTVLVVERFELLPDGRSLVIASGVSRFKVISFEMVDGYHVG 493

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           R++RVDDI+                   + +P ++P+    T +L  I+ DFI+  R   
Sbjct: 494 RIQRVDDIAISEEERLESLETSSSETEESLSPASSPLESLPTQQLFQIALDFIDKSRREG 553

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+   YG+ P DP+ F +W A V+P+ E EKY+LL   SVR+RLK +V W+   
Sbjct: 554 AAWLHPRVLLAYGEAPTDPAVFPWWFACVLPLWEDEKYQLLATTSVRDRLKKVVRWVRKS 613

Query: 287 RDQWW 291
             + W
Sbjct: 614 ESREW 618



>gi|350634602|gb|EHA22964.1| hypothetical protein ASPNIDRAFT_174930 [Aspergillus niger ATCC
           1015]
          Length = 641

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 164/297 (55%), Gaps = 16/297 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+   L+H+  CP+CR+ L+  +     P N+ I + + AL+P   + RR  
Sbjct: 254 CGHTFCRGCVAMVLNHSDLCPLCRRKLNMASTVRAEPANRRISNLVEALFPEQVASRREG 313

Query: 62  LDSE-----LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             +E       +  +  P+FV+ +L FP MP FLH+FEP+YR MI R MQ+R ++FGMV+
Sbjct: 314 SSNEDGVAATGDGERTIPLFVS-SLSFPTMPTFLHIFEPRYRTMIHRVMQTRDKKFGMVM 372

Query: 117 ----------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                          +  +GT+L +   E L DGRSLV   G  +FKVI     DGY VG
Sbjct: 373 YNRSGRLQEGLGRAQFMQYGTVLVVERFELLPDGRSLVIASGVSRFKVISFEMVDGYHVG 432

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           R++RVDDI+                   + +P ++P+    T +L  I+ DFI+  R   
Sbjct: 433 RIQRVDDIAISEEERLESLETSSSETEESLSPASSPLESLPTQQLFQIALDFIDKSRREG 492

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWI 283
           + WL  R+   YG+ P DP+ F +W A V+P+ E EKY+LL   SVR+RLK +V W+
Sbjct: 493 AAWLHPRVLLAYGEAPTDPAVFPWWFACVLPLWEDEKYQLLATTSVRDRLKKVVRWV 549



>gi|302409218|ref|XP_003002443.1| ATP-dependent protease [Verticillium albo-atrum VaMs.102]
 gi|261358476|gb|EEY20904.1| ATP-dependent protease [Verticillium albo-atrum VaMs.102]
          Length = 394

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 173/316 (54%), Gaps = 29/316 (9%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+  CPICR+ L + +  LH    P N+++   I   +      R
Sbjct: 82  CGHTFCRSCLHRVLDHSLYCPICRRAL-SISPLLHRQSCPSNESLSKMINTFWADAVLTR 140

Query: 59  RYLLDSELFNTMQ--DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
              L +E  N  +  D P+FV   L FP MP FLH+FEP+YRLMIRR ++   R FGMV+
Sbjct: 141 GDALAAEALNRHREFDIPVFVCT-LAFPMMPTFLHIFEPRYRLMIRRALEG-DRTFGMVM 198

Query: 117 ------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                 A    + ++GT+L I +AE+  DGRSL+ETIG  +FKV+  G  DGY VG+++R
Sbjct: 199 PRRPRHADDAPFVEYGTLLRIVNAEYFPDGRSLIETIGISRFKVVRHGVLDGYIVGKIDR 258

Query: 171 VDDISPXXXXXXXXXXXXXXXIY----NTS--NPLNNPIREYTTSE---------LIGIS 215
           +DD+S                +     NTS  +    P R  TT+E         L+  +
Sbjct: 259 IDDVSIAEEEELEAQEIRHSSLQRVASNTSQRSGSGTPPRVTTTTEDLARMPTRDLLDFA 318

Query: 216 RDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRER 275
             F++ +   + PWL QR+ ++YG+ P D   F +W AS++P  E EKY+LL  +SVRER
Sbjct: 319 VSFVQRMSQQSVPWLAQRILTIYGECPVDAEQFPWWFASILPAKEPEKYRLLGTQSVRER 378

Query: 276 LKLIVEWISSLRDQWW 291
           LK+   W+       W
Sbjct: 379 LKICCAWVLEWEANRW 394



>gi|71001398|ref|XP_755380.1| ATP-dependent protease (CrgA) [Aspergillus fumigatus Af293]
 gi|66853018|gb|EAL93342.1| ATP-dependent protease (CrgA), putative [Aspergillus fumigatus
           Af293]
 gi|159129454|gb|EDP54568.1| ATP-dependent protease (CrgA), putative [Aspergillus fumigatus
           A1163]
          Length = 626

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 112/295 (37%), Positives = 160/295 (54%), Gaps = 14/295 (4%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC+ C+   LDH+  CPICR+ L+  +     P+NK I       +    + +R 
Sbjct: 236 PCGHTFCRGCVVTILDHSDLCPICRRKLNMSSTINSEPVNKRISDLTELFFSEQIASQRQ 295

Query: 61  LLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL-- 116
            L  E  +    T  P+FV N+L FP MP FL +FEP+Y LMIRR M+SR+R+FGMV+  
Sbjct: 296 SLAEEQSDPDAGTVLPLFV-NSLSFPSMPTFLRIFEPRYCLMIRRVMESRERKFGMVMYN 354

Query: 117 --------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                     +  +  +G +L +   E L  GRSL+  +G  +FKVI+    DGY VG++
Sbjct: 355 RLGRPQGQLGATQFMQYGVVLRVERFEPLPGGRSLIFAMGVSRFKVIKSHIVDGYHVGQI 414

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNT-SNPLNNPIREYTTSELIGISRDFIETLRNGNS 227
           +RVDDI                   +T + P   P+   +T EL  +  DF+   R   +
Sbjct: 415 QRVDDIPIAEEENLESWETSTIPHRSTEARPSQQPLDSMSTQELFQLGLDFVRKRRGEGA 474

Query: 228 PWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEW 282
            WL  R+   YGD+P DP+ F +W+A V P++E EKY LL   SVRERLK+  +W
Sbjct: 475 RWLHPRVLMAYGDIPSDPAQFPWWLACVFPVSEEEKYALLSATSVRERLKITAQW 529



>gi|342873554|gb|EGU75718.1| hypothetical protein FOXB_13737 [Fusarium oxysporum Fo5176]
          Length = 680

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 120/336 (35%), Positives = 176/336 (52%), Gaps = 47/336 (13%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPL--HNYNAYLHHPINKTIYSFIRALYPSLYSERR 59
           CGH+FC+ C+ R LDH+  CPICR+PL      +    P N+TI   I   +    + R+
Sbjct: 324 CGHTFCRSCLHRILDHSRYCPICRRPLAISPLLSQTSSPSNQTIKRIIETFWLEEVNARK 383

Query: 60  YLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
             LD+E    MQD    +FV   L FP+MP FLH+FEP+YRLMIRR ++     FGMV+ 
Sbjct: 384 EALDAERVAQMQDYDLALFVCT-LSFPQMPTFLHIFEPRYRLMIRRALEG-DHTFGMVIP 441

Query: 117 -----ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERV 171
                A    + + GT+L I + +F  DGRSL+ET+G  +F+V+E    DGY VG+ ER+
Sbjct: 442 KRPQHAGDANFHELGTLLRIVNVQFFPDGRSLIETVGLSRFRVLEHSYLDGYIVGKTERI 501

Query: 172 DDIS-------------PXXXXXXXXXXXXXXXIYNTSNPL----------NNP------ 202
           DD+S             P               +   + P           ++P      
Sbjct: 502 DDVSLEDEEAAEAAEATPIETEDQQQPMQAMDSVKEPTEPTPTSPLPRSDSSSPHIPTSV 561

Query: 203 --IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAE 260
             I   +T  L+  +  F+  +R  + PWL +R+ ++YGD P+DP+ F +W AS++P+ +
Sbjct: 562 TEIDSMSTQSLMHYASSFVARMRQQSVPWLTERMLTIYGDCPEDPAIFPWWFASMLPVKD 621

Query: 261 GEKYKLLELRSVRERLKLIVEWISSLRDQWWFARGC 296
            EKY+LL   SVRERLK+   WI     +W  +R C
Sbjct: 622 IEKYRLLGTSSVRERLKICCTWIV----EWETSRCC 653



>gi|358365518|dbj|GAA82140.1| ATP-dependent protease [Aspergillus kawachii IFO 4308]
          Length = 563

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 163/305 (53%), Gaps = 17/305 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+   L+H+  CP+CR+ L+  +     P+N+ I   + AL+P     RR  
Sbjct: 261 CGHTFCRGCVAMVLNHSDLCPLCRRKLNMASTVRAEPVNRRISDLVEALFPEQVVSRREG 320

Query: 62  LDSE-----LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             +E       +  +  P+FV+ +L FP MP FLH+FEP+YR MI R MQ+R ++FGMV+
Sbjct: 321 SSNEDGVAATGDGERTIPLFVS-SLSFPTMPTFLHIFEPRYRTMIHRVMQTRDKKFGMVM 379

Query: 117 ----------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                          +  +GT+L +   E L DGRSLV   G  +FKV+     DGY VG
Sbjct: 380 YNRSGRLQEGLGRAQFMQYGTVLVVERFELLPDGRSLVIASGVSRFKVMSFEMVDGYHVG 439

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           R++RVDDI+                   + +  + P     T +L  I+ DFI+  R   
Sbjct: 440 RIQRVDDIA-ISEEERLESLETSSGTGESLSAASTPPESLPTQQLFQIALDFIDKSRREG 498

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+   YG+ P DP+ F +W A V+P+ E EKYKLL   SVR+RLK++V W+   
Sbjct: 499 AAWLHPRVLLAYGEAPTDPAVFPWWFACVLPLWEDEKYKLLATTSVRDRLKMVVRWVRKS 558

Query: 287 RDQWW 291
             + W
Sbjct: 559 ESREW 563



>gi|67539582|ref|XP_663565.1| hypothetical protein AN5961.2 [Aspergillus nidulans FGSC A4]
 gi|40738634|gb|EAA57824.1| hypothetical protein AN5961.2 [Aspergillus nidulans FGSC A4]
 gi|259479863|tpe|CBF70476.1| TPA: ATP-dependent protease (CrgA), putative (AFU_orthologue;
           AFUA_2G10470) [Aspergillus nidulans FGSC A4]
          Length = 623

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/302 (37%), Positives = 165/302 (54%), Gaps = 14/302 (4%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC+ C+  +L H++ CPICR+ L+  ++      NK++   I  L P   + RR 
Sbjct: 218 PCGHTFCRRCVAMALSHSNLCPICRRKLNMPSSVRSERNNKSLSDIIETLLPDEVASRRA 277

Query: 61  LLDSEL-FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA-- 117
            + S +  N+    P+ V  +L FP MP  LH+FEP+YRLMI+R M+S  R+FGMV+   
Sbjct: 278 DVASNIELNSEGKLPLAVV-SLAFPTMPIGLHIFEPRYRLMIQRVMESGSRKFGMVMPNR 336

Query: 118 --------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       +  +GT+L I   E L DGRSL+   GT +FKV+     DGY VG+++
Sbjct: 337 RGHLQQGLGRAPFMRYGTILAINRHELLPDGRSLLIATGTSRFKVLSWELVDGYHVGKIQ 396

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           RVDD+S                I   S+  +  I   +T EL  ++ DF+   R   +PW
Sbjct: 397 RVDDVS--ISEEEAQESRETATIEPGSSTSDRSIDSMSTQELYQLALDFVLRERRLGAPW 454

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQ 289
           L  R+   YG +P DP+ F +W A+V+P  E EKY LLE  SVR+RLK+   W+  L  +
Sbjct: 455 LHPRVLLAYGALPTDPALFPWWFATVLPRWEEEKYMLLETTSVRQRLKITARWVKRLESR 514

Query: 290 WW 291
            W
Sbjct: 515 QW 516



>gi|449296608|gb|EMC92627.1| hypothetical protein BAUCODRAFT_77623 [Baudoinia compniacensis UAMH
           10762]
          Length = 513

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 167/304 (54%), Gaps = 19/304 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSER--R 59
           CGH+ C+ C+ R LDH+  CP+CR+ L    +  + P NKT+   +  L P   + R   
Sbjct: 215 CGHTLCRKCLARVLDHSFHCPVCRRGLAVPTSLQNQPSNKTLVDLLNGLCPDAVAARVQA 274

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
             L+ +      DTP+FV  +  FP  P FL +FEP+YRLM+RRC+    R+FGM++   
Sbjct: 275 VSLEDQPGEGELDTPLFVCTS-AFPGQPTFLRIFEPRYRLMLRRCLLG-NREFGMLMY-- 330

Query: 120 NTYQD------------FGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
           N Y +            +GTML++   + L DG+SL+E+ G Y+F+V   G  DGY VG 
Sbjct: 331 NRYHEPQGELGTVPFYQYGTMLQVLHCQTLPDGQSLIESRGVYRFRVKSHGLLDGYTVGS 390

Query: 168 VERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNS 227
           VER +D+S                  + ++ ++  I    T +L+ + R+F+  ++  ++
Sbjct: 391 VERFEDVSLAEEERLEAEETSQPPPADETD-MHAVISRMPTQDLLALGREFVYRMQARSA 449

Query: 228 PWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
            WL QR+   YG  P+D + F YW ASV+PIA+ EKYKL+   +VRERLK+   WI  + 
Sbjct: 450 SWLAQRVLDTYGQPPEDAALFPYWFASVLPIADEEKYKLMGTTTVRERLKITASWIRRIE 509

Query: 288 DQWW 291
            Q W
Sbjct: 510 SQRW 513



>gi|453083306|gb|EMF11352.1| hypothetical protein SEPMUDRAFT_150308 [Mycosphaerella populorum
           SO2202]
          Length = 522

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 160/304 (52%), Gaps = 18/304 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERR-- 59
           CGH+ C+ C+ R LDH+  CP+CR+ L    +    P NK I   +   +  L   R   
Sbjct: 216 CGHTLCRNCMARVLDHSQHCPVCRRSLAIPPSLQRQPSNKAIVELLDGCWHDLMVARAAD 275

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV---- 115
             L     +     P+FV   L FP  P FL +FEP+YRLM+RR M+   RQFGM+    
Sbjct: 276 VALQERGSDGSTAVPLFVCT-LGFPNQPTFLRIFEPRYRLMLRRAMEG-NRQFGMLMYNR 333

Query: 116 -------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                  L   + YQ +GTML I   + LADG SL+E  G ++F+V   G+ DGY VG V
Sbjct: 334 YSEPQGELGSVHFYQ-YGTMLHILHCQVLADGTSLIELRGLHRFRVKSHGTLDGYTVGEV 392

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSP 228
           ER+DD+S                + +        I   +T  L  + R+FI  ++  ++ 
Sbjct: 393 ERIDDVSLEEEERIEAEETSSPSVGDEDTVAQ--ISAMSTQALHSLGREFIVKMQARSAN 450

Query: 229 WLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRD 288
           WL QR+  ++G  PDD S F YW ASV+PI+E EKYKLL  R+VRERLK+   WI  +  
Sbjct: 451 WLQQRVLDIHGQPPDDASLFPYWFASVLPISEEEKYKLLGTRTVRERLKITATWIRRIES 510

Query: 289 QWWF 292
           Q W+
Sbjct: 511 QRWY 514



>gi|302902876|ref|XP_003048739.1| hypothetical protein NECHADRAFT_101277 [Nectria haematococca mpVI
           77-13-4]
 gi|256729673|gb|EEU43026.1| hypothetical protein NECHADRAFT_101277 [Nectria haematococca mpVI
           77-13-4]
          Length = 574

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 170/332 (51%), Gaps = 44/332 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSE 57
           PCGH+FC+ C+ R LDH+  CPICR+P+   N  L     P N+TI   I A +      
Sbjct: 246 PCGHTFCRSCLHRILDHSRYCPICRRPM-AINPVLSQKSSPSNETITRIIEAFWLDEVDA 304

Query: 58  RRYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV 115
           RR  LD+E  + MQD   P+FV   L FP MP FLH+FEP+YRLMIRR ++   R FGMV
Sbjct: 305 RREALDAERASQMQDFDLPLFVCT-LSFPLMPTFLHIFEPRYRLMIRRALEG-DRTFGMV 362

Query: 116 LACSNT------YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           L           + D GT+L I + ++  DGRSL+ET+G  +F+V      DGY V ++E
Sbjct: 363 LPKRPQHPDDVDFHDLGTLLRIVNIQYYPDGRSLIETVGLSRFRVRNHSYLDGYTVAKIE 422

Query: 170 RVDDI-------------------------SPXXXXXXXXXXXXXXXIYNTSNPLNNP-- 202
           RVDD+                         S                   T + L  P  
Sbjct: 423 RVDDVSLEQEEAMEAMEAVPPTEQPSTGEDSSIQGDKDSQDSPSSASPPPTIDSLPMPAS 482

Query: 203 ---IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIA 259
              I   +T  L+  +  F+  +R  + PWL +R+ ++YG+ PDD + F +W AS++P+ 
Sbjct: 483 PEDIDAMSTQSLMQFASSFVARMRVQSVPWLTERMLTIYGECPDDAAIFPWWFASMLPVK 542

Query: 260 EGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
           + EKY+LL   SVRERLK+   WI   +   W
Sbjct: 543 DLEKYRLLGTSSVRERLKICCSWIIEWQTSRW 574



>gi|400595143|gb|EJP62953.1| ATP-dependent protease La domain-containing protein [Beauveria
           bassiana ARSEF 2860]
          Length = 472

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 174/344 (50%), Gaps = 50/344 (14%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH---PINKTIYSFIRALYPSLYSER 58
           CGH+FC+ C+ R LDH+  CPICR+ L + N  L+    P N ++   I   +    + R
Sbjct: 131 CGHTFCRSCLHRILDHSRYCPICRRRL-SINPLLNRASCPSNASLTRIIETFWTDELASR 189

Query: 59  RYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
           +  +++E    +QD  TP+FV   L FP+MP FLHVFEP+YRL+IRR ++   + FGMVL
Sbjct: 190 KRAVEAEEAARLQDFETPLFVCT-LAFPQMPTFLHVFEPRYRLLIRRALEG-DKTFGMVL 247

Query: 117 A------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                      + + GT+L I + +F  DGR L+ET+G  +F+V   G  DGY V  V+R
Sbjct: 248 PKRPRQPGDAHFHELGTLLRIENVQFFPDGRCLIETVGLSRFRVQRHGVLDGYTVSSVQR 307

Query: 171 VDDIS------------------------------PXXXXXXXXXXXXXXXIYNTSNPLN 200
           +DDIS                              P                  T     
Sbjct: 308 IDDISLEEEEATEAAEMAAAAAADATPFPPPPDAVPRHSDDGSASGGYASSTSTTPGAAR 367

Query: 201 NPI-----REYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMP-DDPSDFSYWVAS 254
             I        TT +L+ ++ DF+  +R+ + PW+  R+ ++YG  P  DPS F +W+AS
Sbjct: 368 PTITVPSLETMTTQDLMQLATDFVGRMRDQSVPWMTDRMLAIYGACPVQDPSIFPWWLAS 427

Query: 255 VIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWFARGCSI 298
           V+P+ + EKY+LL   SVRERLK+  +WI     + W    CSI
Sbjct: 428 VLPVKDAEKYRLLGSASVRERLKICCKWIIEWETRTWSFNSCSI 471



>gi|406864831|gb|EKD17874.1| putative ATP-dependent protease (CrgA) [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 561

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 167/310 (53%), Gaps = 27/310 (8%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICR--QPLHNYNAYLHHPINKTIYSFIRALYPSLYSER 58
           PCGH+FC+ C+ R LDH+  CPICR  Q +         P N  I   +  L P   + R
Sbjct: 237 PCGHTFCRSCLYRVLDHSRLCPICRRVQTITPQLGRDRDPSNVIISKLLTGLCPEALAVR 296

Query: 59  RYLLDSEL--FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
               +++L       D P+F+   L FP++P FLH+FEP+YRLMIRR ++S + +FGM+ 
Sbjct: 297 AKAAEADLRPGTVEMDIPLFICT-LSFPQVPTFLHIFEPRYRLMIRRAIESGEGKFGMLR 355

Query: 117 ACSN----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
              +          ++ ++GT+L I   + L DGRSL+ET G  +F+V++ G+ DGY +G
Sbjct: 356 HNPSREPQGELGRVSFYEYGTLLCIEGIQVLPDGRSLIETRGKSRFRVLKHGTLDGYTIG 415

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNN------------PIREYTTSELIGI 214
           ++E + DIS                  N S   +N             +   +T  L  +
Sbjct: 416 KIELLTDISIPAEEELEARETTDTRAQNLSAQSDNSAPLSPEAAHIAKLNAMSTKALFEL 475

Query: 215 SRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRE 274
              F++ +R+ ++PWL  R+   YG+ P+DP+ F +W ASV P A+ EKY LL   SVR+
Sbjct: 476 GVAFVKKMRDRSAPWLHARVLQAYGECPNDPAIFPWWFASVFPTADSEKYHLLMTDSVRQ 535

Query: 275 RLKLIVEWIS 284
           RLK+I +WI+
Sbjct: 536 RLKIIADWIA 545



>gi|346319502|gb|EGX89103.1| S16 family peptidase [Cordyceps militaris CM01]
          Length = 583

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 115/320 (35%), Positives = 177/320 (55%), Gaps = 32/320 (10%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQ-----PLHNYNAYLHHPINKTIYSFIRALYPSLYS 56
           CGH+FC+ C+ R LDH+  CP+CR+     PL N  +    P N  +   I AL+P+  +
Sbjct: 264 CGHTFCRSCLHRILDHSRYCPMCRRRLSISPLLNRASC---PSNAALARIIAALWPAERA 320

Query: 57  ERRYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGM 114
            R   + ++     +D  TP+FV   L FP+MP FLHVFEP+YRL++RR +Q   + FGM
Sbjct: 321 ARSIAVRADETARERDLETPLFVCT-LAFPQMPTFLHVFEPRYRLLVRRALQG-DKTFGM 378

Query: 115 VL------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
           VL      A +  + + GT+L I  A+F ADGR L+ET+G  +F+V+   ++DGY V  V
Sbjct: 379 VLPRPPRHADAAAFYELGTLLRIEHAQFYADGRCLIETVGLSRFRVLRHAARDGYAVSAV 438

Query: 169 ERVDDIS-------------PXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGIS 215
           ERVDDIS                               +T+      +    T +L+ ++
Sbjct: 439 ERVDDISLEEEETTEAAEMAAAAAAPPPPSPSSDAGSEHTAVITVPTLETMATRDLMRLA 498

Query: 216 RDFIETLRNGNSPWLLQRLNSVYGDMP-DDPSDFSYWVASVIPIAEGEKYKLLELRSVRE 274
            DF++ +R+ + PW+   + ++YG+ P  DP+ F +W+ SV+P+ + EKY+LL   SVRE
Sbjct: 499 TDFVQRMRDKSVPWMTDSMLAIYGECPVQDPAVFPWWLGSVLPVRDAEKYRLLGSASVRE 558

Query: 275 RLKLIVEWISSLRDQWWFAR 294
           RLK+   WI     + W+A+
Sbjct: 559 RLKICCRWIIEWETKTWYAQ 578



>gi|322709349|gb|EFZ00925.1| hypothetical protein MAA_03521 [Metarhizium anisopliae ARSEF 23]
          Length = 1073

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 166/329 (50%), Gaps = 52/329 (15%)

Query: 2    CGHSFCKPCITRSLDHNSACPICR-----QPLHNYNAYLHHPINKTIYSFIRALYPSLYS 56
            CGH+FC+ C+ R+LDH+  CPICR      PL N +     P N++I   I   +P   +
Sbjct: 726  CGHTFCRSCLHRTLDHSHRCPICRCTLAINPLLNPDLC---PSNESITRLIELFWPDEKA 782

Query: 57   ERRYLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGM 114
             R   + S+     QD   P+FV   L FP MP FLH+FEP+YRLM+RR ++   R FGM
Sbjct: 783  ARDKDVTSDTAARHQDLDLPLFVCT-LAFPSMPTFLHIFEPRYRLMVRRVLEG-NRTFGM 840

Query: 115  VL------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
            VL      A    + + GT+L I +AEF  DGRSL+ET+G  +FKV+  G  DGY + + 
Sbjct: 841  VLPKRPRDADDTHFYELGTLLRIINAEFYPDGRSLIETVGLTRFKVLRHGELDGYTIAKT 900

Query: 169  ERVDDIS----------------------PXXXXXXXXXXXXXXXIYNTSNPLNNP---- 202
            ERVDD+S                                        + + P   P    
Sbjct: 901  ERVDDMSLEEEEAVEASEAVAATRNVDATGLNSDLSAGIDSSTAEDSDETRPETEPTGIP 960

Query: 203  --------IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVAS 254
                    ++  +T  L+  +  F+  +R  + PWL  R+  +YG+ P DP+ F +W AS
Sbjct: 961  PIPMTASDLQAMSTQNLMSYATAFVSRMRGQSVPWLTARMFGIYGECPSDPAVFPWWFAS 1020

Query: 255  VIPIAEGEKYKLLELRSVRERLKLIVEWI 283
            ++P+ + EKY+LL   SVRERLK+   WI
Sbjct: 1021 MLPVKDLEKYRLLGTSSVRERLKICCVWI 1049



>gi|303323719|ref|XP_003071851.1| ATP-dependent protease La domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240111553|gb|EER29706.1| ATP-dependent protease La domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 716

 Score =  196 bits (498), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 164/305 (53%), Gaps = 20/305 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH-PINKTIYSFIRALYPSLYSERR 59
           PCGHSFC+ C+ R L+H+  CP+CR+ L   + YLH  P+N  +   I + +P   +ER+
Sbjct: 224 PCGHSFCRLCLARILNHSDLCPVCRRKL---SGYLHSSPVNLRLDGLISSFFPEQLAERK 280

Query: 60  YLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV-- 115
             L  +    + +T  P+F+   L +P    FL+VFEP+YRLMIRR M+S  R+FG+V  
Sbjct: 281 EALKVDGNGELDETNVPLFICT-LAYPSTRTFLYVFEPRYRLMIRRVMESGNRRFGIVAP 339

Query: 116 ---------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                    +A    + ++GT++EI     L DGR ++ + G Y+FKV+E    DGY VG
Sbjct: 340 KSTASTQEDIADEAPFMEYGTVVEIDRFSPLPDGRCIIRSTGKYRFKVLESTVVDGYAVG 399

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           +VERV+D+S                +    +P  + I   +T  L  I   ++   R   
Sbjct: 400 KVERVEDVS-IAQEEAYEASETGLPVPVEHDP-KDEIDRLSTHRLFQIGLTYVAKCRASK 457

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+  +YG  P D   FSYW A+V+P  E ++Y LL + + R+RLK+I  WI  L
Sbjct: 458 ATWLDDRIYKLYGPPPPDLRTFSYWFANVLPRPEDDRYSLLPVTTARDRLKIITRWIKKL 517

Query: 287 RDQWW 291
               W
Sbjct: 518 ESGEW 522



>gi|320031795|gb|EFW13753.1| LON peptidase domain and ring finger protein [Coccidioides
           posadasii str. Silveira]
          Length = 700

 Score =  196 bits (498), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 164/305 (53%), Gaps = 20/305 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH-PINKTIYSFIRALYPSLYSERR 59
           PCGHSFC+ C+ R L+H+  CP+CR+ L   + YLH  P+N  +   I + +P   +ER+
Sbjct: 208 PCGHSFCRLCLARILNHSDLCPVCRRKL---SGYLHSSPVNLRLDGLISSFFPEQLAERK 264

Query: 60  YLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV-- 115
             L  +    + +T  P+F+   L +P    FL+VFEP+YRLMIRR M+S  R+FG+V  
Sbjct: 265 EALKVDGNGELDETNVPLFICT-LAYPSTRTFLYVFEPRYRLMIRRVMESGNRRFGIVAP 323

Query: 116 ---------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                    +A    + ++GT++EI     L DGR ++ + G Y+FKV+E    DGY VG
Sbjct: 324 KSTASTQEDIADEAPFMEYGTVVEIDRFSPLPDGRCIIRSTGKYRFKVLESTVVDGYAVG 383

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           +VERV+D+S                +    +P  + I   +T  L  I   ++   R   
Sbjct: 384 KVERVEDVS-IAQEEAYEASETGLPVPVEHDP-KDEIDRLSTHRLFQIGLTYVAKCRASK 441

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+  +YG  P D   FSYW A+V+P  E ++Y LL + + R+RLK+I  WI  L
Sbjct: 442 ATWLDDRIYKLYGPPPPDLRTFSYWFANVLPRPEDDRYSLLPVTTARDRLKIITRWIKKL 501

Query: 287 RDQWW 291
               W
Sbjct: 502 ESGEW 506



>gi|389639008|ref|XP_003717137.1| hypothetical protein MGG_06430 [Magnaporthe oryzae 70-15]
 gi|351642956|gb|EHA50818.1| hypothetical protein MGG_06430 [Magnaporthe oryzae 70-15]
          Length = 564

 Score =  196 bits (498), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 169/332 (50%), Gaps = 48/332 (14%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYP-SLYSERRY 60
           CGH+FC+ C+ R LDH+  C +CR+ +H        P NK +      L+  SL + ++ 
Sbjct: 239 CGHTFCRHCLHRILDHSDLCAVCRRQIHRGE----WPQNKLMACIETTLWATSLEARKQA 294

Query: 61  LLDSELFNTMQ-DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL--- 116
           +L      T + D P+FV   L FP MP FLHVFEP+YRLMIRR ++ + R FGMVL   
Sbjct: 295 ILAESRHGTAEFDIPVFVCT-LSFPTMPTFLHVFEPRYRLMIRRALE-QDRTFGMVLHRR 352

Query: 117 ---ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
              A    + D GT+L + + EF  DGRSL+ET+G  +F++++ G KDGY V ++ERV+D
Sbjct: 353 ARRAGEPDFVDIGTLLRVINVEFFPDGRSLIETVGVSRFRILQHGMKDGYVVAKIERVND 412

Query: 174 IS--------------------------PXXXXXXXXXXXXXXXIYNTSNPLNNPIRE-- 205
           +S                                          +  TS   NN   E  
Sbjct: 413 VSIAEEEALEAGEIREALDTDLDTTSQQEEPGDKPANVSGNGVCVATTSTTNNNQGSEAP 472

Query: 206 -----YTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMP-DDPSDFSYWVASVIPIA 259
                  T EL+    +F+  +R  ++ WL  R+ ++YG+ P DD + F +W ASV+P+ 
Sbjct: 473 PNFDVMPTRELLRFGVEFVARMREASAGWLTHRILAIYGECPEDDAAKFPWWFASVLPVN 532

Query: 260 EGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
           + EKY+LL   SVRERLK+   WI       W
Sbjct: 533 DLEKYRLLGTASVRERLKVCCHWIQEWESSRW 564



>gi|392867809|gb|EAS33505.2| ATP-dependent protease [Coccidioides immitis RS]
          Length = 742

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 164/305 (53%), Gaps = 20/305 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH-PINKTIYSFIRALYPSLYSERR 59
           PCGHSFC+ C+ R L+H+  CP+CR+ L   + YLH  P+N  +   I + +P   +ERR
Sbjct: 224 PCGHSFCRLCLARILNHSDLCPVCRRKL---SGYLHSSPVNLRLDGLISSFFPEQLAERR 280

Query: 60  YLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV-- 115
             L  +    + +T  P+F+   L +P    FL+VFEP+YRLMIRR M+S  R+FG+V  
Sbjct: 281 EALKVDGNGELDETNVPLFICT-LAYPSTRTFLYVFEPRYRLMIRRVMESGNRRFGIVAP 339

Query: 116 ---------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                    +A    + ++GT++EI     L DGR ++ + G Y+FKV+E    DGY VG
Sbjct: 340 KSTASTQDDVADDAPFLEYGTLVEIDRFSPLPDGRCIIRSTGKYRFKVLESTVVDGYAVG 399

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           ++ERV+D+S                +    +P  + I   +T  L  I   ++   R   
Sbjct: 400 KIERVEDVS-IAQEEAYEASETGLPVPVEHDP-KDEIDRLSTHRLFQIGLTYVAKCRASK 457

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+  +YG  P D   FSYW A+V+P  E ++Y LL + + R+RLK+I  WI  L
Sbjct: 458 ATWLDDRIYKLYGPPPPDLRTFSYWFANVLPRPEEDRYTLLPVTTARDRLKIITRWIKKL 517

Query: 287 RDQWW 291
               W
Sbjct: 518 ESGEW 522



>gi|119188589|ref|XP_001244901.1| hypothetical protein CIMG_04342 [Coccidioides immitis RS]
          Length = 726

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 164/305 (53%), Gaps = 20/305 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHH-PINKTIYSFIRALYPSLYSERR 59
           PCGHSFC+ C+ R L+H+  CP+CR+ L   + YLH  P+N  +   I + +P   +ERR
Sbjct: 208 PCGHSFCRLCLARILNHSDLCPVCRRKL---SGYLHSSPVNLRLDGLISSFFPEQLAERR 264

Query: 60  YLLDSELFNTMQDT--PIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV-- 115
             L  +    + +T  P+F+   L +P    FL+VFEP+YRLMIRR M+S  R+FG+V  
Sbjct: 265 EALKVDGNGELDETNVPLFICT-LAYPSTRTFLYVFEPRYRLMIRRVMESGNRRFGIVAP 323

Query: 116 ---------LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                    +A    + ++GT++EI     L DGR ++ + G Y+FKV+E    DGY VG
Sbjct: 324 KSTASTQDDVADDAPFLEYGTLVEIDRFSPLPDGRCIIRSTGKYRFKVLESTVVDGYAVG 383

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           ++ERV+D+S                +    +P  + I   +T  L  I   ++   R   
Sbjct: 384 KIERVEDVS-IAQEEAYEASETGLPVPVEHDP-KDEIDRLSTHRLFQIGLTYVAKCRASK 441

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  R+  +YG  P D   FSYW A+V+P  E ++Y LL + + R+RLK+I  WI  L
Sbjct: 442 ATWLDDRIYKLYGPPPPDLRTFSYWFANVLPRPEEDRYTLLPVTTARDRLKIITRWIKKL 501

Query: 287 RDQWW 291
               W
Sbjct: 502 ESGEW 506



>gi|242787204|ref|XP_002480957.1| ATP-dependent protease (CrgA), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218721104|gb|EED20523.1| ATP-dependent protease (CrgA), putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 630

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 163/305 (53%), Gaps = 17/305 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGHSFC  C+ R  D+++ CP+CR+ ++       +P++  +   + +L+P   S RR +
Sbjct: 306 CGHSFCYECVNRIRDNSNLCPLCRKKMYLSFREGSNPVHNVLRDLLNSLFPDEISSRREI 365

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL----- 116
           ++   ++   + P+FV   L FP MP +LH+FEP+YRLMIRR +     +FGMV+     
Sbjct: 366 IEDGAYDE-DELPLFVC-TLAFPSMPIYLHIFEPRYRLMIRRALDYGNSRFGMVIHYLYH 423

Query: 117 ---------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
                    A    +  +GT ++I   +FL DGR ++  +GT+KF+V+     DGY    
Sbjct: 424 GLDAQRFPDAPPQPFMQYGTAVKIEWRDFLPDGRIMLTAVGTHKFRVLRYDILDGYYRAH 483

Query: 168 VERVDDISPXXXXXXXXXXXXXXX-IYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           +ERVDDIS                   N     ++ + + +T +L+ I  DF+E  R  +
Sbjct: 484 IERVDDISLAEEEALEARELAAAADTTNQQQSESSSLNDLSTQQLMQICMDFLEKQRTNS 543

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           +P +  R+N  +G  P DP+ F YW A+V+PI + E YK+L L SVRERLK+   W   L
Sbjct: 544 APAVRDRVNRAFGQPPTDPAIFPYWFANVLPIPDEEAYKILPLTSVRERLKIAATWPHML 603

Query: 287 RDQWW 291
               W
Sbjct: 604 EASGW 608



>gi|345563618|gb|EGX46605.1| hypothetical protein AOL_s00097g621 [Arthrobotrys oligospora ATCC
           24927]
          Length = 576

 Score =  192 bits (489), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 160/302 (52%), Gaps = 13/302 (4%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ +  D ++ CP CR+ L  Y   +    N+ + + +  L+    + R   
Sbjct: 252 CGHTFCQVCLRQVRDRSNLCPFCRRSLSPYQTVVEEKANRRMRTLLSYLFSDDVAARDDQ 311

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA---- 117
              +  N     PIF   A+ FP++P FLH+FEP+YRLM+++ + +  R FGMV      
Sbjct: 312 AAEDPQNETNQVPIFAC-AMTFPRVPMFLHIFEPRYRLMLQKVISNGSRSFGMVSHRRGP 370

Query: 118 -------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                      +  +GTML +   +   DGRSLVETIGTY+FK++    +DGY +  VER
Sbjct: 371 VPSADGDFDAPFTRYGTMLYVTDLQMFPDGRSLVETIGTYRFKIVSYTWQDGYPMAMVER 430

Query: 171 VDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWL 230
           ++DI+                    +  L + +    T EL     +F+ ++R  ++ W 
Sbjct: 431 IEDIAYADEENMEMMERILDATPGNATALAS-LSHLPTQELHRQGLEFVNSMRTSSTGWF 489

Query: 231 LQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQW 290
             R+ + YG  P DP+ F +WVA+++P+ E EKY +L   SVRERLKL+  W+ S++ + 
Sbjct: 490 TDRIINAYGQPPQDPAIFPFWVATLLPVHEREKYLVLVSTSVRERLKLVTVWMRSMQQRS 549

Query: 291 WF 292
           W+
Sbjct: 550 WY 551



>gi|501751544|emb|CCG84244.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 289

 Score =  192 bits (488), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 164/290 (56%), Gaps = 31/290 (10%)

Query: 36  HHPINKTIYSFIRALYPSLYSERRYLLD------SELFNTMQDT--------PIFVTNAL 81
           H P    + S  +  +P L+ ER+  ++      +E F TM  T        PIFV  +L
Sbjct: 3   HAPRAAILTSIFQNFWPLLWQERKTSIEEDNASAAEDFGTMDSTRLGPGITIPIFVC-SL 61

Query: 82  VFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN------------TYQDFGTML 129
            FP MP FL++FEP+Y+LMIRRCM+S QR FG+ L  S                 FGT+L
Sbjct: 62  SFPYMPTFLYIFEPRYKLMIRRCMESDQR-FGICLPKSERSGPIPGEDPDCPTSQFGTVL 120

Query: 130 EIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERV-DDISPXXXXXXXXXXXX 188
            I + ++L DGRSLVET G  +F++   G +DGY +G VE + DD +             
Sbjct: 121 RIYNIQYLDDGRSLVETHGEDRFRLERWGVRDGYMIGHVELLPDDGTDGDAEGDEASSLL 180

Query: 189 XXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDF 248
                  +  L++   + +  +L+  + +FI  LRNG++PWLLQR+   +G +P DP+ F
Sbjct: 181 TAEALGVA--LSDADADSSIEQLLEEASEFIANLRNGSAPWLLQRVELTHGVVPSDPTIF 238

Query: 249 SYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWFARGCSI 298
           ++WVAS+IP+ E EKY LL+ R +R RL++++ W+  L+ QWWF  GCSI
Sbjct: 239 AFWVASLIPVDEEEKYLLLKARGLRTRLRIVLHWVRKLQTQWWFHGGCSI 288



>gi|296412536|ref|XP_002835980.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629777|emb|CAZ80137.1| unnamed protein product [Tuber melanosporum]
          Length = 511

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 155/304 (50%), Gaps = 17/304 (5%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R LDH+  CP CR+ +H  +       NK +   +  L P   S+R   
Sbjct: 211 CGHTFCRGCLERVLDHSRHCPSCRRLMHLPSILPAQSSNKRLTELLVGLCPEALSQRALA 270

Query: 62  LDSELFNTMQD----TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
              E      D    TPIFV  A  +P MP  LHVFEP+YRLM+RR  +S  R+FGM+L 
Sbjct: 271 GAMESMAGNGDGGLSTPIFVCTA-SYPGMPTPLHVFEPRYRLMVRRACESGARKFGMLLP 329

Query: 118 ----------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGR 167
                         +  +GTML+I       DGRS V T+G  +F+V   G +D Y V  
Sbjct: 330 NRTGAPQGDLGVTPFMQYGTMLQIEEINMYPDGRSDVWTVGVSRFRVKRWGIRDEYIVAD 389

Query: 168 VERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNS 227
           VERVDDI                   + +  ++       T  L+ I   F++ ++  ++
Sbjct: 390 VERVDDIP--IIEEEAIEALETALCLSAAQEVHASWMGLPTQTLLHIGHQFVDQMQAISA 447

Query: 228 PWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
           PWL +     +G  PDDP+ F YW+ASV+P+ E EKY+LL   SVRERL+++V WI  + 
Sbjct: 448 PWLHENNILAFGQRPDDPALFPYWLASVLPVTETEKYRLLCSTSVRERLQIVVGWIKKIE 507

Query: 288 DQWW 291
              W
Sbjct: 508 THRW 511



>gi|212543597|ref|XP_002151953.1| ATP-dependent protease (CrgA), putative [Talaromyces marneffei ATCC
           18224]
 gi|210066860|gb|EEA20953.1| ATP-dependent protease (CrgA), putative [Talaromyces marneffei ATCC
           18224]
          Length = 429

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 155/308 (50%), Gaps = 22/308 (7%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFC  C  R  D ++ CP+CR+ +        +P +  +   + A +P     R+ 
Sbjct: 117 PCGHSFCYECANRIRDTSNLCPLCRKKMDLSFREGPNPAHGVLRCLLDAFFPDEIKSRKE 176

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            ++ +      + P+FV   L FP     LH+FEP+YRLMIRR + S   +FGMV    N
Sbjct: 177 AIEEDGTCDDDELPLFVCT-LAFPSTSTHLHIFEPRYRLMIRRALDSGNSKFGMV--THN 233

Query: 121 TYQD----------------FGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYD 164
            Y D                +GT + I   +FL DGR ++  +G +KFK++  G  DGY 
Sbjct: 234 FYHDLATEGHPDRSPEPFMQYGTAVRIEWRDFLPDGRIMLTAVGMHKFKILRYGVLDGYY 293

Query: 165 VGRVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLN-NPIREYTTSELIGISRDFIETLR 223
               ERVDDIS                    + P N +P+   +T +L+ I  DF+E  R
Sbjct: 294 RAHTERVDDIS--LAEEETLEARELAAANQNNQPANGSPLNALSTQQLMQICMDFLEKQR 351

Query: 224 NGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWI 283
             ++P + +R+N V+G  P DP+ F YW A+V+PI + E YK++ L SVRERLK+   W 
Sbjct: 352 MNSAPAVRERINRVFGQPPTDPAIFPYWFANVLPIPDEEAYKIIPLTSVRERLKVAATWP 411

Query: 284 SSLRDQWW 291
             L    W
Sbjct: 412 GKLEGSGW 419



>gi|390601239|gb|EIN10633.1| LON-domain-containing protein [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 607

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 120/183 (65%), Gaps = 11/183 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+++CP+CRQ L  +     H  N+ + S I   +P LY ER  
Sbjct: 245 PCQHTFCAKCLQRSLDHSNSCPLCRQELPGFAYVQDHACNRVVLSIIFKAFPELYRERGE 304

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL---- 116
            +++E  +   DTPIFV   L FP MP  LH FEP+YRLM+RRC++S    FGM++    
Sbjct: 305 AIEAEERDARLDTPIFVAQ-LSFPGMPTLLHFFEPRYRLMLRRCLESPNPSFGMIMPPRA 363

Query: 117 ----ACSNTYQDF--GTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
               A   T  DF  GTMLEIRS + L DGRS+VET GTY+F+++E+G+ DGY VGR+ER
Sbjct: 364 PTSTAAGGTAGDFGYGTMLEIRSVQMLRDGRSMVETWGTYRFRIVERGTLDGYMVGRIER 423

Query: 171 VDD 173
           +DD
Sbjct: 424 IDD 426



 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 66/103 (64%)

Query: 196 SNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASV 255
           S+ +  P    TT+E++     F+  LR G +PW++QRLN+ YG MP D   FS+W+A V
Sbjct: 504 SSGIRGPRDAPTTAEMMATCHAFLAQLRQGTAPWVVQRLNNTYGPMPTDVGSFSFWMALV 563

Query: 256 IPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWWFARGCSI 298
           +PI E EK KLL ++S R RL+L+V W+  L   WWF+ GC I
Sbjct: 564 LPIDESEKAKLLPIKSPRLRLRLVVHWVEQLNSNWWFSSGCVI 606



>gi|296821342|ref|XP_002850091.1| LON peptidase N-terminal domain and RING finger protein 3
           [Arthroderma otae CBS 113480]
 gi|238837645|gb|EEQ27307.1| LON peptidase N-terminal domain and RING finger protein 3
           [Arthroderma otae CBS 113480]
          Length = 620

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 163/308 (52%), Gaps = 21/308 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+TR LD++S CP+CR+ L         P NK + +    L+P   + R   
Sbjct: 141 CGHTFCRLCVTRMLDNSSLCPVCRRKLPMI--LPTDPGNKVLDTLTSMLFPDRVTLRLEG 198

Query: 62  LDSE--LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
           + SE  + ++  + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 199 IRSEEHVPSSTSELPLFVC-TVSFPSMPTYLHVFEPRYRRMILRVVENGGRRFGSVMFNR 257

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           N           Y  +GT+LEI   E L  GR+L+   G Y+F+++     DG  VG V+
Sbjct: 258 NGELGGQIENCVYAQYGTLLEIDRLESLPGGRTLIRATGRYRFRILSGSEYDGCKVGSVQ 317

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                      + LN      +T +L  I   F+   R+ N+ W
Sbjct: 318 RLDDIRIPDEEMIEAEEISASKEDGDVSYLNT----LSTQKLFQIGTKFVTNCRSNNASW 373

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR-- 287
           L +R+ S YG+ P DP+ F YW+ASV+PI   EKYKLL + +VR RLK+  +W   +   
Sbjct: 374 LNERMISAYGEPPTDPAIFPYWLASVLPIPSEEKYKLLSVTTVRGRLKICAKWAEQIEKD 433

Query: 288 DQWWFARG 295
           D+    +G
Sbjct: 434 DKQLLRKG 441



>gi|443927335|gb|ELU45838.1| LON domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 671

 Score =  186 bits (472), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 142/254 (55%), Gaps = 19/254 (7%)

Query: 9   PCITRSLDHNSACPICRQPLHN--YNAYLHHPINKTIYSFIRALYPSLYSERRYLLDSEL 66
           P   + L +   C IC   L N       HH  N+ I   I   +P+L  ER    +++ 
Sbjct: 354 PSFEKELLNELTCEICFMLLCNPITTPCQHHAHNEVITQIIAKAFPTLLEERVAAAETDG 413

Query: 67  FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSNTYQ--- 123
            ++  DTPIFV   L +P MP  LH FEP+YRLM+RRC+ S   +FGMV+   N      
Sbjct: 414 RDSRLDTPIFVCQ-LSYPGMPTLLHFFEPRYRLMLRRCLASATPRFGMVMPRQNANNTDG 472

Query: 124 -DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISPXXXXXX 182
            D+GTMLEI++ + L+DGRS+VET GT++F+++E+G+ DGY VGR ER+DD  P      
Sbjct: 473 NDYGTMLEIKNVQMLSDGRSMVETYGTFRFRILERGTLDGYLVGRTERIDDYPPEVEAEI 532

Query: 183 XXXXXXXXXIYNTSNPLNNPIR----EYTTSELIGISRDFIETLRNGNSPWLLQRLNSVY 238
                         NP    I     E +  EL+ I R F++ LRNG +PW++QRLN+ Y
Sbjct: 533 ERIALM--------NPSEGDITLRGIERSNQELVNICRRFLDQLRNGTAPWVVQRLNNTY 584

Query: 239 GDMPDDPSDFSYWV 252
           G MP D + F +WV
Sbjct: 585 GPMPADVASFGFWV 598



>gi|409049604|gb|EKM59081.1| hypothetical protein PHACADRAFT_87866 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 743

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 120/183 (65%), Gaps = 10/183 (5%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ R++DH+SACPICRQ L  Y  +  HP NK + S I   +P+ Y ER  
Sbjct: 328 PCQHTFCARCLHRTMDHSSACPICRQTLPGYAYFQDHPCNKVVLSLILKAFPTQYDERGA 387

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV----- 115
            +++E  +   DTPI     L FP MP  LH+FEP++RLM+RRC+ +    FGM+     
Sbjct: 388 TIEAEERDARLDTPILDAQ-LSFPGMPTMLHLFEPRFRLMLRRCLATPHPSFGMIPRPRA 446

Query: 116 ----LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERV 171
                A ++   D+GTMLEIR+ + L DGRS+VET GTY+F+++E+G  DGY VGRVERV
Sbjct: 447 AAAAGAGADAGNDYGTMLEIRNVQMLPDGRSIVETWGTYRFRIMERGVLDGYTVGRVERV 506

Query: 172 DDI 174
           +DI
Sbjct: 507 EDI 509



>gi|258575785|ref|XP_002542074.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237902340|gb|EEP76741.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 678

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 160/305 (52%), Gaps = 20/305 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFC+ C+ R L+H   CPICR+ L  +      P N  +   I A +PS  +ERR 
Sbjct: 220 PCGHSFCRLCLGRVLNHADLCPICRRTLSGH--LPSSPENIRLGRLIAAFFPSRLAERRA 277

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
            +    SE  + +Q  P+FV   + +P +P FL VFEP+Y LMIRR M   +R+FGMV+ 
Sbjct: 278 TIKEDGSEEIDEVQ-VPLFVCT-VSYPSVPTFLFVFEPQYELMIRRVMTRNRRRFGMVMP 335

Query: 117 --------ACSNTYQ--DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVG 166
                   A  N  Q  ++GT+LEI     L  G+S+V   G Y+FKV+E    DGY VG
Sbjct: 336 NRTPLDPEATGNRAQFSEYGTLLEIDRLHPLGGGKSIVRATGQYRFKVLESTMVDGYAVG 395

Query: 167 RVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGN 226
           ++ERV+DIS                    ++  ++     +T  L  I   ++   R  N
Sbjct: 396 KIERVEDIS--LTEEERREASELRRSVQAADVTSDEFDRLSTHRLFQIGVTYLAKCRANN 453

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
           + WL  ++  +YG  P DP  FSYW A+V+P    ++Y LL + S RERLKL+  WI  L
Sbjct: 454 ASWLDSQIYRLYGPPPPDPRTFSYWFATVLPRPVEDRYALLPITSTRERLKLVARWIKKL 513

Query: 287 RDQWW 291
               W
Sbjct: 514 ESGEW 518



>gi|336386424|gb|EGO27570.1| hypothetical protein SERLADRAFT_435347 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 551

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (66%), Gaps = 2/174 (1%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC HSFC  C+ RSLDH+  CP+CR+ L     +   P NK I S +   +P  Y+ER  
Sbjct: 226 PCQHSFCSKCLQRSLDHSMFCPLCRKDLPGNAIFQDSPTNKVILSILLKAFPESYAERGE 285

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            L +E  +   DTPIFV   L FP MP  LH FEP+YRLM+RRC++S    FGMVL    
Sbjct: 286 TLRAEERDMRLDTPIFVCQ-LSFPGMPTLLHFFEPRYRLMLRRCLESPHPIFGMVLPPRP 344

Query: 121 TYQ-DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
             Q +FGTMLEIRS + L+DGRS+VET GT++F+++E+G  DGY VGRVER+DD
Sbjct: 345 DGQCEFGTMLEIRSVQMLSDGRSMVETWGTHRFRILERGVLDGYMVGRVERIDD 398



>gi|392568745|gb|EIW61919.1| hypothetical protein TRAVEDRAFT_27359 [Trametes versicolor
           FP-101664 SS1]
          Length = 645

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 120/183 (65%), Gaps = 11/183 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDHN +CP+CRQ L  Y+ +  HP N+ I + +   +P  Y+ER  
Sbjct: 231 PCQHTFCTRCLFRSLDHNQSCPLCRQKLPGYDYFQQHPCNRVILAILLKTFPEAYAERGA 290

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV----- 115
            +++E  +   DTP+FV   L FP MP  LH FEP+YRLM+RRC+ S    FGM+     
Sbjct: 291 TIEAEERDARLDTPVFVCQ-LSFPGMPTMLHFFEPRYRLMLRRCLDSPHPCFGMIPPPRA 349

Query: 116 -----LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVER 170
                 + S+T  D+GTML IR+ + L DGRSLVET GT++F+V+E+G+ DGY V R+ER
Sbjct: 350 APSASASGSSTGNDYGTMLAIRNVQMLPDGRSLVETWGTWRFRVMERGTLDGYMVARIER 409

Query: 171 VDD 173
           ++D
Sbjct: 410 IED 412



 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 1/95 (1%)

Query: 204 REYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEK 263
           R  T +EL+     FI+ +R G +PW++Q LN+ Y  MP D + FS+W+A ++PI E EK
Sbjct: 551 RPPTNAELMAKCHAFIDQMREG-TPWVVQHLNNNYIPMPSDAASFSFWMALLLPIDEHEK 609

Query: 264 YKLLELRSVRERLKLIVEWISSLRDQWWFARGCSI 298
            KLL +RS R RL+L+V WI  L   WWF+ GC +
Sbjct: 610 AKLLPIRSPRLRLRLVVHWIEQLNSNWWFSGGCVV 644



>gi|449549731|gb|EMD40696.1| hypothetical protein CERSUDRAFT_111271 [Ceriporiopsis subvermispora
           B]
          Length = 382

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 118/175 (67%), Gaps = 2/175 (1%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDH+SACP+CR  L  Y  +L HP NK + + +   +   Y+ER  
Sbjct: 6   PCQHTFCTRCLQRSLDHSSACPLCRTTLPEYAYFLEHPCNKVVRTLLLHAFHDEYTERGA 65

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSN 120
            +  E  N+  DTPIFV   L FP +P  LH+FEP+YRLM+RRC+++   +FGM+   S 
Sbjct: 66  AIQEEEHNSGLDTPIFVCQ-LSFPGIPTKLHLFEPRYRLMLRRCLETEDPKFGMIPPPSR 124

Query: 121 TY-QDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDI 174
                +GTML I+S ++  DGRSLVET G Y+F+++ +G++DGY VGRVE++DD+
Sbjct: 125 AGDSQYGTMLAIKSVQWFQDGRSLVETCGIYRFRILARGTRDGYVVGRVEQLDDL 179



>gi|149577008|ref|XP_001520684.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Ornithorhynchus anatinus]
          Length = 534

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 157/280 (56%), Gaps = 19/280 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ RSLDH   CP+C++ L  Y A     I + +   I+   P   +ER+ 
Sbjct: 254 PCGHSFCKNCLERSLDHAPHCPLCKESLKEYLANRRFSITQLLEELIQKYLPEELAERKR 313

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +E  N  ++ P+FV   + +P +PC LHVFEP+YRLMIRRCMQ+  +QFGM ++
Sbjct: 314 IYDEENAEHSNLTKNVPVFVC-TMAYPTVPCPLHVFEPRYRLMIRRCMQTGTKQFGMCVS 372

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            S N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 373 DSRNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLQRGMKDGYFTADIEYLEDVEV 432

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R    S+++       E   N  +P        
Sbjct: 433 EDEGEQKNLKELHDLVYSQACSWFQNLRNRFRSQILQHFGSMPEREENPQAP-------- 484

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERL 276
                P+ P+ + +W+ +V+P+    +  +L +RS+RERL
Sbjct: 485 -----PNGPA-WCWWLLAVLPVDPRYQLSVLSMRSLRERL 518



>gi|395328876|gb|EJF61266.1| hypothetical protein DICSQDRAFT_180881 [Dichomitus squalens
           LYAD-421 SS1]
          Length = 837

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 117/184 (63%), Gaps = 12/184 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PC H+FC  C+ RSLDHN  CP+CRQ L  Y+ +  HP NK I + I   +P  Y+ER  
Sbjct: 360 PCQHTFCTRCLFRSLDHNQTCPLCRQKLPGYDYFQQHPCNKVILAIILRAFPEAYAERGQ 419

Query: 61  LLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL---- 116
            ++ E  +   DTP+FV   L FP MP  LH FEP+YRLM+RRC+++    FGM+     
Sbjct: 420 AVEVEERDARLDTPVFVCQ-LGFPGMPTILHFFEPRYRLMLRRCLENPNPCFGMIPPPRA 478

Query: 117 -------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                     +T  D+G ML+IR+ + L DGRS+VET GT++F+++E+G +DGY V RVE
Sbjct: 479 APSTSANGSVSTGNDYGIMLQIRNVQMLPDGRSVVETWGTWRFRIMERGMRDGYTVARVE 538

Query: 170 RVDD 173
           R++D
Sbjct: 539 RIED 542



 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 57/87 (65%), Gaps = 1/87 (1%)

Query: 203 IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGE 262
           +R  T +EL+     FI+  R G +PW++Q L++ Y  MP DP+ FS+W+A ++PI E E
Sbjct: 680 LRPPTNAELMAKCHAFIDQTRRG-TPWVVQHLHNNYVPMPSDPASFSFWMALLLPIDEHE 738

Query: 263 KYKLLELRSVRERLKLIVEWISSLRDQ 289
           K KLL +RS R RL+L+V WI  L  Q
Sbjct: 739 KAKLLPIRSPRLRLRLVVHWIEHLNSQ 765



>gi|326470631|gb|EGD94640.1| hypothetical protein TESG_02149 [Trichophyton tonsurans CBS 112818]
          Length = 711

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 158/307 (51%), Gaps = 20/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYP--SLYSERR 59
           CGH+FC+ C+TR LD ++ CP+CR  L         P N+ + +    ++P   L   R 
Sbjct: 223 CGHTFCRSCVTRMLDISNICPVCRSKLPMI--LPDDPGNEVLNALSYFIFPRRKLSQLRG 280

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
             ++    + + + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 281 VPIEQPGASGIDELPLFVCT-VSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLNQ 339

Query: 120 NT----------YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
            +          +  +GT+LEI   E L  GR L+   G Y+F+V+     DG   GRV+
Sbjct: 340 TSELTGQSGPCVHARYGTLLEIDRLESLPGGRILIRATGRYRFRVLSCRDSDGCKTGRVQ 399

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                        LN  +R  +T EL  I   F+   R+ +S W
Sbjct: 400 RIDDIQIPFEEMIEAEELSAPKEDQHPKCLN--LR--STQELFQICTKFVTKSRSKSSSW 455

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RD 288
           L QRL S YG+ P DPS F YW  +V+PIA  EKYKLL + +VR RLK+   W+  + RD
Sbjct: 456 LNQRLLSGYGEPPTDPSIFPYWFGTVLPIASSEKYKLLSVTTVRGRLKICANWVQQIERD 515

Query: 289 QWWFARG 295
           +     G
Sbjct: 516 KTVLRSG 522



>gi|351695688|gb|EHA98606.1| LON peptidase and RING finger protein 1, partial [Heterocephalus
           glaber]
          Length = 534

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 254 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 313

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRC+Q+  +QFGM ++
Sbjct: 314 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCIQTGTKQFGMCVS 372

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 373 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 432

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 433 ENEDEVKSLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 483

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 484 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 532



>gi|513012700|ref|XP_004867722.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like, partial [Heterocephalus glaber]
          Length = 796

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 516 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 575

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRC+Q+  +QFGM ++
Sbjct: 576 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCIQTGTKQFGMCVS 634

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 635 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 694

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 695 ENEDEVKSLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 745

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 746 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 794



>gi|331245356|ref|XP_003335315.1| hypothetical protein PGTG_17095 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309314305|gb|EFP90896.1| hypothetical protein PGTG_17095 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 542

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 179/336 (53%), Gaps = 52/336 (15%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHP-----INKTIYSFI-RALYPSLY 55
           CGH+FC+PC  R+ DH   CP+CRQP      +L  P     ++  I   I + L PS  
Sbjct: 221 CGHTFCRPCFLRARDHADHCPVCRQP------FLMGPQAVPGVDLLIDRIIEQCLAPSTG 274

Query: 56  SER-RYLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGM 114
           +      ++ E  +T+   P+ V  ++ FP+MP FL +FEP+Y+L+IRR + S  R+FG+
Sbjct: 275 TAGPASAVNLEANHTI---PLMVC-SIGFPEMPMFLQIFEPRYKLLIRRSL-STDRKFGI 329

Query: 115 VL----------------------ACSNTYQD-----FGTMLEIRSAEFLADGRSLVETI 147
           V+                      A  N   +     FGT++EIR  E  ADGR L+E  
Sbjct: 330 VIPAFDHQPSSEFDHHYSTIIRPTADQNCLPNLPVHLFGTIVEIRKYETAADGRMLIEAR 389

Query: 148 GTYKFKVIEK-GSKDGYDVGRVERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIR-- 204
           G  +F++    GS DGY V ++    D+                 +Y+  +  +      
Sbjct: 390 GCDRFRIEGLLGSLDGYLVAKIRVFGDMP--VQDARLEAQAKEHALYHHHHHSSESKHHR 447

Query: 205 -EYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEK 263
            E TT +L+   ++FIE LR+G+SPW+L+RLN  +G MPD P++F+YW+A V+PI++  K
Sbjct: 448 SEPTTEKLMNTCKEFIEVLRSGSSPWILERLNDTFGPMPDQPTEFTYWIAMVLPISDQYK 507

Query: 264 YKLLELRSVRERLKLIVEWISSLRDQWWFARGCSIS 299
             LL + S R RLK++V WI  L+ Q W ++GC I+
Sbjct: 508 AALLPIISYRSRLKILVRWIRVLKSQ-WNSQGCLIT 542



>gi|326479548|gb|EGE03558.1| ATP-dependent protease CrgA [Trichophyton equinum CBS 127.97]
          Length = 711

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 157/307 (51%), Gaps = 20/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYP--SLYSERR 59
           CGH+FC+ C+TR LD ++ CP+CR  L         P N+ + +    ++P   L   R 
Sbjct: 223 CGHTFCRSCVTRMLDISNICPVCRSKLPMI--LPDDPGNEVLNALSYFIFPRRKLSQLRG 280

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
             ++    + + + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 281 VPIEQPGASGIDELPLFVCT-VSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLNQ 339

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       +  +GT+LEI   E L  GR L+   G Y+F+V+     DG   GRV+
Sbjct: 340 TGELTGQSGPCVHARYGTLLEIDRLESLPGGRILIRATGRYRFRVLSCRDSDGCKTGRVQ 399

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                        LN  +R  +T EL  I   F+   R+ +S W
Sbjct: 400 RIDDIQIPFEEMIEAEELSAPKEDQHPKCLN--LR--STQELFQICTKFVTKSRSKSSSW 455

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RD 288
           L QRL S YG+ P DPS F YW  +V+PIA  EKYKLL + +VR RLK+   W+  + RD
Sbjct: 456 LNQRLLSGYGEPPTDPSIFPYWFGTVLPIASSEKYKLLSVTTVRGRLKICANWVQQIERD 515

Query: 289 QWWFARG 295
           +     G
Sbjct: 516 KTVLRSG 522



>gi|512814589|ref|XP_004877829.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Heterocephalus glaber]
          Length = 544

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 264 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 323

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRC+Q+  +QFGM ++
Sbjct: 324 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCIQTGTKQFGMCVS 382

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 383 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 442

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 443 ENEDEVKSLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 493

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 494 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 542



>gi|511951853|ref|XP_004794312.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1, partial [Mustela putorius furo]
          Length = 597

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 317 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 376

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR MQ+  +QFGM ++
Sbjct: 377 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSMQTGTKQFGMCVS 435

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 436 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 495

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 496 EDEEDIKNLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGTEENLQA 546

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 547 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 595



>gi|504165563|ref|XP_004592740.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1, partial [Ochotona princeps]
          Length = 746

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 466 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPGELSERKK 525

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRC+Q+  +QFGM ++
Sbjct: 526 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCIQTGTKQFGMCVS 584

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F V+++G KDGY    +E ++D+  
Sbjct: 585 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFMVLKRGMKDGYCTADIEYLEDVKV 644

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 645 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 695

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 696 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 744



>gi|511875733|ref|XP_004757878.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Mustela putorius furo]
          Length = 771

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 491 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 550

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR MQ+  +QFGM ++
Sbjct: 551 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSMQTGTKQFGMCVS 609

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 610 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 669

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 670 EDEEDIKNLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGTEENLQA 720

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 721 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 769



>gi|426256550|ref|XP_004021903.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Ovis aries]
          Length = 551

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 271 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 330

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 331 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 389

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 390 DAQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIKV 449

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 450 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 500

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 501 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 549



>gi|346972040|gb|EGY15492.1| ATP-dependent protease [Verticillium dahliae VdLs.17]
          Length = 493

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 148/305 (48%), Gaps = 68/305 (22%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R LDH+  CPI  + L+ +  +                           
Sbjct: 242 CGHTFCRSCLHRVLDHSLYCPISAEALNRHREF--------------------------- 274

Query: 62  LDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSNT 121
                     D P+FV   L FP MP FLH+FEP+YRLMIR                   
Sbjct: 275 ----------DIPVFVCT-LAFPMMPTFLHIFEPRYRLMIRH---------------DAP 308

Query: 122 YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISPXXXXX 181
           + ++GT+L I +AE+  DGRSL+ETIG  +FKV+  G  DGY VG+++R+DD+S      
Sbjct: 309 FVEYGTLLRIVNAEYFPDGRSLIETIGISRFKVVRHGVLDGYMVGKIDRIDDVSIAEEEE 368

Query: 182 XXXXXXXXXXIY----NTSNPLNN--PIREYTTSE---------LIGISRDFIETLRNGN 226
                     +     NTS    +  P R  TT+E         L+  +  F++ +   +
Sbjct: 369 LEVQELQHSSLQRVASNTSQQSGSGTPPRVTTTTEDLARMPTRDLLDFAVSFVQRMSQQS 428

Query: 227 SPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
            PWL QR+ ++YG+ P D + F +W AS++P  E EKY+LL  +SVRERLK+   W+   
Sbjct: 429 VPWLAQRILTIYGECPVDAAQFPWWFASILPAKEPEKYRLLGTQSVRERLKICCAWVLEW 488

Query: 287 RDQWW 291
               W
Sbjct: 489 EANRW 493



>gi|315054609|ref|XP_003176679.1| hypothetical protein MGYG_00767 [Arthroderma gypseum CBS 118893]
 gi|311338525|gb|EFQ97727.1| hypothetical protein MGYG_00767 [Arthroderma gypseum CBS 118893]
          Length = 712

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 159/307 (51%), Gaps = 21/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPI-NKTIYSFIRALYPSLYSERRY 60
           CGH+FC+ C+TR LD ++ CP+CR+   N    L   + N  + +    L+P   +    
Sbjct: 225 CGHTFCRHCVTRMLDTSNLCPVCRR---NLPMILPDDLGNGILDTLTSILFPGRNTSPLG 281

Query: 61  LLDSELFNT--MQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLAC 118
            +  E  +T  + + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+  
Sbjct: 282 GIPIEPLDTSKIDELPLFVCT-VSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLN 340

Query: 119 SN----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRV 168
                        +  +GT+LEI   E L+ GR L+   G Y+F+V+     DG  +G V
Sbjct: 341 QTGELAGQSEPCVHAQYGTLLEIDRLESLSGGRILIRATGRYRFRVLSCRDYDGCKIGCV 400

Query: 169 ERVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSP 228
           +R+DDI                 +   SNP    +   +T +L  I   F+   R+ +S 
Sbjct: 401 QRIDDI--RIPFEEMIEAEELSALKEDSNP--KSLNILSTQKLFQICFKFVTKCRSSSSS 456

Query: 229 WLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRD 288
           WL +RL S YG+ P DP+ F YW ASV+PI   EKYKLL + +VR RLK+  +W+  +  
Sbjct: 457 WLNERLLSGYGEPPTDPAIFPYWFASVLPITSNEKYKLLSVTTVRGRLKICAKWVRQIEK 516

Query: 289 QWWFARG 295
                RG
Sbjct: 517 DKTVLRG 523



>gi|440913153|gb|ELR62640.1| hypothetical protein M91_20015, partial [Bos grunniens mutus]
          Length = 536

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 256 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 315

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 316 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 374

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 375 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIKV 434

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 435 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 485

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 486 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 534



>gi|297491233|ref|XP_002698738.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1, partial [Bos taurus]
 gi|296472403|tpg|DAA14518.1| TPA: LON peptidase N-terminal domain and ring finger 1 [Bos taurus]
          Length = 638

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 358 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 417

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 418 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 476

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 477 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIKV 536

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 537 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 587

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 588 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 636



>gi|358421624|ref|XP_003585046.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like, partial [Bos taurus]
          Length = 289

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 9   PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 68

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 69  IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 127

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 128 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIKV 187

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 188 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 238

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 239 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 287



>gi|194679204|ref|XP_001788603.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1, partial [Bos taurus]
          Length = 645

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 365 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 424

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 425 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 483

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 484 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIKV 543

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 544 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 594

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 595 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 643



>gi|507619089|ref|XP_004696240.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Echinops telfairi]
          Length = 362

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 82  PCGHSFCKNCLERCLDHTPYCPLCKESLREYLADRRYCVTQLLEELIVKYLPDELSERKK 141

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR MQ+  +QFGM ++
Sbjct: 142 VHDEETAELAHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSMQTGTKQFGMCVS 200

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 201 DTHNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 260

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P     L +
Sbjct: 261 ENEDEVTNLRELHNLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREDDLQA 311

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+RERL  I   ++   RDQ
Sbjct: 312 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLRERLTKIQHILTYFSRDQ 360



>gi|260781357|ref|XP_002585782.1| hypothetical protein BRAFLDRAFT_289769 [Branchiostoma floridae]
 gi|229270826|gb|EEN41793.1| hypothetical protein BRAFLDRAFT_289769 [Branchiostoma floridae]
          Length = 288

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 169/300 (56%), Gaps = 38/300 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFC+ C+ R LDH++ CP+C+  L  Y A     +  TI   I+      + +R+ 
Sbjct: 11  PCGHSFCRDCLLRCLDHDNKCPLCKFCLKTYLAERRDKVTDTIDKIIKHFLGKDHVKRQA 70

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
           + D   +EL    +  PIFV   + +P +PC LH+FEP+YRLM+RRC+++  RQFGM + 
Sbjct: 71  VQDEEVAELARLTEQMPIFVCT-VAYPTVPCPLHIFEPRYRLMLRRCLETGTRQFGMCIY 129

Query: 117 ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
           +    Y + GT+LEIR   F+ DGRS+V+T+G  +FKV+++G +DGY++ +VE ++D+  
Sbjct: 130 SPDGGYMEHGTVLEIRDVSFMPDGRSVVDTVGKSRFKVLDRGMRDGYNIAKVEPMEDVRV 189

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                                 LN  + +  TS        ++++L  GN+   + R+  
Sbjct: 190 EGEDKAALER------------LNAAVYQEATS--------WVQSL-PGNT---IDRILQ 225

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
            +G+MPD  +D         +++W+ +++P+ +  +Y +L + S+++RL+ +   +S +R
Sbjct: 226 HFGNMPDCEADPQANPDGPSWTWWLLAILPVDQRIQYTILVMNSLKDRLEALRRILSCIR 285



>gi|466045355|ref|XP_004277206.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Orcinus orca]
          Length = 770

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 490 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 549

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 550 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 608

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N + D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 609 DTQNGFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 668

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 669 ENEEEIENLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 719

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 720 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 768



>gi|301768341|ref|XP_002919591.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Ailuropoda melanoleuca]
          Length = 572

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 292 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 351

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 352 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 410

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 411 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 470

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 471 ENEEEIKNLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 521

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 522 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 570



>gi|350594537|ref|XP_003134232.3| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Sus scrofa]
          Length = 897

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 167/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 617 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 676

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LH+FEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 677 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHIFEPRYRLMIRRSIQTGTKQFGMCVS 735

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 736 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 795

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 796 ENEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 846

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           V    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 847 V----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 895



>gi|345781662|ref|XP_540001.3| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1, partial [Canis lupus familiaris]
          Length = 737

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 457 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 516

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 517 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 575

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 576 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 635

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 636 ENEEEIKNLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 686

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 687 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 735



>gi|472387641|ref|XP_004413159.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Odobenus rosmarus divergens]
          Length = 771

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 491 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 550

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGM-VL 116
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM V 
Sbjct: 551 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVT 609

Query: 117 ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 610 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 669

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 670 ENEEEIKNLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 720

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 721 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 769



>gi|507946646|ref|XP_004682255.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Condylura cristata]
          Length = 768

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 488 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 547

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 548 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 606

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 607 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 666

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 667 ENEDEIKNLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 717

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 718 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 766



>gi|281351750|gb|EFB27334.1| hypothetical protein PANDA_008229 [Ailuropoda melanoleuca]
          Length = 534

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 254 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 313

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 314 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 372

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 373 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 432

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 433 ENEEEIKNLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 483

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 484 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 532



>gi|410956143|ref|XP_003984704.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Felis catus]
          Length = 546

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 266 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKQ 325

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 326 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 384

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 385 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 444

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 445 ENDEEIKNLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 495

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 496 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 544



>gi|478509170|ref|XP_004428863.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Ceratotherium simum simum]
          Length = 416

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 136 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 195

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 196 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 254

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 255 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVEV 314

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 315 ASEGEMENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 365

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 366 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 414



>gi|194373867|dbj|BAG62246.1| unnamed protein product [Homo sapiens]
          Length = 362

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 82  PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 141

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 142 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 200

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    VE ++D+  
Sbjct: 201 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADVEYLEDVKV 260

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 261 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 311

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 312 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 360



>gi|505851010|ref|XP_004622914.1| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           ring finger 1 [Sorex araneus]
          Length = 505

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 225 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 284

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 285 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 343

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+ +G KDGY    +E ++D+  
Sbjct: 344 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLRRGMKDGYCTADIEYLEDVKV 403

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 404 ENEDEVKNLRELHDMVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 454

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 455 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 503



>gi|431902296|gb|ELK08797.1| LON peptidase N-terminal domain and RING finger protein 1 [Pteropus
           alecto]
          Length = 724

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 444 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 503

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 504 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 562

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E + D+  
Sbjct: 563 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLADVKA 622

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 623 LCDSEIENLKQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 673

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 674 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 722



>gi|18676903|dbj|BAB85052.1| unnamed protein product [Homo sapiens]
          Length = 291

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 11  PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 70

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 71  IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 129

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 130 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 189

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 190 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 240

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 241 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 289



>gi|67969038|dbj|BAE00874.1| unnamed protein product [Macaca fascicularis]
          Length = 315

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 35  PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 94

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 95  IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 153

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 154 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 213

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 214 EDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 264

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 265 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 313



>gi|87080813|ref|NP_689484.3| LON peptidase N-terminal domain and RING finger protein 1 [Homo
           sapiens]
 gi|257051033|sp|Q17RB8.2|LONF1_HUMAN RecName: Full=LON peptidase N-terminal domain and RING finger
           protein 1; AltName: Full=RING finger protein 191
          Length = 773

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 493 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 552

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 553 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 611

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 612 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 671

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 672 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 722

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 723 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 771



>gi|114618856|ref|XP_519609.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 isoform 2 [Pan troglodytes]
          Length = 762

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 482 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 541

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 542 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 600

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 601 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 660

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 661 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 711

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 712 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 760



>gi|194386354|dbj|BAG59741.1| unnamed protein product [Homo sapiens]
          Length = 505

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 225 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 284

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 285 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 343

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 344 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 403

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 404 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 454

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 455 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 503



>gi|402877572|ref|XP_003902497.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 isoform 2 [Papio anubis]
          Length = 762

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 482 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 541

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 542 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 600

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 601 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 660

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 661 EDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 711

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 712 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 760



>gi|426358896|ref|XP_004046725.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Gorilla gorilla gorilla]
          Length = 405

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 244 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 303

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 304 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 354

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 403



>gi|395739406|ref|XP_002818872.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Pongo abelii]
          Length = 405

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 244 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 303

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 304 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 354

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 403



>gi|332825576|ref|XP_003311659.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 isoform 1 [Pan troglodytes]
          Length = 773

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 493 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 552

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 553 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 611

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 612 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 671

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 672 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 722

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 723 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 771



>gi|109658896|gb|AAI17386.1| LONRF1 protein [Homo sapiens]
 gi|109659074|gb|AAI17382.1| LONRF1 protein [Homo sapiens]
          Length = 416

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 136 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 195

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 196 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 254

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 255 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 314

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 315 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 365

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 366 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 414



>gi|403288865|ref|XP_003935597.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Saimiri boliviensis boliviensis]
          Length = 405

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 244 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 303

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 304 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 354

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 403



>gi|402877570|ref|XP_003902496.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 isoform 1 [Papio anubis]
          Length = 773

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 493 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 552

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 553 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 611

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 612 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 671

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 672 EDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 722

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 723 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 771



>gi|297298947|ref|XP_002805308.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like, partial [Macaca mulatta]
          Length = 675

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 395 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 454

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 455 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 513

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 514 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 573

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 574 EDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 624

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 625 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 673



>gi|332215214|ref|XP_003256737.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Nomascus leucogenys]
          Length = 405

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 244 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 303

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 304 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 354

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 403



>gi|390473648|ref|XP_002756978.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Callithrix jacchus]
          Length = 405

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 244 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 303

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 304 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 354

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 403



>gi|470618650|ref|XP_004317899.1| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 1-like [Tursiops truncatus]
          Length = 712

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 432 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 491

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 492 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 550

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N + D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 551 DTQNGFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 610

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 611 ENEEEIENLRQLHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPGREENLQA 661

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 662 I----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 710



>gi|149742647|ref|XP_001494772.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Equus caballus]
          Length = 552

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   +    P   SER+ 
Sbjct: 272 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELMVKYLPDELSERKK 331

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 332 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 390

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 391 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 450

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 451 EKEDEIENLRQLHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPGREENLQA 501

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 502 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 550



>gi|444706580|gb|ELW47914.1| LON peptidase N-terminal domain and RING finger protein 1, partial
           [Tupaia chinensis]
          Length = 493

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 213 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 272

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 273 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 331

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 332 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 391

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 392 ENEDEIKTLTELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREEDLQA 442

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L +++++ERL  I   ++   RDQ
Sbjct: 443 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKALKERLTKIQHILTYFSRDQ 491



>gi|507566586|ref|XP_004666937.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Jaculus jaculus]
          Length = 716

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 436 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 495

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 496 VYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 554

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 555 DAQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 614

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 615 ESGDKIQSLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 665

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 666 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 714



>gi|469832261|ref|NP_001264163.1| LON peptidase N-terminal domain and RING finger protein 1 [Danio
           rerio]
          Length = 751

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 156/301 (51%), Gaps = 37/301 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  Y A+  + + + + + I+   P  +SER  
Sbjct: 471 PCGHTFCTNCLERCLDHNPQCPLCKESLKEYLAFRKYTVTQVLDNIIKQHLPKEHSERVK 530

Query: 61  LL---DSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L      EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRCM++  RQFGM ++
Sbjct: 531 LHAEETKELSDLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCMETGTRQFGMCIS 589

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G ML+IRS  FL DGRS+V+TIG  +F V+ +G +DGY +  +E + D   
Sbjct: 590 DPQKGFVDHGCMLQIRSVHFLPDGRSVVDTIGGKRFHVLSRGMRDGYCIANIEYLQDTKV 649

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+                    +R + + L N     +LQ    
Sbjct: 650 NDEEDLKKLQVLHDQVYDQ-------------------ARKWFQNLENRFRNQILQH--- 687

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
            +G MP+  +D           +W+ +V+P+    +  +L + +++ERL  I   ++ L+
Sbjct: 688 -FGPMPEREADIQATPNGPACCWWLLAVLPVDPRYQLSVLSMTTLKERLVKIQHILTYLQ 746

Query: 288 D 288
           +
Sbjct: 747 N 747



>gi|471399766|ref|XP_004382852.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Trichechus manatus latirostris]
          Length = 747

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A     + + +   I    P   SER+ 
Sbjct: 467 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRFCVTQLLEELIVKYLPDELSERKK 526

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 527 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 585

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 586 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDIEV 645

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 646 ENEDEIKNLRELHNLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREEDLQA 696

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 697 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 745



>gi|432117305|gb|ELK37692.1| LON peptidase N-terminal domain and RING finger protein 1 [Myotis
           davidii]
          Length = 618

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 338 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 397

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 398 IYDEETAELSHLTKNVPIFVCT-IAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 456

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N + D+G ML+IR+  FL DGRS+V+T+G  +FKV+++G KDGY    +E ++D+  
Sbjct: 457 DKQNGFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFKVLKRGMKDGYCTADIEYLEDVKV 516

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 517 ENEDELESLRQLHNLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPRREENLQA 567

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 568 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 616



>gi|507653327|ref|XP_004633337.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Octodon degus]
          Length = 416

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 136 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 195

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 196 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 254

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 255 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 314

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 315 ENEDEVKCLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 365

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 366 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 414



>gi|354471552|ref|XP_003498005.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Cricetulus griseus]
          Length = 547

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 267 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 326

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 327 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 385

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 386 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 445

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 446 ENGDEIQSLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 496

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 497 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 545



>gi|348553712|ref|XP_003462670.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Cavia porcellus]
          Length = 854

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 573 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 632

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 633 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 691

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 692 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 751

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 752 ENEDEVKNLRELHDLVYSQACGWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 802

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 803 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 851



>gi|395850291|ref|XP_003797726.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Otolemur garnettii]
          Length = 746

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 164/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 466 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 525

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  +  PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 526 IYDEETAELSHLTKSVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 584

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 585 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 644

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P     L +
Sbjct: 645 ENEDEIKKLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREDNLQA 695

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 696 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 744



>gi|443716928|gb|ELU08221.1| hypothetical protein CAPTEDRAFT_197542 [Capitella teleta]
          Length = 311

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 156/291 (53%), Gaps = 36/291 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH FC+ C+ R LDH + CP+C+  L  Y A     + + I   I+A +P  ++ER+ 
Sbjct: 25  PCGHVFCRHCLDRCLDHTTVCPLCKTSLSEYLAERRQAVTEAIVEIIQAYFPQDFAERQQ 84

Query: 61  LLDSEL-------FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFG 113
             + +L           Q+ PIFV   L FPKM C LH+FEP+YRLMIR+CM++  RQFG
Sbjct: 85  QHEQDLAELSRMGAGDQQEVPIFVCT-LSFPKMVCPLHIFEPRYRLMIRQCMEAGTRQFG 143

Query: 114 MVLAC--SNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERV 171
           M ++    +++ ++G MLEIR  ++  DGRS+V+T+G  +FKVI +G ++GYD  +VE +
Sbjct: 144 MCVSLQEGDSFSEYGCMLEIRDVQYFPDGRSVVDTVGGRRFKVISRGMRNGYDTAKVELL 203

Query: 172 DDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLL 231
            D                         L+N +R+         S  +++ L +G+   + 
Sbjct: 204 SD-----------YIDETPEALTALQKLHNSVRQD--------SEKWMDMLPSGHKAKIQ 244

Query: 232 QRLNSVYG------DMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERL 276
           Q +  +         + D P+ + +W+ SV+P+    K  +L + S+++RL
Sbjct: 245 QHMGPLPNMEVNPLSLTDGPA-WLWWLISVLPLDPKAKLSILAMCSLKDRL 294



>gi|148703520|gb|EDL35467.1| mCG122352 [Mus musculus]
          Length = 645

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 365 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 424

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 425 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 483

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 484 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 543

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 544 ENGDEIRSLRELHDSVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 594

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 595 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 643



>gi|291409154|ref|XP_002720877.1| PREDICTED: LON peptidase N-terminal domain and ring finger 1
           [Oryctolagus cuniculus]
          Length = 808

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 528 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 587

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 588 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 646

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 647 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 706

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 707 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 757

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 758 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 806



>gi|149057966|gb|EDM09209.1| LON peptidase N-terminal domain and ring finger 1 (predicted)
           [Rattus norvegicus]
          Length = 415

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 135 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 194

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 195 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 253

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 254 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 313

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 314 ENGDEIRSLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 364

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 365 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 413



>gi|397471861|ref|XP_003846201.1| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 1 [Pan paniscus]
          Length = 622

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 166/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 342 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 401

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 402 IYDEETAELSHLTKNVPIFVCT-MAYPCVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 460

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 461 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 520

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 521 ENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 571

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 572 A----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 620



>gi|293342466|ref|XP_001066614.2| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 1 [Rattus norvegicus]
          Length = 854

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 574 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 633

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 634 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 692

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 693 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 752

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 753 ENGDEIRSLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 803

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 804 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 852



>gi|392354018|ref|XP_224907.6| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 1 [Rattus norvegicus]
          Length = 853

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 573 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEDLIVKYLPDELSERKK 632

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 633 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 691

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 692 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 751

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 752 ENGDEIRSLRELHDLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 802

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 803 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 851



>gi|124487241|ref|NP_001074619.1| LON peptidase N-terminal domain and RING finger protein 1 [Mus
           musculus]
          Length = 837

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 557 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 616

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 617 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 675

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 676 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKI 735

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 736 ENGDEIRSLRELHDSVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREENLQA 786

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S+ ERL  I   ++   RDQ
Sbjct: 787 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHILTYFSRDQ 835



>gi|355779521|gb|EHH63997.1| RING finger protein 191, partial [Macaca fascicularis]
          Length = 534

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 163/294 (55%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH FCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 254 PCGHLFCKNCLERCLDHAPHCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 313

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 314 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 372

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 373 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKV 432

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++            G+ P   + L +
Sbjct: 433 EDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREENLQA 483

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 484 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 532



>gi|472371601|ref|XP_004405298.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Odobenus rosmarus divergens]
          Length = 906

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 154/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 628 PCGHTFCLKCLERCLDHNAKCPLCKDGLAQCLASRKYSKNVIMEELIAKFLPEELKERRR 687

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 688 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 746

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            +   + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 747 DTVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGHRDGYNTADIEYIED--- 803

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + E  +S        +  +L++     L  R+ S
Sbjct: 804 ---------QKVQGDDYAELMGLHNCVYEQASS--------WFHSLKSS----LKNRILS 842

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 843 HFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 894



>gi|498936553|ref|XP_004541190.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Maylandia zebra]
          Length = 595

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 161/304 (52%), Gaps = 47/304 (15%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK CI RSLDHN  CP+C+QPL  Y     +     +   +  L+    +ER+ 
Sbjct: 319 PCGHTFCKNCIERSLDHNLRCPLCKQPLQEYFRNRKYNPTVLLQDIMTRLFAPQLAERKQ 378

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D+E   L N  +D PIF+   + +P +PC LHVFEP+YRLM+RRCM++  ++FGM   
Sbjct: 379 VHDAEMAELSNLTKDIPIFICT-VAYPGVPCPLHVFEPRYRLMMRRCMETGTKKFGM--- 434

Query: 118 CS----NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
           CS      + D+G MLEI   E L DGRS VETIG  +FKV+++G +DGY    +E ++D
Sbjct: 435 CSYEHGRGFADYGCMLEILDLELLPDGRSYVETIGGSRFKVLKRGQRDGYHTADIEYLED 494

Query: 174 ISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
           I                 +  +   L   + +    +    ++D+ + L       + ++
Sbjct: 495 IK----------------VDGSELELLQRLHDSVYQQ----AQDWYQRL----GSRIREQ 530

Query: 234 LNSVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRER---LKLIVE 281
           +N  YG MPD   +           +W+ SV+ +    +  +L L S+++R   L+L++E
Sbjct: 531 INRQYGAMPDKEDNIQASPNGPGWCWWLLSVLQLDPAYQTTVLSLNSLKDRLGHLRLVLE 590

Query: 282 WISS 285
           + S 
Sbjct: 591 YFSQ 594



>gi|119584264|gb|EAW63860.1| LON peptidase N-terminal domain and ring finger 1 [Homo sapiens]
          Length = 409

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 164/298 (55%), Gaps = 24/298 (8%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 125 PCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 184

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 185 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 243

Query: 118 CSN-----TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVD 172
            +      ++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++
Sbjct: 244 DTQNRFSFSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLE 303

Query: 173 DISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQ 232
           D+                 +Y+ +      +R+   S+++            G+ P   +
Sbjct: 304 DVKVENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQ---------HFGSMPEREE 354

Query: 233 RLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
            L +     P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 355 NLQAA----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 407



>gi|348516870|ref|XP_003445960.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Oreochromis niloticus]
          Length = 595

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 161/304 (52%), Gaps = 47/304 (15%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK CI RSLDHN  CP+C+QPL  Y     +     +   +  L+    +ER+ 
Sbjct: 319 PCGHTFCKNCIERSLDHNLRCPLCKQPLQEYFRNRKYNPTVLLQDIMTQLFAPQLAERKQ 378

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL N  +D PIFV   + +P +PC LHVFEP+YRLM+RRCM++  ++FGM   
Sbjct: 379 VHDAEMAELSNLTKDIPIFVCT-VAYPGVPCPLHVFEPRYRLMMRRCMETGTKKFGM--- 434

Query: 118 CS----NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
           CS      + D+G MLEI   E L DGRS VETIG  +F+V+++G +DGY    +E ++D
Sbjct: 435 CSYEHGRGFADYGCMLEILDLELLPDGRSYVETIGGSRFRVLKRGQRDGYHTADIEYLED 494

Query: 174 ISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
           I                 +  +   L   + +    +    ++D+ + L       + ++
Sbjct: 495 IR----------------VDGSELELLQRLHDSVYQQ----AQDWYQRL----GSRIREQ 530

Query: 234 LNSVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRER---LKLIVE 281
           +N  YG MPD   +           +W+ SV+ +    +  +L L S+++R   L+L++E
Sbjct: 531 INRQYGAMPDKEDNIQASPNGPGWCWWLLSVLQLDPAYQTTVLSLNSLKDRLGHLRLVLE 590

Query: 282 WISS 285
           + S 
Sbjct: 591 YFSQ 594



>gi|113931418|ref|NP_001039158.1| LON peptidase N-terminal domain and ring finger 2 [Xenopus
           (Silurana) tropicalis]
 gi|89272518|emb|CAJ83583.1| ring finger protein 127 [Xenopus (Silurana) tropicalis]
 gi|113197933|gb|AAI21308.1| ring finger protein 127 [Xenopus (Silurana) tropicalis]
          Length = 771

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 149/292 (51%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  Y AY  +         I    P   +ER+ 
Sbjct: 492 PCGHTFCLKCLERCLDHNPHCPLCKEDLAQYLAYRAYKKTLLTEELITRYLPEELTERKK 551

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRR M++  +QFGM +A
Sbjct: 552 IYDEEMKELSNLHKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRSMETGTKQFGMCIA 610

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G ML++R  +F  DGRS+V+TIG  +FKV+  G +DGY+   +E ++D   
Sbjct: 611 DDLKGFADYGCMLQVRDVKFFPDGRSVVDTIGLNRFKVLSHGQRDGYNTANIEYLED--- 667

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + +            +  +L++     +L    S
Sbjct: 668 ---------KKMEGQEYEELLVLHNSVYDQALG--------WFTSLKDNMKSQIL----S 706

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP   SD         + +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 707 HFGQMPSKESDPQNGENGPAWCWWMLAVLPLESKAQLTILAMTSLKDRLHAI 758



>gi|156382456|ref|XP_001632569.1| predicted protein [Nematostella vectensis]
 gi|156219627|gb|EDO40506.1| predicted protein [Nematostella vectensis]
          Length = 204

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 113/179 (63%), Gaps = 6/179 (3%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH FC+ C+ RSLDH   CPICR  L  + A     +   I   ++  +P  Y +R+ 
Sbjct: 22  PCGHVFCRACLNRSLDHRPGCPICRSSLTQFLAARKENVTVAIEMLLKTFFPKDYEDRKL 81

Query: 61  LLDSELF----NTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL 116
             + ++     NT ++ P+FV   L FP +PC LH+FEP+YRLM+R+CM+S  RQFGM +
Sbjct: 82  QHEEDMAMLASNTSEEIPVFVCT-LAFPLIPCPLHIFEPRYRLMVRQCMESGARQFGMCM 140

Query: 117 -ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDI 174
               + + +FGTMLE+R   +L DGRS V+T+G  +FKV+ +G +DGY V RVE + D+
Sbjct: 141 YDDEHDFSEFGTMLEVREVRYLPDGRSFVDTVGGRRFKVLSRGMRDGYSVARVEWIQDV 199



>gi|507575992|ref|XP_004671537.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like isoform X2 [Jaculus jaculus]
          Length = 713

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 150/295 (50%), Gaps = 44/295 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 435 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 494

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 495 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 553

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 554 DPIKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 610

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLR---NGNSPWLLQR 233
                                     ++    +EL+G+     E      +   P L  R
Sbjct: 611 ------------------------QKVQGEDCAELMGLHNCVYEQASLWFHSLKPSLKNR 646

Query: 234 LNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 647 ILNHFGPMPEKDVDPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 701



>gi|507575990|ref|XP_004671536.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like isoform X1 [Jaculus jaculus]
          Length = 754

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 150/295 (50%), Gaps = 44/295 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 476 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 535

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 536 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 594

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 595 DPIKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 651

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLR---NGNSPWLLQR 233
                                     ++    +EL+G+     E      +   P L  R
Sbjct: 652 ------------------------QKVQGEDCAELMGLHNCVYEQASLWFHSLKPSLKNR 687

Query: 234 LNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 688 ILNHFGPMPEKDVDPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 742



>gi|465952885|gb|EMP25121.1| LON peptidase N-terminal domain and RING finger protein 1 [Chelonia
           mydas]
          Length = 527

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 159/294 (54%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK C+ R LDH   CP+C++ L  Y A   + +   +   +        SER+ 
Sbjct: 247 PCGHTFCKNCLERCLDHAPQCPLCKESLKEYLAIRKYSVTVLLEELVVKYLADELSERKR 306

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ P+FV   + +P +PC LHVFEP+YRLMIRR M++  +QFGM ++
Sbjct: 307 IHDEETAELSDLTKNVPVFVCT-MAYPTVPCPLHVFEPRYRLMIRRSMETGTKQFGMCVS 365

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N + D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++DI  
Sbjct: 366 DPQNNFADYGCMLQIRNIHFLPDGRSVVDTVGGKRFRVLQRGMKDGYCTADIEYLEDIKV 425

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +YN +      +R    S+++            G  P   + L +
Sbjct: 426 ADEEELKKLRELHDIVYNQACGWFQSLRNKFRSQILQ---------HFGPMPEREENLQA 476

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
           +    P+ P+ + +W+ +V+P+    +  +L + S++ERL  I   ++   RDQ
Sbjct: 477 I----PNGPA-WCWWLLAVLPVDPRYQISVLSMMSLKERLIKIQHILTYFSRDQ 525



>gi|291407849|ref|XP_002720257.1| PREDICTED: LON peptidase N-terminal domain and ring finger 3
           [Oryctolagus cuniculus]
          Length = 734

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 456 PCGHTFCLKCLERCLDHNAKCPLCKDGLAQCLASRKYSKNVIMEELIAKFLPEELKERRR 515

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 516 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 574

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 575 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 631

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 632 ------------------------QKVQGEDCAELLGLHNCVYEQA----SSWFHSLKSS 663

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ S +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 664 LKNRILSHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 722



>gi|291229803|ref|XP_002734860.1| PREDICTED: LON peptidase N-terminal domain and ring finger 2-like
           [Saccoglossus kowalevskii]
          Length = 639

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 152/302 (50%), Gaps = 37/302 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH FC  C+ R LDH++ CP+C+  L  Y A     I   +   I+ ++P+ Y ER+ 
Sbjct: 360 PCGHMFCCHCLDRCLDHSNRCPLCKDSLIEYLAERRKNITVVMEKLIKMIFPNEYEERKK 419

Query: 61  LLDSEL--FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLAC 118
           L DSE+     + + P+FV   L  P + C LH+FEP+YRLM+R+CM++  RQFGM L  
Sbjct: 420 LHDSEMEALANISEIPVFVCT-LALPSIVCPLHIFEPRYRLMVRQCMETGARQFGMCLPN 478

Query: 119 S--NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
           S  N + D+G MLEIR  + + DGRS+V+ IG  +FKV+E+G +DGY   +V  + D   
Sbjct: 479 SDENGFVDYGCMLEIRDVQHIPDGRSIVDCIGGRRFKVLERGMRDGYHTAKVVFIKDAKV 538

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y  S    N           G++      +RN            
Sbjct: 539 EDEDELQQLKSLHLEVYEESAKWFN-----------GLNLIIKHQIRNH----------- 576

Query: 237 VYGDMP---DDPSD------FSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLR 287
             G+MP   DDP +      +++W+  V+P+    +  +L   +++ERL  +   ++ + 
Sbjct: 577 -LGNMPACDDDPQEATHGPKWTWWLLGVLPLDSNTQMAVLSTTTLKERLIALRRALNDVS 635

Query: 288 DQ 289
            Q
Sbjct: 636 SQ 637



>gi|302659405|ref|XP_003021393.1| ATP-dependent protease (CrgA), putative [Trichophyton verrucosum
           HKI 0517]
 gi|291185290|gb|EFE40775.1| ATP-dependent protease (CrgA), putative [Trichophyton verrucosum
           HKI 0517]
          Length = 707

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 156/307 (50%), Gaps = 20/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPS--LYSERR 59
           CGH+FC+ C+ R LD ++ CP+CR+ L         P N+ + +F   ++P   L   R 
Sbjct: 223 CGHTFCRSCVARMLDISNLCPVCRRNLPMI--LPDDPGNRALNAFSYFIFPERRLSQIRG 280

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
             ++    + + + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 281 VPVEQPGASKIDELPLFVCT-VSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLNQ 339

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       +  +GT+LEI   E L  GR L+   G Y+F+V+     DG  +G V+
Sbjct: 340 TGERTGQSEPCVHARYGTLLEIDRLESLPGGRILIRATGRYRFRVLSSRDYDGCKIGHVQ 399

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                        LN      +T EL  I   F+   R+ +S W
Sbjct: 400 RIDDIRIPFEEMIEAEELSAPKEGQHPKCLN----LLSTQELFQICTKFVTKSRSSSSSW 455

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RD 288
           L +RL S YG+ P DP+ F YW  +V+PIA  EKY LL + +VR RLK+  +W+  + RD
Sbjct: 456 LNERLLSGYGEPPTDPAIFPYWFGTVLPIASSEKYSLLSVTTVRGRLKICADWVRQIERD 515

Query: 289 QWWFARG 295
           +     G
Sbjct: 516 KTVLRSG 522



>gi|300798556|ref|NP_001178063.1| LON peptidase N-terminal domain and RING finger protein 3 [Bos
           taurus]
 gi|296471329|tpg|DAA13444.1| TPA: LON peptidase N-terminal domain and ring finger 3 isoform 2
           [Bos taurus]
          Length = 759

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 540

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHSCVYEQA----SSWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ S +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILSHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|296471328|tpg|DAA13443.1| TPA: LON peptidase N-terminal domain and ring finger 3 isoform 1
           [Bos taurus]
          Length = 718

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 499

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHSCVYEQA----SSWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ S +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILSHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|488534041|ref|XP_004458738.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Dasypus novemcinctus]
          Length = 778

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 153/299 (51%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P   +ERR 
Sbjct: 500 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELNERRR 559

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 560 LHEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 618

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            +   + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 619 DTVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 675

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     +     +EL+G+     E      S W       
Sbjct: 676 ------------------------EKVHGEDCAELMGLHNCVYEQA----SSWFHSLKSS 707

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           +  R+ S +G MP+  +D         + +W+ +V+P+    +   L ++S+++RL  I
Sbjct: 708 MKNRILSHFGPMPEKDADPQINPNGPAWCWWILAVLPLESRAQLPFLAMKSLKDRLNGI 766



>gi|488534043|ref|XP_004458739.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Dasypus novemcinctus]
          Length = 737

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 153/299 (51%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P   +ERR 
Sbjct: 459 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELNERRR 518

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 519 LHEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 577

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            +   + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 578 DTVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 634

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     +     +EL+G+     E      S W       
Sbjct: 635 ------------------------EKVHGEDCAELMGLHNCVYEQA----SSWFHSLKSS 666

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           +  R+ S +G MP+  +D         + +W+ +V+P+    +   L ++S+++RL  I
Sbjct: 667 MKNRILSHFGPMPEKDADPQINPNGPAWCWWILAVLPLESRAQLPFLAMKSLKDRLNGI 725



>gi|512910574|ref|XP_004901858.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Heterocephalus glaber]
          Length = 651

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 373 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 432

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 433 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 491

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 492 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 548

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 549 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 580

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 581 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 639



>gi|512002345|ref|XP_004818680.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Mustela putorius furo]
          Length = 656

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 153/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 378 PCGHTFCLKCLERCLDHNAKCPLCKDGLAQCLASRKYSKNVIMEELIAKFLPEELKERRR 437

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 438 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 496

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +G +DGY+   +E ++D   
Sbjct: 497 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQGHRDGYNTADIEYIED--- 553

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + E  +S        +  +L++     L  R+ S
Sbjct: 554 ---------QKVQGDDYAELMGLHNCVYEQASS--------WFHSLKSS----LKNRIIS 592

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 593 HFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 644



>gi|348563693|ref|XP_003467641.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like [Cavia porcellus]
          Length = 917

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 639 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 698

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 699 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 757

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 758 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 814

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 815 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 846

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 847 LKTRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 905



>gi|351710907|gb|EHB13826.1| LON peptidase and RING finger protein 3 [Heterocephalus glaber]
          Length = 597

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 319 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 378

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 379 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 437

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 438 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 494

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 495 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 526

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 527 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 585



>gi|511884703|ref|XP_004762181.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Mustela putorius furo]
          Length = 827

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 153/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 549 PCGHTFCLKCLERCLDHNAKCPLCKDGLAQCLASRKYSKNVIMEELIAKFLPEELKERRR 608

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 609 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 667

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +G +DGY+   +E ++D   
Sbjct: 668 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQGHRDGYNTADIEYIED--- 724

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + E  +S        +  +L++     L  R+ S
Sbjct: 725 ---------QKVQGDDYAELMGLHNCVYEQASS--------WFHSLKSS----LKNRIIS 763

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 764 HFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 815



>gi|513021878|ref|XP_004872205.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X1 [Heterocephalus glaber]
          Length = 772

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 494 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 553

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 554 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 612

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 613 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 669

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 670 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 701

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 702 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 760



>gi|327307894|ref|XP_003238638.1| hypothetical protein TERG_00629 [Trichophyton rubrum CBS 118892]
 gi|326458894|gb|EGD84347.1| hypothetical protein TERG_00629 [Trichophyton rubrum CBS 118892]
          Length = 706

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 157/307 (51%), Gaps = 20/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRYL 61
           CGH+FC+ C+ R LD ++ CP+CR+ L         P N T+ +F   ++P     +   
Sbjct: 223 CGHTFCRSCVARMLDISNLCPVCRRNLPMI--LPDDPGNGTLNAFSYFIFPERKLSQLRG 280

Query: 62  LDSELFNT--MQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
           + +E  +T  + + P+F+   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 281 VPNEQLDTSKIDELPLFIC-TVSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLNQ 339

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       +  +GT+LEI   E L  GR L+   G Y+F+V+     DG  +G V+
Sbjct: 340 TGELAGQSEPRVHAQYGTLLEIDRLESLPGGRILIRATGLYRFRVLSSRDYDGCKIGCVK 399

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                        LN      +T EL  I   F+   R+ +S W
Sbjct: 400 RIDDIRIPFEEMIEAEELSAPKEGQHPKCLNF----LSTQELFQICNRFVTKSRSSSSSW 455

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RD 288
           L +RL S YG+ P DP+ F YW  +V+PIA  EKY LL + +VR RLK+  +W+  + RD
Sbjct: 456 LNERLLSGYGEPPTDPAIFPYWFGTVLPIASSEKYNLLSVTTVRGRLKICADWVRQIERD 515

Query: 289 QWWFARG 295
           +     G
Sbjct: 516 KTVLRSG 522



>gi|345807557|ref|XP_003435631.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Canis lupus familiaris]
          Length = 775

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 497 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 556

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 557 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 615

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +G +DGY+   +E ++D   
Sbjct: 616 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQGQRDGYNTADIEYIED--- 672

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 673 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 704

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ S +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 705 LKNRILSHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 763



>gi|513021880|ref|XP_004872206.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X2 [Heterocephalus glaber]
          Length = 731

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 453 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 512

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 513 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 571

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 572 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 628

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 629 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 660

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 661 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 719



>gi|512859453|ref|XP_002934588.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Xenopus (Silurana) tropicalis]
          Length = 738

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH++C  C+ R LDHN  CP+C++ L  Y A       + +   I + +P    +R+ 
Sbjct: 459 PCGHTYCLKCLERCLDHNPKCPLCKEDLCEYLAIRTFCKTELMEDLIASYFPDELIDRKT 518

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM + 
Sbjct: 519 VYEEEIAELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIG 577

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            S   + D+G MLEIR+ EF ADGRS+V++IG  +FKVI    +DGY+   +E ++D   
Sbjct: 578 DSVKGFADYGCMLEIRNVEFFADGRSVVDSIGKRRFKVIRHSQRDGYNTADIEYIEDHKA 637

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y+    L+N + +         + ++  TL+    P L  R+ S
Sbjct: 638 QGQE------------YDDLLTLHNAVYDQ--------AFNWFSTLK----PALKSRILS 673

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP +  D         + +W+ +V+P+    +   L + S+++RL  I
Sbjct: 674 HFGPMPANDCDIQANPNGPAWCWWILAVLPLESRAQLPFLAMTSLKDRLTGI 725



>gi|410989317|ref|XP_004000909.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Felis catus]
          Length = 491

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 152/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P  + ERR 
Sbjct: 213 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEEFKERRR 272

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 273 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 331

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V+++G  +F+V+ +G +DGY+   +E ++D   
Sbjct: 332 DPVKGFAEYGCILEIRNVQFFADGRSVVDSVGKRRFRVLHQGQRDGYNTADIEYIED--- 388

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 389 ------------------------QKVQGEDQAELMGLHNCVYEQA----SSWFHSLKTS 420

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 421 LKNRILNHFGPMPEKDADPQVSPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 479



>gi|335306474|ref|XP_003135396.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Sus scrofa]
          Length = 752

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 474 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 533

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 534 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 592

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 593 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 649

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 650 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 681

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 682 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 740



>gi|327284914|ref|XP_003227180.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           2-like [Anolis carolinensis]
          Length = 779

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 150/288 (52%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +  +      I    P   SER+ 
Sbjct: 500 PCGHTFCLKCLERCLDHNPHCPLCKEKLSEFLASRTYKKSVLTEELIVRYLPEELSERKK 559

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + + E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 560 VYEEEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 618

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G MLE+R  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 619 DELKGFADYGCMLEVRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 675

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + +   S        +  +L++     +L    S
Sbjct: 676 ---------KKVEGAEYEELVRLHNSVYDQAVS--------WFTSLKDNMKAQILNHFGS 718

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G   +  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 719 MPGKENEPQSNPSGPAWYWWLLAVLPLENRAQLAILAMTSLKDRLIAI 766



>gi|470644222|ref|XP_004326482.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like isoform 1 [Tursiops truncatus]
          Length = 757

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 479 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 538

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 539 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 597

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 598 DPVKRFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 654

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 655 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 686

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 687 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 745



>gi|335306476|ref|XP_003360480.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Sus scrofa]
          Length = 711

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 433 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 492

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 493 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 551

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 552 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 608

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 609 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 640

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 641 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 699



>gi|344281401|ref|XP_003412468.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Loxodonta africana]
          Length = 556

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 165/294 (56%), Gaps = 20/294 (6%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 276 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRKYCVTQLLEELIVKYLPGELSERKK 335

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 336 IYDEETAELSHLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 394

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
               ++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 395 DAQKSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVEV 454

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +      +R+   S+++   + F      G+ P   + L +
Sbjct: 455 ENEDEIKNLRELHNLVYSQACSWFQNLRDRFRSQIL---QHF------GSMPEREEDLQA 505

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RDQ 289
                P+ P+ + +W+ +V+P+    +  +L ++S++ERL  I   ++   RDQ
Sbjct: 506 T----PNGPA-WCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQ 554



>gi|410928474|ref|XP_003977625.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Takifugu rubripes]
          Length = 736

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 155/303 (51%), Gaps = 43/303 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSER-R 59
           PCGH+FCK C+ R LDH   CP+C++ L  Y A   + +   +   I+      Y+ER +
Sbjct: 456 PCGHTFCKTCLERCLDHTPHCPLCKESLKQYLACRKYMVTTVLDLLIKHYLSQEYAERTK 515

Query: 60  YLLDS--ELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
             LD   EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRRCM++  RQFGM   
Sbjct: 516 THLDETRELSDLTKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRCMETGTRQFGM--- 571

Query: 118 CSNTYQ----DFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
           C N  Q    D+G ML IRS  FL DGRS+V+T+G  +F+V+ +G KDGY    +E ++D
Sbjct: 572 CINDPQKGFVDYGCMLIIRSVHFLPDGRSVVDTVGGKRFRVLTRGMKDGYSTADIEHLED 631

Query: 174 ISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
                             +Y+                    +R + + L+      +LQ 
Sbjct: 632 TRVEDSEEQKRLQELYNAVYDQ-------------------ARVWFQNLKVRFHNQILQH 672

Query: 234 LNSVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWIS 284
               +G MP+  +D           +W+ +V+PI    +  +L + S++ERL  I + ++
Sbjct: 673 ----FGPMPEREADIQATPNGPACCWWLLAVLPIDPRYQLSVLSMSSLKERLVKIQQILT 728

Query: 285 SLR 287
            L+
Sbjct: 729 YLQ 731



>gi|507957527|ref|XP_004685987.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Condylura cristata]
          Length = 745

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 467 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 526

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 527 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 585

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 586 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 642

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 643 ------------------------QKVQGEDRAELMGLHDCVYEQA----SSWFHSLKSS 674

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 675 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 733



>gi|475673004|gb|EMT70127.1| LON peptidase N-terminal domain and RING finger protein 2 [Fusarium
           oxysporum f. sp. cubense race 4]
          Length = 526

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 141/273 (51%), Gaps = 41/273 (15%)

Query: 58  RRYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV 115
           R+  LD+E    MQD    +FV   L FP+MP FLH+FEP+YRLMIRR ++     FGMV
Sbjct: 256 RKEALDAERVAQMQDYDLALFVCT-LSFPQMPTFLHIFEPRYRLMIRRALEG-DHTFGMV 313

Query: 116 L------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           +      A    + + GT+L I + +F  DGRSL+ET+G  +F+V+E    DGY VG+ E
Sbjct: 314 IPKRPQHAGDANFHELGTLLRIVNVQFFPDGRSLIETVGLSRFRVLEHSYLDGYIVGKTE 373

Query: 170 RVDDIS-------------PXXXXXXXXXXXXXXXIYNTSNPL----------NNP---- 202
           R+DD+S             P               +   + P           ++P    
Sbjct: 374 RIDDVSLEDEEAAEAAEATPIETEDQQQPMQAMDTVKEPTEPTPTSPLPRSDSSSPHIPT 433

Query: 203 ----IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPI 258
               I   +T  L+  +  F+  +R  + PWL +R+ ++YGD P+DP+ F +W AS++P+
Sbjct: 434 SVTEIDSMSTQSLMHYASSFVARMRQQSVPWLTERMLTIYGDCPEDPAIFPWWFASMLPV 493

Query: 259 AEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
            + EKY+LL   SVRERLK+   WI       W
Sbjct: 494 KDIEKYRLLGTSSVRERLKICCTWIVEWETSRW 526



>gi|470644225|ref|XP_004326483.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like isoform 2 [Tursiops truncatus]
          Length = 716

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 438 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 497

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 498 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 556

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 557 DPVKRFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 613

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 614 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 645

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 646 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 704



>gi|426257665|ref|XP_004022445.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Ovis aries]
          Length = 718

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 499

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHSCVYEQA----SSWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|426257663|ref|XP_004022444.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Ovis aries]
          Length = 759

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 540

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHSCVYEQA----SSWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|477518428|gb|ENH70653.1| LON peptidase N-terminal domain and RING finger protein 2 [Fusarium
           oxysporum f. sp. cubense race 1]
          Length = 526

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 141/273 (51%), Gaps = 41/273 (15%)

Query: 58  RRYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV 115
           R+  LD+E    MQD    +FV   L FP+MP FLH+FEP+YRLMIRR ++     FGMV
Sbjct: 256 RKEALDAERVAQMQDYDLALFVCT-LSFPQMPTFLHIFEPRYRLMIRRALEG-DHTFGMV 313

Query: 116 L------ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           +      A    + + GT+L I + +F  DGRSL+ET+G  +F+V+E    DGY VG+ E
Sbjct: 314 IPKRPQHAGDANFHELGTLLRIVNVQFFPDGRSLIETVGLSRFRVLEHSYLDGYIVGKTE 373

Query: 170 RVDDIS-------------PXXXXXXXXXXXXXXXIYNTSNPL----------NNP---- 202
           R+DD+S             P               +   + P           ++P    
Sbjct: 374 RIDDVSLEDEEAAEAAEATPIETEDQQQPMQAMDSVKEPTEPTPTSPLPRSDSSSPHIPT 433

Query: 203 ----IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPI 258
               I   +T  L+  +  F+  +R  + PWL +R+ ++YGD P+DP+ F +W AS++P+
Sbjct: 434 SVTEIDSMSTQSLMHYASSFVARMRQQSVPWLTERMLTIYGDCPEDPAIFPWWFASMLPV 493

Query: 259 AEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
            + EKY+LL   SVRERLK+   WI       W
Sbjct: 494 KDIEKYRLLGTSSVRERLKICCTWIVEWETSRW 526



>gi|301761420|ref|XP_002916133.1| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 3-like [Ailuropoda melanoleuca]
          Length = 754

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 152/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 476 PCGHTFCLKCLERCLDHNAKCPLCKDGLAQCLASRKYSKNVIMEELIAKFLPEELKERRQ 535

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 536 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 594

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +G +DGY+   +E ++D   
Sbjct: 595 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQGHRDGYNTADIEYIED--- 651

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + E  +S        +  +L+      L  R+ +
Sbjct: 652 ---------QKVQGDDYAELMGLHNCVYEQASS--------WFHSLKTS----LKNRILT 690

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 691 HFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 742



>gi|440462078|gb|ELQ32481.1| hypothetical protein OOU_Y34scaffold01131g1 [Magnaporthe oryzae
           Y34]
 gi|440486182|gb|ELQ66073.1| hypothetical protein OOW_P131scaffold00430g1 [Magnaporthe oryzae
           P131]
          Length = 528

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 154/311 (49%), Gaps = 48/311 (15%)

Query: 23  ICRQPLHNYNAYLHHPINKTIYSFIRALYP-SLYSERRYLLDSELFNTMQ-DTPIFVTNA 80
           +CR+ +H        P NK +      L+  SL + ++ +L      T + D P+FV   
Sbjct: 224 LCRRQIHRG----EWPQNKLMACIETTLWATSLEARKQAILAESRHGTAEFDIPVFVCT- 278

Query: 81  LVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL------ACSNTYQDFGTMLEIRSA 134
           L FP MP FLHVFEP+YRLMIRR ++ + R FGMVL      A    + D GT+L + + 
Sbjct: 279 LSFPTMPTFLHVFEPRYRLMIRRALE-QDRTFGMVLHRRARRAGEPDFVDIGTLLRVINV 337

Query: 135 EFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS------------------- 175
           EF  DGRSL+ET+G  +F++++ G KDGY V ++ERV+D+S                   
Sbjct: 338 EFFPDGRSLIETVGVSRFRILQHGMKDGYVVAKIERVNDVSIAEEEALEAGEIREALDTD 397

Query: 176 -------PXXXXXXXXXXXXXXXIYNTSNPLNNPIRE-------YTTSELIGISRDFIET 221
                                  +  TS   NN   E         T EL+    +F+  
Sbjct: 398 LDTTSQQEEPGDKPANVSGNGVCVATTSTTNNNQGSEAPPNFDVMPTRELLRFGVEFVAR 457

Query: 222 LRNGNSPWLLQRLNSVYGDMP-DDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
           +R  ++ WL  R+ ++YG+ P DD + F +W ASV+P+ + EKY+LL   SVRERLK+  
Sbjct: 458 MREASAGWLTHRILAIYGECPEDDAAKFPWWFASVLPVNDLEKYRLLGTASVRERLKVCC 517

Query: 281 EWISSLRDQWW 291
            WI       W
Sbjct: 518 HWIQEWESSRW 528



>gi|466038608|ref|XP_004275848.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Orcinus orca]
          Length = 757

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 479 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 538

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 539 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 597

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 598 DPVKRFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 654

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 655 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 686

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 687 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 745



>gi|466038613|ref|XP_004275849.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Orcinus orca]
          Length = 716

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 438 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 497

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 498 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 556

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 557 DPVKRFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 613

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 614 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 645

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 646 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 704



>gi|507705618|ref|XP_004645745.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X1 [Octodon degus]
          Length = 764

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ER+ 
Sbjct: 486 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERKR 545

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 546 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 604

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 605 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 661

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 662 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 693

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 694 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 752



>gi|449474913|ref|XP_002195040.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Taeniopygia guttata]
          Length = 525

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 154/293 (52%), Gaps = 21/293 (7%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK C+ R LDH   CP+C+Q L  Y     +     +   + A +P+  +ERR 
Sbjct: 234 PCGHTFCKECLERCLDHRPNCPLCKQSLREYLKAGRYSPTVLLQDIMLATFPTQLAERRE 293

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
           L  +E   L N  ++ PIFV   + FP +PC LHVFEP+YRLMIRRC +S  R+FGM   
Sbjct: 294 LHRAEMAELSNLTKNIPIFVCT-MSFPGIPCPLHVFEPRYRLMIRRCQESGTRRFGMCTY 352

Query: 117 ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
               ++ D+G MLEIR  E LADGRSLV+TIG  +F+V+ +G +DGY    +E ++D   
Sbjct: 353 ENGKSFADYGCMLEIRQVELLADGRSLVDTIGRQRFRVLSRGHRDGYHTADIEYLED--- 409

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          ++ ++  L     E+        SR  +  +++G  P   + + +
Sbjct: 410 --KKVSGEELQELQCLHESTYRLAQRFCEHGDL----TSRHIL--MQHGPLPEKEEDIQA 461

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQ 289
                 D P+ + +W+ S++P+    +  L    S+R RL  +   +++L  Q
Sbjct: 462 SA----DGPT-WCWWLISILPLDPSYQLNLFSCTSLRARLSQLQRILTALLQQ 509



>gi|507705622|ref|XP_004645746.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X2 [Octodon degus]
          Length = 723

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ER+ 
Sbjct: 445 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERKR 504

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 505 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 563

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 564 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 620

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 621 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 652

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 653 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 711



>gi|505842082|ref|XP_004614549.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Sorex araneus]
          Length = 829

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 155/310 (50%), Gaps = 53/310 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C  R LDHN+ CP+C+  L    A   + IN T+   I    P    ER  
Sbjct: 552 PCGHTFCLKCFERCLDHNAKCPLCKDSLSQCLASRKYKINVTMEEIIAKFLPEDLEERTK 611

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +    EL N  ++ PIFV   + +P +PC LHVF+P YRLMIRRC+++   QFGM L 
Sbjct: 612 IDEEEMEELSNLNKNVPIFVCT-MAYPSVPCPLHVFDPCYRLMIRRCIETGTMQFGMCLG 670

Query: 118 --CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS 175
                 + ++G MLEI+  +F ADG S+VE++G  +FKV+++  +DGY++  +E ++D  
Sbjct: 671 DQLKGNFAEYGCMLEIKYVQFFADGCSMVESVGRRRFKVLQQSLRDGYNIADIEYIED-- 728

Query: 176 PXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------ 229
                                    + I+E   +EL+G+     E      S W      
Sbjct: 729 -------------------------HKIKEEDYAELMGLHNCVYEQA----SSWFHSLRA 759

Query: 230 -LLQRLNSVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            L  R+ S +G MP   +D           +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 760 SLKMRILSHFGPMPKKDADIKAQPNGPAWCWWILAVLPLENRAQLPFLAMRSLKDRLNGI 819

Query: 280 VEWISSLRDQ 289
              ++ + +Q
Sbjct: 820 QRVLAFVGNQ 829



>gi|432105304|gb|ELK31601.1| LON peptidase N-terminal domain and RING finger protein 3 [Myotis
           davidii]
          Length = 533

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 153/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P   SER+ 
Sbjct: 255 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNIIMEELIAKFLPEELSERKR 314

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 315 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 373

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F  DGRS+++++G  +F+V+ +G +DGY+   +E ++D   
Sbjct: 374 DPVKGFAEYGCILEIRNVQFFTDGRSVIDSVGKRRFRVLRQGQRDGYNTADIEYIEDQKV 433

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                                 L+N + E  +S        +  +L+N     L  R+ +
Sbjct: 434 LGEDCAELMG------------LHNCVYEQASS--------WFHSLKNS----LRNRIIN 469

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MPD  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 470 HFGPMPDKDADPQINPNGPAWCWWILAVLPLESRAQLPFLAMRSLKDRLNSI 521



>gi|478536384|ref|XP_004442312.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Ceratotherium simum simum]
          Length = 753

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 475 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 534

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 535 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 593

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 594 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 650

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 651 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 682

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 683 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 741



>gi|432880159|ref|XP_004073581.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Oryzias latipes]
          Length = 568

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 160/304 (52%), Gaps = 47/304 (15%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK CI RSLDHN  CP+C+QPL  Y     +     +  F+  L+PS  +ER+ 
Sbjct: 292 PCGHTFCKNCIERSLDHNLRCPLCKQPLQEYLKNRKYNPTIVLKDFLNQLFPSQLAERKQ 351

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  +D PIFV   + +P + C LH+FEP+YRLM+RRCM++  ++FGM   
Sbjct: 352 VHEAEMAELSNLTKDIPIFVCT-VAYPGVACPLHIFEPRYRLMMRRCMETGTKKFGM--- 407

Query: 118 CS----NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
           CS      + D+G MLEI   E L DGR  VET+G  +F+V+++G +DGY    +E ++D
Sbjct: 408 CSYEHGKGFADYGCMLEILDLELLPDGRFYVETLGGSRFRVLKRGQRDGYHTADIEFLED 467

Query: 174 ISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
           +                            + ++    +   ++D+ + L +       ++
Sbjct: 468 VKVDGSELE--------------------LLQHLHDSVYQQAQDWYQRLGSRTR----EQ 503

Query: 234 LNSVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRER---LKLIVE 281
           +N  +G +P+   D           +W+ SV+ +    +  +L L S+++R   L+L++E
Sbjct: 504 INRQHGRLPEKEEDIQALSNGPAWCWWLLSVLQLDPAYQTTVLSLTSLKDRLGHLRLVLE 563

Query: 282 WISS 285
           + S 
Sbjct: 564 YFSQ 567



>gi|478536386|ref|XP_004442313.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Ceratotherium simum simum]
          Length = 712

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 434 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 493

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 494 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 552

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 553 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 609

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 610 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 641

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 642 LKNRILNHFGPMPEKDADPQINPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 700



>gi|302508831|ref|XP_003016376.1| ATP-dependent protease (CrgA), putative [Arthroderma benhamiae CBS
           112371]
 gi|291179945|gb|EFE35731.1| ATP-dependent protease (CrgA), putative [Arthroderma benhamiae CBS
           112371]
          Length = 707

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 156/307 (50%), Gaps = 20/307 (6%)

Query: 2   CGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPS--LYSERR 59
           CGH+FC+ C+T+ LD ++ CP+CR+ L         P N  + +F   ++P   L   R 
Sbjct: 223 CGHTFCRSCVTQMLDISNLCPVCRRNLPMI--LPDDPGNGALNAFSYFIFPERRLSRLRD 280

Query: 60  YLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACS 119
             ++    + + + P+FV   + FP MP +LHVFEP+YR MI R +++  R+FG V+   
Sbjct: 281 VPVEQPGASKIDELPLFVCT-VSFPSMPTYLHVFEPRYRRMILRVVENGTRRFGSVMLNQ 339

Query: 120 N----------TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
                       +  +GT+LEI   E L  GR L+   G Y+F+V+     DG  +G V+
Sbjct: 340 TGERTGQSEPCVHARYGTLLEIDRLESLPGGRILIRATGRYRFRVLSCRDYDGCKIGHVQ 399

Query: 170 RVDDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW 229
           R+DDI                        LN      +T EL  I   F+   R+ +S W
Sbjct: 400 RIDDIRIPFEEMIEAEELSAPKEGQHPKCLN----LLSTQELFQICTKFVTKSRSSSSSW 455

Query: 230 LLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL-RD 288
           L +RL S YG+ P DP+ F YW  +V+PIA  EKY LL + +VR RLK+  +W+  + RD
Sbjct: 456 LNERLLSGYGEPPTDPAIFPYWFGTVLPIASSEKYSLLSVTTVRGRLKICADWVRQIERD 515

Query: 289 QWWFARG 295
           +     G
Sbjct: 516 KTVLRTG 522



>gi|363733701|ref|XP_420695.3| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 1 [Gallus gallus]
          Length = 721

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 158/303 (52%), Gaps = 38/303 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFI-RALYPSLYSERR 59
           PCGH+FCK C+ R LDH   CP+C++ L  Y A   + I + +   I + L   LY  +R
Sbjct: 441 PCGHTFCKGCLERCLDHAPQCPLCKESLKEYLASRKYSITELLEELIMKYLSDELYERKR 500

Query: 60  YLLD--SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
              +  +E  N  ++ P+FV   + +P +PC LHVFEP+YRLMIRR M++  +QFGM ++
Sbjct: 501 IHAEETAEHSNLTKNVPMFVCT-MAYPTVPCPLHVFEPRYRLMIRRSMETGTKQFGMCIS 559

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            S N + D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+  
Sbjct: 560 DSQNGFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLQRGMKDGYCTADIEYLEDVKV 619

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +                     + + LRN     +LQ    
Sbjct: 620 ADEEELKKLRELHNFVYSQAC-------------------SWFQNLRNKFRTQILQH--- 657

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL- 286
            +G MPD   +           +W+ +V+P+    +  +L + S+++RL  I   ++   
Sbjct: 658 -FGPMPDREENIQAMPNGPAWCWWLLAVLPVDPRYQLSVLSMMSLKDRLIKIQHILTYFS 716

Query: 287 RDQ 289
           RDQ
Sbjct: 717 RDQ 719



>gi|395848815|ref|XP_003797038.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Otolemur garnettii]
          Length = 771

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 493 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 552

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 553 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 611

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 612 DPVKGFVEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 668

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 669 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKTS 700

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 701 LKNRILNHFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 759



>gi|483520330|gb|EOB05844.1| LON peptidase N-terminal domain and RING finger protein 2, partial
           [Anas platyrhynchos]
          Length = 531

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 149/288 (51%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 252 PCGHTFCLKCLERCLDHNPHCPLCKEKLSEFLASRTYKKTVLTEELIVRYLPEELSERKK 311

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + + E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 312 VYEEEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 370

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G +LEIR  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 371 DELKGFADHGCILEIRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 427

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ + +   +        +  +L++     +L    S
Sbjct: 428 ---------KKVEGPEYEELVRLHDSVYDQAVA--------WFTSLKDNMKAQILNHFGS 470

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G  P+  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 471 MPGKEPEPQSNPSGPAWYWWLLAVLPLENRAQLAILAMTSLKDRLIAI 518



>gi|395848817|ref|XP_003797039.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Otolemur garnettii]
          Length = 730

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 452 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 511

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 512 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 570

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 571 DPVKGFVEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 627

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 628 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKTS 659

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 660 LKNRILNHFGPMPEKDADPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 718



>gi|149744890|ref|XP_001487924.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Equus caballus]
          Length = 757

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 154/299 (51%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 479 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 538

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 539 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 597

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 598 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 654

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGI-------SRDFIETLRNGNSPW 229
                                     ++    +EL+G+       +  +  +L++     
Sbjct: 655 ------------------------QKVQGEDCAELMGLHNCVYEQAASWFHSLKSS---- 686

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 687 LKSRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 745



>gi|449280791|gb|EMC88017.1| LON peptidase N-terminal domain and RING finger protein 2, partial
           [Columba livia]
          Length = 531

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 149/288 (51%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 252 PCGHTFCLKCLERCLDHNPHCPLCKEKLSEFLASRTYKKTVLTEELIVRYLPEELSERKK 311

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + + E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 312 VYEEEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 370

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G +LEIR  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 371 DELKGFADHGCILEIRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 427

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ + +   +        +  +L++     +L    S
Sbjct: 428 ---------KKVEGPEYEELVRLHDSVYDQAVA--------WFTSLKDNMKVQILNHFGS 470

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G  P+  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 471 MPGKEPEPQSNPSGPAWYWWLLAVLPLENKAQLAILAMTSLKDRLIAI 518



>gi|149744893|ref|XP_001487934.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Equus caballus]
          Length = 716

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 154/299 (51%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 438 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRR 497

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 498 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 556

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 557 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 613

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGI-------SRDFIETLRNGNSPW 229
                                     ++    +EL+G+       +  +  +L++     
Sbjct: 614 ------------------------QKVQGEDCAELMGLHNCVYEQAASWFHSLKSS---- 645

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 646 LKSRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 704



>gi|449267125|gb|EMC78091.1| LON peptidase N-terminal domain and RING finger protein 3, partial
           [Columba livia]
          Length = 576

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 156/293 (53%), Gaps = 21/293 (7%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK C+ R LDH   CP+C+Q L  Y     +     +   + A +P+  ++RR 
Sbjct: 299 PCGHTFCKECLERCLDHRPNCPLCKQSLREYLKDGSYSPTVLLQDIMLATFPAQLAQRRD 358

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL- 116
           L  +E   L N   + PIFV   + FP + C LHVFEP+YRLMIRRC ++  R+FGM + 
Sbjct: 359 LHQAEMAELSNLTNNIPIFVCT-MSFPGIACPLHVFEPRYRLMIRRCQETGTRRFGMCIY 417

Query: 117 ACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
               ++ D+G MLEIR  E LADGRSLV+TIG  +F+V+ +G +DGY+   +E ++D   
Sbjct: 418 EDGKSFADYGCMLEIRQIELLADGRSLVDTIGQRRFRVLSRGHRDGYNTADIEYLED--- 474

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          ++ ++  L     E+        SR  +  +++G  P   + + +
Sbjct: 475 --KKVAGEELQELQCLHESTYCLAQRFCEHGDL----ASRHVL--VQHGPLPEKEEDIQA 526

Query: 237 VYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQ 289
               +PD P+ + +W+ S++P+    +  L    S+R RL  +   ++SL  Q
Sbjct: 527 ----LPDGPT-WCWWLISILPLDPSYQLNLFSSTSLRARLTQLQRILTSLLQQ 574



>gi|326912597|ref|XP_003202635.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           2-like, partial [Meleagris gallopavo]
          Length = 528

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 149/288 (51%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 249 PCGHTFCLKCLERCLDHNPHCPLCKEKLSEFLASRTYKKTVLTEELIVRYLPEELSERKK 308

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +    EL N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 309 VYEDEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 367

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G +LEIR  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 368 DELKGFADHGCILEIRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 424

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ + +   +        +  +L++     +L    S
Sbjct: 425 ---------KKVEGPEYEELVRLHDSVYDQAVA--------WFTSLKDNMKVQILNHFGS 467

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G  P+  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 468 MPGKEPEPQSNPSGPAWYWWLLAVLPLENRAQLAILAMTSLKDRLIAI 515



>gi|344240340|gb|EGV96443.1| hypothetical protein I79_003640 [Cricetulus griseus]
          Length = 363

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 117/179 (65%), Gaps = 5/179 (2%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFCK C+ R LDH   CP+C++ L  Y A   + + + +   I    P   SER+ 
Sbjct: 127 PCGHSFCKNCLERCLDHTPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKK 186

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D   +EL +  ++ PIFV   + +P +PC LHVFEP+YRLMIRR +Q+  +QFGM ++
Sbjct: 187 IYDEETAELSHLTKNVPIFVC-TMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVS 245

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS 175
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+++G KDGY    +E ++D+ 
Sbjct: 246 DTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVK 304



>gi|465956895|gb|EMP27167.1| LON peptidase N-terminal domain and RING finger protein 2, partial
           [Chelonia mydas]
          Length = 605

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 109/177 (61%), Gaps = 5/177 (2%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 245 PCGHTFCLKCLERCLDHNPYCPLCKEKLSEFLASRTYKKTVLTEELIVHYLPEELSERKK 304

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + + E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 305 IYEEEMKELSNLNEDVPIFVC-TMAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 363

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDD 173
                + D+G MLEIR  +F  DGRS+V+T+G  +FKV+  G +DGY+   +E ++D
Sbjct: 364 DELKGFADYGCMLEIRDVKFFPDGRSVVDTVGVRRFKVLNHGQRDGYNTANIEYLED 420



>gi|431921507|gb|ELK18873.1| LON peptidase N-terminal domain and RING finger protein 3 [Pteropus
           alecto]
          Length = 755

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 150/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ER+ 
Sbjct: 477 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNIIMEELIAKFLPEELKERKK 536

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 537 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 595

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 596 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 652

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 653 ------------------------QKVQGEDCAELMGLHNCVYEQA----SSWFHSLKSS 684

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+   D         + +W  +V+P+    +   L ++S+++RL  I
Sbjct: 685 LKNRILNHFGPMPEKDVDPQINPNGPAWCWWTLAVLPLESRAQLPFLAMKSLKDRLNGI 743



>gi|513164530|ref|XP_416903.4| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           2, partial [Gallus gallus]
          Length = 775

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 149/288 (51%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 496 PCGHTFCLKCLERCLDHNPHCPLCKEKLSEFLASRTYKKTVLTEELIVRYLPEELSERKK 555

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +    EL N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 556 VYEEEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 614

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G +LEIR  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 615 DELKGFADHGCILEIRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 671

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ + +   +        +  +L++     +L    S
Sbjct: 672 ---------KKVEGPEYEELVRLHDSVYDQAVA--------WFTSLKDNMKVQILNHFGS 714

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G  P+  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 715 MPGKEPEPQSNPSGPAWYWWLLAVLPLENRAQLAILAMTSLKDRLIAI 762



>gi|321455609|gb|EFX66737.1| hypothetical protein DAPPUDRAFT_130325 [Daphnia pulex]
          Length = 287

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 150/303 (49%), Gaps = 39/303 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGHSFC+ C+ R +DH +ACP+C+  L  Y A     + + +   +    P+ Y+ER  
Sbjct: 8   PCGHSFCRTCLDRCMDHKAACPLCQTSLETYLAERKQCLTEFLDYAMATYLPNEYAERSL 67

Query: 61  LLDSEL--FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGM---V 115
           L D E+    +  + PIF+   + +P + C LHVFEP+YRLMIRRCM+S  RQFGM   V
Sbjct: 68  LHDEEMKELASSHNIPIFICT-MAYPTVKCPLHVFEPRYRLMIRRCMESGSRQFGMCSYV 126

Query: 116 LACSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS 175
                 + +FGTMLE+   EF  DGRS+V+T+G  +F+V+ +G  DGY    VE      
Sbjct: 127 QDQPQGFAEFGTMLEVNDVEFFPDGRSVVDTVGGRRFRVLRRGLLDGYCTATVE------ 180

Query: 176 PXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLN 235
                            Y    P++ P R  T   L    R   +   +     L QR+ 
Sbjct: 181 -----------------YLVDQPVD-PSRVETVKALHDRVRQEAQNWISSAPANLRQRIL 222

Query: 236 SVYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL 286
             +G MPD   D+          +W+ +++P+    +   L +  + +RL+ I   ++ +
Sbjct: 223 GHFGVMPDVEPDWITLPNGPAWLWWLMAILPLNPKAQVATLSMTQIEKRLEAIQRGVAYV 282

Query: 287 RDQ 289
           R +
Sbjct: 283 RQR 285



>gi|507678992|ref|XP_004710174.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like [Echinops telfairi]
          Length = 695

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 155/304 (50%), Gaps = 41/304 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +     +   I    P  ++ERR 
Sbjct: 417 PCGHTFCLKCLERCLDHNAKCPLCKDGLLQCLTSRKYSKTIIMEELIAKFLPEEFNERRR 476

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  +D PIFV   + +P +PC LH+FEP YRLM+RRC+++  RQFGM L 
Sbjct: 477 LYEEEMEELSNLNKDVPIFVCT-MAYPTVPCPLHIFEPCYRLMMRRCIETGTRQFGMCLG 535

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G MLEIR+ +F  DGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 536 DPVKGFAEYGCMLEIRNVQFFPDGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIEDQKV 595

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                                 L+N + E  +   + +             P L  R+  
Sbjct: 596 QGEDCAELMT------------LHNCVYERASLWFLSL------------KPALKNRILH 631

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERL---KLIVEWIS 284
            +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL   + IV +IS
Sbjct: 632 HFGPMPEKDADPQVSPNGPAWCWWLLAVLPLESRAQLPFLAMRSLKDRLNGIRRIVAFIS 691

Query: 285 SLRD 288
             ++
Sbjct: 692 RTQN 695



>gi|301610356|ref|XP_002934710.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Xenopus (Silurana) tropicalis]
          Length = 684

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 157/303 (51%), Gaps = 39/303 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FCK C+ R LDH   CP+C++ L  + A   + +   +   I+   P    ER+ 
Sbjct: 405 PCGHTFCKKCLERCLDHTPHCPLCKESLSEFLAKRSYNVTHLLEYLIKIYLPEELLERKR 464

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +E  N  ++ PIFV   + +P +PC LHVFEP+YRLMIRRCM++  +QFGM ++
Sbjct: 465 VHEEETAEFSNLTKNVPIFVCT-MSYPTVPCPLHVFEPRYRLMIRRCMETGTKQFGMCIS 523

Query: 118 -CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N++ D+G ML+IR+  FL DGRS+V+T+G  +F+V+ +G +DGY    +E + DI  
Sbjct: 524 DPENSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLTRGMRDGYCTADIEYLSDIQV 583

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           +     L++ +              + + LRN     +L     
Sbjct: 584 NLEE------------FQQLKELHDAVHAQACR--------WFQNLRNRFRSQILHH--- 620

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL- 286
            +G MP+  +D           +W+ +V+P+    +  +L + S++ERL  +   ++   
Sbjct: 621 -FGAMPETGADIQAVPNGPAWCWWLLAVLPVDPRYQLSVLSMMSLKERLLKLQHILTCFS 679

Query: 287 RDQ 289
           RDQ
Sbjct: 680 RDQ 682



>gi|158261419|dbj|BAF82887.1| unnamed protein product [Homo sapiens]
          Length = 718

 Score =  163 bits (412), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 155/306 (50%), Gaps = 52/306 (16%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKLS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLIV 280
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I 
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGIR 707

Query: 281 EWISSL 286
             ++S+
Sbjct: 708 RVLASI 713



>gi|296236256|ref|XP_002763252.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Callithrix jacchus]
          Length = 718

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   L +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-LAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVRGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 616 ------------------------QKVQGEACAELMGLHNSVYEQA----SSWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L + S+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMTSLKDRLNGI 706



>gi|296236258|ref|XP_002763253.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Callithrix jacchus]
          Length = 759

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 540

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   L +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-LAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 600 DPVRGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 657 ------------------------QKVQGEACAELMGLHNSVYEQA----SSWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L + S+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMTSLKDRLNGI 747



>gi|449483669|ref|XP_002194059.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           2 [Taeniopygia guttata]
          Length = 651

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 148/288 (51%), Gaps = 30/288 (10%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L  + A   +         I    P   SER+ 
Sbjct: 372 PCGHTFCLKCLERCLDHNPLCPLCKEKLSEFLASRTYKKTVLTEELIVRYLPEELSERKK 431

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D E   L N  +D PIFV   + FP +PC LHVFEP+YRLMIRRCM++  +QFGM LA
Sbjct: 432 VYDEEMKELSNLNKDVPIFVCT-MAFPTIPCPLHVFEPRYRLMIRRCMETGTKQFGMCLA 490

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D G +LEIR  +F  DGRS+V+T+G  +F+V+  G +DGY+   +E ++D   
Sbjct: 491 DELKGFADHGCILEIRDVKFFPDGRSVVDTVGVRRFRVLSHGQRDGYNTANIEYLED--- 547

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ + +   +        +  +L++     +L    S
Sbjct: 548 ---------KKVEGPEYEELVRLHDSVYDQAVA--------WFTSLKDNMKVQILNHFGS 590

Query: 237 VYGDMPDDPSDFS-----YWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + G   +  S+ S     +W+ +V+P+    +  +L + S+++RL  I
Sbjct: 591 MPGKESEPQSNPSGPAWYWWLLAVLPLENRAQLAILAMTSLKDRLIAI 638



>gi|353236097|emb|CCA68098.1| hypothetical protein PIIN_01966 [Piriformospora indica DSM 11827]
          Length = 523

 Score =  162 bits (411), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 116/180 (64%), Gaps = 14/180 (7%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYN--AYLHHP-INKTIYSFIRALYPSLYSE 57
           PC H+FC  C+ RSLDH + CP+CR   H+Y   A  H P +N+ I S I   + +    
Sbjct: 112 PCQHTFCTSCLQRSLDHLATCPLCR---HDYTNVARFHSPRVNRIINSIISTFFATPSPT 168

Query: 58  RRYLLDSELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
                D +L     +TPIFV   L FP MP  LH+FE +YRLM+RR +Q +  QFGM++ 
Sbjct: 169 PAPDADDDL-----NTPIFVCQ-LSFPGMPTVLHIFEARYRLMLRRVLQRKTPQFGMIMY 222

Query: 118 CSN--TYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS 175
            S+  T   +GTMLEIRSA  L DGRS++ET G+Y+F+++ +G +DGY VG+V+R+DD+S
Sbjct: 223 PSHEGTVVSYGTMLEIRSARILGDGRSIIETWGSYRFRIVRRGEQDGYMVGKVDRIDDLS 282



 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 2/95 (2%)

Query: 205 EYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKY 264
           E TT +L+     F++ LR  +S  ++QRL++V G  P D    S+W+A ++PI E EK 
Sbjct: 431 EPTTEQLVETCHTFLQRLRKASSAAVIQRLDNV-GPPPSDVGILSFWIAQLLPIDESEKA 489

Query: 265 KLLELRSVRERLKLIVEWISSLRDQWWFARGCSIS 299
           KLL +RS R RL+L+V WI      WWF  GC ++
Sbjct: 490 KLLPIRSPRLRLRLVVHWIDQFNSAWWF-NGCVVA 523



>gi|471390139|ref|XP_004379865.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Trichechus manatus latirostris]
          Length = 746

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 153/297 (51%), Gaps = 38/297 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +     +   I    P   +ERR 
Sbjct: 468 PCGHTFCLKCLERCLDHNAKCPLCKDGLLQCLASRKYSKTVIMEELIAKFLPEELNERRR 527

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 528 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 586

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY    +E ++D   
Sbjct: 587 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYSTADIEYIED--- 643

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N +  Y  + L      +  +L++     +  R+  
Sbjct: 644 ---------QKVQGEDYAELLTLHNCV--YAQASL------WFHSLKSS----MKNRILH 682

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWIS 284
            +G MP+  +D           +W+ +V+P+    +   L +RS+++RL  I   +S
Sbjct: 683 HFGPMPEKDTDLQVNPNGPAWCWWILAVLPLESRAQLPFLAMRSLKDRLNGIRRVLS 739



>gi|71043955|ref|NP_083170.1| LON peptidase N-terminal domain and RING finger protein 3 [Mus
           musculus]
 gi|81917015|sp|Q9D4H7.1|LONF3_MOUSE RecName: Full=LON peptidase N-terminal domain and RING finger
           protein 3; AltName: Full=RING finger protein 127
 gi|12855300|dbj|BAB30284.1| unnamed protein product [Mus musculus]
 gi|111308292|gb|AAI20691.1| LON peptidase N-terminal domain and ring finger 3 [Mus musculus]
 gi|111308804|gb|AAI20689.1| LON peptidase N-terminal domain and ring finger 3 [Mus musculus]
 gi|148697022|gb|EDL28969.1| LON peptidase N-terminal domain and ring finger 3 [Mus musculus]
          Length = 753

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 150/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P  + ER+ 
Sbjct: 475 PCGHTFCLKCLERCLDHNAKCPLCKDVLLQCLPSRKYSKNVILEELIATFLPEEFKERKR 534

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 535 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 593

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F +DGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 594 DPVKGFVEYGCILEIRNVQFFSDGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 650

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 651 ------------------------QKVQGDDCAELMGLHNCVYEQA----SSWFHSLKAS 682

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 683 LKNRILNHFGPMPEKDEDPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 741



>gi|344286296|ref|XP_003414895.1| PREDICTED: LOW QUALITY PROTEIN: LON peptidase N-terminal domain and
           RING finger protein 3-like [Loxodonta africana]
          Length = 651

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 152/292 (52%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +     +   I    P   +ERR 
Sbjct: 373 PCGHTFCLKCLERCLDHNTKCPLCKDGLLQCLASRKYSKTVIMEELIAKFLPEELNERRR 432

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 433 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 491

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 492 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 548

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N + E  +         +  +L++     L  R+  
Sbjct: 549 ---------QKVQGEDYAELMTLHNCVYEQASL--------WFHSLKSS----LKNRILH 587

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 588 HFGPMPEKDTDPQINPNGPAWCWWILAVLPLESRAQLPFLAMRSLKDRLNGI 639



>gi|471390142|ref|XP_004379866.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Trichechus manatus latirostris]
          Length = 705

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 153/297 (51%), Gaps = 38/297 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +     +   I    P   +ERR 
Sbjct: 427 PCGHTFCLKCLERCLDHNAKCPLCKDGLLQCLASRKYSKTVIMEELIAKFLPEELNERRR 486

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 487 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 545

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY    +E ++D   
Sbjct: 546 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYSTADIEYIED--- 602

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L+N +  Y  + L      +  +L++     +  R+  
Sbjct: 603 ---------QKVQGEDYAELLTLHNCV--YAQASL------WFHSLKSS----MKNRILH 641

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWIS 284
            +G MP+  +D           +W+ +V+P+    +   L +RS+++RL  I   +S
Sbjct: 642 HFGPMPEKDTDLQVNPNGPAWCWWILAVLPLESRAQLPFLAMRSLKDRLNGIRRVLS 698



>gi|425771032|gb|EKV09487.1| ATP-dependent protease (CrgA), putative [Penicillium digitatum Pd1]
 gi|425776689|gb|EKV14897.1| ATP-dependent protease (CrgA), putative [Penicillium digitatum
           PHI26]
          Length = 263

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 129/238 (54%), Gaps = 22/238 (9%)

Query: 71  QDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLACSNT--------- 121
           ++ P+FV   L FP MP FLH+FEP+YRLMIRR + +   +FGMV+              
Sbjct: 31  KNLPLFVCT-LSFPTMPTFLHIFEPRYRLMIRRVLANGNGKFGMVMYNRQGRVLPGQLDD 89

Query: 122 --YQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISPXXX 179
             +  +GT+L I   E L DGRSLV   G  +FK+++ G  DGY V + ERVDDI+    
Sbjct: 90  VPFVQYGTLLMIERYELLPDGRSLVVATGVSRFKIVDSGMLDGYYVAKTERVDDIA---- 145

Query: 180 XXXXXXXXXXXXIYNTSNPL------NNPIREYTTSELIGISRDFIETLRNGNSPWLLQR 233
                         +T NPL      + P+   +T +L+  +R+FI   R   +PWL  R
Sbjct: 146 LAEEERLESIETSRDTINPLPEGNESDLPLDSMSTQQLLLSAREFISNQRRSGAPWLHPR 205

Query: 234 LNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
           +   YG +P D + F +W AS++PI+E EKY +L   SVRERLK+  +W   L  + W
Sbjct: 206 VMLAYGPVPTDAARFPWWFASILPISEEEKYPILAATSVRERLKISAKWARRLEARDW 263



>gi|403279122|ref|XP_003931115.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Saimiri boliviensis boliviensis]
          Length = 762

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 484 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 543

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LHVFEP YRLMIRRC+++  RQFGM L 
Sbjct: 544 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHVFEPCYRLMIRRCIETGTRQFGMCLG 602

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 603 DPVRGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 659

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 660 ------------------------QKVQGEACAELMGLHNCVYEQA----SSWFHSLKSS 691

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L + S+++RL  I
Sbjct: 692 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMTSLKDRLNGI 750



>gi|354475734|ref|XP_003500082.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like [Cricetulus griseus]
          Length = 538

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P    ERR 
Sbjct: 260 PCGHTFCLKCLERCLDHNAKCPLCKDVLLQCLPSRKYSKNVIMEELIAKFLPEELKERRR 319

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  +QFGM L 
Sbjct: 320 LHEEEMEELSNLNKNVPIFVC-TMAYPTVPCPLHIFEPCYRLMIRRCIETGTKQFGMCLG 378

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 379 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 435

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 436 ------------------------QKVQGEDCAELMGLHNCVYEQA----STWFHSLKAS 467

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 468 LKTRILNHFGPMPEKDEDPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 526



>gi|449498900|ref|XP_002191244.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 [Taeniopygia guttata]
          Length = 726

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 148/292 (50%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L    A   +     +   I    P   +ERR 
Sbjct: 447 PCGHTFCLKCLERCLDHNPKCPLCKEGLSECLAMRKYCKTVLMEELIARYLPEELTERRK 506

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM ++
Sbjct: 507 IYEEEIAELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIS 565

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G +LEIR+ EF ADGRS+V++IG  +FKVI+   +DGY+   +E ++D   
Sbjct: 566 DPVKGFADYGCILEIRNVEFFADGRSVVDSIGKRRFKVIQHSQRDGYNTADIEYIED-QK 624

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +    N +++   S                       R+ S
Sbjct: 625 VQGQEYAALLILHDSVYDQAYTWFNSLKQALKS-----------------------RILS 661

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP    D         + +WV +V+P+    +   L ++S+++RL  I
Sbjct: 662 HFGPMPAKDPDPQANPNGPAWCWWVLAVLPLENRAQLPFLAMKSLKDRLSGI 713



>gi|327273722|ref|XP_003221629.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1-like [Anolis carolinensis]
          Length = 741

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 159/303 (52%), Gaps = 38/303 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC+ C+ R LD+   CP+C++ L  Y A   + I + +   I    P+   ER+ 
Sbjct: 461 PCGHTFCRNCLERCLDYAPQCPLCKESLKEYLASRKYSITQLLEELIMKYMPAELIERKR 520

Query: 61  LLDSEL---FNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + D E+    + +++ PIFV   + +P +PC LHVFEP+YRLMIRR +++  +QFGM ++
Sbjct: 521 IHDEEISEHASLIKNVPIFVCT-MAYPTVPCPLHVFEPRYRLMIRRSIETETKQFGMCIS 579

Query: 118 C-SNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
              N + D+G ML IR+ ++L DGRS+V+T+G  +F+V+ +G KDGY    +E ++DI  
Sbjct: 580 NPQNGFADYGCMLYIRNLDYLPDGRSVVDTVGLKRFRVLRRGMKDGYHTADIEYLEDIKV 639

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +                     + ++LRN     +LQ    
Sbjct: 640 ENDCEKKKLGELHDFVYSQAC-------------------SWFQSLRNKFRSQILQH--- 677

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL- 286
            +G MP+   +           +W+ +V+P+    +  +  ++S++ERL  I + ++   
Sbjct: 678 -FGPMPEREENIQETANGPAWCWWLLAVLPVDPRYQLTVFSMKSLKERLLKIQDILTYFS 736

Query: 287 RDQ 289
           RDQ
Sbjct: 737 RDQ 739



>gi|402911228|ref|XP_003918239.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Papio anubis]
          Length = 759

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 540

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|119610292|gb|EAW89886.1| LON peptidase N-terminal domain and ring finger 3, isoform CRA_b
           [Homo sapiens]
 gi|193783588|dbj|BAG53499.1| unnamed protein product [Homo sapiens]
          Length = 503

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 225 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 284

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 285 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 343

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 344 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 400

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+       +    S W       
Sbjct: 401 ------------------------QKVQGEDCAELMGLHN----CVYQQASLWFHSLKLS 432

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 433 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 491



>gi|426397207|ref|XP_004064815.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Gorilla gorilla gorilla]
          Length = 759

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 540

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|402911226|ref|XP_003918238.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Papio anubis]
          Length = 718

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|403279120|ref|XP_003931114.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Saimiri boliviensis boliviensis]
          Length = 721

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 443 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 502

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LHVFEP YRLMIRRC+++  RQFGM L 
Sbjct: 503 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHVFEPCYRLMIRRCIETGTRQFGMCLG 561

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 562 DPVRGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 618

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 619 ------------------------QKVQGEACAELMGLHNCVYEQA----SSWFHSLKSS 650

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W  +V+P+    +   L + S+++RL  I
Sbjct: 651 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWTLAVLPLESRAQLPFLAMTSLKDRLNGI 709



>gi|426397205|ref|XP_004064814.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Gorilla gorilla gorilla]
          Length = 718

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 154/299 (51%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGI-------SRDFIETLRNGNSPW 229
                                     ++    +EL+G+       +  +  +L++     
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNCVYQQASLWFHSLKSS---- 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|73747840|ref|NP_001027026.1| LON peptidase N-terminal domain and RING finger protein 3 isoform 1
           [Homo sapiens]
 gi|121949074|sp|Q496Y0.1|LONF3_HUMAN RecName: Full=LON peptidase N-terminal domain and RING finger
           protein 3; AltName: Full=RING finger protein 127
 gi|71121157|gb|AAH99847.1| LON peptidase N-terminal domain and ring finger 3 [Homo sapiens]
 gi|71680341|gb|AAI00672.1| LON peptidase N-terminal domain and ring finger 3 [Homo sapiens]
 gi|119610294|gb|EAW89888.1| LON peptidase N-terminal domain and ring finger 3, isoform CRA_d
           [Homo sapiens]
          Length = 759

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 540

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKLS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|224049868|ref|XP_002192219.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           1 [Taeniopygia guttata]
          Length = 824

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 157/303 (51%), Gaps = 39/303 (12%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFI-RALYPSLYSERR 59
           PCGH+FCK C+ R LDH   CP+C++ L  Y A   + I + +   I + L   L+  +R
Sbjct: 545 PCGHTFCKGCLERCLDHAPQCPLCKESLKEYLASRKYSITELLEELIMKYLSDELFERKR 604

Query: 60  YLLD--SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
              +  +E  N  ++ P+FV   + +P +PC LHVFEP+YRLMIRR M++  +QFGM ++
Sbjct: 605 IHAEETAEHSNLTKNVPMFVCT-MAYPTVPCPLHVFEPRYRLMIRRSMETGTKQFGMCIS 663

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
            S N + D+G ML+IR+  FL DGRS+V+TIG  +F+V+ +G KDGY    +E ++D+  
Sbjct: 664 DSQNGFADYGCMLQIRNVHFLPDGRSVVDTIGGKRFRVLRRGMKDGYCTADIEYLEDVK- 722

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +YN +                     + + LRN     +LQ    
Sbjct: 723 VADEELKKLRELHNFVYNQAC-------------------SWFQNLRNKFRTQILQH--- 760

Query: 237 VYGDMPDDPSDFS---------YWVASVIPIAEGEKYKLLELRSVRERLKLIVEWISSL- 286
            +G MPD   +           +W+ +V+P+    +  +L + S+++RL  I   ++   
Sbjct: 761 -FGPMPDREENIQAMPNGPAWCWWLLAVLPVDPRYQLSVLSMMSLKDRLIKIQHILTYFS 819

Query: 287 RDQ 289
           RDQ
Sbjct: 820 RDQ 822



>gi|37622896|ref|NP_079054.3| LON peptidase N-terminal domain and RING finger protein 3 isoform 2
           [Homo sapiens]
 gi|73695332|gb|AAI03492.1| LON peptidase N-terminal domain and ring finger 3 [Homo sapiens]
 gi|119610291|gb|EAW89885.1| LON peptidase N-terminal domain and ring finger 3, isoform CRA_a
           [Homo sapiens]
          Length = 718

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKLS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|149059996|gb|EDM10812.1| similar to ring finger protein 127 (predicted) [Rattus norvegicus]
          Length = 632

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P    ERR 
Sbjct: 354 PCGHTFCLKCLERCLDHNAKCPLCKDVLLQCLPSRKYSKNVIMEELIAKFLPEELKERRR 413

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  +QFGM L 
Sbjct: 414 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTKQFGMCLG 472

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F +DGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 473 DPVKGFAEYGCILEIRNVQFFSDGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 529

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 530 ------------------------QKVQGDDCAELVGLHNCVYEQA----SSWFHSLKTS 561

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 562 LKNRILNHFGPMPEKDEDPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 620



>gi|355705097|gb|EHH31022.1| RING finger protein 127 [Macaca mulatta]
          Length = 623

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 345 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 404

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 405 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 463

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 464 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 520

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 521 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 552

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 553 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 611



>gi|10439066|dbj|BAB15419.1| unnamed protein product [Homo sapiens]
          Length = 516

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 238 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 297

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 298 LYEEEMEELSNLNKNVPIFVC-TMAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 356

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 357 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 413

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 414 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKLS 445

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 446 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 504



>gi|297710864|ref|XP_002832080.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Pongo abelii]
          Length = 759

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P    ERR 
Sbjct: 481 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLVSRKYSKNVIMEELIAKFLPEELKERRK 540

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 541 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 599

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 600 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 656

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +     +S W       
Sbjct: 657 ------------------------QKVQGEDCAELMGLHNSVYQQ----SSLWFHSLKSS 688

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 689 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 747



>gi|355757648|gb|EHH61173.1| RING finger protein 127 [Macaca fascicularis]
          Length = 664

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 386 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 445

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 446 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 504

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 505 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 561

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 562 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 593

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 594 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 652



>gi|513181434|ref|XP_004940903.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X3 [Gallus gallus]
          Length = 723

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 148/292 (50%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L    A   +     +   I    P   +ERR 
Sbjct: 444 PCGHTFCLKCLERCLDHNPKCPLCKEGLSECLAMRKYCKTVLMEELIAKYLPEELTERRK 503

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM ++
Sbjct: 504 IYEEEIAELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIS 562

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G +LEIR+ EF ADGRS+V++IG  +FKVI+   +DGY+   +E ++D   
Sbjct: 563 DPVKGFADYGCILEIRNVEFFADGRSVVDSIGKRRFKVIQHSQRDGYNTADIEYIED-QK 621

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +    N +++   S                       R+ S
Sbjct: 622 VQGQDYAALLVLHDSVYDQAYMWFNSLKQALKS-----------------------RILS 658

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP    D         + +WV +V+P+    +   L ++S+++RL  I
Sbjct: 659 HFGPMPAKDPDPQANPNGPAWCWWVLAVLPLENRAQLPFLAMKSLKDRLNGI 710



>gi|75072991|sp|Q8HXH0.1|LONF3_MACFA RecName: Full=LON peptidase N-terminal domain and RING finger
           protein 3
 gi|26449305|dbj|BAC41780.1| hypothetical protein [Macaca fascicularis]
          Length = 718

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +      S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNCVYQQA----SLWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|332226230|ref|XP_003262292.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Nomascus leucogenys]
          Length = 502

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 224 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 283

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 284 LYEEEMEELSNLNKNVPIFVCT-IAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 342

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 343 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 399

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+       +    S W       
Sbjct: 400 ------------------------QKVQGEDCAELMGLHN----CVYQQASLWFHSLKSS 431

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 432 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 490



>gi|322697143|gb|EFY88926.1| hypothetical protein MAC_05020 [Metarhizium acridum CQMa 102]
          Length = 547

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 129/252 (51%), Gaps = 42/252 (16%)

Query: 72  DTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVL------ACSNTYQDF 125
           D P+FV   L FP MP FLH+FEP+YRLM+RR ++   R FGMVL      A    + + 
Sbjct: 290 DLPLFVCT-LAFPSMPTFLHIFEPRYRLMVRRALEG-NRTFGMVLPKRPRDADDTHFYEL 347

Query: 126 GTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDIS---------- 175
           GT+L I +AEF  DGRSL+ET+G  +F+V+  G  DGY + + ERVDD+S          
Sbjct: 348 GTLLRIVNAEFYPDGRSLIETVGLTRFRVLRHGELDGYTIAKTERVDDMSLEEEEAVEAY 407

Query: 176 ------------PXXXXXXXXXXXXXXXIYNTSNPLNNPI------------REYTTSEL 211
                                       I + + P   PI            +  +T  L
Sbjct: 408 EAAAATRNVDAAVLNSGSSAGVDSAPVEISDETRPETEPIGIPPIPRTASDLQAMSTQNL 467

Query: 212 IGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASVIPIAEGEKYKLLELRS 271
           +  +  F+  +R  + PWL  R+  +YG+ P DP+ F +W AS++P+ + EKY+LL   S
Sbjct: 468 MSYATAFVSRMRGQSVPWLTARMFGIYGECPSDPAVFPWWFASMLPVKDLEKYRLLGTSS 527

Query: 272 VRERLKLIVEWI 283
           VRERLK+   WI
Sbjct: 528 VRERLKICCGWI 539



>gi|363732675|ref|XP_420345.3| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform X2 [Gallus gallus]
          Length = 671

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 148/292 (50%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L    A   +     +   I    P   +ERR 
Sbjct: 392 PCGHTFCLKCLERCLDHNPKCPLCKEGLSECLAMRKYCKTVLMEELIAKYLPEELTERRK 451

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM ++
Sbjct: 452 IYEEEIAELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIS 510

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G +LEIR+ EF ADGRS+V++IG  +FKVI+   +DGY+   +E ++D   
Sbjct: 511 DPVKGFADYGCILEIRNVEFFADGRSVVDSIGKRRFKVIQHSQRDGYNTADIEYIED-QK 569

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                          +Y+ +    N +++   S                       R+ S
Sbjct: 570 VQGQDYAALLVLHDSVYDQAYMWFNSLKQALKS-----------------------RILS 606

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP    D         + +WV +V+P+    +   L ++S+++RL  I
Sbjct: 607 HFGPMPAKDPDPQANPNGPAWCWWVLAVLPLENRAQLPFLAMKSLKDRLNGI 658



>gi|300797540|ref|NP_001178514.1| LON peptidase N-terminal domain and RING finger protein 3 [Rattus
           norvegicus]
          Length = 757

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 149/299 (49%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P    ERR 
Sbjct: 479 PCGHTFCLKCLERCLDHNAKCPLCKDVLLQCLPSRKYSKNVIMEELIAKFLPEELKERRR 538

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  +QFGM L 
Sbjct: 539 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTKQFGMCLG 597

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F +DGRS+V++IG  +FKV+ +G +DGY+   +E ++D   
Sbjct: 598 DPVKGFAEYGCILEIRNVQFFSDGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIED--- 654

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     E      S W       
Sbjct: 655 ------------------------QKVQGDDCAELVGLHNCVYEQA----SSWFHSLKTS 686

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+   D         + +W  +V+P+    +   L +RS+++RL  I
Sbjct: 687 LKNRILNHFGPMPEKDEDPQVNPNGPAWCWWTLAVLPLESRAQLPFLAMRSLKDRLNGI 745



>gi|297710866|ref|XP_002832081.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 2 [Pongo abelii]
          Length = 718

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 151/299 (50%), Gaps = 52/299 (17%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L        +  N  +   I    P    ERR 
Sbjct: 440 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLVSRKYSKNVIMEELIAKFLPEELKERRK 499

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 500 LYEEEMEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 558

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 559 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 615

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPW------- 229
                                     ++    +EL+G+     +     +S W       
Sbjct: 616 ------------------------QKVQGEDCAELMGLHNSVYQQ----SSLWFHSLKSS 647

Query: 230 LLQRLNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           L  R+ + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 648 LKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 706



>gi|345306671|ref|XP_001513421.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3-like [Ornithorhynchus anatinus]
          Length = 597

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 148/295 (50%), Gaps = 44/295 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L    A   +     +   I    P   +ER+ 
Sbjct: 318 PCGHTFCLKCLERCLDHNPKCPLCKEGLSECLAMRKYCKTVIMEELIAKYLPEELTERKK 377

Query: 61  LLDSE---LFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + + E   L N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM + 
Sbjct: 378 VYEEEIEELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIG 436

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G +LEIR+ EF ADGRS+V++IG  +FKVI+   +DGY+   +E ++D   
Sbjct: 437 DPIKGFADYGCILEIRNVEFFADGRSVVDSIGKRRFKVIQHSQRDGYNTADIEYIED--- 493

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETL---RNGNSPWLLQR 233
                                     ++    +EL+G+     +      N     L  R
Sbjct: 494 ------------------------QKVQGEDYAELLGLHDSVYDQAFMWFNSLKQALKSR 529

Query: 234 LNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + S +G MP    D         + +WV +V+P+    +   L ++S+++RL  I
Sbjct: 530 ILSHFGPMPAKDPDPQANPNGPAWCWWVLAVLPLESRAQLPFLAMKSLKDRLNGI 584



>gi|483512038|gb|EOB00665.1| LON peptidase N-terminal domain and RING finger protein 3, partial
           [Anas platyrhynchos]
          Length = 440

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 148/292 (50%), Gaps = 38/292 (13%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN  CP+C++ L    A   +     +   I    P   +ERR 
Sbjct: 161 PCGHTFCLKCLERCLDHNPKCPLCKEGLSECLAMRKYCKTVLMEELIARYLPEELTERRK 220

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           + +   +EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRCM++  +QFGM ++
Sbjct: 221 IYEEEIAELSNLNKNVPIFVCT-MAYPTVPCPLHIFEPCYRLMIRRCMETGTKQFGMCIS 279

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + D+G +LEIR+ EF ADGRS+V++IG  +FKVI+   +DGY+   +E ++D   
Sbjct: 280 DPVKGFADYGCILEIRNVEFFADGRSVVDSIGKRRFKVIQHSQRDGYNTADIEYIED--- 336

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLRNGNSPWLLQRLNS 236
                           Y     L++ +             D   T  N     L  R+ S
Sbjct: 337 ---------QKVQGQDYAALLVLHDSV------------YDLAYTWFNSLKQALKSRILS 375

Query: 237 VYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
            +G MP    D         + +WV +V+P+    +   L ++S+++RL  I
Sbjct: 376 HFGPMPAKDPDPQANPNGPAWCWWVLAVLPLENRAQLPFLAMKSLKDRLNGI 427



>gi|332226228|ref|XP_003262291.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           3 isoform 1 [Nomascus leucogenys]
          Length = 516

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 150/295 (50%), Gaps = 44/295 (14%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHPINKTIYSFIRALYPSLYSERRY 60
           PCGH+FC  C+ R LDHN+ CP+C+  L    A   +  N  +   I    P    ERR 
Sbjct: 238 PCGHTFCLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRK 297

Query: 61  LLD---SELFNTMQDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMVLA 117
           L +    EL N  ++ PIFV   + +P +PC LH+FEP YRLMIRRC+++  RQFGM L 
Sbjct: 298 LYEEEMEELSNLNKNVPIFVC-TIAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLG 356

Query: 118 CS-NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVERVDDISP 176
                + ++G +LEIR+ +F ADGRS+V++IG  +F+V+ +  +DGY+   +E ++D   
Sbjct: 357 DPVKGFAEYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIED--- 413

Query: 177 XXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETLR---NGNSPWLLQR 233
                                     ++    +EL+G+     +      +     L  R
Sbjct: 414 ------------------------QKVQGEDCAELMGLHNCVYQQASLWFHSLKSSLKNR 449

Query: 234 LNSVYGDMPDDPSD---------FSYWVASVIPIAEGEKYKLLELRSVRERLKLI 279
           + + +G MP+  +D         + +W+ +V+P+    +   L +RS+++RL  I
Sbjct: 450 ILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLESRAQLPFLAMRSLKDRLNGI 504



>gi|340379279|ref|XP_003388154.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein
           2-like [Amphimedon queenslandica]
          Length = 649

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 159/306 (51%), Gaps = 49/306 (16%)

Query: 1   PCGHSFCKPCITRSLDHNSACPICRQPLHNYNAYLHHP-------INKTIYSFIRALYPS 53
           PCGHSFC+ C+ R  DH+  CP+CR  L     ++ H        I+ T+ S I+ L+ +
Sbjct: 366 PCGHSFCRDCLARLFDHSPYCPVCRASLGEM--FIQHTQSSGQMCIDVTLESIIQHLFST 423

Query: 54  LYSERRYLLDSELFNTM-------QDTPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQ 106
           LY E++ +  +E            +  PIFV   + FP M C LH+FEPKYRLM+RRC++
Sbjct: 424 LYEEKKSVFVAERIRLSKIGITEDEPLPIFVCT-MTFPAMTCPLHIFEPKYRLMMRRCIE 482

Query: 107 SRQRQFGMVLACS---NTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGY 163
           +  R+FGM        NTY D+GT+L I S E+  DGRSLV T+G  +F+VIE+ ++DGY
Sbjct: 483 TNSRRFGMCTPLDRECNTYVDYGTVLFISSLEYTPDGRSLVTTVGERRFRVIERSTRDGY 542

Query: 164 DVGRVERV-DDISPXXXXXXXXXXXXXXXIYNTSNPLNNPIREYTTSELIGISRDFIETL 222
            V R++ + D++ P                  + + L   + E+           +++ L
Sbjct: 543 AVARIQFLSDEVDPDQ---------------ESLDALQVEVYEHCN--------KWLQAL 579

Query: 223 RNGNSPWLLQRLNSVYGDMPDDPSD-----FSYWVASVIPIAEGEKYKLLELRSVRERLK 277
                  +LQ + +   ++ D P+      + +W  + +P+    K + L+  S+RERL+
Sbjct: 580 PLFTRLMILQAMTTCPPNINDPPTSHDGPLWVWWFVNAMPVTVRSKLEFLQCTSLRERLR 639

Query: 278 LIVEWI 283
           L+ E +
Sbjct: 640 LLKEIL 645



>gi|438688539|emb|CCP50075.1| RING finger protein [Fusarium fujikuroi]
          Length = 547

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 139/276 (50%), Gaps = 44/276 (15%)

Query: 58  RRYLLDSELFNTMQD--TPIFVTNALVFPKMPCFLHVFEPKYRLMIRRCMQSRQRQFGMV 115
           R+  LD+E    MQD    +FV   L FP+MP FLH+FEP+YRLMIRR ++     FGMV
Sbjct: 256 RKEALDAERVAQMQDYDLALFVCT-LSFPQMPTFLHIFEPRYRLMIRRALEG-DHTFGMV 313

Query: 116 LA------CSNTYQDFGTMLEIRSAEFLADGRSLVETIGTYKFKVIEKGSKDGYDVGRVE 169
           +           +   GT+L I + +F  DGRSL+ET+G  +F+V+E    DGY VG+ E
Sbjct: 314 IPKRPQHPGDANFHQLGTLLRIVNVQFFPDGRSLIETVGLSRFRVLEHSYLDGYIVGKTE 373

Query: 170 RVDDIS----------------PXXXXXXXXXXXXXXXIYNTSNPL----------NNP- 202
           R+DD+S                P               +   + P           ++P 
Sbjct: 374 RIDDVSLEDEEAAEAAEAAEATPIETEDQQQPIQAMDTVQEPTEPTPTSPLPRSDSSSPR 433

Query: 203 -------IREYTTSELIGISRDFIETLRNGNSPWLLQRLNSVYGDMPDDPSDFSYWVASV 255
                  I   +T  L+  +  F+  +R  + PWL +R+ ++YG+ P+DP+ F +W AS+
Sbjct: 434 MPTSITEIDSMSTQNLMHYASSFVTRMRQQSVPWLTERMLTIYGECPEDPAIFPWWFASM 493

Query: 256 IPIAEGEKYKLLELRSVRERLKLIVEWISSLRDQWW 291
           +P+ + EKY+LL   SVRERLK+   WI       W
Sbjct: 494 LPVKDIEKYRLLGTSSVRERLKICCTWIVEWETSRW 529