BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp1002_c0_seq1-m.12 5prime_partial 1-1332(+) 444 (+)
         (443 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|299753034|ref|XP_001833014.2| autophagy-type protein 9 [Copri...   345   2e-92   Coprinopsis cinerea okayama7#130
gi|389749173|gb|EIM90350.1| APG9-domain-containing protein [Ster...   340   7e-91   Stereum hirsutum FP-91666 SS1
gi|403412919|emb|CCL99619.1| predicted protein [Fibroporia radic...   338   2e-90   Fibroporia radiculosa
gi|392567056|gb|EIW60231.1| APG9-domain-containing protein [Tram...   336   8e-90   Trametes versicolor FP-101664 SS1
gi|449547188|gb|EMD38156.1| hypothetical protein CERSUDRAFT_8239...   332   1e-88   Gelatoporia subvermispora B
gi|336367239|gb|EGN95584.1| hypothetical protein SERLA73DRAFT_95...   330   5e-88   Serpula lacrymans var. lacrymans S7.3
gi|511010618|gb|EPB91838.1| hypothetical protein HMPREF1544_0134...   329   9e-88   Mucor circinelloides f. circinelloides 1006PhL
gi|393220226|gb|EJD05712.1| APG9-domain-containing protein [Fomi...   328   3e-87   Fomitiporia mediterranea MF3/22
gi|395333811|gb|EJF66188.1| APG9-domain-containing protein [Dich...   327   4e-87   Dichomitus squalens LYAD-421 SS1
gi|353236467|emb|CCA68461.1| related to ATG9-integral membrane p...   324   3e-86   Serendipita indica DSM 11827
gi|472580579|gb|EMS18368.1| autophagy-related protein 9 [Rhodosp...   319   1e-84   Rhodotorula toruloides NP11
gi|443897051|dbj|GAC74393.1| predicted glutamine synthetase [Pse...   318   2e-84   Moesziomyces antarcticus T-34
gi|238603192|ref|XP_002395881.1| hypothetical protein MPER_03985...   314   3e-83   
gi|426200063|gb|EKV49987.1| hypothetical protein AGABI2DRAFT_183...   308   2e-81   Agaricus bisporus var. bisporus H97
gi|321262759|ref|XP_003196098.1| autophagic vacuole formation-re...   308   3e-81   Cryptococcus gattii WM276
gi|73619453|sp|Q6TGJ4.1|ATG9_CRYGA RecName: Full=Autophagy-relat...   308   3e-81   Cryptococcus gattii VGI
gi|134110402|ref|XP_776028.1| hypothetical protein CNBD0770 [Cry...   308   3e-81   Cryptococcus neoformans var. neoformans B-3501A
gi|405119927|gb|AFR94698.1| apg9 [Cryptococcus neoformans var. g...   308   3e-81   
gi|343425663|emb|CBQ69197.1| related to ATG9-integral membrane p...   303   5e-80   Sporisorium reilianum SRZ2
gi|388855494|emb|CCF50940.1| related to ATG9-integral membrane p...   302   1e-79   Ustilago hordei
gi|501756033|emb|CCG80926.1| Autophagy-related protein 9 [Taphri...   301   3e-79   Taphrina deformans PYCC 5710
gi|501309182|dbj|GAC98040.1| hypothetical protein PHSY_005628 [P...   298   3e-78   Pseudozyma hubeiensis SY62
gi|58266636|ref|XP_570474.1| autophagic vacuole formation-relate...   293   8e-77   Cryptococcus neoformans var. neoformans JEC21
gi|393245693|gb|EJD53203.1| APG9-domain-containing protein [Auri...   289   1e-75   Auricularia subglabra TFB-10046 SS5
gi|392574606|gb|EIW67742.1| hypothetical protein TREMEDRAFT_4522...   287   4e-75   Tremella mesenterica DSM 1558
gi|505756733|gb|EOR00874.1| Autophagy-related protein 9 [Wallemi...   285   2e-74   Wallemia ichthyophaga EXF-994
gi|358054383|dbj|GAA99309.1| hypothetical protein E5Q_06004 [Mix...   285   2e-74   Mixia osmundae IAM 14324
gi|121700050|ref|XP_001268290.1| autophagy protein Apg9, putativ...   285   2e-74   Aspergillus clavatus NRRL 1
gi|388582416|gb|EIM22721.1| APG9-domain-containing protein [Wall...   285   2e-74   Wallemia mellicola CBS 633.66
gi|70992529|ref|XP_751113.1| autophagy protein Apg9 [Aspergillus...   285   2e-74   Aspergillus fumigatus Af293
gi|225560831|gb|EEH09112.1| conserved hypothetical protein [Ajel...   284   3e-74   Histoplasma capsulatum G186AR
gi|119472590|ref|XP_001258378.1| autophagy protein Apg9, putativ...   284   4e-74   Aspergillus fischeri NRRL 181
gi|154278002|ref|XP_001539828.1| conserved hypothetical protein ...   284   4e-74   Histoplasma capsulatum NAm1
gi|71020593|ref|XP_760527.1| hypothetical protein UM04380.1 [Ust...   284   4e-74   
gi|406865744|gb|EKD18785.1| putative Autophagy-related protein 9...   282   2e-73   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|242790878|ref|XP_002481645.1| autophagy protein Apg9, putativ...   281   3e-73   Talaromyces stipitatus ATCC 10500
gi|443925189|gb|ELU44090.1| autophagic vacuole formation-related...   281   3e-73   Rhizoctonia solani AG-1 IA
gi|295664781|ref|XP_002792942.1| autophagy-related protein 9 [Pa...   280   6e-73   Paracoccidioides lutzii Pb01
gi|119194771|ref|XP_001247989.1| hypothetical protein CIMG_01760...   280   6e-73   Coccidioides immitis RS
gi|226293427|gb|EEH48847.1| autophagy-related protein 9 [Paracoc...   280   8e-73   Paracoccidioides brasiliensis Pb18
gi|225684036|gb|EEH22320.1| autophagy-related protein 9 [Paracoc...   279   1e-72   
gi|325089117|gb|EGC42427.1| autophagy protein Apg9 [Ajellomyces ...   279   1e-72   Histoplasma capsulatum H88
gi|238504334|ref|XP_002383398.1| autophagy protein Apg9, putativ...   279   1e-72   Aspergillus flavus NRRL3357
gi|303310985|ref|XP_003065504.1| Autophagy protein Apg9 containi...   279   1e-72   Coccidioides posadasii C735 delta SOWgp
gi|317138115|ref|XP_001816681.2| autophagy-related protein 9 [As...   278   2e-72   Aspergillus oryzae RIB40
gi|391869991|gb|EIT79179.1| integral membrane protein [Aspergill...   278   2e-72   Aspergillus oryzae 3.042
gi|121923457|sp|Q2UUT6.1|ATG9_ASPOR RecName: Full=Autophagy-rela...   278   2e-72   Aspergillus oryzae RIB40
gi|327354893|gb|EGE83750.1| autophagy protein Apg9 [Ajellomyces ...   278   2e-72   Blastomyces dermatitidis ATCC 18188
gi|261203801|ref|XP_002629114.1| autophagy protein Apg9 [Ajellom...   278   3e-72   Blastomyces gilchristii SLH14081
gi|239608870|gb|EEQ85857.1| autophagy protein Apg9 [Ajellomyces ...   278   3e-72   
gi|440638342|gb|ELR08261.1| hypothetical protein GMDG_03062 [Geo...   278   3e-72   Pseudogymnoascus destructans 20631-21
gi|115389912|ref|XP_001212461.1| conserved hypothetical protein ...   276   9e-72   Aspergillus terreus NIH2624
gi|384496195|gb|EIE86686.1| hypothetical protein RO3G_11397 [Rhi...   276   9e-72   Rhizopus delemar RA 99-880
gi|258568068|ref|XP_002584778.1| conserved hypothetical protein ...   276   1e-71   Uncinocarpus reesii 1704
gi|320031457|gb|EFW13420.1| autophagy protein Apg9 [Coccidioides...   275   1e-71   Coccidioides posadasii str. Silveira
gi|425776206|gb|EKV14434.1| Autophagy protein Apg9, putative [Pe...   275   2e-71   Penicillium digitatum Pd1
gi|425768944|gb|EKV07455.1| Autophagy protein Apg9, putative [Pe...   275   2e-71   Penicillium digitatum PHI26
gi|255947352|ref|XP_002564443.1| Pc22g04040 [Penicillium chrysog...   275   3e-71   Penicillium rubens Wisconsin 54-1255
gi|212534688|ref|XP_002147500.1| autophagy protein Apg9, putativ...   274   3e-71   Talaromyces marneffei ATCC 18224
gi|340931840|gb|EGS19373.1| putative mitochondrial carrier prote...   274   3e-71   Chaetomium thermophilum var. thermophilum DSM 1495
gi|67526553|ref|XP_661338.1| hypothetical protein AN3734.2 [Aspe...   274   4e-71   Aspergillus nidulans FGSC A4
gi|315054001|ref|XP_003176375.1| Atg9p [Arthroderma gypseum CBS ...   273   1e-70   Microsporum gypseum CBS 118893
gi|358371381|dbj|GAA87989.1| autophagy protein Apg9 [Aspergillus...   273   1e-70   Aspergillus kawachii IFO 4308
gi|166990640|sp|A2QLJ9.1|ATG9_ASPNC RecName: Full=Autophagy-rela...   272   2e-70   Aspergillus niger CBS 513.88
gi|317029027|ref|XP_001390972.2| autophagy-related protein 9 [As...   272   2e-70   Aspergillus niger CBS 513.88
gi|326469504|gb|EGD93513.1| hypothetical protein TESG_01058 [Tri...   271   3e-70   Trichophyton tonsurans CBS 112818
gi|326484386|gb|EGE08396.1| Atg9p [Trichophyton equinum CBS 127.97]   271   3e-70   Trichophyton equinum CBS 127.97
gi|327308786|ref|XP_003239084.1| hypothetical protein TERG_01068...   271   4e-70   Trichophyton rubrum CBS 118892
gi|302504343|ref|XP_003014130.1| hypothetical protein ARB_07435 ...   270   5e-70   Arthroderma benhamiae CBS 112371
gi|302655817|ref|XP_003019692.1| hypothetical protein TRV_06282 ...   270   8e-70   Trichophyton verrucosum HKI 0517
gi|401885186|gb|EJT49309.1| hypothetical protein A1Q1_01511 [Tri...   270   9e-70   Trichosporon asahii var. asahii CBS 2479
gi|402225211|gb|EJU05272.1| APG9-domain-containing protein [Dacr...   269   1e-69   Dacryopinax primogenitus
gi|390597644|gb|EIN07043.1| APG9-domain-containing protein [Punc...   269   2e-69   Punctularia strigosozonata HHB-11173 SS5
gi|328852810|gb|EGG01953.1| hypothetical protein MELLADRAFT_4997...   266   1e-68   Melampsora larici-populina 98AG31
gi|189091792|ref|XP_001929729.1| hypothetical protein [Podospora...   265   2e-68   Podospora anserina S mat+
gi|346326962|gb|EGX96558.1| Autophagy-related protein 9 [Cordyce...   265   2e-68   Cordyceps militaris CM01
gi|302915355|ref|XP_003051488.1| hypothetical protein NECHADRAFT...   263   9e-68   Nectria haematococca mpVI 77-13-4
gi|328773200|gb|EGF83237.1| hypothetical protein BATDEDRAFT_1838...   261   3e-67   Batrachochytrium dendrobatidis JAM81
gi|472241215|gb|EMR85945.1| putative autophagy-related protein 9...   261   3e-67   Botrytis cinerea BcDW1
gi|347836088|emb|CCD50660.1| similar to autophagy-related protei...   261   3e-67   Botrytis cinerea T4
gi|400593023|gb|EJP61034.1| autophagy protein Apg9 [Beauveria ba...   260   7e-67   Beauveria bassiana ARSEF 2860
gi|320588380|gb|EFX00849.1| autophagy protein [Grosmannia clavig...   258   2e-66   Grosmannia clavigera kw1407
gi|336259129|ref|XP_003344369.1| hypothetical protein SMAC_08312...   257   5e-66   Sordaria macrospora k-hell
gi|156050735|ref|XP_001591329.1| hypothetical protein SS1G_07955...   257   5e-66   Sclerotinia sclerotiorum 1980 UF-70
gi|85092988|ref|XP_959604.1| hypothetical protein NCU02422 [Neur...   257   5e-66   Neurospora crassa OR74A
gi|166990657|sp|A7ERK1.2|ATG9_SCLS1 RecName: Full=Autophagy-rela...   256   7e-66   Sclerotinia sclerotiorum 1980 UF-70
gi|336467367|gb|EGO55531.1| hypothetical protein NEUTE1DRAFT_672...   256   9e-66   Neurospora tetrasperma FGSC 2508
gi|408392888|gb|EKJ72176.1| hypothetical protein FPSE_07633 [Fus...   256   1e-65   Fusarium pseudograminearum CS3096
gi|296411511|ref|XP_002835474.1| hypothetical protein [Tuber mel...   255   2e-65   Tuber melanosporum Mel28
gi|406694713|gb|EKC98035.1| hypothetical protein A1Q2_07581 [Tri...   255   2e-65   Trichosporon asahii var. asahii CBS 8904
gi|392595569|gb|EIW84892.1| APG9-domain-containing protein [Coni...   254   3e-65   Coniophora puteana RWD-64-598 SS2
gi|409045796|gb|EKM55276.1| hypothetical protein PHACADRAFT_9577...   254   3e-65   Phanerochaete carnosa HHB-10118-sp
gi|345568407|gb|EGX51301.1| hypothetical protein AOL_s00054g371 ...   254   4e-65   Arthrobotrys oligospora ATCC 24927
gi|380488145|emb|CCF37576.1| autophagy protein Apg9 [Colletotric...   254   4e-65   Colletotrichum higginsianum
gi|512187885|gb|EPE03661.1| autophagy protein apg9 [Ophiostoma p...   253   6e-65   Ophiostoma piceae UAMH 11346
gi|477515973|gb|ENH68254.1| Autophagy-related protein 9 [Fusariu...   252   1e-64   Fusarium oxysporum f. sp. cubense race 1
gi|302692102|ref|XP_003035730.1| hypothetical protein SCHCODRAFT...   251   2e-64   Schizophyllum commune H4-8
gi|342877141|gb|EGU78648.1| hypothetical protein FOXB_10834 [Fus...   251   2e-64   Fusarium oxysporum Fo5176
gi|342318925|gb|EGU10881.1| Autophagy-related protein 9 [Rhodoto...   251   4e-64   Rhodotorula toruloides ATCC 204091
gi|402080167|gb|EJT75312.1| autophagy-like protein 9 [Gaeumannom...   250   6e-64   Gaeumannomyces graminis var. tritici R3-111a-1
gi|389629058|ref|XP_003712182.1| autophagy-like protein 9 [Magna...   250   6e-64   Magnaporthe oryzae 70-15
gi|367047431|ref|XP_003654095.1| hypothetical protein THITE_2116...   250   6e-64   Thielavia terrestris NRRL 8126
gi|378732084|gb|EHY58543.1| hypothetical protein HMPREF1120_0655...   250   6e-64   Exophiala dermatitidis NIH/UT8656
gi|346975640|gb|EGY19092.1| hypothetical protein VDAG_09426 [Ver...   249   2e-63   Verticillium dahliae VdLs.17
gi|302404255|ref|XP_002999965.1| conserved hypothetical protein ...   248   3e-63   Verticillium alfalfae VaMs.102
gi|358385643|gb|EHK23239.1| hypothetical protein TRIVIDRAFT_1232...   248   4e-63   Trichoderma virens Gv29-8
gi|406603944|emb|CCH44577.1| Autophagy-related protein [Wickerha...   247   4e-63   Wickerhamomyces ciferrii
gi|340518824|gb|EGR49064.1| predicted protein [Trichoderma reese...   245   2e-62   Trichoderma reesei QM6a
gi|358394279|gb|EHK43672.1| hypothetical protein TRIATDRAFT_1623...   245   2e-62   Trichoderma atroviride IMI 206040
gi|310795050|gb|EFQ30511.1| autophagy protein Apg9 [Glomerella g...   245   2e-62   Colletotrichum graminicola M1.001
gi|512205638|gb|EPE34459.1| Autophagy-related protein 9 [Glarea ...   244   5e-62   Glarea lozoyensis ATCC 20868
gi|409082232|gb|EKM82590.1| hypothetical protein AGABI1DRAFT_351...   242   2e-61   Agaricus bisporus var. burnettii JB137-S8
gi|470326644|ref|XP_004364748.1| conserved hypothetical protein ...   240   5e-61   Capsaspora owczarzaki ATCC 30864
gi|367032300|ref|XP_003665433.1| hypothetical protein MYCTH_2309...   238   2e-60   Myceliophthora thermophila ATCC 42464
gi|50555498|ref|XP_505157.1| YALI0F08349p [Yarrowia lipolytica] ...   236   7e-60   Yarrowia lipolytica CLIB122
gi|331219555|ref|XP_003322454.1| hypothetical protein PGTG_03991...   234   3e-59   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|189191720|ref|XP_001932199.1| membrane protein Gsa14p [Pyreno...   234   6e-59   Pyrenophora tritici-repentis Pt-1C-BFP
gi|330946384|ref|XP_003306762.1| hypothetical protein PTT_19973 ...   233   8e-59   Pyrenophora teres f. teres 0-1
gi|470238444|ref|XP_004353880.1| RasGTPase-activating protein [D...   233   8e-59   Dictyostelium fasciculatum
gi|396500538|ref|XP_003845744.1| similar to autophagy protein Ap...   233   8e-59   Leptosphaeria maculans JN3
gi|121930818|sp|Q0UYL2.1|ATG9_PHANO RecName: Full=Autophagy-rela...   232   1e-58   Parastagonospora nodorum SN15
gi|169600621|ref|XP_001793733.1| hypothetical protein SNOG_03152...   232   1e-58   Parastagonospora nodorum SN15
gi|320581070|gb|EFW95292.1| Autophagy-related protein 9 [Ogataea...   232   1e-58   
gi|166990643|sp|A7KAI7.1|ATG9_PICAN RecName: Full=Autophagy-rela...   232   1e-58   Ogataea angusta
gi|213406990|ref|XP_002174266.1| conserved hypothetical protein ...   231   2e-58   Schizosaccharomyces japonicus yFS275
gi|477532452|gb|ENH84076.1| autophagy protein [Colletotrichum or...   229   1e-57   Colletotrichum orbiculare MAFF 240422
gi|407924578|gb|EKG17611.1| Autophagy-related protein 9 [Macroph...   228   2e-57   Macrophomina phaseolina MS6
gi|302800349|ref|XP_002981932.1| hypothetical protein SELMODRAFT...   228   2e-57   Selaginella moellendorffii
gi|302802311|ref|XP_002982911.1| hypothetical protein SELMODRAFT...   228   3e-57   Selaginella moellendorffii
gi|168020908|ref|XP_001762984.1| predicted protein [Physcomitrel...   228   3e-57   Physcomitrella patens
gi|71152299|sp|Q876N4.1|ATG9_PICPA RecName: Full=Autophagy-relat...   228   3e-57   Komagataella pastoris
gi|254573670|ref|XP_002493944.1| Transmembrane protein involved ...   228   4e-57   Komagataella phaffii GS115
gi|398396658|ref|XP_003851787.1| hypothetical protein MYCGRDRAFT...   227   5e-57   Zymoseptoria tritici IPO323
gi|482807892|gb|EOA84825.1| hypothetical protein SETTUDRAFT_3206...   227   6e-57   Setosphaeria turcica Et28A
gi|307104789|gb|EFN53041.1| hypothetical protein CHLNCDRAFT_1372...   226   9e-57   Chlorella variabilis
gi|429849322|gb|ELA24723.1| autophagy protein [Colletotrichum gl...   226   2e-56   Colletotrichum gloeosporioides Nara gc5
gi|45187944|ref|NP_984167.1| ADR071Wp [Ashbya gossypii ATCC 1089...   225   2e-56   Eremothecium gossypii ATCC 10895
gi|513031831|gb|AGO11840.1| AaceriADR071Wp [Saccharomycetaceae s...   224   6e-56   Saccharomycetaceae sp. 'Ashbya aceri'
gi|384246809|gb|EIE20298.1| APG9-domain-containing protein [Cocc...   223   7e-56   Coccomyxa subellipsoidea C-169
gi|452004678|gb|EMD97134.1| hypothetical protein COCHEDRAFT_1220...   223   1e-55   Bipolaris maydis C5
gi|303276264|ref|XP_003057426.1| predicted protein [Micromonas p...   223   1e-55   Micromonas pusilla CCMP1545
gi|451853257|gb|EMD66551.1| hypothetical protein COCSADRAFT_1694...   223   1e-55   Bipolaris sorokiniana ND90Pr
gi|168052551|ref|XP_001778713.1| predicted protein [Physcomitrel...   223   1e-55   Physcomitrella patens
gi|452840116|gb|EME42054.1| hypothetical protein DOTSEDRAFT_7297...   223   1e-55   Dothistroma septosporum NZE10
gi|401626464|gb|EJS44410.1| atg9p [Saccharomyces arboricola H-6]      222   2e-55   Saccharomyces arboricola H-6
gi|349576929|dbj|GAA22098.1| K7_Atg9p [Saccharomyces cerevisiae ...   222   2e-55   Saccharomyces cerevisiae Kyokai no. 7
gi|6320052|ref|NP_010132.1| Atg9p [Saccharomyces cerevisiae S288...   222   2e-55   Saccharomyces cerevisiae S288c
gi|322707978|gb|EFY99555.1| Autophagy- protein 9 [Metarhizium an...   221   2e-55   
gi|166990334|sp|A6ZXH8.1|ATG9_YEAS7 RecName: Full=Autophagy-rela...   221   2e-55   Saccharomyces cerevisiae YJM789
gi|207347061|gb|EDZ73368.1| YDL149Wp-like protein [Saccharomyces...   221   5e-55   Saccharomyces cerevisiae AWRI1631
gi|259145095|emb|CAY78359.1| Atg9p [Saccharomyces cerevisiae EC1...   220   5e-55   Saccharomyces cerevisiae EC1118
gi|322701878|gb|EFY93626.1| Autophagy-related protein 9 [Metarhi...   219   9e-55   Metarhizium acridum CQMa 102
gi|361123928|gb|EHK96065.1| putative Autophagy-related protein 9...   219   1e-54   Glarea lozoyensis 74030
gi|365766705|gb|EHN08200.1| Atg9p [Saccharomyces cerevisiae x Sa...   219   1e-54   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|255719350|ref|XP_002555955.1| KLTH0H01760p [Lachancea thermot...   217   5e-54   Lachancea thermotolerans CBS 6340
gi|452981288|gb|EME81048.1| hypothetical protein MYCFIDRAFT_1087...   217   5e-54   Cercospora fijiensis CIRAD86
gi|494826836|gb|EON63863.1| hypothetical protein W97_03091 [Coni...   217   6e-54   Coniosporium apollinis CBS 100218
gi|449299820|gb|EMC95833.1| hypothetical protein BAUCODRAFT_4409...   217   7e-54   Baudoinia panamericana UAMH 10762
gi|367011635|ref|XP_003680318.1| hypothetical protein TDEL_0C021...   216   7e-54   Torulaspora delbrueckii
gi|500259775|gb|EOO02537.1| putative autophagy-like protein 9 pr...   216   1e-53   Phaeoacremonium minimum UCRPA7
gi|366989137|ref|XP_003674336.1| hypothetical protein NCAS_0A139...   215   2e-53   Naumovozyma castellii CBS 4309
gi|50305941|ref|XP_452931.1| hypothetical protein [Kluyveromyces...   214   5e-53   Kluyveromyces lactis NRRL Y-1140
gi|460382915|ref|XP_004237181.1| PREDICTED: autophagy-related pr...   214   5e-53   Solanum lycopersicum
gi|298711723|emb|CBJ32769.1| Autophagy-related protein 9 [Ectoca...   213   7e-53   Ectocarpus siliculosus
gi|363755950|ref|XP_003648191.1| hypothetical protein Ecym_8078 ...   213   8e-53   Eremothecium cymbalariae DBVPG#7215
gi|482562378|gb|EOA26568.1| hypothetical protein CARUB_v10022626...   213   9e-53   Capsella rubella
gi|297826571|ref|XP_002881168.1| hypothetical protein ARALYDRAFT...   213   9e-53   Arabidopsis lyrata subsp. lyrata
gi|432917647|ref|XP_004079534.1| PREDICTED: autophagy-related pr...   213   9e-53   Oryzias latipes [Japanese rice fish]
gi|453084318|gb|EMF12362.1| APG9-domain-containing protein [Myco...   213   1e-52   Sphaerulina musiva SO2202
gi|449496947|ref|XP_004160271.1| PREDICTED: LOW QUALITY PROTEIN:...   212   1e-52   
gi|403214994|emb|CCK69494.1| hypothetical protein KNAG_0C03900 [...   212   1e-52   Kazachstania naganishii CBS 8797
gi|50289951|ref|XP_447407.1| hypothetical protein [Candida glabr...   212   2e-52   Candida glabrata CBS 138
gi|224066265|ref|XP_002302054.1| predicted protein [Populus tric...   212   2e-52   
gi|4432821|gb|AAD20671.1| unknown protein [Arabidopsis thaliana]      212   2e-52   Arabidopsis thaliana [mouse-ear cress]
gi|30684887|ref|NP_850164.1| protein autophagy 9 [Arabidopsis th...   211   2e-52   Arabidopsis thaliana [mouse-ear cress]
gi|449468664|ref|XP_004152041.1| PREDICTED: autophagy-related pr...   211   2e-52   
gi|462396023|gb|EMJ01822.1| hypothetical protein PRUPE_ppa001270...   211   3e-52   Prunus persica
gi|410075900|ref|XP_003955532.1| hypothetical protein KAFR_0B009...   211   4e-52   Kazachstania africana CBS 2517
gi|508702585|gb|EOX94481.1| Autophagy 9 [Theobroma cacao]             211   5e-52   Theobroma cacao [chocolate]
gi|485925293|gb|EOD49916.1| putative autophagy protein [Neofusic...   210   7e-52   Neofusicoccum parvum UCRNP2
gi|297744125|emb|CBI37095.3| unnamed protein product [Vitis vini...   210   7e-52   Vitis vinifera
gi|254584240|ref|XP_002497688.1| ZYRO0F11264p [Zygosaccharomyces...   210   8e-52   Zygosaccharomyces rouxii CBS 732
gi|156838839|ref|XP_001643118.1| hypothetical protein Kpol_461p1...   210   9e-52   Vanderwaltozyma polyspora DSM 70294
gi|512881983|ref|XP_002943059.2| PREDICTED: autophagy-related pr...   209   9e-52   Xenopus tropicalis [western clawed frog]
gi|308804131|ref|XP_003079378.1| Integral membrane protein (ISS)...   209   9e-52   Ostreococcus tauri
gi|225437848|ref|XP_002263784.1| PREDICTED: autophagy-related pr...   209   1e-51   
gi|145347101|ref|XP_001418016.1| predicted protein [Ostreococcus...   209   1e-51   Ostreococcus lucimarinus CCE9901
gi|470107174|ref|XP_004289924.1| PREDICTED: autophagy-related pr...   209   2e-51   Fragaria vesca subsp. vesca
gi|255076885|ref|XP_002502107.1| autophagy domain-containing pro...   209   2e-51   Micromonas commoda
gi|356545851|ref|XP_003541347.1| PREDICTED: autophagy-related pr...   208   3e-51   Glycine max [soybeans]
gi|399164917|emb|CCE34192.1| probable APG9-integral membrane pro...   208   3e-51   Claviceps purpurea 20.1
gi|255583208|ref|XP_002532369.1| conserved hypothetical protein ...   207   4e-51   
gi|444321264|ref|XP_004181288.1| hypothetical protein TBLA_0F022...   207   4e-51   Tetrapisispora blattae CBS 6284
gi|224082790|ref|XP_002306839.1| predicted protein [Populus tric...   207   5e-51   Populus trichocarpa [western balsam poplar]
gi|410923707|ref|XP_003975323.1| PREDICTED: autophagy-related pr...   207   6e-51   Takifugu rubripes [tiger puffer]
gi|66809109|ref|XP_638277.1| autophagy protein 9 [Dictyostelium ...   204   3e-50   Dictyostelium discoideum AX4
gi|28395475|gb|AAO39079.1| autophagy protein 9 [Dictyostelium di...   204   4e-50   Dictyostelium discoideum
gi|498945666|ref|XP_004542879.1| PREDICTED: autophagy-related pr...   204   4e-50   Maylandia zebra
gi|327288877|ref|XP_003229151.1| PREDICTED: autophagy-related pr...   204   5e-50   
gi|348500697|ref|XP_003437909.1| PREDICTED: autophagy-related pr...   204   5e-50   
gi|471561800|gb|EMR63476.1| putative autophagy-related protein 9...   204   5e-50   Eutypa lata UCREL1
gi|47220347|emb|CAF98446.1| unnamed protein product [Tetraodon n...   204   6e-50   Tetraodon nigroviridis
gi|443702522|gb|ELU00510.1| hypothetical protein CAPTEDRAFT_1367...   203   9e-50   Capitella teleta
gi|19113039|ref|NP_596247.1| autophagy associated protein Atg9 [...   203   1e-49   Schizosaccharomyces pombe 972h-
gi|449689238|ref|XP_002157906.2| PREDICTED: autophagy-related pr...   203   1e-49   
gi|365981543|ref|XP_003667605.1| hypothetical protein NDAI_0A020...   202   1e-49   Naumovozyma dairenensis CBS 421
gi|502115030|ref|XP_004495109.1| PREDICTED: autophagy-related pr...   202   2e-49   Cicer arietinum [garbanzo]
gi|242039075|ref|XP_002466932.1| hypothetical protein SORBIDRAFT...   202   2e-49   Sorghum bicolor [broomcorn]
gi|356503602|ref|XP_003520596.1| PREDICTED: autophagy-related pr...   202   2e-49   Glycine max [soybeans]
gi|367005384|ref|XP_003687424.1| hypothetical protein TPHA_0J016...   201   3e-49   Tetrapisispora phaffii CBS 4417
gi|330793179|ref|XP_003284663.1| hypothetical protein DICPUDRAFT...   200   9e-49   Dictyostelium purpureum
gi|125543117|gb|EAY89256.1| hypothetical protein OsI_10753 [Oryz...   199   1e-48   Oryza sativa Indica Group [Indian rice]
gi|74831802|emb|CAJ30211.1| autophagy protein 9 [Saccharum offic...   199   1e-48   Saccharum officinarum [noble cane]
gi|158260533|dbj|BAF82444.1| unnamed protein product [Homo sapiens]   199   1e-48   Homo sapiens [man]
gi|222624568|gb|EEE58700.1| hypothetical protein OsJ_10136 [Oryz...   199   1e-48   Oryza sativa Japonica Group [Japonica rice]
gi|115451905|ref|NP_001049553.1| Os03g0248000 [Oryza sativa Japo...   199   2e-48   
gi|327260430|ref|XP_003215037.1| PREDICTED: autophagy-related pr...   199   2e-48   Anolis carolinensis [Carolina anole]
gi|432103433|gb|ELK30538.1| Autophagy-related protein 9A [Myotis...   198   3e-48   Myotis davidii
gi|356570636|ref|XP_003553491.1| PREDICTED: autophagy-related pr...   198   3e-48   
gi|21739357|emb|CAD38723.1| hypothetical protein [Homo sapiens]       197   4e-48   Homo sapiens [man]
gi|471376680|ref|XP_004376390.1| PREDICTED: autophagy-related pr...   197   4e-48   Trichechus manatus latirostris
gi|193786476|dbj|BAG51759.1| unnamed protein product [Homo sapiens]   197   4e-48   Homo sapiens [man]
gi|397495714|ref|XP_003818691.1| PREDICTED: autophagy-related pr...   197   4e-48   Pan paniscus [bonobo]
gi|332246599|ref|XP_003272440.1| PREDICTED: LOW QUALITY PROTEIN:...   197   4e-48   
gi|114583419|ref|XP_001161185.1| PREDICTED: autophagy-related pr...   197   4e-48   Pan troglodytes
gi|116089282|ref|NP_001070666.1| autophagy-related protein 9A [H...   197   4e-48   Homo sapiens [man]
gi|395527633|ref|XP_003765947.1| PREDICTED: autophagy-related pr...   197   5e-48   Sarcophilus harrisii
gi|197099732|ref|NP_001127287.1| autophagy-related protein 9A [P...   197   5e-48   Pongo abelii [Orang-utan]
gi|383872529|ref|NP_001244824.1| autophagy related 9A [Macaca mu...   197   5e-48   Macaca mulatta [rhesus macaque]
gi|10438450|dbj|BAB15246.1| unnamed protein product [Homo sapiens]    197   5e-48   Homo sapiens [man]
gi|403266809|ref|XP_003925553.1| PREDICTED: autophagy-related pr...   197   5e-48   Saimiri boliviensis boliviensis
gi|296205644|ref|XP_002749853.1| PREDICTED: autophagy-related pr...   197   5e-48   Callithrix jacchus [common marmoset]
gi|402889446|ref|XP_003908027.1| PREDICTED: autophagy-related pr...   197   5e-48   Papio anubis [Doguera baboon]
gi|31874658|emb|CAD98064.1| hypothetical protein [Homo sapiens]       197   5e-48   Homo sapiens [man]
gi|166831531|gb|ABY89796.1| APG9 autophagy 9-like 1 (predicted) ...   197   5e-48   Callithrix jacchus [common marmoset]
gi|449275355|gb|EMC84227.1| Autophagy-related protein 9A, partia...   197   5e-48   Columba livia [carrier pigeon]
gi|242036325|ref|XP_002465557.1| hypothetical protein SORBIDRAFT...   197   5e-48   Sorghum bicolor [broomcorn]
gi|31874056|emb|CAD97944.1| hypothetical protein [Homo sapiens] ...   197   6e-48   Homo sapiens [man]
gi|334347179|ref|XP_001363840.2| PREDICTED: autophagy-related pr...   197   6e-48   
gi|348556532|ref|XP_003464075.1| PREDICTED: autophagy-related pr...   197   6e-48   
gi|281340208|gb|EFB15792.1| hypothetical protein PANDA_001527 [A...   197   6e-48   Ailuropoda melanoleuca
gi|505847524|ref|XP_004617227.1| PREDICTED: autophagy-related pr...   197   7e-48   
gi|148667958|gb|EDL00375.1| autophagy-related 9A (yeast), isofor...   197   7e-48   Mus musculus [mouse]
gi|440911044|gb|ELR60773.1| Autophagy-related protein 9A, partia...   197   7e-48   Bos mutus
gi|345797352|ref|XP_536073.3| PREDICTED: uncharacterized protein...   197   7e-48   
gi|354491038|ref|XP_003507663.1| PREDICTED: autophagy-related pr...   197   7e-48   
gi|301755711|ref|XP_002913735.1| PREDICTED: autophagy-related pr...   197   7e-48   Ailuropoda melanoleuca
gi|77736357|ref|NP_001029878.1| autophagy-related protein 9A [Bo...   197   7e-48   Bos taurus [bovine]
gi|470626514|ref|XP_004320383.1| PREDICTED: autophagy-related pr...   197   7e-48   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|291392269|ref|XP_002712644.1| PREDICTED: APG9 autophagy 9-lik...   197   7e-48   
gi|298231109|ref|NP_001177204.1| autophagy-related protein 9A [S...   197   8e-48   Sus scrofa [pigs]
gi|344255765|gb|EGW11869.1| Autophagy-related protein 9A [Cricet...   197   8e-48   Cricetulus griseus [Chinese hamsters]
gi|426221593|ref|XP_004004993.1| PREDICTED: autophagy-related pr...   196   8e-48   Ovis aries [domestic sheep]
gi|196002587|ref|XP_002111161.1| hypothetical protein TRIADDRAFT...   196   8e-48   Trichoplax adhaerens
gi|431917958|gb|ELK17187.1| Autophagy-related protein 9A [Pterop...   196   8e-48   Pteropus alecto
gi|470626517|ref|XP_004320384.1| PREDICTED: autophagy-related pr...   196   8e-48   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|504126111|ref|XP_004576870.1| PREDICTED: autophagy-related pr...   196   8e-48   Ochotona princeps [southern American pika]
gi|351694644|gb|EHA97562.1| Autophagy-related protein 9A [Hetero...   196   8e-48   Heterocephalus glaber [naked mole rat]
gi|344268179|ref|XP_003405939.1| PREDICTED: hypothetical protein...   196   9e-48   
gi|149016149|gb|EDL75395.1| similar to hypothetical protein [Rat...   196   9e-48   Rattus norvegicus [brown rat]
gi|444514918|gb|ELV10673.1| Autophagy-related protein 9A [Tupaia...   196   9e-48   Tupaia chinensis
gi|507558464|ref|XP_004662969.1| PREDICTED: autophagy-related pr...   196   1e-47   Jaculus jaculus
gi|472366518|ref|XP_004402797.1| PREDICTED: autophagy-related pr...   196   1e-47   Odobenus rosmarus divergens
gi|507672616|ref|XP_004638252.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|513006286|ref|XP_004864595.1| PREDICTED: autophagy-related pr...   196   1e-47   Heterocephalus glaber [naked mole rat]
gi|507672618|ref|XP_004638253.1| PREDICTED: autophagy-related pr...   196   1e-47   Octodon degus
gi|86990446|ref|NP_001003917.2| autophagy-related protein 9A [Mu...   196   1e-47   Mus musculus [mouse]
gi|148667957|gb|EDL00374.1| autophagy-related 9A (yeast), isofor...   196   1e-47   Mus musculus [mouse]
gi|149711121|ref|XP_001493090.1| PREDICTED: autophagy-related pr...   196   1e-47   Equus caballus [domestic horse]
gi|507926133|ref|XP_004674326.1| PREDICTED: autophagy-related pr...   196   1e-47   Condylura cristata
gi|512808887|ref|XP_004876200.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|488552916|ref|XP_004467812.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|485611203|gb|EOD09821.1| hypothetical protein EMIHUDRAFT_4380...   196   1e-47   Emiliania huxleyi CCMP1516
gi|410969470|ref|XP_003991218.1| PREDICTED: autophagy-related pr...   196   1e-47   Felis catus [cat]
gi|62079163|ref|NP_001014240.1| autophagy-related protein 9A [Ra...   196   1e-47   Rattus norvegicus [brown rat]
gi|131889980|ref|NP_001076500.1| autophagy-related protein 9A [D...   196   1e-47   Danio rerio [leopard danio]
gi|395823411|ref|XP_003784980.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|511886158|ref|XP_004762876.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|511886142|ref|XP_004762868.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|478506685|ref|XP_004427637.1| PREDICTED: autophagy-related pr...   196   1e-47   
gi|478506687|ref|XP_004427638.1| PREDICTED: autophagy-related pr...   196   2e-47   
gi|162461865|ref|NP_001105821.1| autophagy protein 9 [Zea mays] ...   196   2e-47   
gi|194379660|dbj|BAG63795.1| unnamed protein product [Homo sapiens]   195   3e-47   
gi|116179650|ref|XP_001219674.1| hypothetical protein CHGG_00453...   194   3e-47   
gi|344301097|gb|EGW31409.1| hypothetical protein SPAPADRAFT_5142...   194   4e-47   
gi|412988956|emb|CCO15547.1| predicted protein [Bathycoccus pras...   194   6e-47   
gi|149241299|ref|XP_001526297.1| conserved hypothetical protein ...   192   1e-46   
gi|166990676|sp|A3LZS3.3|ATG9_PICST RecName: Full=Autophagy-rela...   192   1e-46   
gi|150866881|ref|XP_001386623.2| hypothetical protein PICST_6428...   192   2e-46   
gi|448522737|ref|XP_003868767.1| Atg9 protein [Candida orthopsil...   192   2e-46   
gi|498933179|ref|XP_004540372.1| PREDICTED: autophagy-related pr...   192   2e-46   
gi|512865587|ref|XP_002933994.2| PREDICTED: autophagy-related pr...   192   2e-46   
gi|383851225|ref|XP_003701139.1| PREDICTED: autophagy-related pr...   191   3e-46   
gi|474271382|gb|EMS60913.1| hypothetical protein TRIUR3_19436 [T...   191   4e-46   
gi|326497855|dbj|BAJ94790.1| predicted protein [Hordeum vulgare ...   191   4e-46   
gi|414865820|tpg|DAA44377.1| TPA: autophagy protein 9 [Zea mays]      191   5e-46   
gi|328778529|ref|XP_395581.4| PREDICTED: autophagy-related prote...   191   5e-46   
gi|350414300|ref|XP_003490271.1| PREDICTED: autophagy-related pr...   191   5e-46   
gi|350414297|ref|XP_003490270.1| PREDICTED: autophagy-related pr...   191   5e-46   
gi|344230530|gb|EGV62415.1| APG9-domain-containing protein [Cand...   191   6e-46   
gi|380017339|ref|XP_003692615.1| PREDICTED: autophagy-related pr...   190   6e-46   
gi|74831799|emb|CAJ30210.1| autophagy protein 9 [Sorghum bicolor]     190   6e-46   
gi|255726610|ref|XP_002548231.1| hypothetical protein CTRG_02528...   190   7e-46   
gi|260948392|ref|XP_002618493.1| hypothetical protein CLUG_01952...   190   9e-46   
gi|354548009|emb|CCE44744.1| hypothetical protein CPAR2_405480 [...   189   1e-45   
gi|340727016|ref|XP_003401847.1| PREDICTED: autophagy-related pr...   189   1e-45   
gi|340727014|ref|XP_003401846.1| PREDICTED: autophagy-related pr...   189   1e-45   
gi|459371313|gb|EMG49137.1| hypothetical protein G210_0175 [Cand...   188   3e-45   
gi|238880907|gb|EEQ44545.1| conserved hypothetical protein [Cand...   187   5e-45   
gi|357113140|ref|XP_003558362.1| PREDICTED: autophagy-related pr...   187   6e-45   
gi|68465647|ref|XP_723185.1| potential autophagy factor Atg9 [Ca...   187   6e-45   
gi|241953377|ref|XP_002419410.1| autophagy-related protein, puta...   187   6e-45   
gi|356536827|ref|XP_003536935.1| PREDICTED: autophagy-related pr...   187   6e-45   
gi|223590156|sp|A5DEX5.2|ATG9_PICGU RecName: Full=Autophagy-rela...   187   7e-45   
gi|76253835|ref|NP_001029016.1| autophagy protein 9 [Takifugu ru...   187   7e-45   
gi|31874649|emb|CAD98061.1| hypothetical protein [Homo sapiens]       187   7e-45   
gi|125583081|gb|EAZ24012.1| hypothetical protein OsJ_07737 [Oryz...   186   8e-45   
gi|125555064|gb|EAZ00670.1| hypothetical protein OsI_22690 [Oryz...   186   9e-45   
gi|110288648|gb|ABG65924.1| Autophagy protein Apg9 containing pr...   186   9e-45   
gi|306482671|ref|NP_001177861.1| autophagy-related protein 9 [Na...   186   1e-44   
gi|146420398|ref|XP_001486155.1| hypothetical protein PGUG_01826...   186   1e-44   
gi|91083595|ref|XP_968896.1| PREDICTED: similar to AGAP001762-PA...   186   2e-44   
gi|157278295|ref|NP_001098249.1| autophagy protein 9 [Oryzias la...   185   2e-44   
gi|357157972|ref|XP_003577975.1| PREDICTED: autophagy-related pr...   185   2e-44   
gi|321477852|gb|EFX88810.1| hypothetical protein DAPPUDRAFT_4156...   185   2e-44   
gi|507641560|ref|XP_004701677.1| PREDICTED: autophagy-related pr...   185   2e-44   
gi|242023628|ref|XP_002432234.1| conserved hypothetical protein ...   185   3e-44   
gi|449506547|ref|XP_002195640.2| PREDICTED: autophagy-related pr...   184   3e-44   
gi|340372294|ref|XP_003384679.1| PREDICTED: autophagy-related pr...   184   3e-44   
gi|326922863|ref|XP_003207663.1| PREDICTED: autophagy-related pr...   182   2e-43   
gi|77736637|ref|NP_001029993.1| autophagy-related protein 9A [Ga...   182   2e-43   
gi|74831778|emb|CAJ30207.1| autophagy protein 9 [Hordeum vulgare]     182   2e-43   
gi|74831808|emb|CAJ30212.1| autophagy protein 9 [Triticum aestivum]   182   2e-43   
gi|345485816|ref|XP_001603039.2| PREDICTED: autophagy-related pr...   180   8e-43   
gi|325186232|emb|CCA20733.1| autophagyrelated protein putative [...   180   9e-43   
gi|459175061|ref|XP_002123021.2| PREDICTED: autophagy-related pr...   179   2e-42   
gi|312078504|ref|XP_003141767.1| autophagy protein Apg9 containi...   176   9e-42   
gi|308080147|ref|NP_001183738.1| uncharacterized protein LOC1005...   176   1e-41   
gi|170580769|ref|XP_001895401.1| Autophagy protein Apg9 containi...   175   2e-41   
gi|393906271|gb|EJD74234.1| autophagy protein Apg9 containing pr...   175   2e-41   
gi|391338462|ref|XP_003743577.1| PREDICTED: autophagy-related pr...   175   3e-41   
gi|332018406|gb|EGI59000.1| Autophagy-related protein 9A [Acromy...   175   3e-41   
gi|74831769|emb|CAJ30206.1| autophagy protein 9 [Glycine max]         174   3e-41   
gi|308508987|ref|XP_003116677.1| CRE-ATG-9 protein [Caenorhabdit...   174   4e-41   
gi|118601085|gb|AAH34139.1| Atg9a protein [Mus musculus]              174   5e-41   
gi|341902960|gb|EGT58895.1| CBN-ATG-9 protein [Caenorhabditis br...   174   6e-41   
gi|307196753|gb|EFN78212.1| Autophagy-related protein 9A [Harpeg...   170   6e-40   
gi|448119178|ref|XP_004203669.1| Piso0_000685 [Millerozyma farin...   170   6e-40   
gi|448116701|ref|XP_004203087.1| Piso0_000685 [Millerozyma farin...   170   7e-40   
gi|402594676|gb|EJW88602.1| autophagy protein Apg9 containing pr...   170   7e-40   
gi|156389500|ref|XP_001635029.1| predicted protein [Nematostella...   170   8e-40   
gi|294655424|ref|XP_457561.2| DEHA2B14168p [Debaryomyces hanseni...   170   1e-39   
gi|322780884|gb|EFZ10113.1| hypothetical protein SINV_80336 [Sol...   169   1e-39   
gi|470423499|ref|XP_004337604.1| autophagy protein 9, putative [...   168   2e-39   
gi|326494536|dbj|BAJ94387.1| predicted protein [Hordeum vulgare ...   166   1e-38   
gi|348687990|gb|EGZ27804.1| hypothetical protein PHYSODRAFT_3088...   165   2e-38   
gi|74831729|emb|CAJ30198.1| autophagy protein 9 [Caenorhabditis ...   164   5e-38   
gi|157120667|ref|XP_001659713.1| Autophagy-specific protein, put...   164   5e-38   
gi|390359571|ref|XP_788373.3| PREDICTED: autophagy-related prote...   164   7e-38   
gi|478254522|gb|ENN74768.1| hypothetical protein YQE_08656, part...   162   2e-37   
gi|32566978|ref|NP_872184.1| Protein ATG-9, isoform b [Caenorhab...   162   2e-37   
gi|223998230|ref|XP_002288788.1| predicted protein [Thalassiosir...   160   6e-37   
gi|268556280|ref|XP_002636129.1| C. briggsae CBR-ATGR-9 protein ...   160   9e-37   
gi|323447509|gb|EGB03427.1| hypothetical protein AURANDRAFT_3408...   159   1e-36   
gi|154290394|ref|XP_001545793.1| hypothetical protein BC1G_15751...   159   1e-36   
gi|397621213|gb|EJK66180.1| hypothetical protein THAOC_12915 [Th...   159   1e-36   
gi|307177526|gb|EFN66637.1| Autophagy-related protein 9A [Campon...   158   2e-36   
gi|195401731|ref|XP_002059465.1| GJ18883 [Drosophila virilis] >g...   157   5e-36   
gi|256080456|ref|XP_002576497.1| hypothetical protein [Schistoso...   156   1e-35   
gi|170055984|ref|XP_001863826.1| autophagy protein 9 [Culex quin...   156   1e-35   
gi|328698225|ref|XP_001944038.2| PREDICTED: autophagy-related pr...   155   2e-35   
gi|347966516|ref|XP_321322.5| AGAP001762-PA [Anopheles gambiae s...   155   2e-35   
gi|499010285|ref|XP_004536764.1| PREDICTED: autophagy-related pr...   154   4e-35   
gi|499010288|ref|XP_004536765.1| PREDICTED: autophagy-related pr...   154   5e-35   
gi|374720890|gb|AEZ67830.1| AGAP001762-PA [Anopheles stephensi]       154   7e-35   
gi|195150091|ref|XP_002015988.1| GL10727 [Drosophila persimilis]...   154   7e-35   
gi|125807628|ref|XP_001360466.1| Atg9 [Drosophila pseudoobscura ...   153   1e-34   
gi|74831743|emb|CAJ30201.1| autophagy protein 9 [Drosophila pseu...   153   1e-34   
gi|357603444|gb|EHJ63773.1| putative APG9 autophagy 9-like 1 [Da...   151   3e-34   
gi|339235231|ref|XP_003379170.1| autophagy protein Apg9 [Trichin...   151   4e-34   
gi|195426618|ref|XP_002061410.1| GK20903 [Drosophila willistoni]...   150   6e-34   
gi|194757285|ref|XP_001960895.1| Atg9 [Drosophila ananassae] >gi...   150   8e-34   
gi|512935130|ref|XP_004933199.1| PREDICTED: autophagy-related pr...   150   8e-34   
gi|76154255|gb|AAX25745.2| SJCHGC04419 protein [Schistosoma japo...   150   1e-33   
gi|194882551|ref|XP_001975374.1| Atg9 [Drosophila erecta] >gi|19...   149   2e-33   
gi|74831738|emb|CAJ30200.1| autophagy protein 9 [Drosophila erecta]   149   2e-33   
gi|77455252|gb|ABA86435.1| CG3615 [Drosophila erecta]                 149   2e-33   
gi|301116838|ref|XP_002906147.1| autophagy-related protein, puta...   149   2e-33   
gi|77455248|gb|ABA86433.1| CG3615 [Drosophila yakuba] >gi|774552...   148   3e-33   
gi|195029381|ref|XP_001987552.1| GH19901 [Drosophila grimshawi] ...   148   3e-33   
gi|302842155|ref|XP_002952621.1| hypothetical protein VOLCADRAFT...   148   4e-33   
gi|195488241|ref|XP_002092231.1| Atg9 [Drosophila yakuba] >gi|74...   147   4e-33   
gi|195119580|ref|XP_002004308.1| GI19856 [Drosophila mojavensis]...   147   5e-33   
gi|485626957|gb|EOD22602.1| hypothetical protein EMIHUDRAFT_4696...   147   7e-33   
gi|20130047|ref|NP_611114.1| Autophagy-specific gene 9, isoform ...   146   1e-32   
gi|77455242|gb|ABA86430.1| CG3615 [Drosophila melanogaster]           146   1e-32   
gi|442623918|ref|NP_001261023.1| Autophagy-specific gene 9, isof...   146   1e-32   
gi|77455244|gb|ABA86431.1| CG3615 [Drosophila simulans]               146   1e-32   
gi|74831754|emb|CAJ30203.1| autophagy protein 9 [Drosophila simu...   145   2e-32   
gi|195583902|ref|XP_002081755.1| Atg9 [Drosophila simulans] >gi|...   145   2e-32   
gi|77455246|gb|ABA86432.1| CG3615 [Drosophila simulans]               145   2e-32   
gi|195334893|ref|XP_002034111.1| Atg9 [Drosophila sechellia] >gi...   144   4e-32   
gi|74831751|emb|CAJ30202.1| autophagy protein 9 [Drosophila sech...   144   4e-32   
gi|74831733|emb|CAJ30199.1| autophagy protein 9 [Drosophila anan...   143   1e-31   
gi|47229939|emb|CAG10353.1| unnamed protein product [Tetraodon n...   139   2e-30   
gi|260804079|ref|XP_002596916.1| hypothetical protein BRAFLDRAFT...   139   2e-30   
gi|395539724|ref|XP_003771816.1| PREDICTED: autophagy-related pr...   137   5e-30   
gi|290998840|ref|XP_002681988.1| autophagy 9 [Naegleria gruberi]...   135   2e-29   
gi|38014621|gb|AAH01098.2| ATG9A protein, partial [Homo sapiens]      135   4e-29   
gi|219120312|ref|XP_002180897.1| predicted protein [Phaeodactylu...   134   4e-29   
gi|478512829|ref|XP_004430674.1| PREDICTED: autophagy-related pr...   134   7e-29   
gi|403179322|ref|XP_003337674.2| hypothetical protein PGTG_19201...   133   9e-29   
gi|297466065|ref|XP_583368.5| PREDICTED: autophagy-related prote...   132   2e-28   
gi|334348742|ref|XP_001371433.2| PREDICTED: autophagy-related pr...   131   3e-28   
gi|471364565|ref|XP_004372829.1| PREDICTED: autophagy-related pr...   130   1e-27   
gi|504169909|ref|XP_004594551.1| PREDICTED: autophagy-related pr...   127   6e-27   
gi|17564576|ref|NP_503178.1| Protein ATG-9, isoform a [Caenorhab...   125   2e-26   
gi|488552919|ref|XP_004467813.1| PREDICTED: autophagy-related pr...   125   3e-26   
gi|488552886|ref|XP_004467802.1| PREDICTED: autophagy-related pr...   125   3e-26   
gi|313230141|emb|CBY07845.1| unnamed protein product [Oikopleura...   124   7e-26   
gi|109068896|ref|XP_001100591.1| PREDICTED: autophagy-related pr...   123   1e-25   
gi|296210236|ref|XP_002751886.1| PREDICTED: autophagy-related pr...   122   2e-25   
gi|119574453|gb|EAW54068.1| hCG2039570 [Homo sapiens]                 122   2e-25   
gi|332869962|ref|XP_528002.3| PREDICTED: autophagy-related prote...   122   2e-25   
gi|402865397|ref|XP_003896909.1| PREDICTED: autophagy-related pr...   122   2e-25   
gi|239582720|ref|NP_775952.4| autophagy-related protein 9B [Homo...   122   2e-25   
gi|470600366|ref|XP_004312223.1| PREDICTED: LOW QUALITY PROTEIN:...   120   6e-25   
gi|466065525|ref|XP_004281292.1| PREDICTED: LOW QUALITY PROTEIN:...   120   7e-25   
gi|149046551|gb|EDL99376.1| similar to autophagy 9-like 2 (predi...   120   8e-25   
gi|149707014|ref|XP_001495104.1| PREDICTED: autophagy-related pr...   120   1e-24   
gi|300794915|ref|NP_001178897.1| autophagy-related protein 9B [R...   120   1e-24   
gi|45643434|gb|AAS72555.1| autophagy 9-like 2 [Mus musculus] >gi...   119   3e-24   
gi|146219845|ref|NP_001002897.2| autophagy-related protein 9B [M...   118   4e-24   
gi|148671195|gb|EDL03142.1| nitric oxide synthase 3 antisense [M...   118   4e-24   
gi|298231115|ref|NP_001177209.1| autophagy-related protein 9B [S...   116   1e-23   
gi|483484619|gb|EOA93039.1| Autophagy-related protein 9A, partia...   115   2e-23   
gi|488533196|ref|XP_004458326.1| PREDICTED: autophagy-related pr...   113   1e-22   
gi|291397356|ref|XP_002715114.1| PREDICTED: ATG9 autophagy relat...   113   1e-22   
gi|358334694|dbj|GAA27665.2| autophagy-related protein 9A [Clono...   110   6e-22   
gi|297682003|ref|XP_002818723.1| PREDICTED: autophagy-related pr...   110   8e-22   
gi|507572103|ref|XP_004669647.1| PREDICTED: autophagy-related pr...   110   9e-22   
gi|374720881|gb|AEZ67823.1| AGAP001762-PA [Anopheles merus]           109   1e-21   
gi|15150417|gb|AAK84932.1| SD01812p [Drosophila melanogaster]         109   2e-21   
gi|472378894|ref|XP_004408864.1| PREDICTED: autophagy-related pr...   107   7e-21   
gi|507636307|ref|XP_004629129.1| PREDICTED: autophagy-related pr...   106   1e-20   
gi|440895341|gb|ELR47555.1| Autophagy-related protein 9B, partia...   106   1e-20   
gi|410953212|ref|XP_003983268.1| PREDICTED: autophagy-related pr...   106   1e-20   
gi|426228637|ref|XP_004008407.1| PREDICTED: autophagy-related pr...   106   2e-20   
gi|395838460|ref|XP_003792133.1| PREDICTED: autophagy-related pr...   102   3e-19   
gi|351695419|gb|EHA98337.1| Autophagy-related protein 9B [Hetero...   101   5e-19   
gi|512997773|ref|XP_004860451.1| PREDICTED: autophagy-related pr...   101   5e-19   
gi|512813192|ref|XP_004877464.1| PREDICTED: autophagy-related pr...   101   6e-19   
gi|296814926|ref|XP_002847800.1| Atg9p [Arthroderma otae CBS 113...   100   1e-18   
gi|432114605|gb|ELK36446.1| Autophagy-related protein 9A [Myotis...    99   2e-18   
gi|62510484|sp|Q68FE2.1|ATG9A_MOUSE RecName: Full=Autophagy-rela...    99   3e-18   
gi|41350839|gb|AAH65534.1| ATG9A protein [Homo sapiens]                99   3e-18   
gi|488552922|ref|XP_004467814.1| PREDICTED: autophagy-related pr...    97   7e-18   
gi|507645052|ref|XP_004702532.1| PREDICTED: autophagy-related pr...    96   3e-17   
gi|164450114|gb|ABY56505.1| Atg9, partial [Drosophila simulans] ...    92   4e-16   
gi|345781269|ref|XP_539915.3| PREDICTED: LOW QUALITY PROTEIN: au...    91   5e-16   
gi|164450112|gb|ABY56504.1| Atg9, partial [Drosophila simulans]        91   6e-16   
gi|164450118|gb|ABY56507.1| Atg9, partial [Drosophila simulans] ...    90   1e-15   
gi|444724210|gb|ELW64821.1| Autophagy-related protein 9B [Tupaia...    90   1e-15   
gi|511892854|ref|XP_004766090.1| PREDICTED: autophagy-related pr...    90   1e-15   
gi|397488164|ref|XP_003815140.1| PREDICTED: autophagy-related pr...    89   2e-15   
gi|154418213|ref|XP_001582125.1| autophagy protein [Trichomonas ...    89   2e-15   
gi|403276602|ref|XP_003929983.1| PREDICTED: autophagy-related pr...    89   2e-15   
gi|507981952|ref|XP_004694431.1| PREDICTED: autophagy-related pr...    89   3e-15   
gi|344276526|ref|XP_003410059.1| PREDICTED: LOW QUALITY PROTEIN:...    86   2e-14   
gi|354478330|ref|XP_003501368.1| PREDICTED: autophagy-related pr...    86   3e-14   
gi|432097028|gb|ELK27526.1| Autophagy-related protein 9B [Myotis...    85   4e-14   
gi|512022289|ref|XP_004828348.1| PREDICTED: LOW QUALITY PROTEIN:...    83   2e-13   
gi|36939120|gb|AAQ86941.1| SONE [Homo sapiens]                         83   2e-13   
gi|281202062|gb|EFA76267.1| autophagy protein 9 [Polysphondylium...    82   3e-13   
gi|193883308|gb|ACF28134.1| hypothetical protein CG3615, partial...    82   5e-13   
gi|193883316|gb|ACF28138.1| hypothetical protein CG3615, partial...    81   5e-13   
gi|118763811|gb|AAI28588.1| ATG9B protein [Homo sapiens]               81   6e-13   
gi|167535483|ref|XP_001749415.1| hypothetical protein [Monosiga ...    81   8e-13   
gi|123495196|ref|XP_001326686.1| autophagy protein [Trichomonas ...    81   8e-13   
gi|426358480|ref|XP_004046538.1| PREDICTED: autophagy-related pr...    80   1e-12   
gi|441641192|ref|XP_004090351.1| PREDICTED: LOW QUALITY PROTEIN:...    80   2e-12   
gi|348568047|ref|XP_003469810.1| PREDICTED: LOW QUALITY PROTEIN:...    79   2e-12   
gi|355561175|gb|EHH17861.1| hypothetical protein EGK_14342 [Maca...    79   2e-12   
gi|46309838|gb|AAS87213.1| sONE major form [Mus musculus]              78   5e-12   
gi|355748134|gb|EHH52631.1| hypothetical protein EGM_13100 [Maca...    78   5e-12   
gi|431895757|gb|ELK05176.1| Autophagy-related protein 9B [Pterop...    78   5e-12   
gi|39644946|gb|AAH21202.2| ATG9A protein, partial [Homo sapiens]       78   6e-12   
gi|326433458|gb|EGD79028.1| hypothetical protein PTSG_01997 [Sal...    77   1e-11   
gi|405966461|gb|EKC31741.1| Autophagy-related protein 9A [Crasso...    75   4e-11   


>gi|299753034|ref|XP_001833014.2| autophagy-type protein 9 [Coprinopsis cinerea okayama7#130]
 gi|298410113|gb|EAU88703.2| autophagy-type protein 9 [Coprinopsis cinerea okayama7#130]
          Length = 858

 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 161/274 (58%), Positives = 204/274 (74%), Gaps = 2/274 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPGSI G R++T +A+WKFREFNEL H+F +RLD+SY  AN Y+ QFP  K         
Sbjct: 404 DPGSISG-RRYTSYAQWKFREFNELPHIFTRRLDESYPLANVYMGQFPNEKMTILMRFVA 462

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL+LAT IDPD+FL FEIT  RTV FY GV   +  V+RGMIP+++ VFDPE
Sbjct: 463 FIAGSFAAVLLLATLIDPDIFLNFEITPHRTVLFYLGVFGGILTVARGMIPEENRVFDPE 522

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             + +V+ +THY PD+W+G LH+  V +EF +LF++K++++IQEI SV+ TPF+LWFSL 
Sbjct: 523 LLMNEVIAYTHYMPDDWKGELHSKRVNQEFGELFKMKLLIFIQEIVSVVTTPFVLWFSLP 582

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           DC+  I+DFFREFTVHVDG G VCSFA F+F +HGNVK+GAPA   +N   +S DGKMEK
Sbjct: 583 DCAPAIVDFFREFTVHVDGRGYVCSFAEFNFERHGNVKFGAPAKAKDNR-MISNDGKMEK 641

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAH 291
           SFLNFKA +PDW+PTDP GSLYL+R+   N   H
Sbjct: 642 SFLNFKAANPDWQPTDPSGSLYLNRMANLNANLH 675



>gi|389749173|gb|EIM90350.1| APG9-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 973

 Score =  340 bits (871), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 210/283 (74%), Gaps = 5/283 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI G R +T FA+WKFREFNEL HLF +RLD+SY  AN YI QFP  K         
Sbjct: 489 NPSSI-GGRAYTPFAQWKFREFNELPHLFTRRLDESYPTANIYIAQFPNEKVAIVMRFVA 547

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL+LA+ +DPD+FL FEIT   TV FY  V   + AV++GMIP+++ VFD E
Sbjct: 548 FIAGSFAAVLVLASILDPDIFLHFEITPHGTVVFYITVFTGILAVAQGMIPEENRVFDSE 607

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             + +VV++THY PDEW+ RLH+ +V +EF +LF++K++ +++EI SV+ TPFILWFSL 
Sbjct: 608 MLMMEVVQYTHYLPDEWKERLHSKKVHQEFGELFDMKILTFVKEIISVVLTPFILWFSLP 667

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            C+  IIDFFREFTVHVDG+G VCSFA+FDF++HGNVK+GAP + V++E  +SK+GKMEK
Sbjct: 668 RCAPAIIDFFREFTVHVDGLGFVCSFAVFDFQRHGNVKFGAPTT-VKDEKLMSKEGKMEK 726

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEF---NNQAHPERPNA 297
           SFLNFKA HP+W P+DP GSLYLSR+ ++    N  HP R  A
Sbjct: 727 SFLNFKAAHPEWMPSDPSGSLYLSRMADYTAATNNNHPRRRAA 769



>gi|403412919|emb|CCL99619.1| predicted protein [Fibroporia radiculosa]
          Length = 971

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 161/275 (58%), Positives = 209/275 (76%), Gaps = 3/275 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P +I G R++T FA+WKFREFNEL HLF +RL +SY  A+ YI QFP  K         
Sbjct: 517 NPSNI-GGRRYTPFAQWKFREFNELPHLFKRRLSESYVTASMYIGQFPNEKLTLINRFVS 575

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL+LAT +DPD FL FEIT  RTV FY  V   + AV+RGMIP++H VFDPE
Sbjct: 576 FIAGSFAAVLLLATVVDPDQFLYFEITPHRTVLFYITVFGSILAVARGMIPEEHRVFDPE 635

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             + +VV++THY PDEW+ +LH+ +V  EF +LF +KV+++ QE+ SVI TPF+LW+SL 
Sbjct: 636 LLMMEVVQYTHYLPDEWKDQLHSKKVHAEFGELFNMKVMIFAQELLSVILTPFVLWYSLP 695

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            C+  +IDFFREFTVHVDG+G VCSFA+FDF++HGNVK+GAP + V++E ++SK+GKMEK
Sbjct: 696 TCAPALIDFFREFTVHVDGLGYVCSFAVFDFQRHGNVKFGAP-TNVQDERFVSKEGKMEK 754

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
           SFLNFKA +P+W PTDP GSLYLSR+ +F + AHP
Sbjct: 755 SFLNFKAANPEWMPTDPGGSLYLSRIADF-SAAHP 788



>gi|392567056|gb|EIW60231.1| APG9-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 937

 Score =  336 bits (862), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 157/272 (57%), Positives = 204/272 (75%), Gaps = 2/272 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S FG R +T +A+WKFREFNEL HLF +RL +SY  A+ Y  QFP  +            
Sbjct: 486 SNFGGRSYTPYAQWKFREFNELPHLFKRRLSESYPAASMYNGQFPNEQVTLIVRFVAFIA 545

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GSF AVL+LA+ +DPDLFL FEIT  RTV FY  V   L AV+RGMIP+++ VFDPE  +
Sbjct: 546 GSFAAVLLLASVVDPDLFLHFEITPHRTVLFYLTVFGSLLAVARGMIPEENRVFDPELLM 605

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +VV++THY PDEWRG LH+ +V  EF  LF++KV+++ QE+ SV+ TPF+LW+SL  C+
Sbjct: 606 SEVVQYTHYMPDEWRGLLHSKKVHAEFGTLFQMKVLVFAQELASVLLTPFVLWYSLPTCA 665

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+DFFREFT+HVDG+G VCSFA+FDF++HGNVK+GAP ++V +E ++SK+GKMEKSFL
Sbjct: 666 PAIVDFFREFTLHVDGLGYVCSFAVFDFQRHGNVKFGAP-TQVSDERWMSKEGKMEKSFL 724

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
           NFKA HP+W P DP GSLYLSR+ +  + AHP
Sbjct: 725 NFKAAHPEWTPNDPSGSLYLSRMADL-SAAHP 755



>gi|449547188|gb|EMD38156.1| hypothetical protein CERSUDRAFT_82398 [Ceriporiopsis subvermispora
           B]
          Length = 919

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 208/276 (75%), Gaps = 3/276 (1%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P +I G R++T +A+WKFREFNEL HLF +RL +SY  +++YI QFP  K        
Sbjct: 465 NNPSNI-GGRRYTLYAQWKFREFNELPHLFRRRLKESYTVSSEYIGQFPNEKVTLIVRFV 523

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL+LA  IDPD +  FE+T  RTV FY GV   + AV+RGMIP++++VFDP
Sbjct: 524 AFVAGSFAAVLLLALVIDPDFYTHFEVTPHRTVPFYLGVFAGVLAVARGMIPEENMVFDP 583

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + +VV++THY PDEW+G+LH  +V  EF Q+F +KV+++ QE+ SV+ TPF+LW+SL
Sbjct: 584 ELLMSEVVQYTHYMPDEWKGQLHAKKVHEEFGQIFAMKVMIFAQELLSVLLTPFVLWYSL 643

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
             C+ +IIDFFR+FTVHVD +G VCSFA+FDF++HGNVK+GAP ++V +E  +SK+GKME
Sbjct: 644 PPCAPEIIDFFRDFTVHVDSLGYVCSFAVFDFQRHGNVKFGAP-TKVHDERLMSKEGKME 702

Query: 257 KSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
           KSFLNFKA HP+W P DP GSLYLSR+ +  + AHP
Sbjct: 703 KSFLNFKAAHPEWMPRDPSGSLYLSRMADL-SAAHP 737



>gi|336367239|gb|EGN95584.1| hypothetical protein SERLA73DRAFT_95101 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336379958|gb|EGO21112.1| putative transmembrane protein involved in formation of autophagic
           vesicles [Serpula lacrymans var. lacrymans S7.9]
          Length = 953

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 156/270 (57%), Positives = 202/270 (74%), Gaps = 2/270 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP SI G R++T FA+WKFREFNEL HLF +RLD+SY  A+ YI QFP  K         
Sbjct: 509 DPSSI-GGRRYTPFAQWKFREFNELPHLFTRRLDESYPTASMYIGQFPNEKMTIIMRFVA 567

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL LA+ +DPDLF+ FEIT  RTVFFY  V   + AV+RGMIP+D+ VFDPE
Sbjct: 568 FIAGSFAAVLFLASVVDPDLFIHFEITPHRTVFFYLSVFGSVLAVARGMIPEDNRVFDPE 627

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             +  V+++THY PDEW+  LH+ +V ++F +LF +KV+++IQEI SV+ TPF+LWFSL 
Sbjct: 628 LLMSDVIQYTHYMPDEWKNELHSKKVHQQFGELFAMKVLIFIQEIVSVVTTPFVLWFSLP 687

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            C+  I+DFF +FTV V G G +CSFA FDF++HGNVK+GAPA  +++E  LS++GKMEK
Sbjct: 688 PCAPSIVDFFHDFTVWVPGRGYICSFAEFDFKRHGNVKFGAPAI-IQDERMLSREGKMEK 746

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFN 287
           SFLNFKA +PDW PTDP GSLYL+R+ +F+
Sbjct: 747 SFLNFKAANPDWNPTDPSGSLYLTRMADFS 776



>gi|511010618|gb|EPB91838.1| hypothetical protein HMPREF1544_01346 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 734

 Score =  329 bits (844), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 159/271 (58%), Positives = 197/271 (72%), Gaps = 1/271 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG + GSR +T FA+WKFREFNEL HLF  R+ +SY+ AN YI+QFPK KT        
Sbjct: 372 NPGEM-GSRVYTPFAKWKFREFNELPHLFKNRISQSYEHANLYINQFPKEKTVLMARFVS 430

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF  VL L T  D +  L FEIT+  TV FY G+   +FAV+RGMIPD++ VF+PE
Sbjct: 431 FLAGSFAGVLALFTLFDSEALLNFEITSNGTVLFYLGITGTIFAVTRGMIPDENQVFEPE 490

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L++VVEHTHY P EW+ RLHTD+VR EF +LF+ KV ++IQE+ SV+F P +L  SL 
Sbjct: 491 RLLRQVVEHTHYLPAEWKHRLHTDQVRAEFCKLFDYKVGVFIQELTSVVFAPLVLCLSLP 550

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + QI+DFFREFTVHV+G+G VCSFA FDF +HGNVKYG   + V++EYYLSK GKMEK
Sbjct: 551 SSADQIVDFFREFTVHVNGLGYVCSFAQFDFERHGNVKYGVQGAAVDDEYYLSKQGKMEK 610

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFNN 288
           SFLNFKAN+P W P D  GS+YLSRL +  N
Sbjct: 611 SFLNFKANNPKWMPNDMAGSMYLSRLADIKN 641



>gi|393220226|gb|EJD05712.1| APG9-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 903

 Score =  328 bits (840), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 152/269 (56%), Positives = 205/269 (76%), Gaps = 2/269 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +T +ARWKFREFNEL H+F +RLD+SY  A+ YI QFP  K         
Sbjct: 457 NPTSI-GSRTYTLYARWKFREFNELPHVFSRRLDESYPLASMYIGQFPNEKLALVMRFIS 515

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL+LA+ +DP+LF  FEIT  RTV FY G+   + AV+RGMIP+D+ +FDPE
Sbjct: 516 FIAGSFAAVLLLASVLDPELFTHFEITPHRTVLFYIGIFGSVLAVARGMIPEDNKIFDPE 575

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             ++ V+ +THY PDEW+G+LH+ +V ++F +LF++KV+++ +E+ SVI TPF+L FSL 
Sbjct: 576 LLMEDVIHYTHYMPDEWKGQLHSQKVHKDFGKLFDMKVMIFARELLSVIITPFVLCFSLP 635

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + +  I+DFFREFTVHVD +G VCSFA+FDF++HGNV +GAP +  ++E +LSK+GKMEK
Sbjct: 636 NSAPAIVDFFREFTVHVDSLGYVCSFAVFDFKRHGNVNFGAP-TNAKDERFLSKEGKMEK 694

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           SFLNFKA +P W+PTDP GSLYLSR+ +F
Sbjct: 695 SFLNFKAANPAWQPTDPSGSLYLSRMADF 723



>gi|395333811|gb|EJF66188.1| APG9-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 941

 Score =  327 bits (838), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 204/270 (75%), Gaps = 3/270 (1%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P +I G R +T +A+WKFREFNEL HLF +RL++SY+ A+ YI QFP  K        
Sbjct: 485 NNPSNISG-RGYTPYAQWKFREFNELPHLFKRRLNESYETASMYIGQFPNEKLTLIARFV 543

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL+LA+ +DPDLF+ FEIT  RT  FY  V   + AV+RGM+P+++ VFDP
Sbjct: 544 SFIAGSFAAVLVLASILDPDLFVHFEITPHRTTVFYIAVFGSILAVARGMVPEENRVFDP 603

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  +++VV++THY PDEW+G+LH+ +V  EF QLF +KV+ + QE+ SVI TPF+LW+SL
Sbjct: 604 ELLMQEVVQYTHYMPDEWKGQLHSKKVHEEFGQLFAMKVMTFAQELMSVILTPFVLWYSL 663

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
             C+  I+DFFREFTVHVDG+G VCSFA+FDF++HGNVK+GA A +VE E ++S++GKME
Sbjct: 664 PPCAPAIVDFFREFTVHVDGLGYVCSFAVFDFQRHGNVKFGAKA-KVE-ERFMSREGKME 721

Query: 257 KSFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           KSFLNFKA HPDW P DP GS YLSR+ + 
Sbjct: 722 KSFLNFKAAHPDWTPNDPHGSDYLSRMADL 751



>gi|353236467|emb|CCA68461.1| related to ATG9-integral membrane protein required for Cvt and
           autophagy transport [Piriformospora indica DSM 11827]
          Length = 931

 Score =  324 bits (831), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 204/301 (67%), Gaps = 16/301 (5%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           S+P +I  SR++T +A WKFREFNEL HLF +RLD SY  AN Y+DQ+P           
Sbjct: 504 SNPSAI-SSRRYTPYAEWKFREFNELPHLFTRRLDTSYPTANMYLDQYPHTTVSHVARFV 562

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF  VLILA+ +DP+L L FEI+ GRTV F+ GV   + AV+RGM+ D HLVFDP
Sbjct: 563 SFVAGSFAGVLILASLLDPELVLHFEISHGRTVLFWIGVFGGILAVTRGMVRDGHLVFDP 622

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           +  +K+V+ HTHY P+EWRG+LH+ +V +EF QLF +KV++++QE+ SV+ TP IL  SL
Sbjct: 623 DILMKEVIRHTHYMPEEWRGQLHSQKVYQEFGQLFTMKVMIFVQELLSVVLTPLILMLSL 682

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEV------------- 243
             C+ +IIDFFREFT+HVD +G VCSFA+FDF++HGN+++G    E              
Sbjct: 683 PSCAPEIIDFFREFTIHVDTLGYVCSFAVFDFKRHGNIRFGGNIDETGEEAADDVQQDGW 742

Query: 244 -ENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEF-NNQAHPERPNAARTS 301
             +E   SKDGKME+SFL FKA HP+W PTDP GSLYL RL E   N  H  +P + R++
Sbjct: 743 QRDERLQSKDGKMEQSFLAFKAAHPEWTPTDPTGSLYLERLREMHQNMKHAPQPISRRST 802

Query: 302 V 302
            
Sbjct: 803 A 803



>gi|472580579|gb|EMS18368.1| autophagy-related protein 9 [Rhodosporidium toruloides NP11]
          Length = 1093

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 153/290 (52%), Positives = 206/290 (71%), Gaps = 2/290 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T  ARWKFREFNEL H F QRL  ++  A++YI+ +PKAKT        
Sbjct: 635 NPSSI-GSRQFTPLARWKFREFNELPHHFQQRLALAHPLADQYINHYPKAKTVLLSRFVA 693

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVLIL + IDPD FL FEIT GRTV FY GV   + AV+RGM+PD++ V DPE
Sbjct: 694 FLAGSFAAVLILFSLIDPDAFLHFEITPGRTVLFYIGVFGTILAVARGMLPDENRVVDPE 753

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             ++ +VEHTHY P EW+ +LH+ EV   F +LF++KV L++QE+FSV+ TP +LW+SL 
Sbjct: 754 ELMRNIVEHTHYLPKEWKDKLHSAEVHVAFGKLFQMKVSLFLQELFSVLITPLVLWYSLP 813

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            C+  ++DFFREFTVHVDG+G VCSFA+FDF++HG+  +GAP  +V++  + S +GKME+
Sbjct: 814 KCAGPVVDFFREFTVHVDGLGYVCSFAVFDFKRHGDPSFGAPV-QVQDARWKSAEGKMEQ 872

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVVDSIL 307
           SFL F A++P W P D   SL+LS++TE    A P  P+ A ++ + S L
Sbjct: 873 SFLTFAASNPAWVPRDQAQSLFLSKMTETPPIAGPAHPHPASSTALHSSL 922



>gi|443897051|dbj|GAC74393.1| predicted glutamine synthetase [Pseudozyma antarctica T-34]
          Length = 3056

 Score =  318 bits (816), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 192/266 (72%), Gaps = 13/266 (4%)

Query: 18   DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
            DP S  GSRQ+TQ+ARWKFREFNEL HLF +R   SY PA+KYIDQFPK KT        
Sbjct: 883  DP-SNLGSRQYTQYARWKFREFNELPHLFRRRCHASYAPAHKYIDQFPKEKTAIVARFVA 941

Query: 78   XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
               GSFTAVLILA+ IDPDLFL F+IT  R V FY GV   + AV+RGMIPD+HLVF+PE
Sbjct: 942  FVAGSFTAVLILASVIDPDLFLHFDITPQRNVLFYIGVFGAILAVARGMIPDEHLVFEPE 1001

Query: 138  ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
            A L++V++HTHY P +W+GR H+ EV REF QL+ +K+++++QE+ SV+ TPF+LW SL 
Sbjct: 1002 AMLREVIQHTHYLPPDWKGRFHSAEVHREFGQLYMLKILIFVQEVLSVVTTPFVLWLSLP 1061

Query: 198  DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH--GNVKYGAPA-------SEVENEYY 248
             C+ ++IDFFR++T+HVDGVG VCSFA+FDF +    +   GA A       +E   +  
Sbjct: 1062 GCAPEVIDFFRKYTIHVDGVGHVCSFAVFDFARQPTASTMGGAAARGMRSGFNERRQQSK 1121

Query: 249  LS---KDGKMEKSFLNFKANHPDWEP 271
            L    ++GKME+S L FKANHPDW+P
Sbjct: 1122 LRNGMREGKMEQSILGFKANHPDWDP 1147



>gi|238603192|ref|XP_002395881.1| hypothetical protein MPER_03985 [Moniliophthora perniciosa FA553]
 gi|215467383|gb|EEB96811.1| hypothetical protein MPER_03985 [Moniliophthora perniciosa FA553]
          Length = 420

 Score =  314 bits (805), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 201/280 (71%), Gaps = 8/280 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP +I G R++T +A+WKFREFNEL HLF +RLD+SY  AN YI QFP  K         
Sbjct: 5   DPSTI-GGRRYTSYAQWKFREFNELPHLFIRRLDESYPLANTYIGQFPNEKMTLIMRFVA 63

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F AVL LAT  DPD+F+  EIT  RTV FY GV   + AV+RGMIP+++ VFDPE
Sbjct: 64  FVSGAFAAVLFLATIWDPDIFVHLEITPHRTVLFYLGVFGSVLAVARGMIPEENRVFDPE 123

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVR-----REFIQLFEVKVVLYIQEIFSVIFTPFIL 192
             +  V+ +THY PD W+G LH+  +R     +EF +LF +K++++I+E+ SV+ TPF+L
Sbjct: 124 MLMTGVITYTHYMPDAWKGELHSKRLRLAKVHQEFGELFAMKILIFIEEVASVVLTPFVL 183

Query: 193 WFSLADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKD 252
           WFSL   +  IIDFFREF+VHVDG G VCSFA F+F +HGNVK+GAP ++V+++  +S +
Sbjct: 184 WFSLPPWAPVIIDFFREFSVHVDGRGYVCSFAEFNFERHGNVKFGAP-TQVQDKRMMSNE 242

Query: 253 GKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
           GKMEKSFLNFKA +PDW PTDP GSLYLSRL  F   A+P
Sbjct: 243 GKMEKSFLNFKAANPDWMPTDPSGSLYLSRLQGF-TAAYP 281



>gi|426200063|gb|EKV49987.1| hypothetical protein AGABI2DRAFT_183133 [Agaricus bisporus var.
           bisporus H97]
          Length = 980

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 147/274 (53%), Positives = 198/274 (72%), Gaps = 3/274 (1%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           SDP S+ GSR++T +A+WKFREFNEL H F +RLD+SY  AN YI QFP  K        
Sbjct: 495 SDPSSV-GSRRYTSYAKWKFREFNELPHFFTRRLDESYPLANIYIGQFPNEKISLIMRFV 553

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               G+FTAVL LA+ +D DL L FE++   TV FY  +   + A +RGMIP+++ VFDP
Sbjct: 554 SFVAGAFTAVLALASVLDTDL-LKFELSPHGTVAFYLALFGGIMAATRGMIPEENRVFDP 612

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + +V+ +THY P++W+ +LH+ ++ ++F +LF +KV+++ QE+ SV+ TPF+LWFSL
Sbjct: 613 ELLMTEVITYTHYMPEDWKNQLHSKKIHQDFGELFSMKVLIFAQELISVVLTPFVLWFSL 672

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
            DC+  IIDFFREF+VHVDG G VCSFA F+F +HGNVK+GAP + V ++  +S  GKME
Sbjct: 673 PDCAPAIIDFFREFSVHVDGRGYVCSFAEFNFERHGNVKFGAPKA-VNDKKMISNQGKME 731

Query: 257 KSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQA 290
           KSFLNFKA +PDW PTDP GSLYLSR+ +    A
Sbjct: 732 KSFLNFKAANPDWNPTDPSGSLYLSRMADIAAGA 765



>gi|321262759|ref|XP_003196098.1| autophagic vacuole formation-related protein [Cryptococcus gattii
           WM276]
 gi|317462573|gb|ADV24311.1| Autophagic vacuole formation-related protein, putative
           [Cryptococcus gattii WM276]
          Length = 843

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/317 (48%), Positives = 200/317 (63%), Gaps = 43/317 (13%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T +A+WKFREFNEL HLF +RLD+SY+ A +Y+DQFPK +T        
Sbjct: 398 NPSSI-GSRQYTPYAQWKFREFNELPHLFERRLDRSYETAKEYVDQFPKERTALVMRFVA 456

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL++A+ IDPDLFL FEIT  RTV FY GV   + A+SRGM+P +++VFDPE
Sbjct: 457 FVAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSVLAISRGMVPQENMVFDPE 516

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L +VV  THY P EWRG+LH+  V +EF +LF +K++++  E+ SVI TPFIL+FSL 
Sbjct: 517 ASLNEVVRWTHYLPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLP 576

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAP------------------ 239
            C+  IIDFFREFTVHVDGVG VCSFA+FDF +HGN+    P                  
Sbjct: 577 PCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARHGNIDSNRPETGLQGATGPGAGNAAAA 636

Query: 240 ------------------------ASEVENEYYLSKDGKMEKSFLNFKANHPDWEPTDPF 275
                                    S  + + + S + KME+SFL+FKA HPDW+P+DP 
Sbjct: 637 AAGDGGFGVGKPGRQTSRRAASASPSRFKQKDWRSNENKMEQSFLHFKATHPDWQPSDPS 696

Query: 276 GSLYLSRLTEFNNQAHP 292
            SL+L RL     +  P
Sbjct: 697 SSLFLDRLMGAGTRNRP 713



>gi|73619453|sp|Q6TGJ4.1|ATG9_CRYGA RecName: Full=Autophagy-related protein 9
 gi|46403031|gb|AAS92527.1| APG9 [Cryptococcus gattii]
          Length = 751

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/318 (48%), Positives = 201/318 (63%), Gaps = 44/318 (13%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T +A+WKFREFNEL HLF +RLD+SY+ A +Y+DQFPK +T        
Sbjct: 310 NPSSI-GSRQYTPYAQWKFREFNELPHLFERRLDRSYETAKEYVDQFPKERTALVMRFVA 368

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL++A+ IDPDLFL FEIT  RTV FY GV   + A+SRGM+P +++VFDPE
Sbjct: 369 FVAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSVLAISRGMVPQENMVFDPE 428

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L +VV  THY P EWRG+LH+  V +EF +LF +K++++  E+ SVI TPFIL+FSL 
Sbjct: 429 ASLNEVVRWTHYLPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLP 488

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVE------------- 244
            C+  IIDFFREFTVHVDGVG VCSFA+FDF +HGN+    P + V+             
Sbjct: 489 PCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARHGNIDSNRPETGVQGATGPDAGDSGGG 548

Query: 245 ------------------------------NEYYLSKDGKMEKSFLNFKANHPDWEPTDP 274
                                          + + S + KME+SFL+FKA HPDW+P+DP
Sbjct: 549 GGGGGGGFAAGKSGRQTTRRAASASPSRFKQKDWRSNENKMEQSFLHFKATHPDWQPSDP 608

Query: 275 FGSLYLSRLTEFNNQAHP 292
             SL+L RL     +  P
Sbjct: 609 SSSLFLDRLMGAGARNRP 626



>gi|134110402|ref|XP_776028.1| hypothetical protein CNBD0770 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258696|gb|EAL21381.1| hypothetical protein CNBD0770 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 898

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 200/302 (66%), Gaps = 37/302 (12%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T +A+WKFREFNEL HLF +RLD+SY+ A +Y+DQFPK +T        
Sbjct: 418 NPSSI-GSRQYTPYAQWKFREFNELPHLFERRLDRSYEIAKEYVDQFPKERTALVMRFVA 476

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL++A+ IDPDLFL FEIT  RTV FY GV   + A+SRGM+P +++VFDPE
Sbjct: 477 FIAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSILAISRGMVPQENMVFDPE 536

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L +VV  THY P EWRG+LH+  V +EF +LF +K++++  E+ SVI TPFIL+FSL 
Sbjct: 537 ASLNEVVRWTHYLPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLP 596

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKY--------------GAPA--- 240
            C+  IIDFFREFTVHVDGVG VCSFA+FDF ++GNV                G PA   
Sbjct: 597 PCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARYGNVDANQPETGLEGATGPDGGPAADG 656

Query: 241 -------------------SEVENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLS 281
                              S +++  +   + KME+SFL+FKA HPDW+P+DP  SL+L 
Sbjct: 657 FAAGKPSRPTTRRTTSSSPSRLKHRDWRGNENKMEQSFLHFKATHPDWQPSDPSSSLFLD 716

Query: 282 RL 283
           RL
Sbjct: 717 RL 718



>gi|405119927|gb|AFR94698.1| apg9 [Cryptococcus neoformans var. grubii H99]
          Length = 864

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 154/302 (50%), Positives = 198/302 (65%), Gaps = 37/302 (12%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T +A+WKFREFNEL HLF +RLD+SY+ A +Y+DQFPK +T        
Sbjct: 418 NPSSI-GSRQYTPYAQWKFREFNELPHLFERRLDRSYETAKEYVDQFPKERTALVMRFVA 476

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL++A+ IDPDLFL FEIT  RTV FY GV   + A+SRGM+P +++VFDPE
Sbjct: 477 FIAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGVFGSVLAISRGMVPQENMVFDPE 536

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L +VV  THY P EWRG LH+  V +EF +LF +K++++  E+ SVI TPFIL+FSL 
Sbjct: 537 ASLNEVVRWTHYLPIEWRGHLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLP 596

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAP------------------ 239
            C+  IIDFFREFTVHVDGVG VCSFA+FDF ++GNV    P                  
Sbjct: 597 PCAAAIIDFFREFTVHVDGVGYVCSFAVFDFARYGNVDANQPETGLEGATGPDGGTAAGG 656

Query: 240 ------------------ASEVENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLS 281
                              S ++ + + S + KME+SFL+FKA HPDW+P+DP  SL+L 
Sbjct: 657 FAAGKPSRQIARRTTSPSPSRLKQKDWRSNENKMEQSFLHFKATHPDWQPSDPSSSLFLD 716

Query: 282 RL 283
           RL
Sbjct: 717 RL 718



>gi|343425663|emb|CBQ69197.1| related to ATG9-integral membrane protein required for Cvt and
           autophagy transport [Sporisorium reilianum SRZ2]
          Length = 789

 Score =  303 bits (777), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 142/269 (52%), Positives = 186/269 (69%), Gaps = 15/269 (5%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP ++ GSRQ+TQ+ARWKFREFNEL HLF +R   SY PA+KYIDQFPK KT        
Sbjct: 457 DPSNL-GSRQYTQYARWKFREFNELPHLFRRRCHTSYAPASKYIDQFPKEKTAIVARFVA 515

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTAVLILA+ IDPDLF+ F IT  R V FY GV   + AVSRGMIPD+HLVF+PE
Sbjct: 516 FVAGSFTAVLILASVIDPDLFVHFNITPQRNVLFYIGVFGAILAVSRGMIPDEHLVFEPE 575

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L++V++HTHY P++W+GR H+ +V + F QL+ +K+ +++QE+ SV+ TPF+LW SL 
Sbjct: 576 AMLREVIQHTHYLPEDWKGRFHSAQVHQAFGQLYTLKIYIFVQELLSVVTTPFVLWLSLP 635

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH--GNVKYGAPASEVENEYYLS----- 250
            C+ ++IDF R +TVHVDG+G VCSFA+FDF +    +   GA A  +            
Sbjct: 636 GCAPELIDFLRAYTVHVDGLGHVCSFAVFDFARQPTASTMGGAAAKGIHGRQQHRSGSGK 695

Query: 251 -------KDGKMEKSFLNFKANHPDWEPT 272
                  ++GKME+S L F+ANHPDW+P 
Sbjct: 696 RALRNGMREGKMEQSILGFRANHPDWDPA 724



>gi|388855494|emb|CCF50940.1| related to ATG9-integral membrane protein required for Cvt and
           autophagy transport [Ustilago hordei]
          Length = 782

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 187/266 (70%), Gaps = 12/266 (4%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP ++ GSRQ+TQ+ARWK REFNEL HLF +R   SY PA KYIDQFPK KT        
Sbjct: 452 DPSNL-GSRQYTQYARWKLREFNELPHLFRRRCHTSYAPAQKYIDQFPKEKTAIVARFVA 510

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTAVLILA+ IDPDLFL F+IT  R V FY GV   + AV+RGMIPD+HLVF+PE
Sbjct: 511 FVAGSFTAVLILASVIDPDLFLHFDITPQRNVLFYIGVFGAILAVARGMIPDEHLVFEPE 570

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L++V++HTHY P EW+GR H+ EV + F QL+ +K+ +++QE+ SV+ TPF+LW +L 
Sbjct: 571 AVLREVIQHTHYLPQEWKGRFHSAEVHQAFGQLYTLKIYIFLQELLSVVTTPFVLWLTLP 630

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH--GNVKYGAPASEVENEYYLS----- 250
            C+ ++IDF R++T+HVDG+G VC FA+FDF +    +   GA A E+  +   +     
Sbjct: 631 ACAPELIDFLRKYTIHVDGLGHVCWFAVFDFARQPTASTTGGAAAREMYQDPKRNGRRAI 690

Query: 251 ----KDGKMEKSFLNFKANHPDWEPT 272
               K+GK+E+S L FKANHPDW+P 
Sbjct: 691 RNGIKEGKIEQSILGFKANHPDWDPV 716



>gi|501756033|emb|CCG80926.1| Autophagy-related protein 9 [Taphrina deformans PYCC 5710]
          Length = 1231

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 143/266 (53%), Positives = 187/266 (70%), Gaps = 2/266 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P +I G R +T +A+WKFREFNEL H+F++RL  S+  ANKY+ QFP  KT        
Sbjct: 408 NPAAI-GMRGYTPYAQWKFREFNELQHIFNRRLTMSHDVANKYVSQFPNDKTAQLARFSR 466

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL   + IDPDLFLGFEIT  RTV FY G    + A+S+ ++P+    FDPE
Sbjct: 467 FVAGSFAAVLAFISIIDPDLFLGFEITHDRTVLFYLGFFGTIIAISQSLMPEKQETFDPE 526

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           + L+ V+E THYSP+ W+G+ H+ E + EF +L+E K V++I+EI S I  PFILWFSLA
Sbjct: 527 SSLRAVIEFTHYSPENWQGQYHSHETKAEFCKLYEYKFVIFIEEILSAIAVPFILWFSLA 586

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            CS+QIIDF ++F+VHVDGVG VCSFA+FDF  +G+ KYGAP S+       +K+GKMEK
Sbjct: 587 ACSEQIIDFVKDFSVHVDGVGYVCSFALFDFEANGDAKYGAPISDKATPNRTAKEGKMEK 646

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRL 283
           SFLNFKA++PDW P +  GS +L  L
Sbjct: 647 SFLNFKASNPDWVP-ELSGSHFLQNL 671



>gi|501309182|dbj|GAC98040.1| hypothetical protein PHSY_005628 [Pseudozyma hubeiensis SY62]
          Length = 807

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 189/283 (66%), Gaps = 14/283 (4%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP ++ GSRQ+TQ+ARWKFREFNEL HLF +R   SY PA+KYIDQFPK KT        
Sbjct: 471 DPSNL-GSRQYTQYARWKFREFNELPHLFRRRCHTSYAPASKYIDQFPKEKTAIVARFVA 529

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTAVLILA+ IDPDLF+ F IT  R + FY GV   + AVSRGM+PD+HLVF+PE
Sbjct: 530 FVAGSFTAVLILASVIDPDLFVHFNITPQRNMLFYIGVFGAILAVSRGMVPDEHLVFEPE 589

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L++V++HTHY P +W+GR H+ +V + F QL+ +K+ ++ QE+ SV+ TPF+LW SL 
Sbjct: 590 AVLREVIQHTHYLPQDWKGRFHSAQVHQAFGQLYTLKIYIFFQELLSVVTTPFVLWLSLP 649

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH--GNVKYGAPASEVENEYYLS----- 250
            C+  +IDF R++TVHVDG+G VCSFA+FDF +    +   G  A  +  +         
Sbjct: 650 GCAPDLIDFLRKYTVHVDGLGHVCSFAVFDFARQPTASTMGGVAAKGIHRQPQQGSSKAR 709

Query: 251 ------KDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFN 287
                 ++GKME+S L F+ANHPDW+P     +  + R  E N
Sbjct: 710 ALRNGMREGKMEQSILGFRANHPDWDPAAHASTASIHRHNEDN 752



>gi|58266636|ref|XP_570474.1| autophagic vacuole formation-related protein [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|338817608|sp|P0CM41.1|ATG9_CRYNB RecName: Full=Autophagy-related protein 9
 gi|338817609|sp|P0CM40.1|ATG9_CRYNJ RecName: Full=Autophagy-related protein 9
 gi|57226707|gb|AAW43167.1| autophagic vacuole formation-related protein, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 879

 Score =  293 bits (749), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 189/290 (65%), Gaps = 36/290 (12%)

Query: 30  QFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSFTAVLIL 89
           ++  WKFREFNEL HLF +RLD+SY+ A +Y+DQFPK +T           GSF AVL++
Sbjct: 410 RYFEWKFREFNELPHLFERRLDRSYEIAKEYVDQFPKERTALVMRFVAFIAGSFAAVLLV 469

Query: 90  ATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKVVEHTHY 149
           A+ IDPDLFL FEIT  RTV FY GV   + A+SRGM+P +++VFDPEA L +VV  THY
Sbjct: 470 ASLIDPDLFLHFEITPHRTVLFYLGVFGSILAISRGMVPQENMVFDPEASLNEVVRWTHY 529

Query: 150 SPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQIIDFFRE 209
            P EWRG+LH+  V +EF +LF +K++++  E+ SVI TPFIL+FSL  C+  IIDFFRE
Sbjct: 530 LPVEWRGQLHSQMVHQEFSKLFALKIMIFFSELLSVILTPFILFFSLPPCAAAIIDFFRE 589

Query: 210 FTVHVDGVGDVCSFAIFDFRKHGNVKY--------------GAPA--------------- 240
           FTVHVDGVG VCSFA+FDF ++GNV                G PA               
Sbjct: 590 FTVHVDGVGYVCSFAVFDFARYGNVDANQPETGLEGATGPDGGPAADGFAAGKPSRPTTR 649

Query: 241 -------SEVENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRL 283
                  S +++  +   + KME+SFL+FKA HPDW+P+DP  SL+L RL
Sbjct: 650 RTTSSSPSRLKHRDWRGNENKMEQSFLHFKATHPDWQPSDPSSSLFLDRL 699



>gi|393245693|gb|EJD53203.1| APG9-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 558

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 180/248 (72%), Gaps = 2/248 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
            +P SI G R++T +A WKFREFNEL HLF++RL  SY  AN YI+QFPK +        
Sbjct: 302 KNPSSI-GGRKYTAYAEWKFREFNELPHLFNRRLSLSYPIANVYINQFPKEQVALISRFV 360

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL++AT +DPD FL FEIT  RTV FY GV   + AV+RGM+P+ + VFDP
Sbjct: 361 AFISGSFAAVLLVATIVDPDFFLNFEITPHRTVLFYLGVFGSILAVARGMVPEKNRVFDP 420

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  ++ V+ +THY P+EW+G LH+ +V   F  LF++KV ++  E+ SV+ TPFILW+SL
Sbjct: 421 EVLMRDVIRYTHYMPNEWKGMLHSQKVHEVFGALFDMKVKIFAVELLSVVVTPFILWYSL 480

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
             C+  I+DFFREFTVHVDG+G VCSFA F+F++HGNV++GAP SE   E  +SK+GKME
Sbjct: 481 PTCAPAIVDFFREFTVHVDGLGFVCSFAEFNFKRHGNVQFGAP-SEAAEERLMSKEGKME 539

Query: 257 KSFLNFKA 264
           KSFLNFKA
Sbjct: 540 KSFLNFKA 547



>gi|392574606|gb|EIW67742.1| hypothetical protein TREMEDRAFT_45223 [Tremella mesenterica DSM
           1558]
          Length = 811

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 192/299 (64%), Gaps = 32/299 (10%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
            +P SI GSRQ+T +A+WKFREFNEL HLF +RLD SY  A +YIDQFPK +T       
Sbjct: 357 KNPSSI-GSRQYTPYAQWKFREFNELPHLFERRLDMSYPTAKEYIDQFPKERTALVMRFV 415

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL++A+ IDPDLFL FEIT  RTV FY G+   + A++RGM+P+++LVFDP
Sbjct: 416 AFIAGSFAAVLLVASLIDPDLFLHFEITPHRTVLFYLGIFGSVLAMARGMVPEENLVFDP 475

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           EA L++VV  THY P  W+GRLH+  V  EF  LF++K+ ++ QE+ SV+ TPF+L FSL
Sbjct: 476 EASLREVVRWTHYLPGGWQGRLHSVMVHAEFSTLFQLKITIFFQELLSVLLTPFVLLFSL 535

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK-----YGAPASEV-------- 243
             C+ +IIDFFREFTVHVDGVG VCSFA+FDF +   V+      GA  +          
Sbjct: 536 PPCAGEIIDFFREFTVHVDGVGYVCSFAVFDFGRPALVQEDIHPKGASINTNTNTNLDTN 595

Query: 244 ------------------ENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLT 284
                             +     + + KMEKSFL+FKA HPDW P+DP  S++L +L 
Sbjct: 596 NISTKKKTTEETTMKRGKDKNRNRANENKMEKSFLHFKATHPDWIPSDPASSIFLDKLV 654



>gi|505756733|gb|EOR00874.1| Autophagy-related protein 9 [Wallemia ichthyophaga EXF-994]
          Length = 706

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/268 (49%), Positives = 187/268 (69%), Gaps = 2/268 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +T+ ARWKFREFNEL H+F +RL+ SY  A KYI QFP  K         
Sbjct: 376 NPSSI-GSRNYTELARWKFREFNELQHIFQKRLNMSYDDAQKYIVQFPNEKAAIVARFVA 434

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVLILA+ IDPD+FL FEI+  RT  FY G+   + A++RGM+P ++ V DPE
Sbjct: 435 FVAGSFAAVLILASVIDPDMFLHFEISPQRTTVFYIGLFGTILAIARGMVPVENEVNDPE 494

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L++   +TH+ P EW+ ++H+  + REF +LFE+K+V+++QEI SV+FTP IL++SL 
Sbjct: 495 RLLRRACAYTHHLPQEWQSQMHSKSIHREFSKLFELKIVIFLQEILSVVFTPLILYYSLP 554

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             S  IIDF  + TV VD +G +CSFA FDF +HGN K+GAP  + +N   +S+DGK+EK
Sbjct: 555 KSSPAIIDFVSQSTVKVDQLGYICSFAHFDFVRHGNTKFGAP-KDAQNVKLMSQDGKLEK 613

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S +NFKA +P W P+D  GS+++ ++++
Sbjct: 614 SVMNFKAANPKWIPSDQAGSVFVQKMSD 641



>gi|358054383|dbj|GAA99309.1| hypothetical protein E5Q_06004 [Mixia osmundae IAM 14324]
          Length = 1097

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/268 (49%), Positives = 178/268 (66%), Gaps = 1/268 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +TQ ARWKFRE+NEL H F QRL +SY  A  Y++QFPK  T        
Sbjct: 667 NPSSI-GSRSYTQLARWKFREYNELPHNFQQRLHRSYPAAEMYVEQFPKELTSQIARFVA 725

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF +VL+L + +DPD FL FE+T GRTV FY GV   + AV+RGM+PDDH + DPE
Sbjct: 726 FVSGSFASVLVLFSLLDPDAFLHFEVTPGRTVLFYIGVFGGILAVARGMVPDDHQIVDPE 785

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             +  ++E THY P EW+ +LH+ EV REF QLF+++V  ++ E+ SV+ TP++LW +L 
Sbjct: 786 ELMLAIIECTHYCPPEWKDQLHSAEVHREFSQLFQMRVTTFVLEMISVVTTPYVLWRNLP 845

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             +  I+DFFRE T+HVDG+G VC+ A+FD +         P    E+  + S  GKMEK
Sbjct: 846 KTAPAIVDFFRETTIHVDGLGYVCASAVFDSKGKSAPTLQLPNGGEEHHRWPSDHGKMEK 905

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++FK+ HPDW P D   SL+LSR+TE
Sbjct: 906 SLISFKSTHPDWMPHDQATSLFLSRMTE 933



>gi|121700050|ref|XP_001268290.1| autophagy protein Apg9, putative [Aspergillus clavatus NRRL 1]
 gi|166990639|sp|A1CU77.1|ATG9_ASPCL RecName: Full=Autophagy-related protein 9
 gi|119396432|gb|EAW06864.1| autophagy protein Apg9, putative [Aspergillus clavatus NRRL 1]
          Length = 949

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 182/251 (72%), Gaps = 5/251 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT           
Sbjct: 492 SQIGSRQYTPLAEWKFREFNELWHLFERRINMSYPFASRYVDQFPKDKTVQVAGFVAFVS 551

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RGM+P++  VFDPE  L
Sbjct: 552 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGSVWAVARGMVPEETNVFDPEYAL 611

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+ +THY P +W+GRLH+DEVRREF +L+++K+V++++EI S+IFTPFILWFSL  CS
Sbjct: 612 LEVINYTHYFPSQWKGRLHSDEVRREFAELYQMKIVIFLEEILSMIFTPFILWFSLPRCS 671

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----KYGAPASEVENEYYLSKDGKM 255
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV     +      ++  +Y+ +KDGKM
Sbjct: 672 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVITQGDRREPARQDLRADYFATKDGKM 731

Query: 256 EKSFLNFKANH 266
             S+  F  N+
Sbjct: 732 LASYYGFLDNY 742



>gi|388582416|gb|EIM22721.1| APG9-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 705

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 185/268 (69%), Gaps = 2/268 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +T+ A+WKFREFNEL HLF +RL  SY  A KYI QFP ++         
Sbjct: 381 NPSSI-GSRSYTELAQWKFREFNELQHLFQKRLSLSYDDAQKYIVQFPNSEIAIIARFVA 439

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AV ILA+ IDPD+FL FEIT  RT  FY GV   + AV+RGMIP D+ V DPE
Sbjct: 440 FVAGSFAAVFILASVIDPDMFLHFEITPQRTTVFYIGVFGTILAVARGMIPADNEVNDPE 499

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L++    TH+ P EW G++H+ +V  EF +LFE+K+ +++QEI SV+FTP IL++SL 
Sbjct: 500 RLLRRACAFTHHLPKEWEGQMHSKKVHAEFSRLFELKIAIFLQEILSVLFTPIILYYSLP 559

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             S  IIDF  + TVHVD +G +CSFA FDF +HGN ++GAP  + +N   +S+DGK+EK
Sbjct: 560 KSSPAIIDFISQSTVHVDQLGYICSFAHFDFLRHGNKRFGAP-KDAQNVKLMSEDGKLEK 618

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S LNFKA +P W P D  GS+++++++E
Sbjct: 619 SVLNFKAANPKWMPNDQAGSIFVNKMSE 646



>gi|70992529|ref|XP_751113.1| autophagy protein Apg9 [Aspergillus fumigatus Af293]
 gi|73619447|sp|Q4WLT9.1|ATG9_ASPFU RecName: Full=Autophagy-related protein 9
 gi|66848746|gb|EAL89075.1| autophagy protein Apg9, putative [Aspergillus fumigatus Af293]
 gi|159124685|gb|EDP49803.1| autophagy protein Apg9, putative [Aspergillus fumigatus A1163]
          Length = 951

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 135/261 (51%), Positives = 185/261 (70%), Gaps = 9/261 (3%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT           
Sbjct: 492 SQIGSRQYTPLAEWKFREFNELWHLFERRINMSYPFASRYVDQFPKDKTVQVAGFVAFVS 551

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RG++P++  VFDPE  L
Sbjct: 552 GALASVLALASIVDPELFLGFEITHDRTVLFYLGVFGSVWAVARGLVPEETTVFDPEYAL 611

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+ +THY+P  W+GRLH+DEVRREF +L+++K+V++++EI S+IFTPFILWF+L  CS
Sbjct: 612 LEVINYTHYAPSHWKGRLHSDEVRREFTELYQMKIVIFLEEILSMIFTPFILWFNLPKCS 671

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----KYGAPASEVENEYYLSKDGKM 255
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV     +      ++  +Y+ +KDGKM
Sbjct: 672 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVINQGDRRDPARQDLRADYFSTKDGKM 731

Query: 256 EKSFL----NFKANHPDWEPT 272
             S+     N+ ANH    P 
Sbjct: 732 LASYYGFLDNYGANHRGSHPA 752



>gi|225560831|gb|EEH09112.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 966

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 139/269 (51%), Positives = 189/269 (70%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YIDQFPK KT           
Sbjct: 496 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFATRYIDQFPKDKTVQISRFVGFIA 555

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GVL  ++AV+RG++P++ LVFDPE  L
Sbjct: 556 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVLGTVWAVARGIVPEETLVFDPEFAL 615

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEVR EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 616 REVIDFTHYQPAHWQGKLHSDEVRTEFAMLYQMKVLIFLEELLSMIFIPFVLWFSLPKCS 675

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV            + A  +++ N+Y+ 
Sbjct: 676 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNVIPQNQDAQQGPSHDAGQTDLRNDYFS 735

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 736 TKDGKMLASYYGFLDNYANNP--RPGAPY 762



>gi|119472590|ref|XP_001258378.1| autophagy protein Apg9, putative [Neosartorya fischeri NRRL 181]
 gi|166990641|sp|A1DNW0.1|ATG9_NEOFI RecName: Full=Autophagy-related protein 9
 gi|119406530|gb|EAW16481.1| autophagy protein Apg9, putative [Neosartorya fischeri NRRL 181]
          Length = 953

 Score =  284 bits (727), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 184/255 (72%), Gaps = 9/255 (3%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT           
Sbjct: 494 SQIGSRQYTPLAEWKFREFNELWHLFERRINMSYPFASRYVDQFPKDKTVQVAGFVAFVS 553

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RG++P++  VFDPE  L
Sbjct: 554 GALASVLALASIVDPELFLGFEITHDRTVLFYLGVFGSVWAVARGLVPEETTVFDPEYAL 613

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+ +THY+P  W+GRLH+DEVRREF +L+++K+V++++EI S+IFTPFILWF+L  CS
Sbjct: 614 LEVINYTHYAPSHWKGRLHSDEVRREFAELYQMKIVIFLEEILSMIFTPFILWFNLPKCS 673

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----KYGAPASEVENEYYLSKDGKM 255
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV     +      ++  +Y+ +KDGKM
Sbjct: 674 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVINQGDRREPARQDLRADYFSTKDGKM 733

Query: 256 EKSFL----NFKANH 266
             S+     N+ ANH
Sbjct: 734 LASYYGFLDNYGANH 748



>gi|154278002|ref|XP_001539828.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150413413|gb|EDN08796.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 715

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 139/269 (51%), Positives = 189/269 (70%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YIDQFPK KT           
Sbjct: 245 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFATRYIDQFPKDKTVQVSRFVGFIA 304

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GVL  ++AV+RG++P++ LVFDPE  L
Sbjct: 305 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVLGTVWAVARGIVPEETLVFDPEFAL 364

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEVR EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 365 REVIDFTHYQPAHWQGKLHSDEVRTEFAMLYQMKVLIFLEELLSMIFIPFVLWFSLPKCS 424

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV            + A  +++ N+Y+ 
Sbjct: 425 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNVIPQNQDVQQGPSHDAGQTDLRNDYFS 484

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 485 TKDGKMLASYYGFLDNYANNP--RPGAPY 511



>gi|71020593|ref|XP_760527.1| hypothetical protein UM04380.1 [Ustilago maydis 521]
 gi|74700758|sp|Q4P683.1|ATG9_USTMA RecName: Full=Autophagy-related protein 9
 gi|46100422|gb|EAK85655.1| hypothetical protein UM04380.1 [Ustilago maydis 521]
          Length = 788

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 181/277 (65%), Gaps = 23/277 (8%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP ++ GSRQ+TQ+ARWKFREFNEL HLF +R   SY  A+KY+DQFPK KT        
Sbjct: 450 DPSNL-GSRQYTQYARWKFREFNELPHLFRRRCRTSYVAASKYMDQFPKEKTAIVARFVA 508

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTAVL+LA+ +DPD+F+ F IT  R V FY GV   + AV+RGMIPD+H+VF+PE
Sbjct: 509 FVAGSFTAVLLLASVMDPDVFVHFNITPQRNVLFYIGVFGAILAVARGMIPDEHVVFEPE 568

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A L++V+E THY P +W+GR H+ +V + F QL+ +K+ +++QE+ SV+ TPF+LW SL 
Sbjct: 569 AMLREVIEQTHYLPQDWKGRFHSAQVHQAFGQLYTLKIYIFLQELLSVVTTPFVLWLSLP 628

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH--GNVKYGAPASEVENEYYLS----- 250
            C+  +IDF R++TVHVDG+G VCSFA+FDF +    +   GA A  +  +         
Sbjct: 629 ACAPDLIDFLRKYTVHVDGLGHVCSFAVFDFARQPTASTMGGAAAKGIHRQQQQQQQQQQ 688

Query: 251 ---------------KDGKMEKSFLNFKANHPDWEPT 272
                             KME+S L F+ANHPDW+P 
Sbjct: 689 QSGGSGRTRAPRNGMSQAKMEQSILGFRANHPDWDPA 725



>gi|406865744|gb|EKD18785.1| putative Autophagy-related protein 9 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 917

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 133/251 (52%), Positives = 182/251 (72%), Gaps = 3/251 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP +I GSRQ+T  A WKFREFNEL+HLFH+R++ SY  A++Y+DQFPK K         
Sbjct: 477 DPSAI-GSRQYTPLAEWKFREFNELNHLFHKRVNMSYPFASRYLDQFPKVKMVQFARFMS 535

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL +AT  DP+ FL F++T+ RTV FY  V   ++A   GMIP+++LVF+PE
Sbjct: 536 FIAGAIVSVLAVATLWDPESFLSFDLTSERTVLFYLTVFGGIWATMNGMIPEENLVFEPE 595

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L++V+E+THY P +W+ RLH+DEV+REF  L+++K++++++EI S+I TPFILWFSL 
Sbjct: 596 YALRQVIEYTHYMPTQWQNRLHSDEVKREFATLYQMKIMIFVEEILSIIVTPFILWFSLP 655

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK--YGAPASEVENEYYLSKDGKM 255
            CS QIIDFFREFT+HVDGVG VCSFA+FDF+K    K  +G   S+V +EYY +K GKM
Sbjct: 656 KCSDQIIDFFREFTIHVDGVGYVCSFAVFDFKKGDGRKPLHGGGNSDVRDEYYSTKHGKM 715

Query: 256 EKSFLNFKANH 266
             S+  F  N+
Sbjct: 716 AMSYYGFLDNY 726



>gi|242790878|ref|XP_002481645.1| autophagy protein Apg9, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218718233|gb|EED17653.1| autophagy protein Apg9, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 956

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 177/249 (71%), Gaps = 7/249 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT           
Sbjct: 491 SQIGSRQYTPLAEWKFREFNELWHLFQRRINMSYPFASRYIDQFPKDKTVQISRFVAFIA 550

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFE+T  RTV FY G+   ++A++RG++P++ LVFDPE  L
Sbjct: 551 GALASVLALASLLDPELFLGFEVTQDRTVLFYLGLFGSVWAIARGLVPEETLVFDPEYAL 610

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V   THY P+ W GRLH+DEVR+EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 611 LEVTNFTHYRPNHWAGRLHSDEVRQEFAMLYQMKIVIFLEEILSMIFTPFVLWFSLPKCS 670

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK-------YGAPASEVENEYYLSKDG 253
            ++IDFFREFTVHVDG+G VCSFA+FDF+K            +  P  ++ ++Y+ +KDG
Sbjct: 671 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKDAQTNPQGRAPHHTGPPGDLRDDYFSTKDG 730

Query: 254 KMEKSFLNF 262
           KM  S+  F
Sbjct: 731 KMLASYYGF 739



>gi|443925189|gb|ELU44090.1| autophagic vacuole formation-related protein [Rhizoctonia solani
           AG-1 IA]
          Length = 882

 Score =  281 bits (718), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/273 (50%), Positives = 182/273 (66%), Gaps = 7/273 (2%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
           G+RQ+T +A+W FRE+NEL H+F +RLD SY  A++Y+DQFPK K            GSF
Sbjct: 174 GARQYTPYAKWTFREYNELPHIFARRLDNSYPMASEYMDQFPKEKMTIIARFVSFISGSF 233

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVLILA+ IDPD+FL FEIT GRTV FY  V   +  ++RGM+PD H VFDPE  LK+V
Sbjct: 234 AAVLILASVIDPDIFLHFEITPGRTVVFYITVFGTILGIARGMVPDAHQVFDPEMILKEV 293

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           + +THY P EW G+LH+  V  EF  LF+ KV +++ E+ SV+ TPFILW+SL   +++I
Sbjct: 294 IRYTHYLPKEWEGQLHSKRVHTEFGLLFDTKVTIFLNELISVMVTPFILWYSLPQHAEKI 353

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS----EVENEYYLSKDGKMEKSF 259
           IDFFRE T HV+G+G VC+ A+FD  +HG      P      +V       ++ KME+S 
Sbjct: 354 IDFFRESTWHVEGLGYVCNSAVFDLGRHGRPFEHEPEEPEPRKVGKGKLRERETKMEQSL 413

Query: 260 LNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
           LNFKA +P+W P+D  GSLYLSR  +    AHP
Sbjct: 414 LNFKAANPEWNPSDQTGSLYLSRNADM---AHP 443



>gi|295664781|ref|XP_002792942.1| autophagy-related protein 9 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226278463|gb|EEH34029.1| autophagy-related protein 9 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 971

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 138/271 (50%), Positives = 188/271 (69%), Gaps = 20/271 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT           
Sbjct: 495 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFASRYIDQFPKDKTAQLGRFVGFIA 554

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 555 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGTVWAVARGIVPEETLVFDPEYAL 614

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KVV++++E+ S++F PF+LWFSL  CS
Sbjct: 615 REVIDFTHYQPAHWQGKLHSDEVKTEFAMLYQMKVVIFLEELLSMVFIPFVLWFSLPKCS 674

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK-------------HGNVKYGAPASEVENEY 247
            ++IDFFREFTVHVDG+G VCSFA+FDF+K              GN   G P  ++ N+Y
Sbjct: 675 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNIIPQNQDAQPGGNNDAGQP--DLRNDY 732

Query: 248 YLSKDGKMEKS---FLNFKANHPDWEPTDPF 275
           + +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 733 FSTKDGKMLASYYGFLDNYANNP--RPGAPY 761



>gi|119194771|ref|XP_001247989.1| hypothetical protein CIMG_01760 [Coccidioides immitis RS]
 gi|121770300|sp|Q1E6Q3.1|ATG9_COCIM RecName: Full=Autophagy-related protein 9
 gi|392862767|gb|EAS36565.2| autophagy protein Apg9 [Coccidioides immitis RS]
          Length = 931

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 140/287 (48%), Positives = 188/287 (65%), Gaps = 21/287 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R+  SY+ AN YI+QFPK KT           
Sbjct: 474 SKIGSRQYTPLAEWKFREFNELWHLFERRIHMSYESANMYINQFPKDKTVQLSRFVAFIA 533

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ IDP+LFLGFEIT  RTV FY G+   ++AV+RG++PDD  VFDPE  L
Sbjct: 534 GALLSVLALASVIDPELFLGFEITHDRTVLFYIGLFGTVYAVARGVVPDDAQVFDPEHAL 593

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             V  +THY P  W+G+LH+D+VR+EF  L+++KVV++++EI S+IFTPF+LWFSL  CS
Sbjct: 594 LDVTAYTHYKPAHWQGKLHSDDVRKEFATLYQLKVVIFLEEILSMIFTPFVLWFSLPKCS 653

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPA-----------SEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+    P             ++  +Y+ 
Sbjct: 654 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNLMPPEPQHHRPRGLKHGLHDLRGDYFS 713

Query: 250 SKDGKMEKSFLNFKANH-PDWEPTDPFGSLYLSRLTEFNNQAHPERP 295
           +KDGKM  S+  F  ++ P   P+ P  S           Q +P++P
Sbjct: 714 AKDGKMLASYYGFLDHYAPPARPSGPHAS---------QRQNYPQQP 751



>gi|226293427|gb|EEH48847.1| autophagy-related protein 9 [Paracoccidioides brasiliensis Pb18]
          Length = 971

 Score =  280 bits (715), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 187/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT           
Sbjct: 495 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFASRYIDQFPKDKTAQLGRFVGFIA 554

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 555 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGTVWAVARGIVPEETLVFDPEYAL 614

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KV+++++E+ S++F PF+LWFSL  CS
Sbjct: 615 REVIDFTHYQPAHWQGKLHSDEVKTEFAMLYQMKVIIFLEELLSMVFIPFVLWFSLPKCS 674

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+              A   ++ N+Y+ 
Sbjct: 675 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNIIPQNQDAQPGGTNDAGQPDLRNDYFS 734

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 735 TKDGKMLASYYGFLDNYANNP--RPGAPY 761



>gi|225684036|gb|EEH22320.1| autophagy-related protein 9 [Paracoccidioides brasiliensis Pb03]
          Length = 958

 Score =  279 bits (714), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 187/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT           
Sbjct: 482 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFASRYIDQFPKDKTAQLGRFVGFIA 541

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 542 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGTVWAVARGIVPEETLVFDPEYAL 601

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KV+++++E+ S++F PF+LWFSL  CS
Sbjct: 602 REVIDFTHYQPAHWQGKLHSDEVKTEFAMLYQMKVIIFLEELLSMVFIPFVLWFSLPKCS 661

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+              A   ++ N+Y+ 
Sbjct: 662 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNIIPQNQDAQPGGTNDAGQPDLRNDYFS 721

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 722 TKDGKMLASYYGFLDNYANNP--RPGAPY 748



>gi|325089117|gb|EGC42427.1| autophagy protein Apg9 [Ajellomyces capsulatus H88]
          Length = 966

 Score =  279 bits (714), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 188/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YI QFPK KT           
Sbjct: 496 SQIGSRQYTPLAEWKFREFNELQHLFQRRINMSYPFATRYIGQFPKDKTVQISRFVGFIA 555

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GVL  ++AV+RG++P++ LVFDPE  L
Sbjct: 556 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVLGTVWAVARGIVPEETLVFDPEFAL 615

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEVR EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 616 REVIDFTHYQPAHWQGKLHSDEVRTEFAMLYQMKVLIFLEELLSMIFIPFVLWFSLPKCS 675

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+            + A  +++ ++Y+ 
Sbjct: 676 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNIIPQNQDAQQGPSHDAGQTDLRSDYFS 735

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P   P  P+
Sbjct: 736 TKDGKMLASYYGFLDNYANNP--RPGAPY 762



>gi|238504334|ref|XP_002383398.1| autophagy protein Apg9, putative [Aspergillus flavus NRRL3357]
 gi|220690869|gb|EED47218.1| autophagy protein Apg9, putative [Aspergillus flavus NRRL3357]
          Length = 769

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 185/264 (70%), Gaps = 8/264 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P  I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 307 NPAQI-GSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKTVQVAGFVA 365

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG++P++  VFDPE
Sbjct: 366 FVSGALASVLALVSIIDPELFLGFEITHDRTVLFYLGVFGSVWAFARGLVPEETNVFDPE 425

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L +V++ THY P+ W+GRLH+DEVR+EF  L+++K+V++++EI S+IFTPFILWFSL 
Sbjct: 426 FALLEVIDFTHYFPNHWKGRLHSDEVRKEFAVLYQMKIVIFLEEILSMIFTPFILWFSLP 485

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLS 250
            CS ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  +   ++  +Y+ +
Sbjct: 486 KCSDRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGGTGRRESGRQDLRADYFST 545

Query: 251 KDGKMEKSFLNFKANHPDWEPTDP 274
           KDGKM  S+  F  N+    P +P
Sbjct: 546 KDGKMLASYYGFLDNYGGNRPANP 569



>gi|303310985|ref|XP_003065504.1| Autophagy protein Apg9 containing protein [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240105166|gb|EER23359.1| Autophagy protein Apg9 containing protein [Coccidioides posadasii
           C735 delta SOWgp]
          Length = 931

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/287 (48%), Positives = 187/287 (65%), Gaps = 21/287 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R+  SY+ AN YI+QFPK KT           
Sbjct: 474 SKIGSRQYTPLAEWKFREFNELWHLFERRIHMSYESANMYINQFPKDKTVQLSRFVAFIA 533

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ IDP+LFLGFEIT  RTV FY G+   ++AV+RG++PDD  VFDPE  L
Sbjct: 534 GALLSVLALASVIDPELFLGFEITHDRTVLFYIGLFGTVYAVARGVVPDDAQVFDPEHAL 593

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             V  +THY P  W G+LH+D+VR+EF  L+++KVV++++EI S+IFTPF+LWFSL  CS
Sbjct: 594 LDVTAYTHYKPAHWHGKLHSDDVRKEFATLYQLKVVIFLEEILSMIFTPFVLWFSLPKCS 653

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPA-----------SEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+    P             ++  +Y+ 
Sbjct: 654 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNLMPPEPQHHRPRGLKHGLHDLRGDYFS 713

Query: 250 SKDGKMEKSFLNFKANH-PDWEPTDPFGSLYLSRLTEFNNQAHPERP 295
           +KDGKM  S+  F  ++ P   P+ P  S           Q +P++P
Sbjct: 714 AKDGKMLASYYGFLDHYAPPPRPSGPHAS---------QRQNYPQQP 751



>gi|317138115|ref|XP_001816681.2| autophagy-related protein 9 [Aspergillus oryzae RIB40]
          Length = 890

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 185/264 (70%), Gaps = 8/264 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P  I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 428 NPAQI-GSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKTVQVAGFVA 486

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG++P++  VFDPE
Sbjct: 487 FVSGALASVLALVSIIDPELFLGFEITHDRTVLFYLGVFGSVWAFARGLVPEETNVFDPE 546

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L +V++ THY P+ W+GRLH+DEVR+EF  L+++K+V++++EI S+IFTPFILWFSL 
Sbjct: 547 FALLEVIDFTHYFPNHWKGRLHSDEVRKEFAVLYQMKIVIFLEEILSMIFTPFILWFSLP 606

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLS 250
            CS ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  +   ++  +Y+ +
Sbjct: 607 KCSDRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGGTGRRESGRQDLRADYFST 666

Query: 251 KDGKMEKSFLNFKANHPDWEPTDP 274
           KDGKM  S+  F  N+    P +P
Sbjct: 667 KDGKMLASYYGFLDNYGGNRPANP 690



>gi|391869991|gb|EIT79179.1| integral membrane protein [Aspergillus oryzae 3.042]
          Length = 952

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 185/264 (70%), Gaps = 8/264 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P  I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 490 NPAQI-GSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKTVQVAGFVA 548

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG++P++  VFDPE
Sbjct: 549 FVSGALASVLALVSIIDPELFLGFEITHDRTVLFYLGVFGSVWAFARGLVPEETNVFDPE 608

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L +V++ THY P+ W+GRLH+DEVR+EF  L+++K+V++++EI S+IFTPFILWFSL 
Sbjct: 609 FALLEVIDFTHYFPNHWKGRLHSDEVRKEFAVLYQMKIVIFLEEILSMIFTPFILWFSLP 668

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLS 250
            CS ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  +   ++  +Y+ +
Sbjct: 669 KCSDRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGGTGRRESGRQDLRADYFST 728

Query: 251 KDGKMEKSFLNFKANHPDWEPTDP 274
           KDGKM  S+  F  N+    P +P
Sbjct: 729 KDGKMLASYYGFLDNYGGNRPANP 752



>gi|121923457|sp|Q2UUT6.1|ATG9_ASPOR RecName: Full=Autophagy-related protein 9
 gi|83764535|dbj|BAE54679.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 951

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 185/264 (70%), Gaps = 8/264 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P  I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 489 NPAQI-GSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKTVQVAGFVA 547

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG++P++  VFDPE
Sbjct: 548 FVSGALASVLALVSIIDPELFLGFEITHDRTVLFYLGVFGSVWAFARGLVPEETNVFDPE 607

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L +V++ THY P+ W+GRLH+DEVR+EF  L+++K+V++++EI S+IFTPFILWFSL 
Sbjct: 608 FALLEVIDFTHYFPNHWKGRLHSDEVRKEFAVLYQMKIVIFLEEILSMIFTPFILWFSLP 667

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLS 250
            CS ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  +   ++  +Y+ +
Sbjct: 668 KCSDRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGGTGRRESGRQDLRADYFST 727

Query: 251 KDGKMEKSFLNFKANHPDWEPTDP 274
           KDGKM  S+  F  N+    P +P
Sbjct: 728 KDGKMLASYYGFLDNYGGNRPANP 751



>gi|327354893|gb|EGE83750.1| autophagy protein Apg9 [Ajellomyces dermatitidis ATCC 18188]
          Length = 970

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 186/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YIDQFPK K            
Sbjct: 494 SQIGSRQYTPLAEWKFREFNELRHLFQRRINMSYPFATRYIDQFPKDKMVQIARFVGFIA 553

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEI+  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 554 GALASVLALASVVDPELFLGFEISHDRTVLFYLGVTGTVWAVARGLVPEETLVFDPEFAL 613

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 614 REVIDFTHYQPAHWQGKLHSDEVKAEFAMLYQMKVLIFLEELLSIIFIPFVLWFSLPKCS 673

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV              A   ++ N+Y+ 
Sbjct: 674 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNVIPQNQDTQQGGAQDAGQRDLRNDYFS 733

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P  +P  P+
Sbjct: 734 TKDGKMLASYYGFLDNYANNP--QPGAPY 760



>gi|261203801|ref|XP_002629114.1| autophagy protein Apg9 [Ajellomyces dermatitidis SLH14081]
 gi|239586899|gb|EEQ69542.1| autophagy protein Apg9 [Ajellomyces dermatitidis SLH14081]
          Length = 935

 Score =  278 bits (711), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 186/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YIDQFPK K            
Sbjct: 459 SQIGSRQYTPLAEWKFREFNELRHLFQRRINMSYPFATRYIDQFPKDKMVQIARFVGFIA 518

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEI+  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 519 GALASVLALASVVDPELFLGFEISHDRTVLFYLGVTGTVWAVARGLVPEETLVFDPEFAL 578

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 579 REVIDFTHYQPAHWQGKLHSDEVKAEFAMLYQMKVLIFLEELLSIIFIPFVLWFSLPKCS 638

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV              A   ++ N+Y+ 
Sbjct: 639 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNVIPQNQDTQQGGAQDAGQRDLRNDYFS 698

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P  +P  P+
Sbjct: 699 TKDGKMLASYYGFLDNYANNP--QPGAPY 725



>gi|239608870|gb|EEQ85857.1| autophagy protein Apg9 [Ajellomyces dermatitidis ER-3]
          Length = 935

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 186/269 (69%), Gaps = 16/269 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A +YIDQFPK K            
Sbjct: 459 SQIGSRQYTPLAEWKFREFNELRHLFQRRINMSYPFATRYIDQFPKDKMVQIARFVGFIA 518

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEI+  RTV FY GV   ++AV+RG++P++ LVFDPE  L
Sbjct: 519 GALASVLALASVVDPELFLGFEISHDRTVLFYLGVTGTVWAVARGLVPEETLVFDPEFAL 578

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V++ THY P  W+G+LH+DEV+ EF  L+++KV+++++E+ S+IF PF+LWFSL  CS
Sbjct: 579 REVIDFTHYQPAHWQGKLHSDEVKAEFAMLYQMKVLIFLEELLSIIFIPFVLWFSLPKCS 638

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------KYGAPASEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV              A   ++ N+Y+ 
Sbjct: 639 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNVIPQNQDTQQGGAQDAGQRDLRNDYFS 698

Query: 250 SKDGKMEKS---FLNFKANHPDWEPTDPF 275
           +KDGKM  S   FL+  AN+P  +P  P+
Sbjct: 699 TKDGKMLASYYGFLDNYANNP--QPGAPY 725



>gi|440638342|gb|ELR08261.1| hypothetical protein GMDG_03062 [Geomyces destructans 20631-21]
          Length = 841

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 177/251 (70%), Gaps = 5/251 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  GSRQ+T  A WKFREFNEL HLF  R++ SY  A++Y++QFPK  T           
Sbjct: 376 AALGSRQYTPLAEWKFREFNELPHLFDNRVNMSYPFASRYVEQFPKIMTVQIARFVAFVA 435

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G   ++L LA+ IDP+LFLGFEIT  RTV FY GV+  L+AV+ G +P D+ VFDPE  L
Sbjct: 436 GGIVSILALASIIDPELFLGFEITPDRTVLFYLGVMGTLWAVAHGAVPPDNQVFDPEYAL 495

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+++THY P +W+ RLHTDEV+REF +L+++K+V++++E+ S+IFTP +LWF+L  CS
Sbjct: 496 RNVIDYTHYMPKQWKDRLHTDEVKREFAELYQMKIVIFLEEVLSIIFTPLVLWFTLPKCS 555

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK---HGNVKYGA--PASEVENEYYLSKDGKM 255
            +IIDFFREFTVHVDG+G VCSFA+FDF+K      V  GA   A  + +EYY +K GKM
Sbjct: 556 DRIIDFFREFTVHVDGLGYVCSFAVFDFKKGVGGSAVPPGARNAAEGLRDEYYSTKHGKM 615

Query: 256 EKSFLNFKANH 266
             S+  F  N+
Sbjct: 616 AASYYGFLDNY 626



>gi|115389912|ref|XP_001212461.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114194857|gb|EAU36557.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 810

 Score =  276 bits (706), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 178/255 (69%), Gaps = 8/255 (3%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           P  I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT         
Sbjct: 372 PAQI-GSRQYTPLAEWKFREFNELWHLFERRINMSYPFASRYIDQFPKDKTVQVAGFVAF 430

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             G+  +VL LA+ IDP+LFLGFEIT  RTV FY GV   ++AV+RGM+P++  VFDPE 
Sbjct: 431 VSGAVVSVLALASIIDPELFLGFEITHDRTVLFYLGVFGSVWAVARGMVPEETTVFDPEY 490

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            L +V+  THY P  W+GRLH+D+VR +F  L+++K+V++++EI S+IFTPFILWFSL  
Sbjct: 491 ALLEVINFTHYCPSHWKGRLHSDDVRTDFAMLYQMKIVIFLEEILSMIFTPFILWFSLPK 550

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLSK 251
           CS ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +      +   +Y+ +K
Sbjct: 551 CSDRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGDAGRRDPARQDPRADYFSTK 610

Query: 252 DGKMEKSFLNFKANH 266
           DGKM  S+  F  N+
Sbjct: 611 DGKMLASYYGFLDNY 625



>gi|384496195|gb|EIE86686.1| hypothetical protein RO3G_11397 [Rhizopus delemar RA 99-880]
          Length = 287

 Score =  276 bits (706), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 133/222 (59%), Positives = 163/222 (73%), Gaps = 3/222 (1%)

Query: 82  SFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLK 141
           SF  VL L +  D +  L FEIT   TV FY G+   +FAV+RGMIPD+H VF+PE  LK
Sbjct: 3   SFAGVLALFSLFDSEALLSFEITPSNTVLFYLGITGTIFAVTRGMIPDEHQVFEPETLLK 62

Query: 142 KVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQ 201
           +V+EHTHY P EW+ RLHTD+VR EF  LF+ KV L+ QE+ SV+F P +L FSL   + 
Sbjct: 63  QVIEHTHYLPTEWKYRLHTDQVRAEFCLLFDYKVGLFFQELLSVLFAPLVLCFSLPKSAD 122

Query: 202 QIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLN 261
           QIIDFFREFTVHV+G+G VCSFA FDF +HGNVKYG   + V++EYYLSK+GKMEKSFLN
Sbjct: 123 QIIDFFREFTVHVNGLGYVCSFAQFDFERHGNVKYGVQGATVDDEYYLSKEGKMEKSFLN 182

Query: 262 FKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVV 303
           FKAN+P+WEP D  GSLYLSRL  F N+   +R + A  S +
Sbjct: 183 FKANNPNWEPNDLAGSLYLSRLERFKNE---KRKDLAEPSTI 221



>gi|258568068|ref|XP_002584778.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237906224|gb|EEP80625.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 879

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 177/260 (68%), Gaps = 18/260 (6%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY+ AN Y+DQFPK KT           
Sbjct: 477 SKIGSRQYTPLAEWKFREFNELWHLFERRINLSYESANLYVDQFPKDKTVQLSRFVAFIA 536

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ IDP+LFLGFEIT  RT  FY GV   ++AV+RG++PD+  VFDPE  L
Sbjct: 537 GALLSVLALASVIDPELFLGFEITHDRTALFYIGVFGTVYAVARGVVPDETQVFDPEHAL 596

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             V  +THY P  W+G+LH+D+VR+EF  L+++KVV++++EI S+IFTPF+LWFSL  CS
Sbjct: 597 LNVTSYTHYKPAHWQGKLHSDDVRKEFATLYQLKVVIFLEEILSMIFTPFVLWFSLPKCS 656

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK------------------YGAPASE 242
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+                   +   A +
Sbjct: 657 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNLMPPETHHHQHHLGHQRPRGFKPGAHD 716

Query: 243 VENEYYLSKDGKMEKSFLNF 262
           + ++Y+ +KDGKM  S+  F
Sbjct: 717 LRDDYFSAKDGKMLASYYGF 736



>gi|320031457|gb|EFW13420.1| autophagy protein Apg9 [Coccidioides posadasii str. Silveira]
          Length = 893

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/250 (52%), Positives = 173/250 (69%), Gaps = 11/250 (4%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R+  SY+ AN YI+QFPK KT           
Sbjct: 474 SKIGSRQYTPLAEWKFREFNELWHLFERRIHMSYESANMYINQFPKDKTVQLSRFVAFIA 533

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ IDP+LFLGFEIT  RTV FY G+   ++AV+RG++PDD  VFDPE  L
Sbjct: 534 GALLSVLALASVIDPELFLGFEITHDRTVLFYIGLFGTVYAVARGVVPDDAQVFDPEHAL 593

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             V  +THY P  W G+LH+D+VR+EF  L+++KVV++++EI S+IFTPF+LWFSL  CS
Sbjct: 594 LDVTAYTHYKPAHWHGKLHSDDVRKEFATLYQLKVVIFLEEILSMIFTPFVLWFSLPKCS 653

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPA-----------SEVENEYYL 249
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+    P             ++  +Y+ 
Sbjct: 654 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGTNLMPPEPQHHRPRGLKHGLHDLRGDYFS 713

Query: 250 SKDGKMEKSF 259
           +KDGKM  S+
Sbjct: 714 AKDGKMLASY 723



>gi|425776206|gb|EKV14434.1| Autophagy protein Apg9, putative [Penicillium digitatum Pd1]
          Length = 947

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 181/256 (70%), Gaps = 8/256 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 487 NPGQI-GSRQYTPMAEWKFREFNELWHLFERRINMSYPFASRYVDQFPKDKTVQVARFVS 545

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG+ P++  VFDPE
Sbjct: 546 FISGALASVLALVSVIDPELFLGFEITPDRTVLFYLGVFGTVWAFARGLAPEETDVFDPE 605

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L ++++ THY P  W+GRLH+D+VR+EF  L+++K+V++++EI S+IFTPF+LWFSL 
Sbjct: 606 YALLELIDFTHYFPSGWKGRLHSDDVRKEFAVLYQMKIVIFLEEILSMIFTPFVLWFSLP 665

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-KYGAPA------SEVENEYYLS 250
            CS ++IDFFREFTVHVDGVG +CSFA+FDF+K  NV     PA       ++  +Y+ +
Sbjct: 666 KCSDRLIDFFREFTVHVDGVGYLCSFAVFDFKKGTNVLSQAGPARREPGKQDLRTDYFST 725

Query: 251 KDGKMEKSFLNFKANH 266
           KDGKM  S+  F  N+
Sbjct: 726 KDGKMLASYYGFLDNY 741



>gi|425768944|gb|EKV07455.1| Autophagy protein Apg9, putative [Penicillium digitatum PHI26]
          Length = 947

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 181/256 (70%), Gaps = 8/256 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT        
Sbjct: 487 NPGQI-GSRQYTPMAEWKFREFNELWHLFERRINMSYPFASRYVDQFPKDKTVQVARFVA 545

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL L + IDP+LFLGFEIT  RTV FY GV   ++A +RG+ P++  VFDPE
Sbjct: 546 FISGALASVLALVSVIDPELFLGFEITPDRTVLFYLGVFGTVWAFARGLAPEETDVFDPE 605

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L ++++ THY P  W+GRLH+D+VR+EF  L+++K+V++++EI S+IFTPF+LWFSL 
Sbjct: 606 YALLELIDFTHYFPSGWKGRLHSDDVRKEFAVLYQMKIVIFLEEILSMIFTPFVLWFSLP 665

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-KYGAPA------SEVENEYYLS 250
            CS ++IDFFREFTVHVDGVG +CSFA+FDF+K  NV     PA       ++  +Y+ +
Sbjct: 666 KCSDRLIDFFREFTVHVDGVGYLCSFAVFDFKKGTNVLSQAGPARREPGKQDLRTDYFST 725

Query: 251 KDGKMEKSFLNFKANH 266
           KDGKM  S+  F  N+
Sbjct: 726 KDGKMLASYYGFLDNY 741



>gi|255947352|ref|XP_002564443.1| Pc22g04040 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|166990642|sp|A7KAM0.1|ATG9_PENCW RecName: Full=Autophagy-related protein 9
 gi|129561983|gb|ABO31080.1| Atg9p [Penicillium chrysogenum]
 gi|211591460|emb|CAP97692.1| Pc22g04040 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 948

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 182/256 (71%), Gaps = 8/256 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG I GSRQ+T  A WKFREFNEL HLF +R++ SY  A++YIDQFPK KT        
Sbjct: 488 NPGQI-GSRQYTPMAEWKFREFNELWHLFERRINMSYPFASRYIDQFPKDKTVQVARFVA 546

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL LA+ IDP+LFLGFEIT  RTV FY G+   ++A +RG+ P++  VFDPE
Sbjct: 547 FISGALASVLALASVIDPELFLGFEITHDRTVLFYLGIFGTVWAFARGLAPEETDVFDPE 606

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L ++++ THY P  W+GRLH+D+VR+EF  L+++K+V++++EI S+IFTPF+LWFSL 
Sbjct: 607 YALLELIDFTHYFPSGWKGRLHSDDVRKEFAILYQMKIVIFLEEILSMIFTPFVLWFSLP 666

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGA------PASE-VENEYYLS 250
            CS ++IDFFREFTVHVDGVG +CSFA+FDF+K  NV   A      P  + +  +Y+ +
Sbjct: 667 KCSDRLIDFFREFTVHVDGVGYLCSFAVFDFKKGTNVLSQAGPGRRDPGKQDLRTDYFST 726

Query: 251 KDGKMEKSFLNFKANH 266
           KDGKM  S+  F  N+
Sbjct: 727 KDGKMLASYYGFLDNY 742



>gi|212534688|ref|XP_002147500.1| autophagy protein Apg9, putative [Talaromyces marneffei ATCC 18224]
 gi|210069899|gb|EEA23989.1| autophagy protein Apg9, putative [Talaromyces marneffei ATCC 18224]
          Length = 954

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 175/249 (70%), Gaps = 7/249 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK KT           
Sbjct: 490 SQIGSRQYTPLAEWKFREFNELWHLFQRRINMSYPFASRYVDQFPKDKTVQISSFVAFIA 549

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY G+   ++A++RG++P++  VFDPE  L
Sbjct: 550 GALASVLALASLLDPELFLGFEITHDRTVLFYLGLFGSVWAIARGLVPEETDVFDPEFAL 609

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V   THY P+ W  RLH+DEVR+EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 610 LEVTNFTHYRPNHWAARLHSDEVRQEFAMLYQMKIVIFLEEILSMIFTPFVLWFSLPKCS 669

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS-------EVENEYYLSKDG 253
            ++IDFFREFTVHVDG+G VCSFA+FDF+K         AS       ++ ++Y+ +KDG
Sbjct: 670 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKDAQTNPQGRASHQTGLAGDLRDDYFSTKDG 729

Query: 254 KMEKSFLNF 262
           KM  S+  F
Sbjct: 730 KMLASYYGF 738



>gi|340931840|gb|EGS19373.1| putative mitochondrial carrier protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 1311

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 172/247 (69%), Gaps = 1/247 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S+  SR +T  A WKFREFNEL HLF +RL+ S+  A  YIDQFPKAKT           
Sbjct: 448 SVLSSRTYTPLAEWKFREFNELPHLFRERLNMSHPYAIHYIDQFPKAKTEMVARTVAFVS 507

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+   VL + + IDPDLFLGFEIT  RTV FYT V   ++A +RGMI +DHLVF+PE  +
Sbjct: 508 GALATVLAICSVIDPDLFLGFEITHDRTVLFYTAVFGSVWAFARGMISEDHLVFNPELAM 567

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+++THY+PD W GRLH+ +++ EF +L+++KV+++I+EI S++ TPF+L  SL  CS
Sbjct: 568 RNVIQYTHYNPDHWEGRLHSADIKAEFSELYKMKVIIFIEEILSILTTPFVLLSSLPKCS 627

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVENEYYLSKDGKMEKSF 259
            QIIDFFREFT+HVDG+G VCSFA FDF+   G  K      +V ++YY +K GKME S+
Sbjct: 628 DQIIDFFREFTIHVDGLGYVCSFAEFDFKNGFGKKKAKEGTGDVRDDYYSTKHGKMEASY 687

Query: 260 LNFKANH 266
             F  N+
Sbjct: 688 YGFLGNY 694



>gi|67526553|ref|XP_661338.1| hypothetical protein AN3734.2 [Aspergillus nidulans FGSC A4]
 gi|73619457|sp|Q5B6U6.1|ATG9_EMENI RecName: Full=Autophagy-related protein 9
 gi|40740752|gb|EAA59942.1| hypothetical protein AN3734.2 [Aspergillus nidulans FGSC A4]
          Length = 820

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 191/302 (63%), Gaps = 17/302 (5%)

Query: 23  FGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGS 82
             SRQ+T  A WKFREFNEL HLF +R++ SY  A +Y+DQFPK KT           G+
Sbjct: 362 LSSRQYTPLAEWKFREFNELWHLFEKRINLSYPYATRYVDQFPKDKTVQVAGFVAFISGA 421

Query: 83  FTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKK 142
             +VL LA+ +DP+LFLGFE+T  RT  FY GV   ++A +RGM+P++ LVFDPE  L +
Sbjct: 422 LASVLALASILDPELFLGFELTHDRTTLFYLGVFGSVWAFARGMVPEETLVFDPEYALLE 481

Query: 143 VVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQ 202
           V++ THY P  W+G+LH+D+VRREF  L+++K++++++EI S+IFTPFILWFSL  CS++
Sbjct: 482 VIQFTHYFPSHWKGKLHSDDVRREFAVLYQMKIIIFMEEILSMIFTPFILWFSLPKCSER 541

Query: 203 IIDFFREFTVHVDGVGDVCSFAIFDFRK------HGNVKYGAPASEVENEYYLSKDGKME 256
           +IDFFREFTVHVDG+G +CSFA+FDF+K       G++       +   +Y+ +KDGKM 
Sbjct: 542 VIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVIPQGHINQRDARQDPRVDYFSTKDGKML 601

Query: 257 KSFLNF-----------KANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVVDS 305
            S+  F            AN   + P   F SL        +N  + + P  AR +   +
Sbjct: 602 ASYYGFLDNYGGNPRATNANKRAFHPPPTFPSLGSPPFVGASNIGNRQDPIQARVNTASA 661

Query: 306 IL 307
            L
Sbjct: 662 AL 663



>gi|315054001|ref|XP_003176375.1| Atg9p [Arthroderma gypseum CBS 118893]
 gi|311338221|gb|EFQ97423.1| Atg9p [Arthroderma gypseum CBS 118893]
          Length = 950

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 177/259 (68%), Gaps = 17/259 (6%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 478 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 537

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 538 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 597

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 598 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSMIFTPFVLWFSLPKCS 657

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-----------------KYGAPASEV 243
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+                   GA  +  
Sbjct: 658 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNIIPQGRDATGATIPATGAGPGALPAPG 717

Query: 244 ENEYYLSKDGKMEKSFLNF 262
            N+YY ++DGKM  S+  F
Sbjct: 718 RNDYYSTQDGKMLASYYGF 736



>gi|358371381|dbj|GAA87989.1| autophagy protein Apg9 [Aspergillus kawachii IFO 4308]
          Length = 941

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 179/253 (70%), Gaps = 7/253 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK K            
Sbjct: 491 SQIGSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKMVQFAGFVAFVS 550

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV++G++P++  VFDPE  L
Sbjct: 551 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGSIWAVAQGLVPEETNVFDPEYAL 610

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+  THY P  W+GRLH+D+VR++F  L+++K+V++++EI S+IFTPFILWFSL  CS
Sbjct: 611 LEVINFTHYFPSHWKGRLHSDDVRKDFAVLYQMKIVIFLEEILSMIFTPFILWFSLPKCS 670

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLSKDG 253
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  A   ++  +Y+ +KDG
Sbjct: 671 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGDTGRRDAARQDLRADYFSTKDG 730

Query: 254 KMEKSFLNFKANH 266
           KM  S+  F  N+
Sbjct: 731 KMLASYYGFLDNY 743



>gi|166990640|sp|A2QLJ9.1|ATG9_ASPNC RecName: Full=Autophagy-related protein 9
 gi|134075433|emb|CAK47994.1| unnamed protein product [Aspergillus niger]
 gi|350630179|gb|EHA18552.1| hypothetical protein ASPNIDRAFT_47279 [Aspergillus niger ATCC 1015]
          Length = 941

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 179/253 (70%), Gaps = 7/253 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK K            
Sbjct: 491 SQIGSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKMVQFAGFVAFVS 550

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV++G++P++  VFDPE  L
Sbjct: 551 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGSIWAVAQGLVPEETNVFDPEYAL 610

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+  THY P  W+GRLH+D+VR++F  L+++K+V++++EI S+IFTPFILWFSL  CS
Sbjct: 611 LEVINFTHYFPGHWKGRLHSDDVRKDFAVLYQMKIVIFLEEILSMIFTPFILWFSLPKCS 670

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLSKDG 253
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  A   ++  +Y+ +KDG
Sbjct: 671 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGDTGRRDAARQDLRADYFSTKDG 730

Query: 254 KMEKSFLNFKANH 266
           KM  S+  F  N+
Sbjct: 731 KMLASYYGFLDNY 743



>gi|317029027|ref|XP_001390972.2| autophagy-related protein 9 [Aspergillus niger CBS 513.88]
          Length = 880

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 179/253 (70%), Gaps = 7/253 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R++ SY  A++Y+DQFPK K            
Sbjct: 430 SQIGSRQYTPLAEWKFREFNELWHLFERRVNMSYPFASRYVDQFPKDKMVQFAGFVAFVS 489

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL LA+ +DP+LFLGFEIT  RTV FY GV   ++AV++G++P++  VFDPE  L
Sbjct: 490 GALASVLALASVVDPELFLGFEITHDRTVLFYLGVFGSIWAVAQGLVPEETNVFDPEYAL 549

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            +V+  THY P  W+GRLH+D+VR++F  L+++K+V++++EI S+IFTPFILWFSL  CS
Sbjct: 550 LEVINFTHYFPGHWKGRLHSDDVRKDFAVLYQMKIVIFLEEILSMIFTPFILWFSLPKCS 609

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-------KYGAPASEVENEYYLSKDG 253
            ++IDFFREFTVHVDG+G +CSFA+FDF+K  NV       +  A   ++  +Y+ +KDG
Sbjct: 610 DRLIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVISQGDTGRRDAARQDLRADYFSTKDG 669

Query: 254 KMEKSFLNFKANH 266
           KM  S+  F  N+
Sbjct: 670 KMLASYYGFLDNY 682



>gi|326469504|gb|EGD93513.1| hypothetical protein TESG_01058 [Trichophyton tonsurans CBS 112818]
          Length = 920

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 178/264 (67%), Gaps = 22/264 (8%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 443 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 502

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 503 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 562

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 563 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSMIFTPFVLWFSLPKCS 622

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV---------------------KYGAP 239
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV                       G  
Sbjct: 623 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNVIPQGRDASGATIPATGGAAGPSSGRG 682

Query: 240 ASEV-ENEYYLSKDGKMEKSFLNF 262
           A+ V  N+YY ++DGKM  S+  F
Sbjct: 683 AAPVGRNDYYSTQDGKMLASYYGF 706



>gi|326484386|gb|EGE08396.1| Atg9p [Trichophyton equinum CBS 127.97]
          Length = 970

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 178/264 (67%), Gaps = 22/264 (8%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 493 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 552

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 553 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 612

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 613 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSMIFTPFVLWFSLPKCS 672

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV---------------------KYGAP 239
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV                       G  
Sbjct: 673 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNVIPQGRDASGATIPATGGAAGPSSGRG 732

Query: 240 ASEV-ENEYYLSKDGKMEKSFLNF 262
           A+ V  N+YY ++DGKM  S+  F
Sbjct: 733 AAPVGRNDYYSTQDGKMLASYYGF 756



>gi|327308786|ref|XP_003239084.1| hypothetical protein TERG_01068 [Trichophyton rubrum CBS 118892]
 gi|326459340|gb|EGD84793.1| hypothetical protein TERG_01068 [Trichophyton rubrum CBS 118892]
          Length = 970

 Score =  271 bits (692), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 177/262 (67%), Gaps = 20/262 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 499 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 558

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 559 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 618

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 619 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSMIFTPFVLWFSLPKCS 678

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV-KYGAPASEV---------------- 243
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  NV   G  AS                  
Sbjct: 679 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNVIPQGRDASGATMPVTGAAGPSSGGGA 738

Query: 244 ---ENEYYLSKDGKMEKSFLNF 262
               N+YY ++DGKM  S+  F
Sbjct: 739 PVGRNDYYSTQDGKMLASYYGF 760



>gi|302504343|ref|XP_003014130.1| hypothetical protein ARB_07435 [Arthroderma benhamiae CBS 112371]
 gi|291177698|gb|EFE33490.1| hypothetical protein ARB_07435 [Arthroderma benhamiae CBS 112371]
          Length = 945

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 178/262 (67%), Gaps = 20/262 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 472 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 531

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 532 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 591

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S IFTPF+LWFSL  CS
Sbjct: 592 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSTIFTPFVLWFSLPKCS 651

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV------KYGA--PASEV--------- 243
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+        GA  PA+           
Sbjct: 652 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNIIPQGRDASGATIPATGAAGPSSGGGA 711

Query: 244 ---ENEYYLSKDGKMEKSFLNF 262
               N+YY ++DGKM  S+  F
Sbjct: 712 PVGRNDYYSTQDGKMLASYYGF 733



>gi|302655817|ref|XP_003019692.1| hypothetical protein TRV_06282 [Trichophyton verrucosum HKI 0517]
 gi|291183430|gb|EFE39047.1| hypothetical protein TRV_06282 [Trichophyton verrucosum HKI 0517]
          Length = 946

 Score =  270 bits (689), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 177/262 (67%), Gaps = 20/262 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  GSRQ+T  A WKFREFNEL HLF +R + S   A++YI QFPK KT           
Sbjct: 472 SQIGSRQYTPLAEWKFREFNELWHLFERRTNMSRLAADEYIAQFPKDKTVQFARFVAFIA 531

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
            +  +VL LAT IDP+LFLGFEIT  RT  FY G+   ++AV++G+IP ++LVFDPE  +
Sbjct: 532 SALASVLALATIIDPELFLGFEITHDRTALFYLGIFGSVWAVAQGVIPAENLVFDPELAI 591

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P  W+GRLH+DE+++EF  L+++K+V++++EI S+IFTPF+LWFSL  CS
Sbjct: 592 RRVIEYTHYQPSHWQGRLHSDEIKKEFSLLYQMKLVIFLEEILSMIFTPFVLWFSLPKCS 651

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV--------KYGAPASEV--------- 243
            ++IDFFREFTVHVDG+G VCSFA+FDF+K  N+            PA+           
Sbjct: 652 DRLIDFFREFTVHVDGLGYVCSFAVFDFKKGNNIIPQGRDASGSTIPATGAAGPSSGGGA 711

Query: 244 ---ENEYYLSKDGKMEKSFLNF 262
               N+YY ++DGKM  S+  F
Sbjct: 712 PVGRNDYYSTQDGKMLASYYGF 733



>gi|401885186|gb|EJT49309.1| hypothetical protein A1Q1_01511 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 928

 Score =  270 bits (689), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 182/278 (65%), Gaps = 18/278 (6%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  G RQ+T FAR+KFREFNEL HL ++RLD+ Y+ A +YIDQFPK +T           
Sbjct: 557 ATLGGRQYTLFARYKFREFNELPHLLNRRLDEGYEVAKEYIDQFPKQRTALVMKFVAFVA 616

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GSF AVLI A  + P+L   FE++  RT+ +Y GV   + AV+RGMIP D+  FDP   +
Sbjct: 617 GSFAAVLIAAGMVHPELLSNFELSPHRTLLWYLGVFGVILAVARGMIPPDNHAFDPARHM 676

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+ +THY PD WRG+LH+  V  +F  LF++K++++ QE+  V+ TPFIL FSL  C+
Sbjct: 677 QEVIHYTHYCPDSWRGQLHSQVVLAQFGVLFQLKLMVFAQELLGVLLTPFILLFSLPQCA 736

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAP-------ASEVENEYYLSK-- 251
           + +IDFFRE ++HV+ +G VCSFA+FDF++ GNV  GAP       A  V  E  LS+  
Sbjct: 737 EALIDFFRENSIHVEDLGYVCSFAVFDFKRDGNV--GAPSAGHAGQAEHVPPERPLSRNR 794

Query: 252 -------DGKMEKSFLNFKANHPDWEPTDPFGSLYLSR 282
                  D KME+S L+FK  HPDW+P DP  SL+L R
Sbjct: 795 KGRRTFTDAKMEQSVLHFKHAHPDWQPMDPGASLFLDR 832



>gi|402225211|gb|EJU05272.1| APG9-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 574

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 160/217 (73%), Gaps = 1/217 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI G RQ+T  A+WKFREFNEL HLF +R+ +SY  A +YI QFP +K         
Sbjct: 343 NPSSI-GGRQYTPLAQWKFREFNELPHLFTRRMHQSYPFATEYISQFPSSKVAAIMRFVS 401

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F AVL+LAT I+PD+FLGFEIT  RTV FY G+   + AVSRGM+PD+  VFDPE
Sbjct: 402 FVAGAFAAVLLLATVINPDVFLGFEITPHRTVLFYLGLFGSVLAVSRGMVPDERTVFDPE 461

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             ++ VVE THY P EW+ +LH+  +  EF +L+E+K+ +++QE+ SVI TPFILWFSL 
Sbjct: 462 LLMRDVVEFTHYMPAEWQDQLHSKTIHTEFGKLYEMKITIFVQELVSVILTPFILWFSLP 521

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV 234
            C+  IIDFFREFTVHVDG+G VCSFA+FDF++HGNV
Sbjct: 522 ACAPAIIDFFREFTVHVDGLGYVCSFAVFDFKRHGNV 558



>gi|390597644|gb|EIN07043.1| APG9-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 527

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 158/219 (72%), Gaps = 1/219 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
            +P SI GSR++T FA WKFREFNEL H F  RLD+SY  AN YI QFP  K        
Sbjct: 296 KNPSSI-GSRRYTPFAEWKFREFNELPHFFKTRLDESYPTANVYIAQFPNEKMTIVMRFV 354

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL+LA+ +DPDLFL FE+T  RTV FY GV   + A +RGMIP++H VFD 
Sbjct: 355 AFIAGSFAAVLLLASVLDPDLFLHFEVTPHRTVLFYLGVFGSVLAAARGMIPEEHRVFDT 414

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + +V+ HTHY PD W+ +LH+ +V  EF +LF +KV+ Y+ E+ SVI TPFILWFSL
Sbjct: 415 EMLMTEVIHHTHYMPDHWKDQLHSKKVHTEFGELFGMKVMTYVHELISVIVTPFILWFSL 474

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK 235
            DC+  IIDFFREFTVHVDG+G VCSFA+FDF++HGNVK
Sbjct: 475 PDCAPAIIDFFREFTVHVDGLGYVCSFAVFDFQRHGNVK 513



>gi|328852810|gb|EGG01953.1| hypothetical protein MELLADRAFT_49970 [Melampsora larici-populina
           98AG31]
          Length = 835

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 187/295 (63%), Gaps = 30/295 (10%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +T+ A+WKFRE+NEL HLF  RL KSY  + +Y+DQFPK KT        
Sbjct: 441 NPSSI-GSRNFTKLAQWKFREYNELPHLFQSRLFKSYSISKQYVDQFPKTKTSILAKFVS 499

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDH--LVFD 135
              GSF AVLIL +  DPD FL F+IT  R+V FY G+   + A+SRGMIP ++   +  
Sbjct: 500 FVAGSFAAVLILLSIFDPDAFLHFQITKDRSVLFYIGLFGSILAISRGMIPKEYEESIET 559

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
           PE  ++ +V+HTHY P  W G+LH+ ++  EF +LF++KVV +++E+ SV+ TPFILW+ 
Sbjct: 560 PEVLMQHIVQHTHYLPPHWYGKLHSLDIYTEFCELFQLKVVNFLRELMSVLLTPFILWYG 619

Query: 196 LAD--CSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK------------------ 235
            +D  C ++I+DFFREFT+HVDG+G VCSFA+FDF K GNV                   
Sbjct: 620 FSDQRC-ERIVDFFREFTIHVDGIGHVCSFAVFDFSKLGNVNSPGYLQPNPNNTPHPPRQ 678

Query: 236 ---YGAPASEVENEYYLSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFN 287
                 P    +N+   S   KME+S L+F A+HP+WEP++   SLYLS+   F+
Sbjct: 679 QVPTSRPTPHPQNQ---SDVNKMERSLLSFVAHHPNWEPSNQTASLYLSKAIGFS 730



>gi|189091792|ref|XP_001929729.1| hypothetical protein [Podospora anserina S mat+]
 gi|73619465|sp|Q875A7.1|ATG9_PODAS RecName: Full=Autophagy-related protein 9
 gi|27803006|emb|CAD60709.1| unnamed protein product [Podospora anserina]
 gi|188219249|emb|CAP49229.1| unnamed protein product [Podospora anserina S mat+]
          Length = 900

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 178/273 (65%), Gaps = 2/273 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S+  SR +T  A WKFREFNEL HLF +RLD S   A  Y+DQFPK KT           
Sbjct: 465 SVLSSRSYTPLAEWKFREFNELPHLFQKRLDMSKAFATHYMDQFPKVKTEMVAKSVAFVS 524

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+   VL +A+  DP+LFLGFEIT  RTV FYT +   ++AV+ GM   D +VFDPE  +
Sbjct: 525 GALATVLAIASVFDPELFLGFEITPDRTVLFYTAIFGSIWAVAHGMQSQDDVVFDPEYAM 584

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+E+THY PD W+ RLH+ +++ EF +L++ K+V++++EI  ++ TPF+L+FSL  CS
Sbjct: 585 RNVIEYTHYEPDHWKDRLHSYDIKLEFAELYKPKIVIFLEEILGILTTPFVLFFSLPKCS 644

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVENEYYLSKDGKMEKSF 259
            QIIDFFREFT+H+DG+G VC+FA FDF+K   N K  +   +V +EYY +K GKME S+
Sbjct: 645 DQIIDFFREFTLHIDGLGYVCTFAEFDFKKAMANAKKPSDGGDVRDEYYSAKHGKMEASY 704

Query: 260 LNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHP 292
             F  N+ ++   +P G+          NQ HP
Sbjct: 705 YGFIGNYGNFA-LNPKGAPGSHLPPGMRNQFHP 736



>gi|346326962|gb|EGX96558.1| Autophagy-related protein 9 [Cordyceps militaris CM01]
          Length = 887

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 174/250 (69%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  +  +R++T  A WKFREFNEL H+F++RL  S+  A +Y+DQFPK  T        
Sbjct: 464 DP-KLAAARKYTALAEWKFREFNELPHIFYERLHMSFPFATRYVDQFPKRMTEDIARSVA 522

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ TAVL + T +D +LFLGFEIT  RTV FY G+   ++A++RGM+ ++  VF+PE
Sbjct: 523 FMSGAITAVLAVCTILDSELFLGFEITKDRTVLFYLGIFGAIWAMTRGMVSEETAVFNPE 582

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+THY PD W GRLH+ EV++EF +L+++KVV++++E+  +I TP +L F+L 
Sbjct: 583 YALRNVIEYTHYMPDHWEGRLHSFEVKKEFAELYKMKVVIFLEEVMGIITTPMLLLFALP 642

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKME 256
            CS QI+DFFREFT+HVDG+G VCSFA+FDF+K  GN     PA +V  +YY +K GKM 
Sbjct: 643 KCSDQIVDFFREFTIHVDGLGYVCSFAVFDFKKGVGNDGKRGPAPDVREDYYTTKHGKMA 702

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 703 ASYYGFLDNY 712



>gi|302915355|ref|XP_003051488.1| hypothetical protein NECHADRAFT_37808 [Nectria haematococca mpVI
           77-13-4]
 gi|256732427|gb|EEU45775.1| hypothetical protein NECHADRAFT_37808 [Nectria haematococca mpVI
           77-13-4]
          Length = 899

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R++T  A WKFREFNEL H+F++RL  SY  A +YIDQFPK  T           G+ 
Sbjct: 472 AARKYTSLAEWKFREFNELPHIFYERLHMSYPFATRYIDQFPKRMTEDIARSIAFMSGAI 531

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
           TA+L L + +D +LFL FEIT  R V FY GV   ++A++RGM+ ++ LVF+PE  L+ V
Sbjct: 532 TAILALGSILDSELFLNFEITKDRPVLFYLGVFAAVWAITRGMVSEETLVFNPEYALRNV 591

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +E+THY PD W+GRLH+ EV++EF +L+++KVV++++E+  +I TP +L FSL  CS QI
Sbjct: 592 IEYTHYMPDHWQGRLHSFEVKQEFSELYKMKVVIFLEEVMGIITTPMLLLFSLPKCSDQI 651

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVENEYYLSKDGKMEKSFLNF 262
           +DFFREFT+HVDG+G VCSFA+FDF+K  GN    A   +V  +YY +K GKM  S+  F
Sbjct: 652 VDFFREFTIHVDGLGYVCSFAVFDFQKGPGNTGQQAAHQDVREDYYSTKHGKMAASYYGF 711

Query: 263 KANH 266
             N+
Sbjct: 712 IDNY 715



>gi|328773200|gb|EGF83237.1| hypothetical protein BATDEDRAFT_18386 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 690

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 175/268 (65%), Gaps = 6/268 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   +RQ++ FA WKFREFNEL HL   RL +S + AN YI QFP               
Sbjct: 308 SALSARQYSPFAMWKFREFNELPHLLRTRLFRSTESANTYIRQFPHYPLVIVVKFISFVS 367

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS  A+L+  T  + ++  GFEI+ GR+ FFY G+   + A+SR ++P +  V+DPE  +
Sbjct: 368 GSLGAILLALTLFEEEMQQGFEISPGRSAFFYIGLCGTIMAISRSIVPPETEVYDPEQWM 427

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V   THY PD WR   HT +VR EF +L++ K+VL+I E+ SV+  PF+L++SL  C+
Sbjct: 428 REVAAETHYLPDTWRSHAHTSQVRSEFCELYDYKLVLWIFELLSVLVAPFVLYYSLPGCA 487

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPA--SEVENEY---YLSKDGKM 255
            +I+DFFR FT+  D +G VCSFA+FDF++HG+V++GAPA  ++V   Y    +S  GKM
Sbjct: 488 GEIVDFFRAFTIKSDRLGYVCSFAVFDFKRHGDVRFGAPALGNQVPEAYDGRLVSNQGKM 547

Query: 256 EKSFLNFKANHPDWEPTDPFGSLYLSRL 283
           E SFLNFKANHP WEP D  G  YLSRL
Sbjct: 548 EMSFLNFKANHPHWEP-DVDGEEYLSRL 574



>gi|472241215|gb|EMR85945.1| putative autophagy-related protein 9 protein [Botryotinia
           fuckeliana BcDW1]
          Length = 926

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 172/248 (69%), Gaps = 2/248 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  GSR +T  A WKFREFNEL HLF++RL+ S   A++Y++QFP  KT           
Sbjct: 488 AALGSRGYTPLAEWKFREFNELHHLFNRRLNMSDPFASRYLNQFPNIKTAHMARFITFVA 547

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VLI+AT  D ++  GF+IT+ R V FY GV   ++A++ GMIP ++ VFDPE  L
Sbjct: 548 GAVVSVLIVATVWDSEVLAGFDITSERPVLFYLGVFGSIWAITNGMIPKENEVFDPEYAL 607

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+E+THY P  W+ RLH+DEV++EF  L+++K+V++ +E+ S+I TPF+LWFSL  C+
Sbjct: 608 RSVIEYTHYMPSHWQDRLHSDEVKQEFSTLYQLKLVIFFEEVLSIIITPFLLWFSLPKCA 667

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK--HGNVKYGAPASEVENEYYLSKDGKMEKS 258
           +QIIDFFREFTVHVDGVG VCSFA+FDF+K        G   ++V  +YY +K GKM  S
Sbjct: 668 EQIIDFFREFTVHVDGVGYVCSFAVFDFKKGVGSAPSRGVVKTDVREDYYSTKHGKMAAS 727

Query: 259 FLNFKANH 266
           + NF  N+
Sbjct: 728 YYNFLDNY 735



>gi|347836088|emb|CCD50660.1| similar to autophagy-related protein 9 [Botryotinia fuckeliana T4]
          Length = 936

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 172/248 (69%), Gaps = 2/248 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  GSR +T  A WKFREFNEL HLF++RL+ S   A++Y++QFP  KT           
Sbjct: 498 AALGSRGYTPLAEWKFREFNELHHLFNRRLNMSDPFASRYLNQFPNIKTAHMARFITFVA 557

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VLI+AT  D ++  GF+IT+ R V FY GV   ++A++ GMIP ++ VFDPE  L
Sbjct: 558 GAVVSVLIVATVWDSEVLAGFDITSERPVLFYLGVFGSIWAITNGMIPKENEVFDPEYAL 617

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+E+THY P  W+ RLH+DEV++EF  L+++K+V++ +E+ S+I TPF+LWFSL  C+
Sbjct: 618 RSVIEYTHYMPSHWQDRLHSDEVKQEFSTLYQLKLVIFFEEVLSIIITPFLLWFSLPKCA 677

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRK--HGNVKYGAPASEVENEYYLSKDGKMEKS 258
           +QIIDFFREFTVHVDGVG VCSFA+FDF+K        G   ++V  +YY +K GKM  S
Sbjct: 678 EQIIDFFREFTVHVDGVGYVCSFAVFDFKKGVGSAPSRGVVKTDVREDYYSTKHGKMAAS 737

Query: 259 FLNFKANH 266
           + NF  N+
Sbjct: 738 YYNFLDNY 745



>gi|400593023|gb|EJP61034.1| autophagy protein Apg9 [Beauveria bassiana ARSEF 2860]
          Length = 904

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 172/250 (68%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  +  +R++T  A WKFREFNEL H+F +RL  S+  A +Y+DQFPK  T        
Sbjct: 465 DP-KLAAARKYTALAEWKFREFNELPHIFFERLHMSFPFATRYVDQFPKRMTEDVARSVA 523

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ TAVL + T +D +LFLGFEIT  RTV FY G+   ++A++RGM+ ++  VF+PE
Sbjct: 524 FMSGAITAVLAVCTVLDSELFLGFEITKDRTVLFYLGIFGAIWAMTRGMVSEEAAVFNPE 583

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+THY PD W GRLH+ EV++EF +L+++KVV++++E+  +I TP +L F+L 
Sbjct: 584 YALRNVIEYTHYMPDHWEGRLHSFEVKKEFAELYKMKVVIFLEEVMGIITTPMLLLFALP 643

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKME 256
            CS QI+DFFREFT+HVDG+G VCSFA+FDF+K  GN      A ++  +YY +K GKM 
Sbjct: 644 KCSDQIVDFFREFTIHVDGLGYVCSFAVFDFKKGVGNGGKRGTALDIREDYYTTKHGKMA 703

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 704 ASYYGFLDNY 713



>gi|320588380|gb|EFX00849.1| autophagy protein [Grosmannia clavigera kw1407]
          Length = 989

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 171/264 (64%), Gaps = 19/264 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G+R +T  A WKFREFNEL HLF +RL+ SY  A +Y++QFPK KT           
Sbjct: 519 SALGARAYTPLAEWKFREFNELDHLFEERLNMSYPFATRYLEQFPKKKTEQVAKTVAFIA 578

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   VL +A+ +DP+LFLGFEIT  RTV FY G+   ++A +RGMI +++ VFDPE  L
Sbjct: 579 GSVMTVLAIASLVDPELFLGFEITHDRTVLFYVGIFATVWATARGMITEENSVFDPEYAL 638

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+E+THY PD W+GRLH+  V+ EF +L++ K+ ++++EI S++ TP +L+ SL  CS
Sbjct: 639 RNVIEYTHYEPDHWKGRLHSHSVKMEFSELYQNKIKIFLEEIVSILITPLVLFVSLPKCS 698

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV------------------KYGAPASE 242
            QI+DFFREFT+HVDG+G VCSFA+FDF K  N                     GA  ++
Sbjct: 699 DQIVDFFREFTIHVDGLGYVCSFAVFDFNKDVNGGGGGGAGGGNSKRPKQPDSLGA-GAD 757

Query: 243 VENEYYLSKDGKMEKSFLNFKANH 266
           V ++YY +K GKM  S+  F  N+
Sbjct: 758 VRDDYYSTKHGKMAASYYGFLDNY 781



>gi|336259129|ref|XP_003344369.1| hypothetical protein SMAC_08312 [Sordaria macrospora k-hell]
 gi|380092680|emb|CCC09433.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 911

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 171/250 (68%), Gaps = 5/250 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S+  +R +T  A WKFREFNEL HLF +RLD S+  A+ YIDQFPKAKT           
Sbjct: 472 SVLSARGYTPLAEWKFREFNELPHLFKRRLDMSHPFASHYIDQFPKAKTSMVAKTVSFIA 531

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   +L L +  DP++FLGFEIT  RTV FYT V   +++V+RG + +D+ VFDPE  L
Sbjct: 532 GSIATILALISVFDPEMFLGFEITHDRTVLFYTAVFGAIWSVARGSVSEDNTVFDPEYAL 591

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VVE+THY P+ W+ R H+ +V+ EF QL+++K+V++++EI S++ TPF+L+FSL   +
Sbjct: 592 GNVVEYTHYQPEHWKDRWHSADVKAEFEQLYKLKLVIFVEEILSILTTPFVLFFSLPKSA 651

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVE----NEYYLSKDGKME 256
            +IIDFFREFT+HVDG+G VC FA FDF K G+    APA+ VE    ++YY +K GKME
Sbjct: 652 DRIIDFFREFTIHVDGLGYVCYFAEFDF-KQGSKNQAAPATTVEGDVRDDYYSTKHGKME 710

Query: 257 KSFLNFKANH 266
            S   F  N+
Sbjct: 711 ASMYGFINNY 720



>gi|156050735|ref|XP_001591329.1| hypothetical protein SS1G_07955 [Sclerotinia sclerotiorum 1980]
 gi|154692355|gb|EDN92093.1| hypothetical protein SS1G_07955 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 890

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  GSR +T  A WKFREFNEL HLF++RL+ SY  A++Y++QFP  KT           
Sbjct: 444 AALGSRGYTPLAEWKFREFNELHHLFNKRLNMSYPFASRYLNQFPNVKTAHMAKFITFMA 503

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL++AT  D ++  GF+IT+ R V FY GV   L+A++ GMIP+++ VFDPE  L
Sbjct: 504 GAVVSVLVVATVWDSEVLAGFDITSERPVLFYIGVFGSLWAITNGMIPEENEVFDPEYAL 563

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P+ W+ RLH+DEV+REF  L+++K++++I+E+FS+I TPF+LWFSL  C+
Sbjct: 564 RQVIEYTHYMPNHWQDRLHSDEVKREFSTLYQLKLMIFIEEVFSIIITPFLLWFSLPKCA 623

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK--YGAPASEVENEYYLSKDGKMEKS 258
            QIIDFFREFTVHVDGVG VCSFA+FDF+K        G   S++  +YY +K GKM  S
Sbjct: 624 DQIIDFFREFTVHVDGVGYVCSFAVFDFKKGDGRAPTQGKAKSDMREDYYSTKHGKMAAS 683

Query: 259 FLNFKANH 266
           + NF  N+
Sbjct: 684 YYNFLDNY 691



>gi|85092988|ref|XP_959604.1| hypothetical protein NCU02422 [Neurospora crassa OR74A]
 gi|73619461|sp|Q7S4D7.1|ATG9_NEUCR RecName: Full=Autophagy-related protein 9
 gi|28921048|gb|EAA30368.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 908

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 128/251 (50%), Positives = 171/251 (68%), Gaps = 7/251 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           SI  +R +T  A WKFREFNEL HLF +RLD S+  A+ YIDQFPKAKT           
Sbjct: 469 SILSARSYTPLAEWKFREFNELPHLFKRRLDMSHPFASHYIDQFPKAKTSMVAKTVSFIA 528

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   VL L +  DP++FLGFEIT  RTV FYT V   +++V+RG + +D+ VFDPE  L
Sbjct: 529 GSIATVLALISVFDPEMFLGFEITHDRTVLFYTAVFGAIWSVARGSVSEDNAVFDPEYAL 588

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VVE+THY P+ W+ R H+ +V+ EF +L+++K+V++I+EI S++ TPF+L+FSL   +
Sbjct: 589 GNVVEYTHYQPEHWKDRWHSADVKAEFEELYKLKLVIFIEEILSILTTPFVLFFSLPKSA 648

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS-----EVENEYYLSKDGKM 255
            QIIDFFREFT+HVDG+G VC FA FDF+K    K  APA+     +V ++YY +K GKM
Sbjct: 649 DQIIDFFREFTIHVDGLGYVCYFAEFDFKK--GSKSQAPAATAGEGDVRDDYYSTKHGKM 706

Query: 256 EKSFLNFKANH 266
           E S   F  N+
Sbjct: 707 EASMYGFINNY 717



>gi|166990657|sp|A7ERK1.2|ATG9_SCLS1 RecName: Full=Autophagy-related protein 9
          Length = 944

 Score =  256 bits (655), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  GSR +T  A WKFREFNEL HLF++RL+ SY  A++Y++QFP  KT           
Sbjct: 498 AALGSRGYTPLAEWKFREFNELHHLFNKRLNMSYPFASRYLNQFPNVKTAHMAKFITFMA 557

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  +VL++AT  D ++  GF+IT+ R V FY GV   L+A++ GMIP+++ VFDPE  L
Sbjct: 558 GAVVSVLVVATVWDSEVLAGFDITSERPVLFYIGVFGSLWAITNGMIPEENEVFDPEYAL 617

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY P+ W+ RLH+DEV+REF  L+++K++++I+E+FS+I TPF+LWFSL  C+
Sbjct: 618 RQVIEYTHYMPNHWQDRLHSDEVKREFSTLYQLKLMIFIEEVFSIIITPFLLWFSLPKCA 677

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK--YGAPASEVENEYYLSKDGKMEKS 258
            QIIDFFREFTVHVDGVG VCSFA+FDF+K        G   S++  +YY +K GKM  S
Sbjct: 678 DQIIDFFREFTVHVDGVGYVCSFAVFDFKKGDGRAPTQGKAKSDMREDYYSTKHGKMAAS 737

Query: 259 FLNFKANH 266
           + NF  N+
Sbjct: 738 YYNFLDNY 745



>gi|336467367|gb|EGO55531.1| hypothetical protein NEUTE1DRAFT_67234 [Neurospora tetrasperma FGSC
           2508]
 gi|350287991|gb|EGZ69227.1| APG9-domain-containing protein [Neurospora tetrasperma FGSC 2509]
          Length = 907

 Score =  256 bits (654), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 171/251 (68%), Gaps = 7/251 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           SI  +R +T  A WKFREFNEL HLF +RLD S+  A+ YIDQFPKAKT           
Sbjct: 469 SILSARSYTPLAEWKFREFNELPHLFKRRLDMSHPFASHYIDQFPKAKTSMVAKTVSFIA 528

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   VL L +  DP++FLGFEIT  RTV FYT V   +++V+RG + +D+ VFDPE  L
Sbjct: 529 GSIATVLALISVFDPEMFLGFEITHDRTVLFYTAVFGAIWSVARGSVSEDNAVFDPEYAL 588

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VVE+THY P+ W+ R H+ +V+ EF +L+++K+V++++EI S++ TPF+L+FSL   +
Sbjct: 589 GNVVEYTHYQPEHWKDRWHSADVKAEFEELYKLKLVIFVEEILSILTTPFVLFFSLPKSA 648

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS-----EVENEYYLSKDGKM 255
            QIIDFFREFT+HVDG+G VC FA FDF+K    K  APA+     +V ++YY +K GKM
Sbjct: 649 DQIIDFFREFTIHVDGLGYVCYFAEFDFKK--GSKNQAPAATAGEGDVRDDYYSTKHGKM 706

Query: 256 EKSFLNFKANH 266
           E S   F  N+
Sbjct: 707 EASMYGFINNY 717



>gi|408392888|gb|EKJ72176.1| hypothetical protein FPSE_07633 [Fusarium pseudograminearum CS3096]
          Length = 901

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 167/244 (68%), Gaps = 1/244 (0%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R++T  A WKFR+FNEL H+F++RL  SY  A +YIDQFPK  T           G+ 
Sbjct: 474 AARKYTSLAEWKFRQFNELPHIFYERLHMSYPFATRYIDQFPKRITEAVARTIAFMSGAI 533

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
           TA+L + + +D +LFL FEIT  R V FY GV   ++A +RGM+ ++ LVF+PE  L+ V
Sbjct: 534 TAILAIGSVLDSELFLNFEITKDRPVIFYLGVFAAIWATTRGMVSEETLVFNPEYALRNV 593

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +E+T Y PD W+ +LH+ EV++EF +L+++KVV++++E+  +I TP +L FSL  CS QI
Sbjct: 594 IEYTRYVPDHWKNKLHSSEVKQEFSELYKMKVVIFLEEMMGIITTPMLLLFSLPRCSDQI 653

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSFLNF 262
           +DFFREFT+HVDG+G VCSFA+FDF+K  GN     P  +V  +YY +K GKM  S+  F
Sbjct: 654 VDFFREFTIHVDGLGYVCSFAVFDFQKGPGNTGPQGPRPDVREDYYSTKHGKMAASYYGF 713

Query: 263 KANH 266
             N+
Sbjct: 714 LDNY 717



>gi|296411511|ref|XP_002835474.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629258|emb|CAZ79631.1| unnamed protein product [Tuber melanosporum]
          Length = 898

 Score =  255 bits (652), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/240 (48%), Positives = 161/240 (67%), Gaps = 4/240 (1%)

Query: 23  FGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGS 82
            G RQ+T  A WKFREFNEL H+FH RL+ SY  A  Y++QFPK KT           GS
Sbjct: 485 IGHRQYTPLAEWKFREFNELYHIFHMRLNMSYPAAEAYVEQFPKEKTAQVARFVSFVAGS 544

Query: 83  FTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKK 142
              VL +A+  D DL  GFEI  G         L  + AVSRGM+P+++ V+DPE  ++ 
Sbjct: 545 LLGVLAIASIFDGDLIQGFEIVQGMNGLTAIATLTTIVAVSRGMLPEENTVYDPEWSIRN 604

Query: 143 VVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQ 202
           V++H HY PD W+ +L TD++++EF+ L+++KV +++ E+ SVIFTPF+LW SL++ S++
Sbjct: 605 VIQHIHYMPDHWKDKLRTDDIKKEFMSLYDLKVTIFLGEVMSVIFTPFVLWVSLSNRSER 664

Query: 203 IIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNF 262
           IIDFFREFTVHVDG+G VCSFA+FDF+K G        +++  EY+ SKD KM  S+L F
Sbjct: 665 IIDFFREFTVHVDGIGYVCSFAVFDFQKPGR----QSMADIREEYFSSKDNKMLSSYLGF 720



>gi|406694713|gb|EKC98035.1| hypothetical protein A1Q2_07581 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 923

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 178/281 (63%), Gaps = 32/281 (11%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  G RQ+T FAR+KFREFNEL HL ++RLD+ Y+ A +YIDQF                
Sbjct: 557 ATLGGRQYTLFARYKFREFNELPHLLNRRLDEGYEVAKEYIDQF-----------VAFVA 605

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GSF AVLI A  + P+L   FE++  RT+ +Y GV   + AV+RGMIP D+  FDP   +
Sbjct: 606 GSFAAVLIAAGMVHPELLSNFELSPHRTLLWYLGVFGVILAVARGMIPPDNHAFDPARHM 665

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+ +THY PD WRG+LH+  V  +F  LF++K++++ QE+  V+ TPFIL FSL  C+
Sbjct: 666 QEVIHYTHYCPDSWRGQLHSQVVLAQFGVLFQLKLMVFAQELLGVLLTPFILLFSLPQCA 725

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAP----------ASEVENEYYLS 250
           + +IDFFRE ++HV+ +G VCSFA+FDF++ GNV  GAP          A  V  E  LS
Sbjct: 726 EALIDFFRENSIHVEDLGYVCSFAVFDFKRDGNV--GAPSAGHAGHAGQAEHVPPERPLS 783

Query: 251 K---------DGKMEKSFLNFKANHPDWEPTDPFGSLYLSR 282
           +         D KME+S L+FK  HPDW+P DP  SL+L R
Sbjct: 784 RNRKGRRTFTDAKMEQSVLHFKHAHPDWQPMDPGASLFLDR 824



>gi|392595569|gb|EIW84892.1| APG9-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 530

 Score =  254 bits (650), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/218 (55%), Positives = 160/218 (73%), Gaps = 1/218 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR++T FA WKFREFNEL H+F +R+D+SY  A++YI QFP  K         
Sbjct: 304 NPSSI-GSRRYTPFAEWKFREFNELPHIFTRRVDESYPVASRYIGQFPNEKLTIIVRFVA 362

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTAVL+LAT IDPD+FL  EIT  RTVFFY  +   + AV+RGMIP+D+ VFDPE
Sbjct: 363 FVAGSFTAVLLLATIIDPDVFLSLEITPHRTVFFYISIFGSVLAVARGMIPEDNKVFDPE 422

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             + +V+++THY PDEW+  LH+ +V +EF +LF +K +++ QEI S++ TPF+LWFSL 
Sbjct: 423 LLMSEVIQYTHYMPDEWKAMLHSKQVHQEFGELFTMKPLVFAQEIISIVTTPFVLWFSLP 482

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK 235
           +C+  I+DFF +FTV V G G VCSFA FDF++HGNVK
Sbjct: 483 ECAPVIVDFFHDFTVWVPGRGYVCSFAEFDFKRHGNVK 520



>gi|409045796|gb|EKM55276.1| hypothetical protein PHACADRAFT_95774 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 519

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 164/222 (73%), Gaps = 1/222 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P ++ G R++T FA+WKFREFNEL H F +RL++S   A+ YI QFP  K        
Sbjct: 297 NNPSNMSG-RRYTPFAQWKFREFNELPHNFARRLNESSPTASLYIGQFPNEKVTIIVRFV 355

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL+LA+ +DPD+ + FEIT  RTV FY  +   + AV+RGMIP+++ VFDP
Sbjct: 356 AFIAGSFAAVLLLASVLDPDMIVHFEITPHRTVLFYLTLFGSILAVARGMIPEENRVFDP 415

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  +  V+++THY PDEW+ +LH+ +V +EF +LF++K+V+Y QE+ SV+ TPF+LW+SL
Sbjct: 416 EMLMTDVIQYTHYMPDEWKDQLHSKKVHQEFGELFQMKIVIYTQELLSVLLTPFVLWYSL 475

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGA 238
            +C+  IIDFFREF+VHVDG+G VCSFA+FDF++HGNVK G 
Sbjct: 476 PNCAPAIIDFFREFSVHVDGLGYVCSFAVFDFQRHGNVKVGC 517



>gi|345568407|gb|EGX51301.1| hypothetical protein AOL_s00054g371 [Arthrobotrys oligospora ATCC
           24927]
          Length = 892

 Score =  254 bits (649), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 219/425 (51%), Gaps = 34/425 (8%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P +I GSR++T  A WKFREFNEL HLFH+R++ SY  A KY++QFPK K        
Sbjct: 480 TNPSAI-GSRRYTPLAEWKFREFNELVHLFHRRMNISYPFAVKYLEQFPKEKFVQAAKFV 538

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL +A+ +D +L L FEIT  RTV FY  +   + AV+RG+IP +  VFDP
Sbjct: 539 TFIFGSFAAVLAIASLLDTEL-LQFEITKDRTVLFYITLFGSITAVARGIIPAETDVFDP 597

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
              L  V+ HT YSP EW+GRLH+DEV++EF +L+E+K+V++  E+ S+I TPF++WFSL
Sbjct: 598 TYELSWVMYHTRYSPPEWKGRLHSDEVKKEFSKLYELKIVIFFWEVASIILTPFVMWFSL 657

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
             CS +IIDFFREFTVHVDG+G VCSFA FDF   G  K  +       EYY S+D KM+
Sbjct: 658 PKCSDRIIDFFREFTVHVDGIGYVCSFAEFDFNMTGPKKSTSITG--REEYYDSRDNKMK 715

Query: 257 KSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVVDSILKTTXXXXXX 316
            S + F          D +G+      +          P A+  +  +++  T       
Sbjct: 716 ASMMGF---------LDSYGNRQAGTASRIAYAPGYTNPLASPVAAPENMTGTITQRRNR 766

Query: 317 XXXXXVHFSYPIGSQSTTHYTNAXXXXXXXXDDLNSIMEDGQTHAGPSH---ITRGSYRG 373
                       G Q +   +++            S + D   H  PSH   + +  Y  
Sbjct: 767 TNP---------GVQQSQQISHSMYRGQA------SGLLDRHHHPAPSHARTLRQSVYHN 811

Query: 374 YGIXXXXXXXXXXXXXXQE---HYTSELGDSFILPGARIGGAGINESNEHDKPRNGGVIG 430
            G                     Y S LG+SF+          I   ++ D  + GGVI 
Sbjct: 812 PGFPRQESILREEEDEVDSPDGRYISNLGESFVSTTLENDNLQIERIDDEDDLQGGGVID 871

Query: 431 LLNQF 435
           LL QF
Sbjct: 872 LLRQF 876



>gi|380488145|emb|CCF37576.1| autophagy protein Apg9 [Colletotrichum higginsianum]
          Length = 913

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 168/250 (67%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP S F  R++T  A WKFREFNE+ HLF +R++ SY  A++YIDQFPK  T        
Sbjct: 476 DP-STFSHRRYTPLAEWKFREFNEVPHLFQERINMSYPFASRYIDQFPKKMTEQFARTVT 534

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ T+VL +A+++DP LFLGFEITT R+  FY G+   ++A +RGMI ++  VFDP+
Sbjct: 535 FVAGAITSVLAVASFLDPQLFLGFEITTERSALFYIGLFAAIWAAARGMISEETTVFDPD 594

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+T Y PD W+ RLHT +V+REF +L+++K+++ ++EI  ++    +L +S  
Sbjct: 595 YALRNVIEYTRYMPDNWKDRLHTADVKREFSELYKLKMLILVEEILGILTASLVLIYSAP 654

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKME 256
            CS QIIDFFREFT+HVDGVG +CSFA FDF+K  G  K    A +V  +YY +K  KM 
Sbjct: 655 KCSDQIIDFFREFTIHVDGVGYICSFAEFDFKKGVGKTKQATGAGDVREDYYSTKHNKMA 714

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 715 ASYYGFLDNY 724



>gi|512187885|gb|EPE03661.1| autophagy protein apg9 [Ophiostoma piceae UAMH 11346]
          Length = 1049

 Score =  253 bits (647), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 169/266 (63%), Gaps = 20/266 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G+R +T  A WKFREFNEL HLF +RL+ SY  A +Y+DQFPK  T           
Sbjct: 571 SALGARGYTPLAEWKFREFNELEHLFQERLNMSYPFATRYLDQFPKRGTEQIARTVTFIS 630

Query: 81  GSFTAVLILATYIDPD-LFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEAR 139
           G+   VL +AT +DPD LFLG EIT G TV FY GV   ++A +RGMI +D+ VFDPE  
Sbjct: 631 GALWTVLAIATLLDPDPLFLGMEITRGHTVLFYVGVFASVWAAARGMITEDNSVFDPEYA 690

Query: 140 LKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADC 199
           L+ V+E+THY PD W+GRLH+ +V+ EF +L+++K+ ++ +EI S++ TP IL+ SL   
Sbjct: 691 LRNVIEYTHYEPDHWKGRLHSYDVKVEFSELYQLKIRIFFEEIMSILLTPLILFTSLPRS 750

Query: 200 SQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS------------------ 241
           S QI+DFFREFT+HVDG+G VCSFA+FDF K      GA +S                  
Sbjct: 751 SDQIVDFFREFTIHVDGLGYVCSFAVFDFHKGIGGAAGASSSKRQTEPQIVEPDPLGADG 810

Query: 242 -EVENEYYLSKDGKMEKSFLNFKANH 266
            +V ++YY +K GKM  S+  F  N+
Sbjct: 811 GDVRDDYYATKHGKMAASYYGFLDNY 836



>gi|477515973|gb|ENH68254.1| Autophagy-related protein 9 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 872

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 167/244 (68%), Gaps = 1/244 (0%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R++T  A WKFREFNEL H+F++RL  SY  A +YIDQFPK  T           G+ 
Sbjct: 447 AARKYTSLAEWKFREFNELPHIFYERLHMSYPFATRYIDQFPKRMTEDIARTIAFMTGAI 506

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
           TA+L + + +D +LF+ FEIT  R V FY G+   ++A++RGM+ ++ LVF+PE  L  V
Sbjct: 507 TAILAVGSILDSELFINFEITKDRPVLFYLGIFGAIWAITRGMVSEETLVFNPEYALMNV 566

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +E+THY PD W+ +LH+ EV++EF +L+++KVV++++E+  ++ TP +L FSL  CS QI
Sbjct: 567 IEYTHYMPDHWKNKLHSFEVKQEFAELYKMKVVIFLEEVMGIVTTPMLLLFSLPKCSDQI 626

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSFLNF 262
           +DFFREFT+HVDG+G VCSFA+FDF+K  GN  +     +V  +YY +K  KM  S+  F
Sbjct: 627 VDFFREFTIHVDGLGYVCSFAVFDFQKGPGNTGHQGQRPDVREDYYSTKHNKMAASYFGF 686

Query: 263 KANH 266
             N+
Sbjct: 687 LDNY 690



>gi|302692102|ref|XP_003035730.1| hypothetical protein SCHCODRAFT_51000 [Schizophyllum commune H4-8]
 gi|300109426|gb|EFJ00828.1| hypothetical protein SCHCODRAFT_51000 [Schizophyllum commune H4-8]
          Length = 527

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/227 (52%), Positives = 156/227 (68%), Gaps = 1/227 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
            DP +I G RQ+T +A+WKFREFNEL H F +RL +SY  A  YI QFP  K        
Sbjct: 301 KDPSTI-GGRQYTLYAQWKFREFNELPHFFKRRLHESYPVATSYIGQFPNEKMKLIMRFV 359

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSFTAVL+LA+  DPDL + FEIT   TV F+  V   + A +RGMIPDDH VFDP
Sbjct: 360 AFVAGSFTAVLVLASIADPDLVVHFEITPHGTVLFWISVFGGILATARGMIPDDHDVFDP 419

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + +V+ HTHY PDEW+G LH+ +   +F +LF++K+++++QEI SV+ TPF+LW+SL
Sbjct: 420 EQLMMEVITHTHYMPDEWKGELHSKKTHAQFGELFQMKILIFVQEILSVLLTPFVLWYSL 479

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEV 243
             C+  IIDFFREF+VHV+G G VCSFA F+F +HGNVK      +V
Sbjct: 480 PPCAPAIIDFFREFSVHVEGRGYVCSFAEFNFERHGNVKVCRTIDDV 526



>gi|342877141|gb|EGU78648.1| hypothetical protein FOXB_10834 [Fusarium oxysporum Fo5176]
          Length = 915

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 167/244 (68%), Gaps = 1/244 (0%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R++T  A WKFREFNEL H+F++RL  SY  A +YIDQFPK  T           G+ 
Sbjct: 475 AARKYTSLAEWKFREFNELPHIFYERLHMSYPFATRYIDQFPKRMTEDIARTIAFMTGAI 534

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
           TA+L + + +D +LF+ FEIT  R V FY G+   ++A++RGM+ ++ LVF+PE  L  V
Sbjct: 535 TAILAVGSILDSELFINFEITKDRPVLFYLGIFGAIWAITRGMVSEETLVFNPEYALMNV 594

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +E+THY PD W+ +LH+ EV++EF +L+++KVV++++E+  ++ TP +L FSL  CS QI
Sbjct: 595 IEYTHYMPDHWKNKLHSFEVKQEFAELYKMKVVIFLEEVMGIVTTPMLLLFSLPKCSDQI 654

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSFLNF 262
           +DFFREFT+HVDG+G VCSFA+FDF+K  GN  +     +V  +YY +K  KM  S+  F
Sbjct: 655 VDFFREFTIHVDGLGYVCSFAVFDFQKGPGNTGHQGQRPDVREDYYSTKHNKMAASYFGF 714

Query: 263 KANH 266
             N+
Sbjct: 715 LDNY 718



>gi|342318925|gb|EGU10881.1| Autophagy-related protein 9 [Rhodotorula glutinis ATCC 204091]
          Length = 853

 Score =  251 bits (640), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%), Gaps = 1/208 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSRQ+T  ARWKFREFNEL H F QRL  ++  A++YI+ +PKAKT        
Sbjct: 635 NPSSI-GSRQFTPLARWKFREFNELPHHFQQRLALAHPLADQYINHYPKAKTVLLSRFVA 693

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVLIL + IDPD FL FEIT GRTV FY GV   + AV+RGM PDD+ V DPE
Sbjct: 694 FLAGSFAAVLILFSLIDPDAFLHFEITPGRTVLFYIGVFGTILAVARGMSPDDNRVVDPE 753

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             ++ +VEHTHY P+EW+ +LH+ EV   F +LF++KV L++QE+FSV+ TP +LW+SL 
Sbjct: 754 ELMRNIVEHTHYLPNEWKDKLHSAEVHVAFGKLFQMKVSLFLQELFSVLITPVVLWYSLP 813

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAI 225
            C+  ++DFFREFTVHVDG+G VCSFA+
Sbjct: 814 KCAGPVVDFFREFTVHVDGLGYVCSFAV 841



>gi|402080167|gb|EJT75312.1| autophagy-like protein 9 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 911

 Score =  250 bits (639), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 166/250 (66%), Gaps = 2/250 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           SDP +I G+R +T  A WKFREFNEL HLF+ RL  S   A  YIDQFPK KT       
Sbjct: 473 SDPSAI-GARAYTSLALWKFREFNELEHLFNARLKMSQPFAKVYIDQFPKRKTEQVARTI 531

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GS  AVL +AT  D ++FL FEIT  RT  FY GVL  ++A +RG + D++ V+DP
Sbjct: 532 SFIAGSIVAVLAVATLFDSEMFLSFEITPDRTAVFYIGVLGAVWAAARGNVSDENEVYDP 591

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  +K V+ +THY PD W+ RLH+ +V+ EF +L++ K +++++EI S++ TP +L  SL
Sbjct: 592 EYAMKSVIGYTHYEPDHWQDRLHSTDVKTEFAELYKPKPLIFLEEIISILLTPLVLLISL 651

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
              S QIIDFFREFT+HVDG+G VCSFA+FDF+K G      PA+++ + YY +K GKM 
Sbjct: 652 PKTSDQIIDFFREFTIHVDGLGYVCSFAVFDFKK-GVENQKQPAADMRDGYYSTKHGKMA 710

Query: 257 KSFLNFKANH 266
            SF  F  N+
Sbjct: 711 ASFYGFLDNY 720



>gi|389629058|ref|XP_003712182.1| autophagy-like protein 9 [Magnaporthe oryzae 70-15]
 gi|73619459|sp|Q51WZ9.1|ATG9_MAGO7 RecName: Full=Autophagy-related protein 9
 gi|216408397|gb|ACJ72888.1| ATG9 protein [Magnaporthe oryzae]
 gi|351644514|gb|EHA52375.1| autophagy-like protein 9 [Magnaporthe oryzae 70-15]
 gi|440469125|gb|ELQ38248.1| autophagy-related protein 9 [Magnaporthe oryzae Y34]
 gi|440487583|gb|ELQ67364.1| autophagy-related protein 9 [Magnaporthe oryzae P131]
          Length = 917

 Score =  250 bits (638), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 168/249 (67%), Gaps = 4/249 (1%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           +DPG++ G+R +   A+WKFREFNEL HLF+ R++ S+  A +YID FPK KT       
Sbjct: 475 NDPGAL-GARTYNSLAKWKFREFNELDHLFNDRMNMSHPFAKRYIDMFPKRKTEQVARTV 533

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GS  AVL LAT  D + FL FEIT  R+V FY  +L  L+AV+RG I DD+ V+DP
Sbjct: 534 SFITGSIVAVLGLATIFDSEAFLTFEITPDRSVLFYVSILATLWAVARGNISDDNEVYDP 593

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  +K ++E THY PD WRGRLH+ EV+ EF +L++ +  ++++EI S++ TP +L  SL
Sbjct: 594 EFAMKSIIEFTHYEPDHWRGRLHSTEVKNEFSELYKPRPQIFLEEILSILLTPLVLLVSL 653

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVEN--EYYLSKDG 253
            + + QI+DFFREFT+HVDG+G VC F++F+F++ H N K  A A   +N  EYY +K G
Sbjct: 654 PNSTDQIVDFFREFTIHVDGLGYVCLFSVFNFQQGHANQKQAAAADAPDNREEYYSTKHG 713

Query: 254 KMEKSFLNF 262
           KM  SF  F
Sbjct: 714 KMAASFYGF 722



>gi|367047431|ref|XP_003654095.1| hypothetical protein THITE_2116774 [Thielavia terrestris NRRL 8126]
 gi|347001358|gb|AEO67759.1| hypothetical protein THITE_2116774 [Thielavia terrestris NRRL 8126]
          Length = 896

 Score =  250 bits (638), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 168/246 (68%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +I  SR +T  A WKFREFNEL HLF +RLD S+  A+ YIDQFPKAKT           
Sbjct: 466 AILASRTYTPLAEWKFREFNELPHLFRKRLDMSHPFASHYIDQFPKAKTEMFFRTVAFIS 525

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+ + +L +A+ +D +LFLGFEIT  RT  FYT V   ++A +R  I  ++ VFDPE  +
Sbjct: 526 GALSTILAIASVVDSELFLGFEITPDRTALFYTAVFGGVWAFARANISAENSVFDPEYAM 585

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+++THY PD W+ RLH+ ++++EF +L+++K+V++++E+ S++  PF+++ SL  CS
Sbjct: 586 RNVIQYTHYEPDHWKDRLHSFDIKKEFSELYKLKMVIFLEEMLSILTIPFVMFSSLPKCS 645

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
            QIIDFFREFT+HVDG+G VCSFA FDF+K           +V ++YY +K GKME S+ 
Sbjct: 646 DQIIDFFREFTIHVDGLGYVCSFAEFDFKKGFGNGRQRDGGDVRDDYYATKHGKMEASYY 705

Query: 261 NFKANH 266
            F  N+
Sbjct: 706 GFMDNY 711



>gi|378732084|gb|EHY58543.1| hypothetical protein HMPREF1120_06553 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 1060

 Score =  250 bits (638), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 161/214 (75%), Gaps = 1/214 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P  I GSR++++FA+WKFREFNEL HLF +R++ SY  A +Y++QFPK KT        
Sbjct: 503 NPAQI-GSREYSRFAQWKFREFNELDHLFQRRINMSYPFATRYLNQFPKDKTIQAAQFVS 561

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+  +VL LAT +D + FL FE+T GRT  FY G+   ++AV+RG++P+D++V+D  
Sbjct: 562 LVSGAVVSVLGLATILDQENFLNFEVTPGRTTIFYLGIFGSIWAVARGVLPEDNMVYDTS 621

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             +++V++ THY P  W GRLHT EV++EF QL+++K+VL+++E+ S+IFTPF+LWFSL 
Sbjct: 622 LAIQEVIQFTHYEPQHWAGRLHTMEVKQEFSQLYQMKLVLFLEEVLSMIFTPFVLWFSLP 681

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH 231
            CS++IIDFFREFTVHVDG+G VCSFA F+F + 
Sbjct: 682 KCSERIIDFFREFTVHVDGLGYVCSFAEFNFMQQ 715



>gi|346975640|gb|EGY19092.1| hypothetical protein VDAG_09426 [Verticillium dahliae VdLs.17]
          Length = 911

 Score =  249 bits (635), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 164/247 (66%), Gaps = 1/247 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  G R++T  ARWKFREFNEL HLF +R++ SY  A++YIDQFPK              
Sbjct: 471 ATLGDRRYTALARWKFREFNELPHLFQERINMSYPFASRYIDQFPKRLVEQVARSVTFMS 530

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+ T  L  A+++DP+LFLGFEIT  RT  FY GV   ++A++RGMI ++  VFDPE  L
Sbjct: 531 GAITFTLAAASFLDPELFLGFEITKDRTALFYIGVFGTIWALARGMISEETTVFDPEFAL 590

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           K V++ TH+ PD W+GRLH+ +V++EF +L+++KVV+  +EI  +    F+L FS    S
Sbjct: 591 KGVLDFTHHMPDHWQGRLHSFDVKQEFSELYKLKVVILAEEILGIFLASFVLLFSAPKSS 650

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSF 259
            QIIDF REFT+HVDG+G VCSFA FDFR+  GN K  A   +V  +YY +K GKM  S+
Sbjct: 651 DQIIDFVREFTIHVDGLGYVCSFAEFDFRRGLGNQKPTAGVDDVREDYYTTKHGKMAASY 710

Query: 260 LNFKANH 266
             F  N+
Sbjct: 711 YGFLENY 717



>gi|302404255|ref|XP_002999965.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
 gi|261361147|gb|EEY23575.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
          Length = 567

 Score =  248 bits (633), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 163/247 (65%), Gaps = 1/247 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           +  G R++T  ARWKFREFNEL HLF +R++ SY  A++YIDQFPK              
Sbjct: 127 ATLGDRRYTALARWKFREFNELPHLFQERINMSYPFASRYIDQFPKRLVEQVARSVTFMS 186

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+ T  L  A+++DP+LFLGFEIT  RT  FY GV   ++A++RGMI ++  VFDPE  L
Sbjct: 187 GAITFTLAAASFLDPELFLGFEITKDRTALFYIGVFGTIWALARGMISEETTVFDPEFAL 246

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           K V++ TH+ PD W GRLH+ +V++EF +L+++KVV+  +EI  +    F+L FS    S
Sbjct: 247 KGVLDFTHHMPDHWHGRLHSFDVKQEFSELYKLKVVILAEEILGIFLASFVLLFSAPKSS 306

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSF 259
            QIIDF REFT+HVDG+G VCSFA FDFR+  GN +  A   +V  +YY +K GKM  S+
Sbjct: 307 DQIIDFVREFTIHVDGLGYVCSFAEFDFRRGLGNQRPTAGVEDVREDYYTTKHGKMAASY 366

Query: 260 LNFKANH 266
             F  N+
Sbjct: 367 YGFLENY 373



>gi|358385643|gb|EHK23239.1| hypothetical protein TRIVIDRAFT_123233, partial [Trichoderma virens
           Gv29-8]
          Length = 888

 Score =  248 bits (632), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 173/252 (68%), Gaps = 5/252 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  +  +R++T  A WKFREFNEL HLF++RL  S+  A +YIDQFPK  T        
Sbjct: 459 DP-KLAAARKYTSLAEWKFREFNELPHLFYERLHMSFPFATRYIDQFPKRMTEDIAKSIS 517

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ TA+L + T +D +LFL FEIT  RT  FY G+   ++A++RGM+ ++ +VFDPE
Sbjct: 518 FMSGALTAILAVCTLLDSELFLSFEITKDRTALFYLGIFGGIWAITRGMVSEESMVFDPE 577

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+THY PD W+GRLH+ EV++EF +L+++KVV++++E+  +I TP +L  SL 
Sbjct: 578 YALRNVIEYTHYMPDHWQGRLHSFEVKQEFSELYKMKVVIFLEEVLGIITTPLLLLLSLP 637

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNV---KYGAPASEVENEYYLSKDGK 254
            CS QI+DFFREFTVHVDG+G VCSFA FDF++  +    + GAP  +V  +YY +K GK
Sbjct: 638 KCSDQIVDFFREFTVHVDGMGYVCSFAEFDFKRGPSQPANRQGAP-KDVREDYYATKHGK 696

Query: 255 MEKSFLNFKANH 266
           M  S+  F  N+
Sbjct: 697 MAASYYGFLDNY 708



>gi|406603944|emb|CCH44577.1| Autophagy-related protein [Wickerhamomyces ciferrii]
          Length = 869

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 165/248 (66%), Gaps = 4/248 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGSI GSRQ+T FA WKFREFNEL HLF +RL+ S   A KY+DQFPK KT        
Sbjct: 502 NPGSI-GSRQYTPFAEWKFREFNELYHLFQRRLNLSVPEAAKYVDQFPKEKTTIVLKFVA 560

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL + + +DPD+F  FEIT  RTV FY  +   ++AV  G IP+++ VFD E
Sbjct: 561 FITGSFAAVLGILSVVDPDMFFNFEITKDRTVLFYISIFGTIWAVCHGAIPEEYQVFDSE 620

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A LK+V  +TH+ P  W G+ HT+EV+ EF + F++K  + ++EI S+I TPFILWFSL 
Sbjct: 621 ASLKQVATYTHFLPQSWEGKYHTEEVKAEFCEYFDLKPFILLREISSLIMTPFILWFSLP 680

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDF---RKHGNVKYGAPASEVENEYYLSKDGK 254
             + +I+DFFREF+VHVDG+G VC+FA+F+F   +K    K     ++    +Y S + K
Sbjct: 681 KSTNRIVDFFREFSVHVDGLGYVCTFAMFNFDKSKKGLQSKKSISPNDPRKTHYNSGEDK 740

Query: 255 MEKSFLNF 262
           M KS+L F
Sbjct: 741 MMKSYLYF 748



>gi|340518824|gb|EGR49064.1| predicted protein [Trichoderma reesei QM6a]
          Length = 791

 Score =  245 bits (626), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 173/252 (68%), Gaps = 5/252 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  +  +R++T  A WKFREFNEL H+F++RL  S+  A +YIDQFPK  T        
Sbjct: 358 DP-KLAATRKYTSLAEWKFREFNELPHIFYERLHMSFPFATRYIDQFPKRMTEEIARSIS 416

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ TA+L + T +D +LFL FEIT  RT  FY G+   ++A++RGM+ ++  VF+PE
Sbjct: 417 FMSGALTAILAVCTLLDSELFLSFEITQDRTALFYLGIFGGIWAITRGMVSEEASVFNPE 476

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+THY PD W+GRLH+ EV++EF +L+++KVV++++E+  +I TP +L  SL 
Sbjct: 477 YALRNVIEYTHYMPDHWQGRLHSFEVKQEFSELYKMKVVIFLEEVLGIITTPLLLLLSLP 536

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK---HGNVKYGAPASEVENEYYLSKDGK 254
            CS QI+DFFREFTVHVDG+G VCSFA+FDF+K    G  + GA  ++V  +YY +K GK
Sbjct: 537 KCSDQIVDFFREFTVHVDGLGYVCSFAVFDFKKGPGQGVDRRGA-TNDVREDYYSTKHGK 595

Query: 255 MEKSFLNFKANH 266
           M  S+  F  N+
Sbjct: 596 MAASYYGFLDNY 607



>gi|358394279|gb|EHK43672.1| hypothetical protein TRIATDRAFT_162356, partial [Trichoderma
           atroviride IMI 206040]
          Length = 892

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 171/250 (68%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  +  +R++T  A WKFREFNEL H+F++RL  S+  A +YIDQFPK  T        
Sbjct: 459 DP-KLAAARKYTSLAEWKFREFNELPHIFYERLHMSFPFATRYIDQFPKRMTEEIARSIS 517

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ TA+L + T +D +LFL FEIT  RT  FY G+   ++A++RGM+ ++ +VF+PE
Sbjct: 518 FMCGALTAILAVCTLLDSELFLSFEITKDRTALFYLGIFGGIWAITRGMVSEESMVFNPE 577

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+THY PD W+GRLH+ ++++EF +L+++KVV++++E+  +I TP +L  SL 
Sbjct: 578 YALRNVIEYTHYMPDHWQGRLHSTDIKQEFSELYKMKVVIFLEEVLGIITTPLLLLLSLP 637

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVENEYYLSKDGKME 256
            CS QI+DFFREFTVHVDG+G VCSFA+FDF+K  G+        +V  +YY +K GKM 
Sbjct: 638 KCSDQIVDFFREFTVHVDGLGYVCSFAVFDFKKGPGHPDRQRIPQDVREDYYATKHGKMA 697

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 698 ASYYGFLDNY 707



>gi|310795050|gb|EFQ30511.1| autophagy protein Apg9 [Glomerella graminicola M1.001]
          Length = 920

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 169/250 (67%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP S F  R++T  A WKFREFNE+ HLFH+R++ SY  A++YIDQFPK  T        
Sbjct: 477 DP-STFSHRRYTPLAEWKFREFNEVPHLFHERINMSYPFASRYIDQFPKKMTEQFARMVT 535

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ T+VL +A+++DP LFLGFEIT  R+  FY G+   ++A +RGMI ++  VFDP+
Sbjct: 536 FVAGAITSVLAVASFLDPQLFLGFEITKDRSALFYIGLFAAIWAAARGMISEETTVFDPD 595

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+T Y PD W GRLHT +V+REF +L+++K+++ I+EI  ++   F+L +S  
Sbjct: 596 YALRNVIEYTRYMPDTWNGRLHTADVKREFSELYKLKLLILIEEILGILTASFVLIYSAP 655

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKME 256
            CS QIIDFFREFT+HVDGVG +CSFA FDF+K  G  K    A +V  +YY +K  KM 
Sbjct: 656 KCSDQIIDFFREFTIHVDGVGYICSFAEFDFKKGVGKAKQQVGAGDVREDYYSTKHNKMA 715

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 716 ASYYGFLDNY 725



>gi|512205638|gb|EPE34459.1| Autophagy-related protein 9 [Glarea lozoyensis ATCC 20868]
          Length = 921

 Score =  244 bits (622), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 161/244 (65%), Gaps = 3/244 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G R +T  A WKFREFNEL H+FH+RL+ SY  A +Y++QFPK KT           
Sbjct: 485 STIGQRSYTPLAEWKFREFNELEHMFHERLNMSYFFATRYLEQFPKVKTGHFATFVMFVT 544

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS  AVL +A  +DP++F  FEI    +V  +   L  ++AV  G +P+ + VFDPE  +
Sbjct: 545 GSIIAVLSIAALLDPEMFFSFEIAGDTSVALWITGLGAIWAVMSGSVPEPNGVFDPEQEM 604

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+++THY P  W GRL T++V REF  L+++K++ + QEIF +I TPF+L  SL  C+
Sbjct: 605 RSVIQYTHYGPPHWEGRLETNDVMREFSSLYQMKLLQFFQEIFCIIATPFVLGVSLPRCA 664

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYG--APASEVENEYYLSKDGKMEKS 258
            QIIDFFREFTVHVDGVG VCSFA+FDF K G+ + G  AP ++  ++YY +K GKM  S
Sbjct: 665 DQIIDFFREFTVHVDGVGYVCSFAVFDF-KRGDGRNGGQAPVADARDDYYSTKHGKMTAS 723

Query: 259 FLNF 262
           +  F
Sbjct: 724 YYGF 727



>gi|409082232|gb|EKM82590.1| hypothetical protein AGABI1DRAFT_35166 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 584

 Score =  242 bits (618), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 158/219 (72%), Gaps = 2/219 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           SDP S+ GSR++T +A+WKFREFNEL H F +RLD+SY  AN YI QFP  K        
Sbjct: 345 SDPSSV-GSRRYTSYAKWKFREFNELPHFFTRRLDESYPLANIYIGQFPNEKISLIMRFV 403

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               G+FTAVL LA+ +D DL L FE++   TV FY  +   + A +RGMIP+++ VFDP
Sbjct: 404 SFVAGAFTAVLALASVLDTDL-LKFELSPHGTVAFYLALFGGIMAATRGMIPEENRVFDP 462

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + +V+ +THY P++W+ +LH+ ++ ++F +LF +KV+++ QE+ SV+ TPF+LWFSL
Sbjct: 463 ELLMTEVITYTHYMPEDWKNQLHSKKIHQDFGELFSMKVLIFAQELISVVLTPFVLWFSL 522

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK 235
            DC+  IIDFFREF+VHVDG G VCSFA F+F +HGNVK
Sbjct: 523 PDCAPAIIDFFREFSVHVDGRGYVCSFAEFNFERHGNVK 561



>gi|470326644|ref|XP_004364748.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gi|320166937|gb|EFW43836.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 1005

 Score =  240 bits (613), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 165/268 (61%), Gaps = 6/268 (2%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
           G+RQWT +ARW  REFNEL H+F  RL+  YKPA+KYI +F                G+F
Sbjct: 500 GARQWTPYARWWLREFNELPHIFQARLNNGYKPASKYISKFNSEFLALIARFIAFVLGAF 559

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            A++I  +  + D  L   +  GR++F+  GVL+ +  V R +IPD++LVFDP   ++ V
Sbjct: 560 AAIIIAVSIYNEDFLLQVHLVEGRSMFWVLGVLIAILGVVRTLIPDENLVFDPPLLMRNV 619

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           V H H  P  W+ R HT EV  EF  LF++++V++ QE+FS I TP +L+F L   S+QI
Sbjct: 620 VYHIHMFPAHWKNREHTFEVAGEFSTLFDMRMVVFAQEVFSFILTPAMLFFKLPSTSRQI 679

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAP-----ASEVENEYYLSKDGKMEKS 258
           IDF R+ TV+ +GVG VCSFA+F+F ++GN  YG P     AS+      +S  GKMEKS
Sbjct: 680 IDFIRQVTVYENGVGYVCSFALFNFERNGNANYGVPLSDRAASQPVGARQISSHGKMEKS 739

Query: 259 FLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           FL+FKA + DW+P       YL  LT+ 
Sbjct: 740 FLSFKATNADWKPRKS-ARHYLDHLTQI 766



>gi|367032300|ref|XP_003665433.1| hypothetical protein MYCTH_2309135 [Myceliophthora thermophila ATCC
           42464]
 gi|347012704|gb|AEO60188.1| hypothetical protein MYCTH_2309135 [Myceliophthora thermophila ATCC
           42464]
          Length = 895

 Score =  238 bits (608), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 160/245 (65%), Gaps = 1/245 (0%)

Query: 23  FGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGS 82
             +R +T  A WKFREFNEL HLF +RL  S+  A+ YIDQFPKAKT           GS
Sbjct: 465 LAARTYTPLAEWKFREFNELPHLFQKRLAMSHPFASHYIDQFPKAKTEMLAWTVAFISGS 524

Query: 83  FTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKK 142
             +VL+ A+ +D +L + FEIT G+TV FY  V   ++A +R    D+   FDPE  ++ 
Sbjct: 525 LASVLVAASILDSELVMTFEITPGKTVIFYLAVFGTIWAGARASTSDEKSAFDPEYAMRN 584

Query: 143 VVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQ 202
           V+++THY PD W+ RLH+ +++ EF +L++ KV+++I+EI S+I  P +L+FSL   S Q
Sbjct: 585 VIQYTHYEPDHWKNRLHSSDIKVEFSELYKPKVMVFIEEILSIIHAPLVLFFSLPKSSDQ 644

Query: 203 IIDFFREFTVHVDGVGDVCSFAIFDFRKH-GNVKYGAPASEVENEYYLSKDGKMEKSFLN 261
           IIDFFREFT+HVDG+G VC+FA FDF K  G  K      +V ++YY +K GKME S+  
Sbjct: 645 IIDFFREFTIHVDGLGYVCTFAEFDFSKGVGKNKSNNGERDVRDDYYSTKHGKMEASYYG 704

Query: 262 FKANH 266
           F  N+
Sbjct: 705 FMGNY 709



>gi|50555498|ref|XP_505157.1| YALI0F08349p [Yarrowia lipolytica]
 gi|73619470|sp|Q6C2F5.1|ATG9_YARLI RecName: Full=Autophagy-related protein 9
 gi|49651027|emb|CAG77964.1| YALI0F08349p [Yarrowia lipolytica CLIB122]
          Length = 788

 Score =  236 bits (603), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 169/256 (66%), Gaps = 14/256 (5%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI G+R++   A WK RE+NEL H F +RL  SY PA+KY+DQFPK KT        
Sbjct: 424 NPASI-GTRRYNPLAEWKLREYNELPHQFERRLTLSYIPASKYLDQFPKEKTALVSKFVS 482

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSF AVL +A+ IDP+LFL FEI+  RTV FY GV   + AVSR +IP++ LVFDPE
Sbjct: 483 FIAGSFAAVLGIASLIDPELFLMFEISANRTVLFYIGVFGSILAVSRSLIPEETLVFDPE 542

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V E THY P EW G+LHT++V+ EF  ++E+++++ ++E+ S+   PFIL++SL 
Sbjct: 543 ISLRYVAEFTHYLPPEWEGKLHTEQVKNEFSLMYEMRLIILLKELASIFLAPFILYYSLT 602

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
                I+DF R+ +VHVDG+G VC+FA+FDF++       +P  + +      +D KM K
Sbjct: 603 QSCDDIVDFIRDHSVHVDGLGYVCTFAMFDFKQK------SPDHQPD------EDQKMLK 650

Query: 258 SFLNFKANHPDWEPTD 273
           S+L F  ++ D +PT+
Sbjct: 651 SYLYFMDHYGD-KPTN 665



>gi|331219555|ref|XP_003322454.1| hypothetical protein PGTG_03991 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309301444|gb|EFP78035.1| hypothetical protein PGTG_03991 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 1074

 Score =  234 bits (597), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 181/302 (59%), Gaps = 33/302 (10%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P SI GSR +T+ A+WKFRE+NEL HLF +RL  S   + +YIDQFPK KT        
Sbjct: 564 NPASI-GSRSFTRLAQWKFREYNELPHLFQERLVSSCCLSKQYIDQFPKTKTTILAKFVS 622

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDH--LVFD 135
              GSF  VLIL +  DPD FL FEIT  R+V FY G+   + A+SRGMI  ++   +  
Sbjct: 623 FIAGSFAGVLILLSLYDPDAFLHFEITPERSVLFYIGLFGSILAISRGMIKQEYEEKIER 682

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
           P   ++++V  THY P  W G+LH  +V  +F QLF++++V ++ E+ S++ TPFI W++
Sbjct: 683 PGDLMERIVGLTHYLPSHWYGKLHGLDVYNDFGQLFQLRIVNFLNELMSILLTPFIFWYN 742

Query: 196 L-ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDF------------------RKHGNVKY 236
              D  Q+II+FFREFT+HVDG+G VCSF++FDF                  R   + ++
Sbjct: 743 FDLDRCQRIIEFFREFTIHVDGIGYVCSFSVFDFNKLDLDASPGPSSNPNQPRHPSDTRH 802

Query: 237 GAPASEVENEYYLSKD-----------GKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           G PA + +++ +                KME+S L+F A+HP+WEP++   SLYLS+   
Sbjct: 803 GRPAGQHQHQQHQHHQPTMASVQQNDINKMERSLLSFVAHHPNWEPSNQTASLYLSKAIG 862

Query: 286 FN 287
           F+
Sbjct: 863 FS 864



>gi|189191720|ref|XP_001932199.1| membrane protein Gsa14p [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973805|gb|EDU41304.1| membrane protein Gsa14p [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 904

 Score =  234 bits (596), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 216/435 (49%), Gaps = 36/435 (8%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL H F +R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHYFARRRNMAYPYANLYLAQFPKDKTEQVSSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL++ T +D +LFL FEIT G+T  F+ G+L  ++ V+RG  P D  V DP 
Sbjct: 534 FVAGAFAFVLVVFTLLDSELFLNFEITPGKTAIFWIGILTTVYRVARGSSPQDDQVTDPS 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y P+ WR RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLNHVIYHTRYEPESWRDRLHTDEVRAEFTELYQPKILIFAEEILSMVITPFLLIFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIF----DFRKHGNVKYGAPASEVEN-----EYY 248
            CS++I+DFFREF++ VDG+G  CS+++F      R   N+   AP +  E+     +Y+
Sbjct: 654 KCSERIVDFFREFSIVVDGLGVTCSYSMFPSTKTTRNANNIPANAPGARREDPDLREDYF 713

Query: 249 LSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFNN-QAHPERPNAARTSVVDSIL 307
           ++KD KM  S+  F     D   T   GS    RL   +N    P+ PN   T      +
Sbjct: 714 MAKDNKMMASYYGFL----DTYQTPARGS--NGRLQGRSNFHPPPQFPNTFGT------M 761

Query: 308 KTTXXXXXXXXXXXVHFSYPIGSQSTTHYTNAXXXXXXXXDDLNSIMEDGQTHAGPSHIT 367
             T                  G Q +              D  NS++ D       + I 
Sbjct: 762 SQTAQPVDVATARGTSRGPATGRQPSFQNKPPRHRPGARDDSFNSVLLDPHHQPSSASIL 821

Query: 368 RGSYRG-----YGIXXXXXXXXXXXXXXQEHYTSELGDSFILPGARIGGAGINESNEHDK 422
           RGS R      Y                +    S LGDS+    +R+      +  E + 
Sbjct: 822 RGSPRQAANNRYRTPLQPVSDAPGPSNTRIEEESTLGDSWRT--SRLA----QDEEEEEA 875

Query: 423 PRN--GGVIGLLNQF 435
           PRN  GGV+ LL QF
Sbjct: 876 PRNNRGGVLQLLQQF 890



>gi|330946384|ref|XP_003306762.1| hypothetical protein PTT_19973 [Pyrenophora teres f. teres 0-1]
 gi|311315625|gb|EFQ85153.1| hypothetical protein PTT_19973 [Pyrenophora teres f. teres 0-1]
          Length = 905

 Score =  233 bits (594), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 152/435 (34%), Positives = 213/435 (48%), Gaps = 35/435 (8%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL H F +R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHYFARRRNMAYPYANLYLAQFPKDKTEQVSSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL++ T +D +LFL FEIT G+T  F+ G+L  ++ V+RG  P D  V DP 
Sbjct: 534 FVAGAFAFVLVVFTLLDSELFLNFEITPGKTAIFWIGILSTVYRVARGSSPQDDQVTDPS 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y P+ WR RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLNHVIYHTRYEPESWRDRLHTDEVRAEFTELYQPKILIFAEEILSMVITPFLLIFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIF----DFRKHGNVKYGAPASEVEN-----EYY 248
            CS++I+DFFREF++ VDG+G  CS+++F      R   N+   AP +  E+     +Y+
Sbjct: 654 KCSERIVDFFREFSIVVDGLGVTCSYSMFPSTKTTRNANNIPANAPGARREDPDLREDYF 713

Query: 249 LSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFNN-QAHPERPNAARTSVVDSIL 307
           ++KD KM  S+  F     D   T   G  Y  RL   +N    P+ PN   T      +
Sbjct: 714 MAKDNKMMASYYGFL----DTYQTPARG--YNGRLQGRSNFHPPPQFPNTFGT------M 761

Query: 308 KTTXXXXXXXXXXXVHFSYPIGSQSTTHYTNAXXXXXXXXDDLNSIMEDGQTHAGPSHIT 367
             T                    Q                D  NS++ D       + I 
Sbjct: 762 SQTAQPVDVATARGASRGPTTSRQPNFQNKPPRHRPGARDDSFNSVLLDPHHQPSSASIL 821

Query: 368 RGSYRG-----YGIXXXXXXXXXXXXXXQEHYTSELGDSFILPGARIGGAGINESNEHDK 422
           RGS R      Y                +    S LGDS+     R      ++  E + 
Sbjct: 822 RGSPRQAANNRYRTPLQLVSDGPGPSNTRIEEESTLGDSW-----RTSRLAQDDDEEEEA 876

Query: 423 PRN--GGVIGLLNQF 435
           PRN  GGV+ LL QF
Sbjct: 877 PRNNRGGVLQLLQQF 891



>gi|470238444|ref|XP_004353880.1| RasGTPase-activating protein [Dictyostelium fasciculatum]
 gi|328866085|gb|EGG14471.1| RasGTPase-activating protein [Dictyostelium fasciculatum]
          Length = 2325

 Score =  233 bits (594), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 127/290 (43%), Positives = 172/290 (59%), Gaps = 10/290 (3%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           S PGS+ GSR+W+  A+WKFREFNELSH F  RL+ SY  ANKY+D FP           
Sbjct: 351 SKPGSL-GSREWSPLAKWKFREFNELSHYFKTRLNLSYSHANKYVDSFPSETVSIMAKFI 409

Query: 77  XXXXGSFTAV-LILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFD 135
               GS  AV LI   Y D D    F+I  G+T  +Y G+     AV + ++ D++ V  
Sbjct: 410 SFILGSILAVFLIFGIYSD-DFLFNFDIY-GKTPIWYVGIFGTAVAVCKSLVVDENQVAR 467

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
           P  ++ +VV++T Y P  W+G+ HT  VR EF+ LFE +VV +++E+ SVIF PFIL FS
Sbjct: 468 PAIQMTRVVQYTRYCPRSWKGKSHTYSVRDEFLTLFEFRVVNFLREVSSVIFAPFILIFS 527

Query: 196 LADCSQQIIDFFREFTVHVDGVGDVCSFAIF-DFRKHGNVKYGAPASEVENEYYLSKDGK 254
           L  CS  I+DF   FTV V+GVG +CSF  F D +KHG+ KYG  A++  ++YY +K GK
Sbjct: 528 LPKCSLDILDFIGTFTVRVNGVGLICSFGAFTDVKKHGSKKYG--ATQDADKYYKTKQGK 585

Query: 255 MEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVVD 304
           +EKS +NF   +P+W+P    G   L  L +F  Q      N   +  VD
Sbjct: 586 LEKSIVNFSLIYPEWKPA---GHEILDNLNQFQKQQQTNGTNQNSSGRVD 632



>gi|396500538|ref|XP_003845744.1| similar to autophagy protein Apg9 [Leptosphaeria maculans JN3]
 gi|312222325|emb|CBY02265.1| similar to autophagy protein Apg9 [Leptosphaeria maculans JN3]
          Length = 912

 Score =  233 bits (594), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 114/254 (44%), Positives = 162/254 (63%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL HLF +R + +Y  AN Y+ QFPK KT        
Sbjct: 482 DPGQL-SNRDFTTFAQWKFREFNELPHLFARRRNMAYPYANLYLAQFPKDKTEQISSFVA 540

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL+  T +D +LFL FEIT G+T  F+ GVL  ++ V+RG  P +  V DP 
Sbjct: 541 FVAGAFAFVLVAFTLLDSELFLNFEITPGKTAIFWIGVLGTIYRVARGSSPQEDQVTDPS 600

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HTHY P+ W+ RLHTDEVR EF +L++ KV+++ +EI S++ TPF+L F L 
Sbjct: 601 YYLNHVIYHTHYEPESWQDRLHTDEVRAEFSKLYQPKVLIFAEEILSMVITPFLLMFRLP 660

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
           DCS++I+DFFREF++ VDG+G  CS+++F F K        PA+         ++  +Y+
Sbjct: 661 DCSERIVDFFREFSIVVDGLGVTCSYSMFPFNKGTRAANNIPANGTGARREDPDLREDYF 720

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 721 MAKDNKMLASYYGF 734



>gi|121930818|sp|Q0UYL2.1|ATG9_PHANO RecName: Full=Autophagy-related protein 9
          Length = 899

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 164/254 (64%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL HLF++R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHLFNRRRNMAYPYANLYLAQFPKDKTEQISSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F +VL+  T +D +LFL FEI+ G+T  F+ GVL  ++ V+RG  P +  V DP 
Sbjct: 534 FIAGAFASVLVAFTLLDSELFLTFEISPGKTAIFWIGVLTTIYRVARGSSPQEDQVTDPS 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y PD W+ RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLDHVIYHTRYKPDSWQDRLHTDEVRAEFAKLYQPKILIFAEEILSMVVTPFLLMFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
            CS++I+DFFREF++ VDG+G  CS+++F F+K       APA+         ++  +Y+
Sbjct: 654 QCSERIVDFFREFSIVVDGLGVTCSYSMFPFKKGTQNVNNAPANRSGAHKDDGDLREDYF 713

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 714 MAKDNKMLASYYGF 727



>gi|169600621|ref|XP_001793733.1| hypothetical protein SNOG_03152 [Phaeosphaeria nodorum SN15]
 gi|160705480|gb|EAT89883.2| hypothetical protein SNOG_03152 [Phaeosphaeria nodorum SN15]
          Length = 775

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 164/254 (64%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL HLF++R + +Y  AN Y+ QFPK KT        
Sbjct: 425 DPGQL-SNRDFTTFAQWKFREFNELPHLFNRRRNMAYPYANLYLAQFPKDKTEQISSFVA 483

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F +VL+  T +D +LFL FEI+ G+T  F+ GVL  ++ V+RG  P +  V DP 
Sbjct: 484 FIAGAFASVLVAFTLLDSELFLTFEISPGKTAIFWIGVLTTIYRVARGSSPQEDQVTDPS 543

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y PD W+ RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 544 YYLDHVIYHTRYKPDSWQDRLHTDEVRAEFAKLYQPKILIFAEEILSMVVTPFLLMFRLP 603

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
            CS++I+DFFREF++ VDG+G  CS+++F F+K       APA+         ++  +Y+
Sbjct: 604 QCSERIVDFFREFSIVVDGLGVTCSYSMFPFKKGTQNVNNAPANRSGAHKDDGDLREDYF 663

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 664 MAKDNKMLASYYGF 677



>gi|320581070|gb|EFW95292.1| Autophagy-related protein 9 [Ogataea parapolymorpha DL-1]
          Length = 889

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 161/245 (65%), Gaps = 3/245 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S+ GSR+++ +ARWK REFNEL H+F +RL  S   A +YI+QFPK  T           
Sbjct: 500 SLVGSREYSPYARWKLREFNELPHMFDKRLKMSRARATEYINQFPKEATNIILNFVAFVT 559

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   +L++ T +  + FL FE+T GRTV FY   L  +F + +G + ++  VFDPEA L
Sbjct: 560 GSLVTILVVLTVLGHENFLNFELTEGRTVLFYISTLGAIFTICKGSVSENDTVFDPEASL 619

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V + THY P+ W GR HT+EV+ EF +LF ++++L ++EI S+I  P+IL+  L D S
Sbjct: 620 RYVAQFTHYLPNSWNGRFHTEEVKNEFCKLFNLRLILVLKEITSLIMLPYILYCRLPDVS 679

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDF-RKHGNVKYGAPA--SEVENEYYLSKDGKMEK 257
           +++IDFFREF+VHVDG+G VC+FA+F+F  K   V+  A     +++ EYY + D KM K
Sbjct: 680 EKVIDFFREFSVHVDGLGYVCTFAMFEFDSKDKPVRSQAANDDDDLKQEYYTADDDKMVK 739

Query: 258 SFLNF 262
           S+L F
Sbjct: 740 SYLYF 744



>gi|166990643|sp|A7KAI7.1|ATG9_PICAN RecName: Full=Autophagy-related protein 9
 gi|129714854|gb|ABO31292.1| Atg9p [Ogataea angusta]
          Length = 889

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 161/245 (65%), Gaps = 3/245 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S+ GSR+++ +ARWK REFNEL H+F +RL  S   A +YI+QFPK  T           
Sbjct: 500 SLVGSREYSPYARWKLREFNELPHMFDKRLKMSRARATEYINQFPKEATNIILNFVAFVT 559

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS   +L++ T +  + FL FE+T GRTV FY   L  +F + +G + ++  VFDPEA L
Sbjct: 560 GSLVTILVVLTVLGHENFLNFELTEGRTVLFYISTLGAVFTICKGSVSENDTVFDPEASL 619

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V + THY P+ W GR HT+EV+ EF +LF ++++L ++EI S+I  P+IL+  L D S
Sbjct: 620 RYVAQFTHYLPNSWNGRFHTEEVKNEFCKLFNLRLILVLKEITSLIMLPYILYCRLPDVS 679

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDF-RKHGNVKYGAPA--SEVENEYYLSKDGKMEK 257
           +++IDFFREF+VHVDG+G VC+FA+F+F  K   V+  A     +++ EYY + D KM K
Sbjct: 680 EKVIDFFREFSVHVDGLGYVCTFAMFEFDSKDKPVRSQAANDDDDLKQEYYTADDDKMVK 739

Query: 258 SFLNF 262
           S+L F
Sbjct: 740 SYLYF 744



>gi|213406990|ref|XP_002174266.1| conserved hypothetical protein [Schizosaccharomyces japonicus
           yFS275]
 gi|212002313|gb|EEB07973.1| conserved hypothetical protein [Schizosaccharomyces japonicus
           yFS275]
          Length = 701

 Score =  231 bits (590), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 118/277 (42%), Positives = 161/277 (58%), Gaps = 22/277 (7%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +P S+ G+R++T  A+W+FREFNEL H+F +R++ SY+ A+ YI QFP            
Sbjct: 421 NPSSL-GARRYTPLAQWRFREFNELQHVFEKRMNASYEAASHYISQFPNINLIRLAKFVT 479

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTA+L+L T I+PDL L FE+T  R + FY G+   L AV R  IP+D LVFDPE
Sbjct: 480 LVLGSFTAILVLLTIIEPDLALTFELTDDRPILFYLGIFGTLIAVVRSAIPEDTLVFDPE 539

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
           A LK+VVE+THY P  W+ ++H+ EV+ EF   +  +V   + EI  V++TPF LW    
Sbjct: 540 ASLKEVVEYTHYLPASWKDKMHSKEVQAEFCAFYAFRVTTLLWEIIGVLYTPFFLWKIAP 599

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHG-----------NVKYGAPASEVENE 246
           + S  +IDFFRE TV+V GVG+VCSFA+F     G              Y +P S     
Sbjct: 600 ERSAAVIDFFREHTVNVSGVGNVCSFAVFHSSTRGPATSKARETFTRTSYPSPMSHKVAA 659

Query: 247 YYLSKDG----------KMEKSFLNFKANHPDWEPTD 273
            Y +  G          KM+ S LNF A +P+W P +
Sbjct: 660 VYGASAGPQARDAFLRDKMQLSILNFAATNPEWIPQN 696



>gi|477532452|gb|ENH84076.1| autophagy protein [Colletotrichum orbiculare MAFF 240422]
          Length = 922

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 162/250 (64%), Gaps = 2/250 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP S F  R++T  A WKFR FNEL HLF +RL+ SY  A+ Y+DQFPK  T        
Sbjct: 480 DP-STFSHRRYTPLAEWKFRGFNELPHLFQERLNMSYPIASVYMDQFPKKMTEQFARSVT 538

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ T VL +A++++P+ FLGFE+  G++  FY G+    +A +RGMI ++  VF+PE
Sbjct: 539 FIAGAITFVLAVASFLEPEHFLGFELVLGKSALFYIGIFAATWAAARGMISEETTVFNPE 598

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+E+  Y PD W+GRLHT E++REF  L+++KV++ I+EI  +I    +L  S  
Sbjct: 599 YALRSVIEYIRYMPDHWQGRLHTAEIKREFSGLYKLKVLILIEEILGIITASLVLIISAP 658

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS-EVENEYYLSKDGKME 256
            CS QIIDFFREFT+HVDGVG VCSFA+FDF+     +    AS +V  +YY +K GKM 
Sbjct: 659 KCSDQIIDFFREFTIHVDGVGYVCSFAVFDFKAAAGKEMKPSASGDVREDYYSTKHGKMA 718

Query: 257 KSFLNFKANH 266
            S+  F  N+
Sbjct: 719 ASYYGFLENY 728



>gi|407924578|gb|EKG17611.1| Autophagy-related protein 9 [Macrophomina phaseolina MS6]
          Length = 818

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 160/250 (64%), Gaps = 6/250 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  + GSR +T  A WKFREFNEL HLF QR + +Y  A +Y++QFPK K+        
Sbjct: 387 DPSQL-GSRMFTPMAEWKFREFNELRHLFEQRRNIAYPYAERYLNQFPKNKSDQICEFVA 445

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDD-HLVFDP 136
                  AVL+LA+ + P+     EI  G+ VFF+ GVL  ++A +R  I ++  +V  P
Sbjct: 446 FVASIGIAVLVLASLLYPETITRLEILPGKPVFFWIGVLSAIYAAARNQIANEADMVMLP 505

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L++V+  THY P  WR R HTDEVR++F +L+++K+V++ +E+ S++ TPF+LW SL
Sbjct: 506 EQALEEVIAITHYCPSSWRDRFHTDEVRKDFSKLYQMKLVIFFEEVLSMVLTPFVLWHSL 565

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASE----VENEYYLSKD 252
             CS++IIDFFREFT+HVDG+G VCS+A+FDF+K  N+       +      + +Y   D
Sbjct: 566 PQCSERIIDFFREFTIHVDGLGHVCSYAVFDFKKTDNIAQDNQTQQQTAGARHGWYRIND 625

Query: 253 GKMEKSFLNF 262
           GK++ S + F
Sbjct: 626 GKLDASMVGF 635



>gi|302800349|ref|XP_002981932.1| hypothetical protein SELMODRAFT_50959 [Selaginella moellendorffii]
 gi|300150374|gb|EFJ17025.1| hypothetical protein SELMODRAFT_50959 [Selaginella moellendorffii]
          Length = 570

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/263 (42%), Positives = 161/263 (61%), Gaps = 5/263 (1%)

Query: 25  SRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSFT 84
           SR+W+  A+W FREFNEL H+F+QRL+ SYKPA +Y+ QFP               G   
Sbjct: 311 SRRWSNLAKWTFREFNELEHMFNQRLNASYKPAVEYVKQFPSPIVSKVAKFVSFVSGGLA 370

Query: 85  AVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKVV 144
           AVLI+  ++D  L        GR + +   V   + A+S+    D++ VFDPE  ++ V 
Sbjct: 371 AVLIIIAFLDESLLEA--QLFGRNLLWMAAVFGTITAISKQCTADENQVFDPEGFMRYVA 428

Query: 145 EHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQII 204
           +HTHY P  WRG  +T  +R EF +LF+   V+ ++E+ S+  TPFIL   L +C   ++
Sbjct: 429 QHTHYMPKHWRGAEYTIRIRLEFEKLFQYTGVMLLEEMISIFVTPFILIVLLPECVDDVL 488

Query: 205 DFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNFKA 264
            F ++FTV++ GVGDVCS A+FDF  HGN+KYG+P    ++    S  GKMEKSFL+FK+
Sbjct: 489 QFVQDFTVNLSGVGDVCSLAVFDFEHHGNMKYGSPCFTAKDRR--SNQGKMEKSFLSFKS 546

Query: 265 NHPDWEPTDPFGSLYLSRLTEFN 287
           N+P+WEP D  G  +L+ L +F 
Sbjct: 547 NYPNWEP-DAKGKQFLNLLAQFR 568



>gi|302802311|ref|XP_002982911.1| hypothetical protein SELMODRAFT_50960 [Selaginella moellendorffii]
 gi|300149501|gb|EFJ16156.1| hypothetical protein SELMODRAFT_50960 [Selaginella moellendorffii]
          Length = 570

 Score =  228 bits (581), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/263 (42%), Positives = 161/263 (61%), Gaps = 5/263 (1%)

Query: 25  SRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSFT 84
           SR+W+  A+W FREFNEL H+F+QRL+ SYKPA +Y+ QFP               G   
Sbjct: 311 SRRWSNLAKWTFREFNELEHMFNQRLNASYKPAVEYVKQFPSPIVSKVAKFVSFVSGGLA 370

Query: 85  AVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKVV 144
           AVLI+  ++D  L        GR + +   V   + A+S+    D++ VFDPE  ++ V 
Sbjct: 371 AVLIIIAFLDESLLEA--QLFGRNLLWMAAVFGTITAISKQCTADENQVFDPEGFMRYVA 428

Query: 145 EHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQII 204
           +HTHY P  WRG  +T  +R EF +LF+   V+ ++E+ S+  TPFIL   L +C   ++
Sbjct: 429 QHTHYMPKHWRGAEYTIRIRLEFEKLFQYTGVMLLEEMISIFVTPFILIVLLPECVDDVL 488

Query: 205 DFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNFKA 264
            F ++FTV++ GVGDVCS A+FDF  HGN+KYG+P    ++    S  GKMEKSFL+FK+
Sbjct: 489 QFVQDFTVNLSGVGDVCSLAVFDFEHHGNMKYGSPCFTAKDRR--SNQGKMEKSFLSFKS 546

Query: 265 NHPDWEPTDPFGSLYLSRLTEFN 287
           N+P+WEP D  G  +L+ L +F 
Sbjct: 547 NYPNWEP-DAKGKQFLNLLAQFR 568



>gi|168020908|ref|XP_001762984.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685796|gb|EDQ72189.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 585

 Score =  228 bits (581), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 164/270 (60%), Gaps = 7/270 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNE-LSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           +P S+  SR+W+  A+W FREFNE L H+F  RL+ SYK A +Y+ QFP           
Sbjct: 321 NPASM-SSRRWSNLAKWNFREFNEVLEHMFKHRLNSSYKHAVEYVKQFPSPIISMIAKLV 379

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               G+F AV++L + ID  L  G        + +YT     +  VSR +I +D+ VFDP
Sbjct: 380 SYVAGAFAAVILLISLIDESLLEGH--IGKHNLIWYTAFFAAILLVSRSLITEDYQVFDP 437

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
              ++++  HTHY P  WRG  +TD+VR EF  LF+ K  L+ +EI S+I TPFIL F+L
Sbjct: 438 VGVMRQITSHTHYMPKHWRGAENTDKVRIEFEGLFKYKAALFFEEIMSIIVTPFILIFAL 497

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKME 256
             C + ++ F  +FTV+++GVG VCS +IFDF  HGN KYG+P    ++    S  GKME
Sbjct: 498 PKCVEDVLLFVEDFTVYIEGVGHVCSLSIFDFEHHGNSKYGSPFHTSKDRR--SSQGKME 555

Query: 257 KSFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           KSF++FK N+P+WEP D  G   +S L +F
Sbjct: 556 KSFISFKTNYPNWEP-DGNGKQLMSVLADF 584



>gi|71152299|sp|Q876N4.1|ATG9_PICPA RecName: Full=Autophagy-related protein 9; AltName:
           Full=Glucose-induced selective autophagy protein 14
 gi|28192451|gb|AAL77196.1| membrane protein Gsa14p [Komagataella pastoris]
          Length = 885

 Score =  228 bits (581), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 165/272 (60%), Gaps = 27/272 (9%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P  I  SR+++ +ARWK REFNEL H+F++RL+ S + +NKYI+QFPK  T       
Sbjct: 471 TNPADI-SSREYSPYARWKLREFNELPHIFNRRLNISTESSNKYINQFPKETTTALLKFI 529

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GS   VL++ T +DP+ FL FE+T GRTV FY   L  +F + +  IPDD LVFDP
Sbjct: 530 MFISGSIVGVLVIVTILDPEFFLNFELTPGRTVLFYVSTLGAIFTICKNSIPDDTLVFDP 589

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L+ + + THY P EW G+ HT+EV+ +F +L+ +K+ L  +EI S +F P+IL + L
Sbjct: 590 EVSLRYLSQFTHYLPQEWEGKYHTEEVKNDFCKLYTLKLYLVGKEILSWLFLPYILCYKL 649

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR------------KHGNVKYGAPASEVE 244
            +C+  I DFFREF+VHVDG+G VC+FA+F F             ++GN   G P+++ +
Sbjct: 650 PECADTISDFFREFSVHVDGLGYVCTFAMFQFNNQHNENGNANVHQNGNGNGGVPSAKSK 709

Query: 245 NEYY--------------LSKDGKMEKSFLNF 262
           ++                +  D KM KS++ F
Sbjct: 710 SKKVPNPNRFTTKPSMRDMENDDKMIKSYMYF 741



>gi|254573670|ref|XP_002493944.1| Transmembrane protein involved in formation of Cvt and autophagic
           vesicles [Komagataella pastoris GS115]
 gi|238033743|emb|CAY71765.1| Transmembrane protein involved in formation of Cvt and autophagic
           vesicles [Komagataella pastoris GS115]
 gi|328354237|emb|CCA40634.1| Autophagy-related protein 9 [Komagataella pastoris CBS 7435]
          Length = 885

 Score =  228 bits (580), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 145/217 (66%), Gaps = 1/217 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           ++P  I  SR+++ +ARWK REFNEL H+F++RL+ S + +NKYI+QFPK  T       
Sbjct: 471 TNPADI-SSREYSPYARWKLREFNELPHIFNRRLNISTESSNKYINQFPKETTTALLKFI 529

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GS   VL++ T +DP+ FL FE+T GRTV FY   L  +F + +  IPDD LVFDP
Sbjct: 530 MFISGSIVGVLVIVTILDPEFFLNFELTPGRTVLFYVSTLGAIFTICKNSIPDDTLVFDP 589

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L+ + + THY P EW G+ HT+EV+ +F +L+ +K+ L  +EI S +F P+IL + L
Sbjct: 590 EVSLRYLSQFTHYLPQEWEGKYHTEEVKNDFCKLYTLKLYLVGKEILSWLFLPYILCYKL 649

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGN 233
            +C+  I DFFREF+VHVDG+G VC+FA+F F    N
Sbjct: 650 PECADTISDFFREFSVHVDGLGYVCTFAMFQFNNQHN 686



>gi|398396658|ref|XP_003851787.1| hypothetical protein MYCGRDRAFT_100550 [Zymoseptoria tritici
           IPO323]
 gi|339471667|gb|EGP86763.1| hypothetical protein MYCGRDRAFT_100550 [Zymoseptoria tritici
           IPO323]
          Length = 853

 Score =  227 bits (579), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 157/244 (64%), Gaps = 4/244 (1%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R +T FA WK R+ NEL HLF +RL ++Y  AN Y+ + PK KT           GSF
Sbjct: 442 SARAFTPFAEWKMRQLNELQHLFDRRLRQAYPFANDYVKEVPKDKTDQICRFVAFVSGSF 501

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVL LAT +D +LFLGFE+T GRTV F+  V+  +F V+ G +PD+H   DP   LK V
Sbjct: 502 AAVLTLATLLDSELFLGFEVTPGRTVVFWLTVMGVIFGVAHGALPDEHETHDPVRHLKDV 561

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +  THY P  W+GRLH++EVR EF  ++++KV+++++E+ S++  P+ILW +     ++I
Sbjct: 562 LLFTHYMPSHWKGRLHSNEVRAEFSAMYQMKVLIFVEEVASLVLAPWILWRNSGRNCERI 621

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASE----VENEYYLSKDGKMEKSF 259
           IDFFRE TVHV+GVG  C+FA+F F+K  NV+      E    + ++YY  KD KM  S 
Sbjct: 622 IDFFRETTVHVEGVGHQCNFAVFGFKKDPNVEDPTTMLEEPDGLRDDYYGLKDDKMAASM 681

Query: 260 LNFK 263
            NF+
Sbjct: 682 QNFQ 685



>gi|482807892|gb|EOA84825.1| hypothetical protein SETTUDRAFT_32064 [Setosphaeria turcica Et28A]
          Length = 902

 Score =  227 bits (578), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 111/254 (43%), Positives = 159/254 (62%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL H F +R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHYFARRRNMAYPYANLYLAQFPKDKTEQVSSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL+L T  D +LFL FEIT G+T  F+ G+L  ++ V+RG  P D  V DP 
Sbjct: 534 FIAGAFAFVLVLFTLFDSELFLNFEITPGKTAIFWIGILSTIYRVARGSSPQDDQVTDPS 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y P+ WR RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLNHVIYHTRYEPESWRDRLHTDEVRAEFTKLYQPKILIFAEEILSMVITPFLLIFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
           +CS++I+DFFREF++ VDG+G  CS+++F   K        PA+         ++  +Y+
Sbjct: 654 NCSERIVDFFREFSIVVDGLGVTCSYSMFPSTKTTRNANNIPANGTGARREDPDLREDYF 713

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 714 MAKDNKMMASYYGF 727



>gi|307104789|gb|EFN53041.1| hypothetical protein CHLNCDRAFT_137278 [Chlorella variabilis]
          Length = 899

 Score =  226 bits (577), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 164/268 (61%), Gaps = 21/268 (7%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           P S+ G+R+W+  A W+ REFNEL H    RL+ S+K A +YI QFP             
Sbjct: 279 PSSV-GARRWSPLAAWRLREFNELPHFIRHRLNASHKAAEEYIQQFPSPVLSHAARFVAF 337

Query: 79  XXGSFTAVLILATYIDP-----DLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLV 133
             GS  A+L++ T ID      DLF       GR + ++  V+  + A+SR  + +    
Sbjct: 338 VAGSVAALLLVVTLIDERLLERDLF-------GRQLVWWVAVVGVVLALSRAFVIESGTA 390

Query: 134 FDPEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEV-----KVVLYIQEIFSVIFT 188
           FDPEA L +VV HTHY P  WRGR HT EV++EF  LF+V     K +L+++E+ S++ T
Sbjct: 391 FDPEAALMEVVLHTHYLPRHWRGRAHTREVQQEFEALFQVGRQAFKALLFLEELSSILLT 450

Query: 189 PFILWFSLADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYY 248
           P +LWFSL  C+  ++ F    TV+V+GVGDVCS A FDF++HGN KYG+PA+    + Y
Sbjct: 451 PLLLWFSLPQCAGAVLSFVESNTVYVEGVGDVCSLAAFDFQRHGNAKYGSPAA--APKLY 508

Query: 249 LSKDGKMEKSFLNFKANHPDWEPTDPFG 276
            S+ GKMEKSFL+F A +P WEP DP G
Sbjct: 509 RSRQGKMEKSFLSFAATYPAWEP-DPAG 535



>gi|429849322|gb|ELA24723.1| autophagy protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 707

 Score =  226 bits (575), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 151/227 (66%), Gaps = 2/227 (0%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG+ F  R++T  A WKFREFNEL HLF +RL+ SY  A+ YIDQFPK  T        
Sbjct: 480 DPGT-FSHRRYTPLAEWKFREFNELPHLFQERLNMSYPAAHAYIDQFPKRLTEQFARSVT 538

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+ T+VL +A++++P+ FLGFE+  G++  FY GV    +A +RGMI ++  VF+PE
Sbjct: 539 FIAGAITSVLAIASFLEPEHFLGFELLFGKSALFYIGVFAAAWAAARGMISEETTVFNPE 598

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+   HY P  W  RLHT EV+REF +L+++KV++ ++EI  ++    +L FS  
Sbjct: 599 YALRNVIGFIHYMPAHWEARLHTAEVKREFSELYKLKVLILVEEIVGILTASLVLIFSAP 658

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHG-NVKYGAPASEV 243
            CS QIIDFFREFT+HVDGVG VCSFA+FDF+K     K+ A   ++
Sbjct: 659 KCSDQIIDFFREFTIHVDGVGYVCSFAVFDFKKGAERAKFQAATRDI 705



>gi|45187944|ref|NP_984167.1| ADR071Wp [Ashbya gossypii ATCC 10895]
 gi|71152298|sp|Q75A48.1|ATG9_ASHGO RecName: Full=Autophagy-related protein 9
 gi|44982728|gb|AAS51991.1| ADR071Wp [Ashbya gossypii ATCC 10895]
 gi|374107383|gb|AEY96291.1| FADR071Wp [Ashbya gossypii FDAG1]
          Length = 897

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/211 (49%), Positives = 146/211 (69%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+  +RQ+T  A WKFRE+NEL HLF +R+  SY+ AN YI+QFP A         
Sbjct: 505 TSPGSL-STRQYTPIAEWKFREYNELYHLFKKRMGLSYEVANTYINQFPNALGDYFFKFV 563

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L L T +DP+ FL FE+T  RTV FY  VL  ++AV    + D+  VFDP
Sbjct: 564 KFISGSFVAILALMTVLDPENFLNFELTADRTVLFYMTVLGTIWAVCHSAVNDNCSVFDP 623

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK+++ + HY+P EW GR HTDEV++EF +L+ ++V+L ++E+ S+I TPFILWFSL
Sbjct: 624 EDSLKELITYIHYAPKEWDGRYHTDEVKQEFCKLYNLRVILLLRELASLIMTPFILWFSL 683

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
            + ++ I+DFFRE TV+ DG+G VC +A+FD
Sbjct: 684 PNSAESIVDFFREVTVYGDGLGYVCKYAMFD 714



>gi|513031831|gb|AGO11840.1| AaceriADR071Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 893

 Score =  224 bits (570), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 144/211 (68%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+  +RQ+T  A WKFRE+NEL HLF +R+  SY+ AN YI+QFP A         
Sbjct: 505 TSPGSL-STRQYTPIAEWKFREYNELYHLFKKRMGLSYEVANTYINQFPNAMGDYFFKFV 563

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L L T +DP+ FL FE+T  RTV FY  VL  ++AV    + D+  VFDP
Sbjct: 564 KFISGSFVAILALMTVLDPENFLNFELTADRTVLFYMTVLGTIWAVCHSAVNDNCSVFDP 623

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK+++ + HY+P EW GR HTDEV++EF + + ++V+L ++E+ S+I TPFILWFSL
Sbjct: 624 EDSLKELITYIHYAPKEWEGRYHTDEVKQEFCKFYNLRVILLLRELASLIMTPFILWFSL 683

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
              ++ I+DFFRE TV+ DG+G VC +A+FD
Sbjct: 684 PSSAENIVDFFREVTVYGDGLGYVCKYAMFD 714



>gi|384246809|gb|EIE20298.1| APG9-domain-containing protein [Coccomyxa subellipsoidea C-169]
          Length = 609

 Score =  223 bits (569), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (61%), Gaps = 4/258 (1%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
           G+R+W+  A W+ REFNEL H  + RL+ S+K A KYI QFP               GSF
Sbjct: 269 GARRWSSLAAWRLREFNELPHYLNHRLNASHKAAEKYIQQFPSPVLSHMAKFVAFLAGSF 328

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            A+L+    +D D  L   +  GR + ++   L  + AVSR  I +  + F+PE  L +V
Sbjct: 329 AALLLFMALVD-DTLLERHLF-GRNLVWWAATLGIVLAVSRAFIAEAGVAFEPELALLEV 386

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           V HTH+ P  WRGR HT EV+++F +LF+ K +L+++E+ S++ TPF+L+FSL  C+  I
Sbjct: 387 VAHTHWLPRHWRGRAHTQEVQQQFQELFQFKALLFLEEMASIVLTPFVLYFSLPKCAPAI 446

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNFK 263
           + F R+F+VHV GVGD+CS   FDF +HGN KYG+P+   +     S+ GKMEKSFL+F 
Sbjct: 447 LAFVRDFSVHVPGVGDICSLGAFDFERHGNSKYGSPSQAPKAAR--SRQGKMEKSFLSFA 504

Query: 264 ANHPDWEPTDPFGSLYLS 281
           A +P WEP      + LS
Sbjct: 505 ATYPTWEPDSAAKQMLLS 522



>gi|452004678|gb|EMD97134.1| hypothetical protein COCHEDRAFT_1220612 [Bipolaris maydis C5]
 gi|477587319|gb|ENI04401.1| hypothetical protein COCC4DRAFT_72897 [Bipolaris maydis ATCC 48331]
          Length = 904

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/254 (42%), Positives = 158/254 (62%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL H F +R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHYFARRRNMAYPYANLYLAQFPKDKTEQLSSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL+L T +  +LFL FEIT G+T  F+ G+L  ++ V+RG  P +  V DP 
Sbjct: 534 FIAGAFAFVLVLFTLLGSELFLNFEITPGKTAIFWIGILTTVYRVARGSSPQEDQVTDPA 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y P+ WR RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLNHVIYHTRYEPESWRDRLHTDEVRAEFTKLYQPKILIFAEEILSMVVTPFLLIFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
            CS++I+DFFREF++ VDG+G  CS+++F   K        PA+         ++  +Y+
Sbjct: 654 KCSERIVDFFREFSIVVDGLGVTCSYSMFPSTKTTRNANNIPANGTSARREDPDLREDYF 713

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 714 MAKDNKMMSSYYGF 727



>gi|303276264|ref|XP_003057426.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461778|gb|EEH59071.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 574

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/255 (43%), Positives = 151/255 (59%), Gaps = 5/255 (1%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           P ++ G+R W+  +RWK REFNEL H    RL  ++K A KY+ QFP             
Sbjct: 312 PAAV-GARSWSPESRWKLREFNELKHFHEHRLTAAHKHATKYLSQFPSPVVSMIAKFVSY 370

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             G+F A+ I    ID DL L  E+  GR + ++T VL  L A SRGMI + + VF+P  
Sbjct: 371 VVGAFAAMCIACALIDDDL-LHAEVF-GRDLLWHTAVLGTLLAASRGMIGEANKVFEPNR 428

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            + +VV HTHY P  WR   H  EV+ EF ++F  K   + +E+ S+   PF+LW+ L +
Sbjct: 429 LMAEVVSHTHYLPRRWRDAAHKAEVQAEFEEMFPFKAATFAKEMLSIFVAPFVLWYPLCE 488

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKS 258
            + +I+ F R FTVH  GVGDVCS + FDFR+HGN KYGA  +  +     SK GKMEKS
Sbjct: 489 SAPEIVSFVRNFTVHRQGVGDVCSLSAFDFRRHGNAKYGAGTTARKPAR--SKQGKMEKS 546

Query: 259 FLNFKANHPDWEPTD 273
           FL+F A +P WEP +
Sbjct: 547 FLSFHAQYPTWEPDE 561



>gi|451853257|gb|EMD66551.1| hypothetical protein COCSADRAFT_169464 [Bipolaris sorokiniana
           ND90Pr]
          Length = 904

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/254 (42%), Positives = 158/254 (62%), Gaps = 10/254 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DPG +  +R +T FA+WKFREFNEL H F +R + +Y  AN Y+ QFPK KT        
Sbjct: 475 DPGQL-SNRDFTTFAQWKFREFNELPHYFARRRNMAYPYANLYLAQFPKDKTEQLSSFVA 533

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              G+F  VL+L T +  +LFL FEIT G+T  F+ G+L  ++ V+RG  P +  V DP 
Sbjct: 534 FIAGAFAFVLVLFTLLGSELFLNFEITPGKTAIFWIGILTTVYRVARGSSPQEDQVTDPA 593

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L  V+ HT Y P+ WR RLHTDEVR EF +L++ K++++ +EI S++ TPF+L F L 
Sbjct: 594 YYLNHVIYHTRYEPESWRDRLHTDEVRAEFTKLYQPKILIFAEEILSMVVTPFLLIFRLP 653

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPAS---------EVENEYY 248
            CS++I+DFFREF++ VDG+G  CS+++F   K        PA+         ++  +Y+
Sbjct: 654 KCSERIVDFFREFSIVVDGLGVTCSYSMFPSTKTTRNANNIPANGTGARREDPDLREDYF 713

Query: 249 LSKDGKMEKSFLNF 262
           ++KD KM  S+  F
Sbjct: 714 MAKDNKMMASYYGF 727



>gi|168052551|ref|XP_001778713.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669928|gb|EDQ56506.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 593

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 164/271 (60%), Gaps = 9/271 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNE-LSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           +P S+  SR+W+  A W FREFNE L H+F  RL+ SYK A +Y+ QFP           
Sbjct: 329 NPASM-SSRRWSNLAEWSFREFNEVLEHMFKHRLNSSYKYAVEYLKQFPSPIINTIAKLV 387

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGR-TVFFYTGVLVPLFAVSRGMIPDDHLVFD 135
               G+F AV+IL + ID  L  G     GR  + +YT        VSR +I +++ VFD
Sbjct: 388 SYIAGAFAAVIILISLIDESLLEG---HIGRHNLIWYTAFFTTALVVSRSLITEEYQVFD 444

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
           P   ++++  HTHY P  WRG  +T+ VR EF  +F+    L+ +EI S+  TPFIL F+
Sbjct: 445 PVGVMRQITSHTHYMPKHWRGAENTETVRLEFEGMFKYNAALFFEEIISIFVTPFILVFA 504

Query: 196 LADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKM 255
           L  C + ++ F ++FTV+V+GVG VCS ++FDF  HGN KYG+P    +     S  GKM
Sbjct: 505 LPKCVEDVLLFVQDFTVNVEGVGHVCSLSVFDFEHHGNSKYGSPFHTHKGRR--SSQGKM 562

Query: 256 EKSFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           EKSF++FKAN+P+WEP D  G  ++S LT+F
Sbjct: 563 EKSFISFKANYPNWEP-DGNGKQFMSMLTDF 592



>gi|452840116|gb|EME42054.1| hypothetical protein DOTSEDRAFT_72973 [Dothistroma septosporum
           NZE10]
          Length = 854

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 176/300 (58%), Gaps = 18/300 (6%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R +T FA WK REFNEL HLF  RL ++Y  AN Y+ QFPK K            G+ 
Sbjct: 460 SARTFTPFAEWKIREFNELDHLFAIRLRQAYPFANDYLKQFPKDKMDQFCRFIAFVSGAI 519

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVL LAT  DP+LFLGFE+T GRT  F+  +   +F V+ G +PD++ V DP   L++V
Sbjct: 520 AAVLALATLFDPELFLGFEVTPGRTAVFWLTLTGVIFGVANGALPDENEVHDPVLHLREV 579

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           + +THY P  W+ RLH++EVR EF  ++++KV+++I+EI S+I  P ILW +     ++I
Sbjct: 580 LLYTHYMPAHWKHRLHSNEVRSEFSAMYQMKVLIFIEEILSLIVAPIILWRNAGSRCERI 639

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASE----VENEYYLSKDGKMEKSF 259
           +DFFRE TVHV+G+G+ C+FA+F F+K  N      A E    + ++Y+ +KD KM +S 
Sbjct: 640 VDFFREQTVHVEGIGNQCNFAVFGFKKDLNAGDIHDAFEEPDGLRDDYFNAKDDKMGQSM 699

Query: 260 LNFK-----------ANHPD-WEPTDPFGSLYLSRLTEFNNQAHP--ERPNAARTSVVDS 305
           ++F+           +N P  W+P   +  +    + E      P     N  R+ ++DS
Sbjct: 700 MHFRQYYSHYHRRPGSNRPQGWQPPPAWPPVITQSIAEEPGPMPPPTRNSNVRRSGMIDS 759



>gi|401626464|gb|EJS44410.1| atg9p [Saccharomyces arboricola H-6]
          Length = 993

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 563 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRMSLSTPLANKYVDQFPKEKTNLFLKFV 621

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 622 SFISGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 681

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 682 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 741

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFRE + +VDG+G VC +A+F+ +
Sbjct: 742 PSSAGKIVDFFRENSEYVDGLGYVCKYAMFNVK 774



>gi|349576929|dbj|GAA22098.1| K7_Atg9p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 997

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFRE + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRENSEYVDGLGYVCKYAMFNMK 778



>gi|6320052|ref|NP_010132.1| Atg9p [Saccharomyces cerevisiae S288c]
 gi|61211369|sp|Q12142.1|ATG9_YEAST RecName: Full=Autophagy-related protein 9; AltName: Full=Cytoplasm
           to vacuole targeting protein 7
 gi|1321955|emb|CAA66342.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|1431235|emb|CAA98723.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285810885|tpg|DAA11709.1| TPA: Atg9p [Saccharomyces cerevisiae S288c]
 gi|392300674|gb|EIW11765.1| Atg9p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 997

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFRE + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRENSEYVDGLGYVCKYAMFNMK 778



>gi|322707978|gb|EFY99555.1| Autophagy- protein 9 [Metarhizium anisopliae ARSEF 23]
          Length = 404

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/236 (44%), Positives = 155/236 (65%), Gaps = 9/236 (3%)

Query: 53  SYKPANKYIDQFPKAKTXXXXXXXXXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFY 112
           S+  A +YI+QFPK  T           G+ TAVL + T +D +LFLGFEIT  R V FY
Sbjct: 2   SFPFATRYIEQFPKRMTEEIARSISFMSGAITAVLAVGTLLDSELFLGFEITQDRPVLFY 61

Query: 113 TGVLVPLFAVSRGMIPDDHLVFDPEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFE 172
            GV   ++A++RGMI ++  VF+PE  L+ V+E+THY PD W+GRLH+ EV++EF +L++
Sbjct: 62  LGVFGAIWAMTRGMISEETTVFNPEYALRNVIEYTHYMPDHWQGRLHSFEVKQEFSELYK 121

Query: 173 VKVVLYIQEIFSVIFTPFILWFSLADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK-H 231
           +KVV++++E+  +I TP +L+FSL  C++Q++DFFREFT+HVDG+G VCSFA+FDF+K  
Sbjct: 122 MKVVIFLEEVLGIITTPMLLFFSLPKCAEQVVDFFREFTIHVDGLGYVCSFAVFDFKKGM 181

Query: 232 GNVKYGAPASEVENEYYLSKDGKMEKSFLNFKANH--------PDWEPTDPFGSLY 279
              +  A   ++ ++YY +K GKM  S+  F  N+        P   P  P G  Y
Sbjct: 182 RQTQTQAAGPDLRDDYYSTKHGKMAASYYGFLDNYVINPKTGIPGHMPPGPRGQFY 237



>gi|166990334|sp|A6ZXH8.1|ATG9_YEAS7 RecName: Full=Autophagy-related protein 9; AltName: Full=Cytoplasm
           to vacuole targeting protein 7
 gi|151941852|gb|EDN60208.1| autophagy-related protein [Saccharomyces cerevisiae YJM789]
          Length = 997

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFRE + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRENSEYVDGLGYVCKYAMFNMK 778



>gi|207347061|gb|EDZ73368.1| YDL149Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273575|gb|EEU08508.1| Atg9p [Saccharomyces cerevisiae JAY291]
 gi|323334308|gb|EGA75689.1| Atg9p [Saccharomyces cerevisiae AWRI796]
          Length = 997

 Score =  221 bits (562), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFR+ + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRDNSEYVDGLGYVCKYAMFNMK 778



>gi|259145095|emb|CAY78359.1| Atg9p [Saccharomyces cerevisiae EC1118]
          Length = 997

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+DQFPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFR+ + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRDNSEYVDGLGYVCKYAMFNMK 778



>gi|322701878|gb|EFY93626.1| Autophagy-related protein 9 [Metarhizium acridum CQMa 102]
          Length = 404

 Score =  219 bits (559), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 154/236 (65%), Gaps = 9/236 (3%)

Query: 53  SYKPANKYIDQFPKAKTXXXXXXXXXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFY 112
           S+  A +YI+QFPK  T           G+ TAVL + T +D +LFLGFEIT  R V FY
Sbjct: 2   SFPFATRYIEQFPKRMTEEIARSISFMSGAITAVLAVGTLLDSELFLGFEITQDRPVLFY 61

Query: 113 TGVLVPLFAVSRGMIPDDHLVFDPEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFE 172
            GV   ++A++RGMI ++  VF+PE  L+ V+E+THY PD W+GRLH+ EV++EF +L++
Sbjct: 62  LGVFGAIWAMTRGMISEETTVFNPEYALRNVIEYTHYMPDHWQGRLHSFEVKQEFSELYK 121

Query: 173 VKVVLYIQEIFSVIFTPFILWFSLADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK-H 231
           +K V++++E+  +I TP +L+FSL  C++Q++DFFREFT+HVDG+G VCSFA+FDF+K  
Sbjct: 122 MKAVIFLEEVLGIITTPMLLFFSLPKCAEQVVDFFREFTIHVDGLGYVCSFAVFDFKKGM 181

Query: 232 GNVKYGAPASEVENEYYLSKDGKMEKSFLNFKANH--------PDWEPTDPFGSLY 279
              +  A   ++ ++YY +K GKM  S+  F  N+        P   P  P G  Y
Sbjct: 182 RQTQTQAAGPDLRDDYYSTKHGKMAASYYGFLDNYVINPKTGIPGHMPPGPRGQFY 237



>gi|361123928|gb|EHK96065.1| putative Autophagy-related protein 9 [Glarea lozoyensis 74030]
          Length = 263

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 152/251 (60%), Gaps = 19/251 (7%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G R +T  A WKFREFNEL H+FH+RL+ SY  A +Y++QFPK KT           
Sbjct: 17  STIGQRSYTPLAEWKFREFNELEHMFHERLNMSYFFATRYLEQFPKVKTGHFATFVMFVT 76

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GS  AVL +A  +DP++F  FEI    +V  +   L  ++AV  G +P+ + VFDPE  +
Sbjct: 77  GSIIAVLSIAALLDPEMFFSFEIAGDTSVALWITGLGAIWAVMSGSVPEPNGVFDPEQEM 136

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V+++THY P  W GRL T++V                 +IF +I TPF+L  SL  C+
Sbjct: 137 RSVIQYTHYGPPHWEGRLETNDV----------------MQIFCIIATPFVLGVSLPRCA 180

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYG--APASEVENEYYLSKDGKMEKS 258
            QIIDFFREFTVHVDGVG VCSFA+FDF++ G+ + G  AP ++  ++YY +K GKM  S
Sbjct: 181 DQIIDFFREFTVHVDGVGYVCSFAVFDFKR-GDGRNGGQAPVADARDDYYSTKHGKMTAS 239

Query: 259 FLNFKANHPDW 269
           +  F  N   W
Sbjct: 240 YYGFVDNRRGW 250



>gi|365766705|gb|EHN08200.1| Atg9p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 997

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G+RQ+T  A WKFRE+NEL H+F +R+  S   ANKY+D+FPK KT       
Sbjct: 567 TSPGSI-GARQYTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDEFPKEKTNLFLKFV 625

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T  DP+ FL FEIT+ R+V FY  +L  +++VSR  I  ++ VFDP
Sbjct: 626 SFICGSFVAILAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDP 685

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++ E+THY P EW GR H +E++ EF +L+ +++V+ ++E+ S++ TPF+LWFSL
Sbjct: 686 EETLKELYEYTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSL 745

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFR 229
              + +I+DFFR+ + +VDG+G VC +A+F+ +
Sbjct: 746 PSSAGRIVDFFRDNSEYVDGLGYVCKYAMFNMK 778



>gi|255719350|ref|XP_002555955.1| KLTH0H01760p [Lachancea thermotolerans]
 gi|238941921|emb|CAR30093.1| KLTH0H01760p [Lachancea thermotolerans CBS 6340]
          Length = 921

 Score =  217 bits (553), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 102/219 (46%), Positives = 144/219 (65%), Gaps = 1/219 (0%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SRQ+T  A WKFRE+NEL HLF +RL  S + AN YIDQFPK KT           
Sbjct: 521 SALSSRQYTPIAEWKFREYNELYHLFQKRLGLSVEVANNYIDQFPKEKTNIIMKFIAFVS 580

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           GSF A+L L T  DP+ FL FEIT  ++V FY  V   ++A+ +  +   + VFDPE  L
Sbjct: 581 GSFVAILALLTVFDPENFLNFEITKDKSVLFYISVFGTVWAICKNSVSGQYRVFDPEESL 640

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++VV + HY P EW G+ HT++V+++F +LF ++V+L ++E+ S++ TPFILWFSL   S
Sbjct: 641 REVVSYLHYKPKEWEGKYHTEDVKQDFCKLFNLRVILLLRELASLVMTPFILWFSLPKSS 700

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFR-KHGNVKYGA 238
            +I+DF RE +V+VDG+G VC +A F+ + +H + K  A
Sbjct: 701 GKIVDFMREVSVYVDGLGYVCKYATFEVQGRHHDAKSRA 739



>gi|452981288|gb|EME81048.1| hypothetical protein MYCFIDRAFT_10877, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 565

 Score =  217 bits (553), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 156/243 (64%), Gaps = 4/243 (1%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R +T +A WK REFNEL HLF +RL ++   A++Y+ QFPK K            G+ 
Sbjct: 296 STRSFTPYAEWKIREFNELRHLFERRLRQAGPFASEYLKQFPKDKMDQLCRFVAFVSGAV 355

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVL L T  DP+LFLGFEIT GRT  FY G++  ++ V+ GM+P++H V DP   LK+V
Sbjct: 356 AAVLTLCTLFDPELFLGFEITPGRTAVFYLGLMATIWGVAHGMLPEEHDVHDPVLHLKEV 415

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           + +THY P  W+ RLH+DEVR EF  ++++K++++ +E+ S+I  P+I+W +     ++I
Sbjct: 416 LLYTHYMPAHWKERLHSDEVRAEFSSMYKLKIMIFTEEVLSLIVAPWIMWRNSGRNCERI 475

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASE----VENEYYLSKDGKMEKSF 259
           IDFFRE TVH++G+G  C+FA F+F+K  N +      +    + ++YY  KD KM  S 
Sbjct: 476 IDFFREQTVHIEGIGFQCNFAYFNFKKDPNAEDPTALLQEPDGLRDDYYGLKDDKMAASL 535

Query: 260 LNF 262
            NF
Sbjct: 536 QNF 538



>gi|494826836|gb|EON63863.1| hypothetical protein W97_03091 [Coniosporium apollinis CBS 100218]
          Length = 898

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 159/247 (64%), Gaps = 5/247 (2%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR +T  A W FREFNEL H + +R   +   A++Y+ QFPK K            
Sbjct: 465 SKLSSRAFTPLADWHFREFNELPHFYQRRKMMATPYADQYLQQFPKDKIEQISHFVAFVS 524

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+  AVL LA++ D +LFLGFE+T G+TV F+ GVL P++  +R    +D +V DPE  L
Sbjct: 525 GALAAVLALASFWDSELFLGFELTPGKTVLFWLGVLTPIYLAARSSTSEDTVVMDPEYAL 584

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           + V++  H+SP  W+ RLHTDEVR+EF  ++++KV+++ +E+ S+IFTP +L +SL   S
Sbjct: 585 EGVLQFMHHSPAHWQDRLHTDEVRKEFSAMYQMKVLIFAEELLSMIFTPLVLIYSLPRSS 644

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGN-----VKYGAPASEVENEYYLSKDGKM 255
           ++IIDFFREFT+HVDGVG VCSFA+F+F++ G      ++ G     +  +YY +K GKM
Sbjct: 645 ERIIDFFREFTIHVDGVGHVCSFAVFNFKRPGGPKPRAIQQGHDTEGLREDYYSTKGGKM 704

Query: 256 EKSFLNF 262
             S   F
Sbjct: 705 AASTYGF 711



>gi|449299820|gb|EMC95833.1| hypothetical protein BAUCODRAFT_44094, partial [Baudoinia
           compniacensis UAMH 10762]
          Length = 561

 Score =  217 bits (552), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 156/243 (64%), Gaps = 4/243 (1%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            +R +T FA WK REFNEL HLF +RL ++Y+PAN Y+ QFPK K            G+ 
Sbjct: 294 STRSFTPFAEWKIREFNELDHLFQRRLRQAYQPANNYLRQFPKDKVDQLCRFVSFLSGAI 353

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVL LAT +DP+LFLGFE+T GRT  F+  V+V +F VS+G +P++  VFDP   LK V
Sbjct: 354 AAVLALATLLDPELFLGFEVTPGRTAVFWLTVMVAIFTVSQGSLPEEDEVFDPVMHLKAV 413

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           +  THY P  W+ RLHT EVR EF  +++ KV+++++EI S+I  P+IL  +    S++I
Sbjct: 414 LYCTHYVPSHWKDRLHTTEVRSEFSAMYQTKVLIFVEEILSLIVAPWILLRNAGKRSERI 473

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASE----VENEYYLSKDGKMEKSF 259
           IDFFRE TVHVDG+G  C+FA+F F+K  N        +    + +EY+  KD KM  S 
Sbjct: 474 IDFFREHTVHVDGIGFQCNFAVFGFKKDANAADPTTVLDEPDGLRDEYFGLKDDKMAASV 533

Query: 260 LNF 262
            NF
Sbjct: 534 QNF 536



>gi|367011635|ref|XP_003680318.1| hypothetical protein TDEL_0C02180 [Torulaspora delbrueckii]
 gi|359747977|emb|CCE91107.1| hypothetical protein TDEL_0C02180 [Torulaspora delbrueckii]
          Length = 926

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 142/210 (67%), Gaps = 1/210 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+ G+RQ+T  A WKFRE+NEL HLF +R+  S   A+KYI+QFPK  T       
Sbjct: 525 TSPGSL-GARQYTPMADWKFREYNELYHLFQRRIGLSAGLADKYINQFPKEGTNIFLRFV 583

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL L T  DP+ F  FEIT  RT  FY  +L  ++ V +  + DD+ VFDP
Sbjct: 584 AFVSGSFVAVLALLTIFDPENFFNFEITHERTALFYITILGAVWTVCKNSVSDDYNVFDP 643

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + ++  +THY PDEW GR HT+EV+ EF +L+ +++++ ++E+ S++ TPFILWFSL
Sbjct: 644 EKTINELASYTHYLPDEWNGRYHTEEVKNEFCKLYNLRIIILLRELASLVLTPFILWFSL 703

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIF 226
              + +I++FFRE +V+VDG+G VC +A+F
Sbjct: 704 PKSADKIVEFFRETSVYVDGLGYVCKYAMF 733



>gi|500259775|gb|EOO02537.1| putative autophagy-like protein 9 protein [Togninia minima UCRPA7]
          Length = 322

 Score =  216 bits (551), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 136/198 (68%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   +R +T  A WKFREFNEL HLF +RL+ SY  A +YIDQFPK K            
Sbjct: 119 SALNARNYTPLADWKFREFNELPHLFRERLNMSYPFATRYIDQFPKVKMERLARTIAFIA 178

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+   VL +A+ IDP++FL FEIT  RT  FY G+   ++A +RG I DD  VFDPE  L
Sbjct: 179 GAVVTVLAIASLIDPEMFLSFEITHDRTALFYIGIFGSVWAFARGSITDDDSVFDPEYAL 238

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
           ++V+E+THY PD W+GRLH+ +V++EF  L++ K+V++++EI S++ TP IL  SL   S
Sbjct: 239 RQVIEYTHYQPDHWQGRLHSFDVKKEFADLYKNKIVIFVEEILSILITPLILIASLPKSS 298

Query: 201 QQIIDFFREFTVHVDGVG 218
            Q+IDFFREFT+HVDG+G
Sbjct: 299 DQVIDFFREFTIHVDGLG 316



>gi|366989137|ref|XP_003674336.1| hypothetical protein NCAS_0A13980 [Naumovozyma castellii CBS 4309]
 gi|342300199|emb|CCC67956.1| hypothetical protein NCAS_0A13980 [Naumovozyma castellii CBS 4309]
          Length = 927

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/211 (45%), Positives = 143/211 (67%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI  +RQ+T  A WKFRE NEL H+F +R+  S + A+KYIDQFPK KT       
Sbjct: 542 TSPGSI-NARQYTPIAEWKFREHNELYHIFKKRIGLSSQIADKYIDQFPKEKTNLILKFV 600

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L+L T  D + FL FEI   +TV F+  +L  ++++ R  I D + +F+P
Sbjct: 601 AFICGSFAAILVLLTIFDSENFLNFEIIGDKTVIFFITILGTIWSICRNAISDKYTIFNP 660

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L ++  +THY P EW GR HT+E++ EF  L+ +K+++ ++E+ S++ TPFILWFSL
Sbjct: 661 EDTLTELASYTHYMPKEWEGRYHTEEIKNEFCTLYNLKIIILLRELASLVITPFILWFSL 720

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
            + + +I+DFFRE +V+VDG+G VC +A+FD
Sbjct: 721 PNSAGKIVDFFRESSVYVDGLGYVCKYAVFD 751



>gi|50305941|ref|XP_452931.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|73619458|sp|Q6CT08.1|ATG9_KLULA RecName: Full=Autophagy-related protein 9
 gi|49642064|emb|CAH01782.1| KLLA0C16357p [Kluyveromyces lactis]
          Length = 908

 Score =  214 bits (545), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 100/214 (46%), Positives = 142/214 (66%), Gaps = 1/214 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI GSRQ+T  A WKFRE+NEL H+F +R+  S   A+ Y++QFP           
Sbjct: 540 TSPGSI-GSRQYTPIAEWKFREYNELYHIFQKRMRLSMIIADNYVNQFPNTLLSLTLSFI 598

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L + T  DPD FL FEIT  RTV FY  V   L+AV    I D++ V  P
Sbjct: 599 QFVSGSFVAILGILTIFDPDNFLNFEITPDRTVLFYMTVFGTLWAVCHSSINDEYTVLKP 658

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L+++V +THY+P EW+G+ HT++++ EF +L+ +++ L ++E+ S+I TPFILWFSL
Sbjct: 659 EETLEELVSYTHYAPKEWKGKYHTEDIKNEFCRLYNLRITLLLRELVSIIITPFILWFSL 718

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK 230
              S++IIDFFRE TV+ +G+G VC +A+F+  K
Sbjct: 719 PKNSERIIDFFRECTVYEEGLGYVCKYAMFEATK 752



>gi|460382915|ref|XP_004237181.1| PREDICTED: autophagy-related protein 9-like [Solanum lycopersicum]
          Length = 900

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 159/269 (59%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A+ Y+ QFP               
Sbjct: 354 STASSRRWSNLSKWMFREFNEVDHLFKHRINSSAVHASDYLKQFPSPILSIVAKFISFVS 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F AVLI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DP+  +
Sbjct: 414 GGFAAVLIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAITDELLVLDPQGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTH+ P  WRG+ +T+ +R EF  LF+   ++ ++E+ S+  TP++L F +    
Sbjct: 472 SLVVQHTHFMPKRWRGKENTEAIRTEFETLFQYTGMMLLEEMTSIFLTPYLLLFVVPKKV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTVHV+GVG VCSF++FDF+ HGN KYG+P +   +    S  GKMEKSFL
Sbjct: 532 DDILRFIADFTVHVEGVGHVCSFSVFDFQNHGNRKYGSPFN--SSRLQRSSQGKMEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F+ ++P W+P D  G  ++S L  F  Q
Sbjct: 590 SFQTSYPSWQPDD-HGKQFISTLKTFREQ 617



>gi|298711723|emb|CBJ32769.1| Autophagy-related protein 9 [Ectocarpus siliculosus]
          Length = 985

 Score =  213 bits (543), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (55%), Gaps = 18/286 (6%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G R+W+  ARW FREFNEL H F QR+  SY  AN ++ +FP+              
Sbjct: 310 SYLGPREWSPLARWTFREFNELQHFFEQRMSGSYVHANTFLMRFPRPVLASLMRVTRFVS 369

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVF-----D 135
           GS  AVL++ T+++  + L  ++   R + +Y GV   ++A SR + P    V       
Sbjct: 370 GSVVAVLLVMTFLEDSVLLHVKVWD-RNLLWYIGVFSAIYAFSRSVSPQASEVPTLQEDS 428

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
            E  + KV  HTHY P+ W G+ HT  VR E + LF  K  L+++E+ +V+F P IL FS
Sbjct: 429 AEEVMLKVAAHTHYMPEHWLGKAHTVVVRAELLGLFHYKAQLFLEELLAVLFAPVILCFS 488

Query: 196 LADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYY------- 248
           +  C+Q+I++F  E TV V GVG VCS+++FDF ++G+  Y AP++    E         
Sbjct: 489 MPSCAQEIVEFVTEHTVEVPGVGSVCSYSVFDFGRYGDEDYAAPSAASMAEVGPAERARR 548

Query: 249 ----LSKDGKMEKSFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQA 290
                +  GKMEKSFLNF+A++PDW+P  P G   + RL  F  Q 
Sbjct: 549 RRPDTTAQGKMEKSFLNFRAHYPDWQP-GPAGQEMIDRLAGFQLQC 593



>gi|363755950|ref|XP_003648191.1| hypothetical protein Ecym_8078 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891391|gb|AET41374.1| Hypothetical protein Ecym_8078 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 898

 Score =  213 bits (543), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 109/223 (48%), Positives = 153/223 (68%), Gaps = 3/223 (1%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+ GSRQ+   A WKFRE+NEL HLF +R+  SY+ ANKYI+QFP A         
Sbjct: 509 TSPGSL-GSRQYAPVAEWKFREYNELYHLFKKRIGLSYEVANKYINQFPNAVCDYFFKFV 567

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L L T +DP+ FL FE+T  +TV FY  +L  ++AV  G + D + VFDP
Sbjct: 568 KFISGSFVAILGLMTILDPENFLNFELTHDKTVLFYMTILGTVWAVCHGAVNDQYSVFDP 627

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK+++ +THYSP EW GR HTD+V++EF +L+ ++VVL ++E+ S++ TPFILWFSL
Sbjct: 628 EEALKELITYTHYSPKEWSGRYHTDDVKQEFCKLYNLRVVLLLRELASLVMTPFILWFSL 687

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIF--DFRKHGNVKYG 237
              ++ I+DFFRE +V+ DG+G VC +A+F  D +K+  V  G
Sbjct: 688 PKSAESIVDFFREVSVYGDGLGYVCQYAMFETDQKKNSTVSGG 730



>gi|482562378|gb|EOA26568.1| hypothetical protein CARUB_v10022626mg [Capsella rubella]
          Length = 853

 Score =  213 bits (542), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 157/269 (58%), Gaps = 4/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 355 STASSRRWSNLSKWLFREFNEVDHLFKHRINSSVVNASEYLKQFPSPIISIIAKFVSFVS 414

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F AVLI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DP   +
Sbjct: 415 GGFAAVLIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAISDEVLVLDPVGTM 472

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+ + D+VR E   LF+   ++ ++EI S+  TPF+L F +    
Sbjct: 473 TLVVQHTHYMPKRWRGKENKDDVRLELETLFQYTGMMLLEEIASIFITPFLLMFVVPKRV 532

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV ++GVG VCSF+ F F  HGN+KYG+P +    E   S  GKMEKSFL
Sbjct: 533 DDILQFIMDFTVDIEGVGHVCSFSAFYFENHGNIKYGSPCNAPRREQR-SSQGKMEKSFL 591

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WE +D  G  +LS L  F ++
Sbjct: 592 SFQSSYPSWE-SDSLGKQFLSNLRTFRDR 619



>gi|297826571|ref|XP_002881168.1| hypothetical protein ARALYDRAFT_482052 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327007|gb|EFH57427.1| hypothetical protein ARALYDRAFT_482052 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 863

 Score =  213 bits (542), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 158/269 (58%), Gaps = 4/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 355 STASSRRWSNLSKWLFREFNEVDHLFKHRINSSVVHASEYLKQFPSPIISIIAKFVSFVS 414

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F AVLI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DP   +
Sbjct: 415 GGFAAVLIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAISDELLVLDPVGTM 472

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+ + D+VR E   LF+   ++ ++EI S+  TPF+L F +    
Sbjct: 473 SLVVQHTHYMPKRWRGKENKDDVRLELETLFQYTGMMLLEEIASIFITPFLLMFVVPKRV 532

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F ++FTV ++GVG VCSF+ F F  HGN++YG+P +    E   S  GKMEKSFL
Sbjct: 533 DDILQFIKDFTVDIEGVGHVCSFSAFYFENHGNIQYGSPHNATRREQR-SSQGKMEKSFL 591

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WE +D  G  +LS L  F ++
Sbjct: 592 SFQSSYPSWE-SDSLGKQFLSNLRTFRDR 619



>gi|432917647|ref|XP_004079534.1| PREDICTED: autophagy-related protein 9A-like [Oryzias latipes]
          Length = 768

 Score =  213 bits (542), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 154/268 (57%), Gaps = 8/268 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL+H  H RL + YKP +KY++ F             
Sbjct: 287 EPGSL-GARRWSLYGRLYLRHFNELNHELHGRLGRGYKPTSKYMNSFTSPLLTVIAKNVA 345

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     I T  TV    GV++    ++R  IPD+HLV+ PE
Sbjct: 346 FFSGSVLAVLIALTVYDEDVLTVQHILTAITVL---GVVI---TITRSFIPDEHLVWCPE 399

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD WRG  HT E R E  QLF+ K V  ++E+ S I TPFIL F L 
Sbjct: 400 QLLQCVLAHIHYMPDHWRGNAHTSETRDEVAQLFQYKAVFILEELLSPIVTPFILIFLLR 459

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + S +IIDFFR FTV V GVGD+CSFA  D R+HGN  + +      + Y  +++GK E 
Sbjct: 460 NKSLEIIDFFRNFTVEVVGVGDICSFAQMDIRRHGNPAWMSEGQTEASMYQQAENGKTEL 519

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++F   +P W+P     S+++S L E
Sbjct: 520 SLMHFTIKNPRWQPPQE-SSVFISHLKE 546



>gi|453084318|gb|EMF12362.1| APG9-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 871

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 156/243 (64%), Gaps = 4/243 (1%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
           G+R +  +A WK REFNEL HLF +RL +++  A +Y+ QFPK KT           GS 
Sbjct: 474 GARTFAPYAEWKMREFNELDHLFRRRLRQAHPFATEYLKQFPKDKTDQAFRFVCFVAGSI 533

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVL +AT  DP+LFLGFE+T GRT  ++  V + +F  + G +PDD+ + DP   + +V
Sbjct: 534 AAVLTIATLFDPELFLGFEVTPGRTAIYWLSVSLGVFGFANGSLPDDNDLHDPGFHMTEV 593

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           + +THY P  W+ RLH+DEVR EF  +F++++ ++ +E+ S+I TP ILW +     ++I
Sbjct: 594 LLYTHYMPSHWKNRLHSDEVRAEFSGMFKLRLFVFAEELLSLIVTPLILWQNSGKTCERI 653

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGA---PASE-VENEYYLSKDGKMEKSF 259
           IDFFRE T+H+DG+G  C+FA F+F+K  +++  A   P  + + +++Y  KD K+  S 
Sbjct: 654 IDFFREQTIHIDGIGHQCNFAYFNFKKRNDIEDPATFIPEPDGLRDDHYGLKDDKLASSV 713

Query: 260 LNF 262
            NF
Sbjct: 714 QNF 716



>gi|449496947|ref|XP_004160271.1| PREDICTED: LOW QUALITY PROTEIN: autophagy-related protein 9-like
           [Cucumis sativus]
          Length = 882

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/274 (38%), Positives = 161/274 (58%), Gaps = 5/274 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FRE+NE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 354 STASSRRWSNLSKWIFREYNEVMHLFKHRINSSVLHASEYLKQFPSPIISIIAKFISFVF 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  ++D  L  G     GR + +Y  V   + A+SR  + D+ LV DPE  +
Sbjct: 414 GGFAAILIIIAFLDESLLEGH--IFGRNLLWYAAVFGTITAISRAAVTDEILVLDPEGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+ +++ VR EF  LF+   ++ ++E+ S+  TPF+L + + +  
Sbjct: 472 SMVVQHTHYMPKRWRGKENSELVRLEFETLFQYTGMMLLEEMVSIFLTPFLLVYVVPERV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTVH++GVG VCSF+ F+F+KHGN  YG+P +    E   S  GKMEKSFL
Sbjct: 532 DDILQFIADFTVHIEGVGHVCSFSAFNFQKHGNSSYGSPHNAPGAER--SSQGKMEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPER 294
           +F +N+P WEP +  G  ++S L  F  +   +R
Sbjct: 590 SFCSNYPGWEP-NAQGKQFMSNLRNFRERTLQQR 622



>gi|403214994|emb|CCK69494.1| hypothetical protein KNAG_0C03900 [Kazachstania naganishii CBS
           8797]
          Length = 922

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 144/211 (68%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+ G+RQ+T  A WKFRE+NEL HLF +R+  S   A+KYI+QFPK K        
Sbjct: 524 TSPGSL-GTRQYTPMAEWKFREYNELYHLFKKRIGLSVPLADKYINQFPKEKVNIMMRFI 582

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L L T +DP+ FL FEIT  R+  FY  +L  ++ +++  +  ++ VFDP
Sbjct: 583 AFIAGSFVAILGLFTILDPESFLNFEITNDRSALFYITILGTIWTIAQSSVSQEYAVFDP 642

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  ++ V  +THY P EW  R H++EV+++F +L+ +K+V+ ++E+ S+I TPF+LWFSL
Sbjct: 643 EETIRDVANYTHYLPQEWAERYHSEEVKQDFSKLYNLKIVILLRELGSLIITPFVLWFSL 702

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
              + +++DFFRE +V+VDG+G VC +A+FD
Sbjct: 703 PKSASKVVDFFRETSVYVDGLGYVCKYALFD 733



>gi|50289951|ref|XP_447407.1| hypothetical protein [Candida glabrata CBS 138]
 gi|73619451|sp|Q6FQT7.1|ATG9_CANGA RecName: Full=Autophagy-related protein 9
 gi|49526717|emb|CAG60344.1| unnamed protein product [Candida glabrata]
          Length = 928

 Score =  212 bits (540), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 143/205 (69%)

Query: 23  FGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGS 82
            G+RQ+T  A WKFRE+NEL H+F +R+  S   A+KY+DQFPK KT           GS
Sbjct: 541 IGARQYTPMAEWKFREYNELYHIFRKRIGLSNPLASKYVDQFPKEKTNILLKFVSFISGS 600

Query: 83  FTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKK 142
           F A+L +    DP+ FL FE+T  +TV FY  VL  ++++S+G +  ++ VFDPE  L++
Sbjct: 601 FVAILAILALWDPENFLNFEVTHDKTVLFYITVLGAIWSISQGSVSTEYHVFDPEETLRE 660

Query: 143 VVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQ 202
           + E+THY PD W+ R HT+ V++EF +L+ +++ + ++E+ S+I TPFILWFSL + + +
Sbjct: 661 LAEYTHYLPDSWKDRYHTEGVKQEFCELYNLRITVLLRELASLITTPFILWFSLPNSAGK 720

Query: 203 IIDFFREFTVHVDGVGDVCSFAIFD 227
           ++DFFRE +V+VDG+G VC +A++D
Sbjct: 721 MVDFFRESSVYVDGLGYVCKYAVYD 745



>gi|224066265|ref|XP_002302054.1| predicted protein [Populus trichocarpa]
 gi|222843780|gb|EEE81327.1| predicted protein [Populus trichocarpa]
          Length = 876

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 161/269 (59%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 352 STASSRRWSNLSRWTFREFNEVDHLFKHRINSSVMHASEYLKQFPSPIISIIAKFISFVS 411

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  + D+ LV D E  +
Sbjct: 412 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAVTDELLVLDQEGAM 469

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P +WRG+ +T+ VR EF  LF+   ++ ++E+ S+  TPF+L F +    
Sbjct: 470 SMVVQHTHYMPKKWRGKENTERVRMEFETLFQYTGMMLLEEMASIFLTPFLLLFVVPKHV 529

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV V+GVG VCSF+ F+F+KHGN  YG+P + + ++   S  GKMEKSFL
Sbjct: 530 DGILQFIADFTVDVEGVGHVCSFSTFNFQKHGNSNYGSPYNMLRSQR--SCQGKMEKSFL 587

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WEP +  G  +L  L  F +Q
Sbjct: 588 SFQSSYPSWEP-NIHGKQFLLNLRTFRDQ 615



>gi|4432821|gb|AAD20671.1| unknown protein [Arabidopsis thaliana]
          Length = 865

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 158/269 (58%), Gaps = 4/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 354 STASSRRWSNLSKWLFREFNEVDHLFKHRINSSVVHASEYLKQFPSPIISIIAKFVSFVS 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F AVLI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DP   +
Sbjct: 414 GGFAAVLIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAISDELLVLDPVGTM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV++THY P  WRG+ + D+VR E   LF+   ++ ++EI S+  TPF+L F +    
Sbjct: 472 SLVVQNTHYMPKRWRGKENKDDVRLELETLFQYTGMMLLEEIASIFITPFLLMFVVPKRV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F ++FTV ++GVG VCSF+ F F  HGN+KYG+P +    E   S  GKMEKSFL
Sbjct: 532 DDILQFIKDFTVDIEGVGHVCSFSAFYFENHGNIKYGSPHNATRREQR-SSQGKMEKSFL 590

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WE +D  G  +LS L  F ++
Sbjct: 591 SFQSSYPSWE-SDSLGKQFLSNLRTFRDR 618



>gi|30684887|ref|NP_850164.1| protein autophagy 9 [Arabidopsis thaliana]
 gi|19715618|gb|AAL91630.1| At2g31260/F16D14.10 [Arabidopsis thaliana]
 gi|19912149|dbj|BAB88386.1| autophagy 9 [Arabidopsis thaliana]
 gi|20466356|gb|AAM20495.1| unknown protein [Arabidopsis thaliana]
 gi|23198070|gb|AAN15562.1| unknown protein [Arabidopsis thaliana]
 gi|23463043|gb|AAN33191.1| At2g31260/F16D14.10 [Arabidopsis thaliana]
 gi|330253421|gb|AEC08515.1| protein autophagy 9 [Arabidopsis thaliana]
          Length = 866

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 158/269 (58%), Gaps = 4/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 355 STASSRRWSNLSKWLFREFNEVDHLFKHRINSSVVHASEYLKQFPSPIISIIAKFVSFVS 414

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F AVLI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DP   +
Sbjct: 415 GGFAAVLIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAISDELLVLDPVGTM 472

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV++THY P  WRG+ + D+VR E   LF+   ++ ++EI S+  TPF+L F +    
Sbjct: 473 SLVVQNTHYMPKRWRGKENKDDVRLELETLFQYTGMMLLEEIASIFITPFLLMFVVPKRV 532

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F ++FTV ++GVG VCSF+ F F  HGN+KYG+P +    E   S  GKMEKSFL
Sbjct: 533 DDILQFIKDFTVDIEGVGHVCSFSAFYFENHGNIKYGSPHNATRREQR-SSQGKMEKSFL 591

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WE +D  G  +LS L  F ++
Sbjct: 592 SFQSSYPSWE-SDSLGKQFLSNLRTFRDR 619



>gi|449468664|ref|XP_004152041.1| PREDICTED: autophagy-related protein 9-like [Cucumis sativus]
          Length = 856

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 106/274 (38%), Positives = 161/274 (58%), Gaps = 5/274 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FRE+NE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 354 STASSRRWSNLSKWIFREYNEVMHLFKHRINSSVLHASEYLKQFPSPIISIIAKFISFVF 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  ++D  L  G     GR + +Y  V   + A+SR  + D+ LV DPE  +
Sbjct: 414 GGFAAILIIIAFLDESLLEGH--IFGRNLLWYAAVFGTITAISRAAVTDEILVLDPEGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+ +++ VR EF  LF+   ++ ++E+ S+  TPF+L + + +  
Sbjct: 472 SMVVQHTHYMPKRWRGKENSELVRLEFETLFQYTGMMLLEEMVSIFLTPFLLVYVVPERV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTVH++GVG VCSF+ F+F+KHGN  YG+P +    E   S  GKMEKSFL
Sbjct: 532 DDILQFIADFTVHIEGVGHVCSFSAFNFQKHGNSSYGSPHNAPGAER--SSQGKMEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPER 294
           +F +N+P WEP +  G  ++S L  F  +   +R
Sbjct: 590 SFCSNYPGWEP-NAQGKQFMSNLRNFRERTLQQR 622



>gi|462396023|gb|EMJ01822.1| hypothetical protein PRUPE_ppa001270mg [Prunus persica]
          Length = 867

 Score =  211 bits (538), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 159/269 (59%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE+ HLF  R++ S   A+ Y+ QFP               
Sbjct: 352 STASSRRWSNLSRWMFREFNEVDHLFKHRINSSIVHASDYLKQFPSPIISIIAKFISFVS 411

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DPE  +
Sbjct: 412 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAITDELLVLDPEGAM 469

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV++THY P  WRG+ +T+ VR EF  LF+   ++ ++E+ S+  TP++L F +    
Sbjct: 470 SMVVQYTHYMPKTWRGKENTERVRIEFETLFQYTGMMLLEEMASIFLTPYLLLFVVPKRV 529

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I++F  EFT  V+GVG VCSF+ FDF++HGN  YG+  +   ++   S  GKMEKSFL
Sbjct: 530 DDILEFIAEFTADVEGVGHVCSFSAFDFQRHGNSNYGSLYNVTRSQR--SSQGKMEKSFL 587

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++N+P W+P D  G+ +L +L  F  Q
Sbjct: 588 SFQSNYPSWDP-DTQGNQFLKKLRTFREQ 615



>gi|410075900|ref|XP_003955532.1| hypothetical protein KAFR_0B00990 [Kazachstania africana CBS 2517]
 gi|372462115|emb|CCF56397.1| hypothetical protein KAFR_0B00990 [Kazachstania africana CBS 2517]
          Length = 931

 Score =  211 bits (537), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 141/211 (66%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGSI G RQ+T  A WKFRE+NEL H+F +R+  S   ANKYI+QFPK K        
Sbjct: 529 TSPGSI-GVRQYTPIAEWKFREYNELYHIFEKRVGLSTDIANKYINQFPKDKFNTAMKFI 587

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L L    DP+ FL FEIT  RTV FY  +   ++ VS+  +  ++ VFDP
Sbjct: 588 AFISGSFVAILALLAIFDPENFLNFEITQDRTVLFYITLFGTIWTVSQSSVGTEYNVFDP 647

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  + ++  +THY P EW+G+ HT+EV+ EF +L+ +K+++ ++E+ S++ TPFILWFSL
Sbjct: 648 EESIMELSSYTHYLPSEWKGKYHTEEVKNEFCKLYNLKIIILMKELTSLVLTPFILWFSL 707

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
              +  I+DFFR+ ++++DG+G VC +A+FD
Sbjct: 708 PKSAGDIVDFFRDTSIYIDGLGYVCKYAMFD 738



>gi|508702585|gb|EOX94481.1| Autophagy 9 [Theobroma cacao]
          Length = 866

 Score =  211 bits (536), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 158/269 (58%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 354 STASSRRWSNLSKWMFREFNEVDHLFKHRINSSVLHASEYLKQFPSPIISIIAKFISFVS 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  + D+ LV DPE  +
Sbjct: 414 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAVTDELLVLDPEGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTH+ P  WRG+ +T+ VR EF  LF+   ++ ++E+ S+  TPF+L F +    
Sbjct: 472 SMVVQHTHFMPKRWRGKENTEIVRIEFETLFQYTGMMLLEEMASIFLTPFLLLFVVPKRV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV V+GVG VCSF+ FDF+ HGN  YG+P +   ++   S  GKMEKSFL
Sbjct: 532 DDILQFIADFTVDVEGVGHVCSFSAFDFQNHGNGNYGSPHNASRSQR--SSQGKMEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP D  G  +LS +  F  Q
Sbjct: 590 SFQSCYPSWEP-DAQGKQFLSNIRTFREQ 617



>gi|485925293|gb|EOD49916.1| putative autophagy protein [Neofusicoccum parvum UCRNP2]
          Length = 741

 Score =  210 bits (534), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 142/205 (69%), Gaps = 4/205 (1%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           DP  + GSR +T  A WKFREFNEL HLF QR + +Y  A +Y++QFPK KT        
Sbjct: 484 DPSKL-GSRMFTPMAEWKFREFNELQHLFEQRRNFAYPFAERYLNQFPKNKTDQLCEFVA 542

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMI--PDDHLVFD 135
              G   A+L+L +++ P++  G EI  G+ V F+ GVL  ++A +R  I  P D ++ +
Sbjct: 543 FITGIGIAILVLGSFLYPEVITGLEILPGKPVLFWIGVLSAIYAAARNNITNPAD-IIME 601

Query: 136 PEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFS 195
           P+  LK+V++ THY P  WR RLHTDEVRR+F +L++VK+V++ +E+ S++ TPF+LW+S
Sbjct: 602 PQFALKEVIDITHYCPTSWRDRLHTDEVRRDFSKLYQVKLVIFFEEVLSMVLTPFVLWYS 661

Query: 196 LADCSQQIIDFFREFTVHVDGVGDV 220
           L  CS++I+DFFREFT+HVDG+G +
Sbjct: 662 LPQCSERIVDFFREFTIHVDGLGHI 686



>gi|297744125|emb|CBI37095.3| unnamed protein product [Vitis vinifera]
          Length = 816

 Score =  210 bits (534), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 159/275 (57%), Gaps = 8/275 (2%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            SR+W+  ++W FREFNE+ HLF  R++ S   A+ Y+ QFP               G F
Sbjct: 356 SSRRWSNLSKWIFREFNEVDHLFKHRINSSVVHASDYLKQFPSPIISIIAKFISFVFGGF 415

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVLI   +++  L  G     GR +F+Y  V   + A+SR  + D+ LV DPE  +  V
Sbjct: 416 AAVLIFIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAVTDELLVLDPEGAMSLV 473

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           V+HTHY P  WRG  +++ VR EF  LF+   ++ ++EI S+  TP +L F +      I
Sbjct: 474 VQHTHYLPKRWRGTENSELVRMEFETLFQYTGMMLLEEIASIFLTPCLLLFVVPKRVDDI 533

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNFK 263
           + F  +FTVHV+GVG VCSF++FDF+ HGN  YG+P +   ++   S  GKMEKSFL+F+
Sbjct: 534 LQFIEDFTVHVEGVGHVCSFSVFDFQNHGNSNYGSPHNSSRSQR--SSQGKMEKSFLSFQ 591

Query: 264 ANHPDWEPTDPFGSLYLSRLTEFNN---QAHPERP 295
           +++P WEP D  G  +LS L  F     Q H  RP
Sbjct: 592 SSYPSWEP-DAQGKQFLSTLRTFREEKLQGHGTRP 625



>gi|254584240|ref|XP_002497688.1| ZYRO0F11264p [Zygosaccharomyces rouxii]
 gi|238940581|emb|CAR28755.1| ZYRO0F11264p [Zygosaccharomyces rouxii]
          Length = 981

 Score =  210 bits (534), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+ G+RQ+T  A WKFRE+NEL HLF +R+  S   A++YIDQFPK          
Sbjct: 559 TSPGSL-GARQYTPMAEWKFREYNELYHLFQKRIGLSTFLADRYIDQFPKEGVNLMLRFV 617

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L + T +DP+ FL FEIT  +T  FY  VL  ++ V R  I D++ VFDP
Sbjct: 618 AFVTGSFVAILGIFTILDPENFLNFEITHDKTALFYITVLGTIWTVCRSSISDEYNVFDP 677

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           +  ++ +  +THY P EW GR HT+EV+ EF +L+ +K+++ ++E+ S+I TPFILWFSL
Sbjct: 678 DETIQDLAAYTHYLPVEWEGRYHTEEVKNEFCKLYNLKIIILLRELASLIMTPFILWFSL 737

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVK 235
              + +I++FFR+ +V+VDG+G VC +A+F+     + K
Sbjct: 738 PRSADRIVEFFRDNSVYVDGLGYVCKYAMFEINDSTDTK 776



>gi|156838839|ref|XP_001643118.1| hypothetical protein Kpol_461p14 [Vanderwaltozyma polyspora DSM
           70294]
 gi|166990333|sp|A7TR50.1|ATG9_VANPO RecName: Full=Autophagy-related protein 9
 gi|156113712|gb|EDO15260.1| hypothetical protein Kpol_461p14 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 961

 Score =  210 bits (534), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 142/210 (67%), Gaps = 1/210 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PG+I G+RQ+T  A W FREFNEL H+F +RL  S   A+KYI+QFPK  T       
Sbjct: 565 TSPGTI-GARQYTPMAEWTFREFNELYHIFQKRLGLSTVIADKYINQFPKESTDLILKFI 623

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF AVL+  T +D + FL FE+T  R+V FY  V   +++V R  I D++ V+DP
Sbjct: 624 SFISGSFVAVLMSLTLLDSENFLNFEVTKDRSVLFYITVFGAIWSVCRNSISDEYKVYDP 683

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           +  +K++ E THY P EW G+ HT++V++EF +L+ +++++ ++E+ S++ TPFILWFSL
Sbjct: 684 DETIKELSEFTHYLPKEWEGKHHTEDVKQEFCKLYNIRLIILLRELASLVLTPFILWFSL 743

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIF 226
             CS +I+DFF + + ++DG+G VC +A F
Sbjct: 744 PACSDRIVDFFSDSSTYIDGLGYVCKYATF 773



>gi|512881983|ref|XP_002943059.2| PREDICTED: autophagy-related protein 9A-like isoform X1 [Xenopus
           (Silurana) tropicalis]
 gi|512881987|ref|XP_004919887.1| PREDICTED: autophagy-related protein 9A-like isoform X2 [Xenopus
           (Silurana) tropicalis]
 gi|512881991|ref|XP_004919888.1| PREDICTED: autophagy-related protein 9A-like isoform X3 [Xenopus
           (Silurana) tropicalis]
 gi|512881994|ref|XP_004919889.1| PREDICTED: autophagy-related protein 9A-like isoform X4 [Xenopus
           (Silurana) tropicalis]
          Length = 802

 Score =  209 bits (533), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 157/283 (55%), Gaps = 10/283 (3%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL+H    RL + YKPA KY++ F             
Sbjct: 327 EPGSL-GARRWSLYGRLYLRHFNELTHELQARLSRGYKPATKYMNSFASPLLAIAAKNIA 385

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     I T  TV    GV+V    V+R  IPD+H+V+ PE
Sbjct: 386 FFAGSLLAVLIALTVYDEDVLTVQHILTAITVL---GVMV---TVARSFIPDEHMVWCPE 439

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD W+G  H  E R E  QLF+ K V  ++E+ S I TPFIL FSL 
Sbjct: 440 QLLQCVLAHIHYMPDHWQGHAHKSETRDELAQLFQYKAVFILEELLSPIITPFILIFSLR 499

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             S +IIDFFR F+V V GVGD+CSFA  D R+HGN ++ +      + Y  +++GK E 
Sbjct: 500 HKSLEIIDFFRNFSVEVVGVGDICSFAQMDIRRHGNPQWLSEGQTQASVYQQAENGKTEL 559

Query: 258 SFLNFKANHPDWEPTDPF-GSLYLSRLTEFNNQAHPERPNAAR 299
           S ++F   +P W+P  P   S+++  L E   Q     P A +
Sbjct: 560 SLMHFAITNPHWQP--PLESSVFIGHLKEKVQQDAANAPPAQQ 600



>gi|308804131|ref|XP_003079378.1| Integral membrane protein (ISS) [Ostreococcus tauri]
 gi|116057833|emb|CAL54036.1| Integral membrane protein (ISS) [Ostreococcus tauri]
          Length = 762

 Score =  209 bits (533), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 165/316 (52%), Gaps = 18/316 (5%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G+R W+ +A W+ REFNEL H   QRL  +Y  A  Y+ QFP               
Sbjct: 293 STVGTRDWSSYAYWRMREFNELPHFTQQRLAAAYPHAKDYVAQFPSPVVNVLAKFVSYVV 352

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+F A  +    ID  L   +     R + + T VL  + A SR ++  ++ VF P A +
Sbjct: 353 GAFAACALFCAIIDDRLLQAY--VGDRDLLWVTAVLGTILAFSRALMATENAVFQPNAIM 410

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            K+V HTHY P  WR   H +EV  EF   F  K +L+++EI SV   PF+LWF L+D  
Sbjct: 411 SKIVAHTHYLPKHWRDSAHKEEVVHEFNSFFTPKAILFLEEIASVFAAPFVLWFPLSDSV 470

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             II F R+FTV+  GVGD+CS + FDF +HGN  YGAP+    N+   S+ GKMEKSFL
Sbjct: 471 GDIIQFVRQFTVNKSGVGDICSMSAFDFIRHGNKHYGAPSH--ANKDQRSRQGKMEKSFL 528

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAARTSVVDSILKTTXXXXXXXXXX 320
            F+A +P+WEP D  G   L  L  F N        +A  S   S+L+ +          
Sbjct: 529 TFQATYPNWEP-DASGRDVLISLNGFANANETALGKSAEMS--SSVLRKS---------- 575

Query: 321 XVHFSYPIGSQSTTHY 336
              F+ P+  +S +H+
Sbjct: 576 -TRFAEPVQKESGSHH 590



>gi|225437848|ref|XP_002263784.1| PREDICTED: autophagy-related protein 9-like [Vitis vinifera]
          Length = 957

 Score =  209 bits (533), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 159/275 (57%), Gaps = 8/275 (2%)

Query: 24  GSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGSF 83
            SR+W+  ++W FREFNE+ HLF  R++ S   A+ Y+ QFP               G F
Sbjct: 356 SSRRWSNLSKWIFREFNEVDHLFKHRINSSVVHASDYLKQFPSPIISIIAKFISFVFGGF 415

Query: 84  TAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKKV 143
            AVLI   +++  L  G     GR +F+Y  V   + A+SR  + D+ LV DPE  +  V
Sbjct: 416 AAVLIFIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAVTDELLVLDPEGAMSLV 473

Query: 144 VEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQI 203
           V+HTHY P  WRG  +++ VR EF  LF+   ++ ++EI S+  TP +L F +      I
Sbjct: 474 VQHTHYLPKRWRGTENSELVRMEFETLFQYTGMMLLEEIASIFLTPCLLLFVVPKRVDDI 533

Query: 204 IDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFLNFK 263
           + F  +FTVHV+GVG VCSF++FDF+ HGN  YG+P +   ++   S  GKMEKSFL+F+
Sbjct: 534 LQFIEDFTVHVEGVGHVCSFSVFDFQNHGNSNYGSPHNSSRSQR--SSQGKMEKSFLSFQ 591

Query: 264 ANHPDWEPTDPFGSLYLSRLTEFNN---QAHPERP 295
           +++P WEP D  G  +LS L  F     Q H  RP
Sbjct: 592 SSYPSWEP-DAQGKQFLSTLRTFREEKLQGHGTRP 625



>gi|145347101|ref|XP_001418016.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578244|gb|ABO96309.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 527

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 149/266 (56%), Gaps = 5/266 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S  G+R W  +A W+ REFNEL H   QRL  +Y  A KY+ QFP               
Sbjct: 267 SAVGARDWNSYAYWRMREFNELPHFTQQRLAAAYPHAKKYVAQFPSPVVNILAKFVSYVV 326

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G+F A  +    +D  L   +     R + + T VL  + A SR ++  ++ VF+P   +
Sbjct: 327 GAFAACALFCAIVDDRLLQAY--VGDRDLLWITAVLGTILASSRALMATENAVFEPNVIM 384

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
            K+V HTHY P  WR   H +EV+ EF   F +K V++++EI SV   PF+LWF L D +
Sbjct: 385 SKIVAHTHYLPKHWRDAAHKEEVQHEFNSFFSLKAVMFLEEIASVFAAPFVLWFPLCDSA 444

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             II F R+FTV+  GVGD+CS + FDF +HGN  YGAP+   + +   S+ GKMEKSFL
Sbjct: 445 DDIIQFVRQFTVNKSGVGDMCSLSAFDFNRHGNKHYGAPSHASKEQR--SRQGKMEKSFL 502

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEF 286
            F+A +P WEP D  G   L+ L  F
Sbjct: 503 TFQATYPAWEP-DASGRDMLNSLNGF 527



>gi|470107174|ref|XP_004289924.1| PREDICTED: autophagy-related protein 9-like [Fragaria vesca subsp.
           vesca]
          Length = 886

 Score =  209 bits (531), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 158/269 (58%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE+ HLF  R++ S   A++Y+ QFP               
Sbjct: 354 STASSRRWSNLSRWMFREFNEVDHLFKHRINSSLVHASEYLKQFPSPIISIIAKFISFVS 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  I D+ LV DPE  +
Sbjct: 414 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAISDELLVLDPEGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV++THY P  WRG+ +T+ VR EF  LF+   ++ ++E+ S+  TP++L F +    
Sbjct: 472 SMVVQYTHYMPKTWRGKENTEGVRTEFESLFQYTGMMLLEEMASIFLTPYLLIFVVPKRV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I++F  E+T+ ++GVG VCSF+ FDF+KHGN  YG+P +   ++   S  GKMEKSFL
Sbjct: 532 DDILEFIAEYTIDIEGVGHVCSFSAFDFQKHGNRNYGSPFNVSRSQR--SSQGKMEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F+ ++P W+P    G  +L  L  F  Q
Sbjct: 590 SFQCSYPSWDPNAE-GHQFLLNLRTFREQ 617



>gi|255076885|ref|XP_002502107.1| autophagy domain-containing protein [Micromonas sp. RCC299]
 gi|226517372|gb|ACO63365.1| autophagy domain-containing protein [Micromonas sp. RCC299]
          Length = 805

 Score =  209 bits (531), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/270 (40%), Positives = 154/270 (57%), Gaps = 4/270 (1%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           PG + G R+W+  A WK REFNELSH   QRL  +YK AN Y+ QFP             
Sbjct: 326 PG-VVGQREWSTHAWWKLREFNELSHFTEQRLAAAYKGANNYVSQFPSPVVSMVAKFVSY 384

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             G+  AV +    +  D  L   +   + + + T V   + AVSRGM+ +++ VF P  
Sbjct: 385 IVGALAAVALALPLLLDDKLLHANVMWDKDILWVTMVSATVLAVSRGMVGEENRVFRPNR 444

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            + +VV HTHY P  WR   H  EV+ EF  +F  K  L++QE+ S+   PFILW+ + +
Sbjct: 445 YMAEVVRHTHYLPKNWRNLAHKPEVQAEFEDMFAFKAGLFLQEMLSIFAVPFILWYPMCE 504

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKS 258
            +  I+ F R+FTVH  GVG +CS + FDFR+HG+ +YGAP +   +    SK GKMEKS
Sbjct: 505 SAPDIVQFVRQFTVHRKGVGHICSLSAFDFRRHGDARYGAPTNARRDAR--SKQGKMEKS 562

Query: 259 FLNFKANHPDWEPTDPFGSLYLSRLTEFNN 288
           F++F A++P WEP D  G   L+ L  F +
Sbjct: 563 FVSFHAHYPTWEP-DAGGREMLTSLAGFKS 591



>gi|356545851|ref|XP_003541347.1| PREDICTED: autophagy-related protein 9-like [Glycine max]
          Length = 868

 Score =  208 bits (529), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 156/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE+ HLF  R++ S   A  YI QFP               
Sbjct: 353 STASSRRWSNLSRWVFREFNEVDHLFRHRINSSVLHATNYIKQFPSPIISIIAKFISFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+ R  I D+ LV DPE  +
Sbjct: 413 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAIRRASITDELLVIDPEGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VVEHTHY P  WRG+  T+ VR EF  LF+   ++ ++E+ S+  TP++L   +    
Sbjct: 471 SMVVEHTHYMPKRWRGKESTEMVRIEFETLFQYSGMMLLEEMASIFLTPYLLLLVVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV V+GVG VCSF++F+F++HGN  YG+P +   ++   S  GK+EKSFL
Sbjct: 531 DDILQFIADFTVDVEGVGHVCSFSVFNFQEHGNSNYGSPFNAPHSQR--SSQGKLEKSFL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WEP +  G  +L  L  F +Q
Sbjct: 589 SFQSSYPSWEP-NAQGKQFLQNLRTFRDQ 616



>gi|399164917|emb|CCE34192.1| probable APG9-integral membrane protein required for Cvt and
           autophagy transport [Claviceps purpurea 20.1]
          Length = 613

 Score =  208 bits (529), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 154/251 (61%), Gaps = 35/251 (13%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
            DP  +  +R++T  A WKFREFNEL HLF++RL  S   A  YIDQFPK          
Sbjct: 206 KDP-KLAAARKYTALAEWKFREFNELPHLFYERLHMSIPFATHYIDQFPKR--------- 255

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
                                   FEIT  RTV FY G+   ++A+++G++ DD  VF+P
Sbjct: 256 ------------------------FEITHERTVLFYLGIFGGIWAMTKGIVSDDTTVFNP 291

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  L+ V+++TH+ PD W+ RLH+ EV++EF +L+++KV+++++E+  +I TP +L FSL
Sbjct: 292 EFALRNVIDYTHFMPDHWQDRLHSFEVKKEFSELYKMKVIIFLEEVLGIITTPMLLLFSL 351

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRK-HGNVKYGAPASEVENEYYLSKDGKM 255
             C+++I DF REFTVHVDG+G VCSFA+FDF+K  G   +     +V  ++YL+K GKM
Sbjct: 352 PKCAERITDFIREFTVHVDGLGHVCSFAVFDFQKGTGQAVHRRRDCDVREDFYLTKHGKM 411

Query: 256 EKSFLNFKANH 266
             S+  F  N+
Sbjct: 412 AASYYGFLDNY 422



>gi|255583208|ref|XP_002532369.1| conserved hypothetical protein [Ricinus communis]
 gi|223527925|gb|EEF30012.1| conserved hypothetical protein [Ricinus communis]
          Length = 864

 Score =  207 bits (528), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  ++W FREFNE+ HLF  R++ S   A+ Y+ QFP               
Sbjct: 353 STASSRRWSNLSKWIFREFNEVDHLFKHRINGSIMHASDYLKQFPSPIISIVAKFISFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  + D+ LV DPE  +
Sbjct: 413 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAVTDELLVLDPEGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+ +++ VR EF  LF+   ++ ++E+ S+  TPF+L F +    
Sbjct: 471 SMVVQHTHYMPKRWRGKENSETVRMEFETLFQYTGMMLLEEMASIFLTPFLLLFIVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FT+ V+GVG +CSF+ FDF+ HGN  YG+P      +   S  GKMEKSFL
Sbjct: 531 DDILQFIADFTMDVEGVGHICSFSAFDFQNHGNSNYGSPYHTPHTQR--SSQGKMEKSFL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WEP    G  +LS L  F  Q
Sbjct: 589 SFQSSYPSWEPNIQ-GKQFLSTLRNFRAQ 616



>gi|444321264|ref|XP_004181288.1| hypothetical protein TBLA_0F02270 [Tetrapisispora blattae CBS 6284]
 gi|387514332|emb|CCH61769.1| hypothetical protein TBLA_0F02270 [Tetrapisispora blattae CBS 6284]
          Length = 1037

 Score =  207 bits (528), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 141/211 (66%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PG++ G+RQ++  A WKFRE+NEL HLF +RL  S + A+KYI QFP   T       
Sbjct: 645 TSPGNL-GARQYSPLAEWKFREYNELYHLFQKRLGLSRELADKYIQQFPNESTNILLKFV 703

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L+L T  DP+ F  FEI+  +T  FY  +   ++ +   +IP+++ VFDP
Sbjct: 704 TLISGSFVAILVLLTIFDPENFFNFEISKDKTALFYITLFGSIWTICHNLIPNEYRVFDP 763

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  LK++  +TH+ P+ W+GR H +EV++EF +L+ ++V++ ++E+ S+I TPFILWFSL
Sbjct: 764 EETLKELATYTHFLPNTWKGRYHMEEVKQEFCELYNLRVIVLLRELASLILTPFILWFSL 823

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
              +  IIDFFR  + +VDG+G VC +A+F+
Sbjct: 824 PRNACDIIDFFRNNSTYVDGLGYVCKYAMFE 854



>gi|224082790|ref|XP_002306839.1| predicted protein [Populus trichocarpa]
 gi|222856288|gb|EEE93835.1| predicted protein [Populus trichocarpa]
          Length = 876

 Score =  207 bits (527), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE  HLF  R+  S   A+ Y+ QFP               
Sbjct: 353 STASSRRWSNLSRWIFREFNEADHLFKHRISSSAMHASDYLKQFPSPIISIIAKFISFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR + +Y  V   + A+SR  + D+ LV D E  +
Sbjct: 413 GGFAAILIIIAFLEESLLEGH--IFGRNLLWYAAVFGTITAISRAAVTDELLVLDQEGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P +WRGR +T+ VR EF  LF+   ++ ++E+ S+  TPF+L F +    
Sbjct: 471 SMVVQHTHYMPKKWRGRENTERVRMEFETLFQYTGMMLLEEMASIFLTPFLLLFVVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV V+GVGDVCSF+ FDF+ +GN  YG+P +   ++   S  GKMEKSFL
Sbjct: 531 DDILQFIADFTVDVEGVGDVCSFSAFDFQNYGNSNYGSPYNAPRSQR--SCQGKMEKSFL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WEP    G  +L  L  F +Q
Sbjct: 589 SFQSSYPSWEPNIQ-GKQFLLNLRTFRDQ 616



>gi|410923707|ref|XP_003975323.1| PREDICTED: autophagy-related protein 9A-like [Takifugu rubripes]
          Length = 806

 Score =  207 bits (526), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 109/268 (40%), Positives = 154/268 (57%), Gaps = 8/268 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL+H  H+RL + YKP +KY++ F             
Sbjct: 328 EPGSL-GARRWSLYGRLYLRHFNELNHELHERLGRGYKPTSKYMNSFTSPLLAVLAKNIA 386

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     I T  TV    G+++    V+R  IPD+H+V+ PE
Sbjct: 387 FFSGSVLAVLIALTVYDEDVLTVQHILTAITVL---GIVI---TVTRSFIPDEHMVWCPE 440

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD WRG  +  E R E  QLF+ K V  ++E+ S I TPFIL F L 
Sbjct: 441 QLLQCMLAHIHYMPDHWRGNANKSETRDEVAQLFQYKAVFILEELLSPIVTPFILIFLLR 500

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + S +IIDFFR FTV V GVGD+CSFA  D R+HGN  + +      + Y  +++GK E 
Sbjct: 501 NKSLEIIDFFRNFTVEVVGVGDICSFAQMDIRRHGNPTWMSEGQTEASVYQQAENGKTEL 560

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++F   +P W+P     S+++S L E
Sbjct: 561 SLMHFTIKNPHWQPPQE-SSVFISHLKE 587



>gi|66809109|ref|XP_638277.1| autophagy protein 9 [Dictyostelium discoideum AX4]
 gi|74853858|sp|Q54NA3.1|ATG9_DICDI RecName: Full=Autophagy-related protein 9
 gi|60466685|gb|EAL64736.1| autophagy protein 9 [Dictyostelium discoideum AX4]
          Length = 699

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/269 (40%), Positives = 162/269 (60%), Gaps = 7/269 (2%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           PGS+F SR+W+  ARW+FRE NEL H F  RL+ SY  AN+Y++ FP             
Sbjct: 334 PGSLF-SREWSPLARWEFRELNELPHYFQNRLNLSYSHANQYVESFPSQMLSTIAKFISF 392

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             GS  AV I+   +     + ++I   RT  +Y G+L  + A++R +I D++ VF P  
Sbjct: 393 LFGSVLAVFIVLGIVSDHFIMNYQIF-DRTPIWYIGILGTIVAITRSLIVDENQVFQPAK 451

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            + + V++THY P  W G+ HT +VR EF+ LFE ++V ++++IFSV+FTPFIL FSL  
Sbjct: 452 HMARTVQNTHYLPMSWVGKTHTHKVRDEFLVLFEYRIVDFVRDIFSVLFTPFILIFSLPK 511

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIF-DFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            SQ IIDFF   TV ++GVG +C    F + RK G+  +G+  +  +N+  L+ + K+EK
Sbjct: 512 SSQAIIDFFGNNTVVLEGVGPICQLGDFSNIRKLGDNSFGS-LNHSQNKISLTNNAKLEK 570

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           S +NFK  +P+W  TD   +  L  L EF
Sbjct: 571 SIINFKCLNPEWN-TD--NNELLQNLNEF 596



>gi|28395475|gb|AAO39079.1| autophagy protein 9 [Dictyostelium discoideum]
          Length = 687

 Score =  204 bits (520), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/269 (40%), Positives = 162/269 (60%), Gaps = 7/269 (2%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           PGS+F SR+W+  ARW+FRE NEL H F  RL+ SY  AN+Y++ FP             
Sbjct: 334 PGSLF-SREWSPLARWEFRELNELPHYFQNRLNLSYSHANQYVESFPSQMLSTIAKFISF 392

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             GS  AV I+   +     + ++I   RT  +Y G+L  + A++R +I D++ VF P  
Sbjct: 393 LFGSVLAVFIVLGIVSDHFIMNYQIF-DRTPIWYIGILGTIVAITRSLIVDENQVFQPAK 451

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            + + V++THY P  W G+ HT +VR EF+ LFE ++V ++++IFSV+FTPFIL FSL  
Sbjct: 452 HMARTVQNTHYLPMSWVGKTHTHKVRDEFLVLFEYRIVDFVRDIFSVLFTPFILIFSLPK 511

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIF-DFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            SQ IIDFF   TV ++GVG +C    F + RK G+  +G+  +  +N+  L+ + K+EK
Sbjct: 512 SSQAIIDFFGNNTVVLEGVGPICQLGDFSNIRKLGDNSFGS-LNHSQNKISLTNNAKLEK 570

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEF 286
           S +NFK  +P+W  TD   +  L  L EF
Sbjct: 571 SIINFKCLNPEWN-TD--NNELLQNLNEF 596



>gi|498945666|ref|XP_004542879.1| PREDICTED: autophagy-related protein 9A-like isoform X1 [Maylandia
           zebra]
 gi|498945672|ref|XP_004542880.1| PREDICTED: autophagy-related protein 9A-like isoform X2 [Maylandia
           zebra]
          Length = 809

 Score =  204 bits (520), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/268 (40%), Positives = 151/268 (56%), Gaps = 8/268 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL H  H RL + YKP +KY++ F             
Sbjct: 328 EPGSL-GARRWSLYGRLYLRHFNELDHELHGRLGRGYKPTSKYMNSFTSPLLTVIAKNIA 386

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI+ T  D D+     I T  TV    GV +    ++R  IPD+H+ + PE
Sbjct: 387 FFSGSVLAVLIVLTVYDEDVLTVQHILTAITVL---GVTI---TIARSFIPDEHMAWCPE 440

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD WRG  +  E R E  QLF+ K V  ++E+ S I TPFIL F L 
Sbjct: 441 QLLQCVLAHIHYMPDHWRGNANKSETRDEVAQLFQYKAVFILEELLSPIVTPFILIFLLR 500

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + S +IIDFFR FTV V GVGD+CSFA  D R+HGN  + +      + Y  +++GK E 
Sbjct: 501 NKSLEIIDFFRNFTVEVVGVGDICSFAQMDIRRHGNPTWLSEGQTEASVYQQAENGKTEL 560

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++F   +P W+P     S+++S L E
Sbjct: 561 SLMHFTIKNPRWQPPQE-SSVFISHLKE 587



>gi|327288877|ref|XP_003229151.1| PREDICTED: autophagy-related protein 9A-like, partial [Anolis
           carolinensis]
          Length = 660

 Score =  204 bits (519), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 155/282 (54%), Gaps = 8/282 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL H    RL + YKPA+KY++ F             
Sbjct: 250 EPGSL-GARRWSLYGRLYLRHFNELDHELQARLGRGYKPASKYMNSFASPLLTALAKNVA 308

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     I T  T+    G++V    V+R  IPD+HLV+ PE
Sbjct: 309 FFAGSILAVLIALTVYDEDVLTVQHILTAITLL---GLVV---TVARSFIPDEHLVWCPE 362

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD W+G  H  E R E  QLF+ K V  ++E+ S I TPF+L F L 
Sbjct: 363 QLLQCVLAHIHYIPDHWQGNAHKSETREELSQLFQYKAVFILEELLSPIVTPFLLIFPLR 422

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             +  IIDFFR F+V V GVGD+CSFA  D R HGN ++ +      +    +++GK E 
Sbjct: 423 ARALDIIDFFRNFSVEVVGVGDICSFAQLDIRNHGNPQWLSQGQTEASVQQQAENGKTEL 482

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNAAR 299
           S ++F  ++P W+P  P  SL++  L E   Q   + P A R
Sbjct: 483 SLVHFAISNPRWQP-PPESSLFIGHLKEKVQQDAAQAPPAQR 523



>gi|348500697|ref|XP_003437909.1| PREDICTED: autophagy-related protein 9A-like [Oreochromis
           niloticus]
          Length = 759

 Score =  204 bits (519), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 109/268 (40%), Positives = 151/268 (56%), Gaps = 8/268 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL H  H RL + YKP +KY++ F             
Sbjct: 328 EPGSL-GARRWSLYGRLYLRHFNELDHELHGRLGRGYKPTSKYMNSFTSPLLTVIAKNIA 386

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI+ T  D D+     I T  TV    GV +    ++R  IPD+H+ + PE
Sbjct: 387 FFSGSVLAVLIVLTVYDEDVLTVQHILTAITVL---GVTI---TIARSFIPDEHMAWCPE 440

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD WRG  +  E R E  QLF+ K V  ++E+ S I TPFIL F L 
Sbjct: 441 QLLQCVLAHIHYMPDHWRGNANKSETRDEVAQLFQYKAVFILEELLSPIVTPFILIFLLR 500

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + S +IIDFFR FTV V GVGD+CSFA  D R+HGN  + +      + Y  +++GK E 
Sbjct: 501 NKSLEIIDFFRNFTVEVVGVGDICSFAQMDIRRHGNPTWLSEGQTEASVYQQAENGKTEL 560

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++F   +P W+P     S+++S L E
Sbjct: 561 SLMHFTIKNPRWQPPQE-SSVFISHLKE 587



>gi|471561800|gb|EMR63476.1| putative autophagy-related protein 9 protein [Eutypa lata UCREL1]
          Length = 438

 Score =  204 bits (518), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 146/248 (58%), Gaps = 28/248 (11%)

Query: 57  ANKYIDQFPKAKTXXXXXXXXXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVL 116
           A  YIDQFPK KT           G+  AVL L  + DP++F+ FE+  G   F +  ++
Sbjct: 6   AKHYIDQFPKKKTESAARTVQFFAGALIAVLALVGFADPEMFVDFELFPGMNAFAFIALM 65

Query: 117 VPLFAVSRGMIPDDHLVFDPEARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVV 176
             ++AV+RGMI +++ VFDP   ++ V+E+THY PD+W+GRLH+ +V+ EF +L+ V+++
Sbjct: 66  TTVWAVARGMISEENEVFDPAFFMQSVIEYTHYQPDQWKGRLHSFDVKTEFAELYRVRII 125

Query: 177 LYIQEIFSVIFTPFILWFSLADCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHG-NVK 235
           ++++EI  V+ TP IL+FSL  CS+QI+DFFREFT+HVDG+G VCSFA+FDF+K   N K
Sbjct: 126 IFLEEILGVLVTPLILFFSLPKCSEQIVDFFREFTIHVDGLGYVCSFAVFDFQKDARNAK 185

Query: 236 YGAP-------------------ASEVENEYYLSKDGKMEKSFLNFKANH--------PD 268
              P                     +   +YY +K GKM+ S   F  N+        P 
Sbjct: 186 QKGPQQQQQQQQQQQQQQTVGGGGGDAREDYYSTKHGKMQASMYGFLDNYVYNPRSGLPG 245

Query: 269 WEPTDPFG 276
             P  P G
Sbjct: 246 AHPLGPAG 253



>gi|47220347|emb|CAF98446.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 596

 Score =  204 bits (518), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 154/268 (57%), Gaps = 8/268 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R+W+ + R   R FNEL+H  H+RL + YKP  KY++ F             
Sbjct: 332 EPGSL-GARRWSLYGRLYLRHFNELNHELHERLGRGYKPTAKYMNSFTSPLLAVLAKNIA 390

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     I T  TV    G+++    ++R  IPD+H+V+ PE
Sbjct: 391 FFSGSVLAVLIALTVYDEDVLTVQHILTAITVL---GIVI---TITRSFIPDEHMVWCPE 444

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD WRG  + +E R E  QLF+ K V  ++E+ S I TPFIL F L 
Sbjct: 445 QLLQCMLAHIHYMPDHWRGNANKNETRDEVAQLFQYKAVFILEELLSPIVTPFILIFLLR 504

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
           + S +IIDFFR FTV V GVGD+CSFA  D R+HGN  + +      + Y  +++GK E 
Sbjct: 505 NKSLEIIDFFRNFTVEVVGVGDICSFAQMDIRRHGNPTWMSEGQTEASIYQQAENGKTEL 564

Query: 258 SFLNFKANHPDWEPTDPFGSLYLSRLTE 285
           S ++F   +P W+P     S+++S L E
Sbjct: 565 SLMHFTIKNPHWQPPQE-SSVFISHLKE 591



>gi|443702522|gb|ELU00510.1| hypothetical protein CAPTEDRAFT_136790, partial [Capitella teleta]
          Length = 546

 Score =  203 bits (516), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ GSR+W+ ++R   R FNEL H F+ RL ++YKPA KY++ F             
Sbjct: 283 EPGSL-GSRRWSLYSRLYLRHFNELDHEFNARLCRAYKPAEKYMNIFTSPVVVIIAKHVA 341

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVL++ T ID D+     I    T+    GV+V    +    IPD+H+VF PE
Sbjct: 342 FLAGSILAVLVILTMIDEDVLAVQHILVTMTI---AGVVV---TICGACIPDEHMVFCPE 395

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ V+ H HY PD WRG+ H    R EF Q F+ KVV  ++E+ S I TP IL FS+ 
Sbjct: 396 LLLRSVLGHIHYMPDHWRGQGHNHNTRNEFAQHFQYKVVYLLEEVLSPILTPLILTFSVR 455

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             +  I+DFFR FTV V GVGDVCSFA  D RKHGN K+          +   ++GK E 
Sbjct: 456 HKALDIVDFFRNFTVEVTGVGDVCSFAQMDIRKHGNPKWIEDDQTEAGLHEQGENGKTEL 515

Query: 258 SFLNFKANHPDWEPTDP 274
           S ++F   +P+W+P  P
Sbjct: 516 SLMHFTLTNPEWKPATP 532



>gi|19113039|ref|NP_596247.1| autophagy associated protein Atg9 [Schizosaccharomyces pombe 972h-]
 gi|73619467|sp|O74312.1|ATG9_SCHPO RecName: Full=Autophagy-related protein 9
 gi|3451465|emb|CAA20482.1| autophagy associated protein Atg9 [Schizosaccharomyces pombe]
          Length = 702

 Score =  203 bits (516), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 143/229 (62%), Gaps = 5/229 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++  +R++T  A W FRE+NEL H F +R++ SY  A+ Y+ QFP            
Sbjct: 448 NPGAL-STRRYTPLALWTFREYNELQHFFDERINDSYAAASHYVSQFPDFNMIRLFKYIS 506

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GSFTA+L++ T  DP+L + FEIT  R+V FY G+   L AVSR +IPD+ LVF PE
Sbjct: 507 FILGSFTAILVIITVFDPELMVTFEITKDRSVLFYLGLFGSLIAVSRSIIPDETLVFAPE 566

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L++V+  THY P  W   +H+  V++EF  L+  ++V  + EI  ++ TP +L+F+  
Sbjct: 567 KALRRVITFTHYMPGWWSDNMHSKAVQQEFCSLYSYRIVNLLWEILGILLTPVLLFFTFP 626

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENE 246
            CSQ I+DFFRE T++V+GVG VCS+A+F      N  Y + AS V++ 
Sbjct: 627 SCSQDIVDFFREHTINVEGVGYVCSYAVF----QDNPPYESVASLVQSR 671



>gi|449689238|ref|XP_002157906.2| PREDICTED: autophagy-related protein 9A-like, partial [Hydra
           magnipapillata]
          Length = 619

 Score =  203 bits (516), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 146/255 (57%), Gaps = 10/255 (3%)

Query: 22  IFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXG 81
           +FG+R+W+ F R   R FNEL H F  RL+K+Y PA +Y++ F                G
Sbjct: 235 VFGARRWSPFGRLYLRHFNELDHEFQSRLNKAYMPATRYMNVFTSPIITIFAKNIAFFSG 294

Query: 82  SFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLK 141
           +  AVL+  ++ D D      + T   V  +   L  +  +  G IPD+H+VF PE  +K
Sbjct: 295 AILAVLLGLSFYDKD------VLTAEHVLSFMATLGIIIKICSGFIPDEHMVFCPETLMK 348

Query: 142 KVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQ 201
           +++ +THY P+EW+GR HT EVR EF ++F+ K +  ++E+ S + TPFIL F L   + 
Sbjct: 349 QILSNTHYIPEEWKGRAHTMEVREEFSKMFQYKFICLLEELMSPLLTPFILCFGLRYKAL 408

Query: 202 QIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYY----LSKDGKMEK 257
           QI+DF+R FTV V G+GDVCSFA  D RKHG   +       E++       +++ K E 
Sbjct: 409 QIVDFYRNFTVEVAGLGDVCSFAQMDIRKHGAKNWSDEGCSKEDQMLSAESQAENAKTEL 468

Query: 258 SFLNFKANHPDWEPT 272
           S LNF   +PDW+P+
Sbjct: 469 SLLNFSIKNPDWKPS 483



>gi|365981543|ref|XP_003667605.1| hypothetical protein NDAI_0A02040 [Naumovozyma dairenensis CBS 421]
 gi|343766371|emb|CCD22362.1| hypothetical protein NDAI_0A02040 [Naumovozyma dairenensis CBS 421]
          Length = 737

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/211 (41%), Positives = 140/211 (66%), Gaps = 1/211 (0%)

Query: 17  SDPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXX 76
           + PGS+  +RQ+T  A WKFRE+NEL H+F +RL  S   ANKYIDQFPK KT       
Sbjct: 323 TSPGSL-SARQYTPMAEWKFREYNELYHIFKKRLGLSMNVANKYIDQFPKEKTNLILKFV 381

Query: 77  XXXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDP 136
               GSF A+L   T +D + F+ FEIT  ++V F+  +   ++ VSR  +  ++  F+P
Sbjct: 382 AFLSGSFIAILATLTLVDSENFINFEITNDKSVVFFFTIFGAIWTVSRNAVSQEYNTFNP 441

Query: 137 EARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSL 196
           E  ++++  +THY P EW+   HT+EV+ +F +L+ +++V+ ++E+ S++ TPF+LWF+L
Sbjct: 442 EETVRELASYTHYLPKEWKNAYHTEEVKNDFCKLYNLRIVILLRELTSLVLTPFVLWFAL 501

Query: 197 ADCSQQIIDFFREFTVHVDGVGDVCSFAIFD 227
              ++ I+DFFRE + +VDG+G VC +A+F+
Sbjct: 502 PRSAENIVDFFREASTYVDGLGYVCKYAMFE 532



>gi|502115030|ref|XP_004495109.1| PREDICTED: autophagy-related protein 9-like [Cicer arietinum]
          Length = 893

 Score =  202 bits (514), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 151/269 (56%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FR FNE+ HLF  R++ S   A+ Y+ QFP               
Sbjct: 354 STASSRRWSNLSRWIFRGFNEVDHLFRHRINSSVLHASDYLKQFPSPIISIIAKFISFVS 413

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR + +Y  V   + A+SR  I ++ LV DPE  +
Sbjct: 414 GGFAAILIIIAFLEESLLEGH--IFGRNLLWYAAVFGTITAISRAAIVNELLVIDPEGAM 471

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+  T+ VR EF  LF+   ++ ++E+ S+  TP++L   +    
Sbjct: 472 SMVVQHTHYMPKRWRGKESTEMVRIEFETLFQYTGMMLLEEMASIFLTPYLLLLVVPKRV 531

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV V+GVG VCSF+ FDF+ HGN  YG+P     ++   S  GK+EKSFL
Sbjct: 532 DDILQFIEDFTVAVEGVGHVCSFSAFDFQTHGNSCYGSPCDAPRSQR--SSQGKLEKSFL 589

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +FK+++P WEP    G  +L  L  F  Q
Sbjct: 590 SFKSSYPSWEPNAE-GKQFLLNLRTFREQ 617



>gi|242039075|ref|XP_002466932.1| hypothetical protein SORBIDRAFT_01g016890 [Sorghum bicolor]
 gi|241920786|gb|EER93930.1| hypothetical protein SORBIDRAFT_01g016890 [Sorghum bicolor]
          Length = 958

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 151/269 (56%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW  RE+NE+ H F  R+D     +  Y+ QFP               
Sbjct: 384 STASSRRWSNLSRWILREYNEVEHFFRHRMDNCTLHSLNYLKQFPTPLISIVAKFVSFVS 443

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G    +L++  ++   +  G     GR +F+YT V   + AVSR ++ D+  V DPE  +
Sbjct: 444 GGLAGILLILGFLGESILEGH--VFGRNLFWYTVVFGTIAAVSRKVVADELQVIDPEGAM 501

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+  ++ VR+EF  LF+  + + ++E+ S+  TP++L F L    
Sbjct: 502 TLVVQHTHYMPKRWRGKESSEVVRKEFETLFQYTITMLLEEMASIFITPYLLIFVLPKRV 561

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  EFT++VDGVGDVCS ++FD R+HGN  YG+P   V++    S  GKMEKS L
Sbjct: 562 NDILCFISEFTIYVDGVGDVCSLSLFDLRRHGNRNYGSPLDSVKDTR--SSQGKMEKSLL 619

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +  W+P +P G  +L  L  F  +
Sbjct: 620 SFQSTYTSWQP-NPDGKQFLCNLQRFKEK 647



>gi|356503602|ref|XP_003520596.1| PREDICTED: autophagy-related protein 9-like [Glycine max]
          Length = 872

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FREFNE+ HLF  R++ S   A+ Y+ QFP               
Sbjct: 353 STASSRRWSNLSRWIFREFNEVDHLFKHRINSSVLHASDYLKQFPSPIISIIAKFISFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  I  + LV D +  +
Sbjct: 413 GGFAAILIIIAFLEESLLEGH--IFGRNLFWYAAVFGTITAISRAAITSEVLVLDADGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+  T+ VR EF  LF+   ++ ++E+ S+  TP++L   +    
Sbjct: 471 SMVVQHTHYMPKRWRGKESTEMVRVEFETLFQYTGMMLLEEMASIFLTPYLLLCIVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV+++GVG VCSF+ FDF++HGN +YG+P +   ++   S  GKMEKS L
Sbjct: 531 DDILQFIADFTVNIEGVGHVCSFSAFDFQEHGNSRYGSPCNAPRSQR--SSQGKMEKSLL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++++P WEP+   G  +L  L  F  +
Sbjct: 589 SFQSSYPSWEPSAQ-GKRFLLNLRRFREE 616



>gi|367005384|ref|XP_003687424.1| hypothetical protein TPHA_0J01690 [Tetrapisispora phaffii CBS 4417]
 gi|357525728|emb|CCE64990.1| hypothetical protein TPHA_0J01690 [Tetrapisispora phaffii CBS 4417]
          Length = 1043

 Score =  201 bits (512), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/211 (41%), Positives = 134/211 (63%)

Query: 23  FGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXXGS 82
            G RQ+T  A WKFREFNEL H+F +RL  S K A+KYI+QFPK              G+
Sbjct: 636 LGVRQYTPIAEWKFREFNELYHVFEKRLGLSTKLADKYINQFPKETLDIIFNFVSFVSGT 695

Query: 83  FTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARLKK 142
           F  +L+  T  D + FL  EIT  RT  FY  +   ++ + +  I +++ VFDPE  +K+
Sbjct: 696 FVTILVCLTLFDSEHFLNVEITKDRTAIFYITIFGAIWTICKNSISEEYNVFDPEETIKE 755

Query: 143 VVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCSQQ 202
           +  +THY P+EW G+ HT+ V+ EF +L+ +++++ ++E+ S+I TPF+LWFSL  CSQ+
Sbjct: 756 LSLYTHYLPEEWEGKYHTEGVKNEFCKLYNLRIIILLRELTSLILTPFVLWFSLPKCSQK 815

Query: 203 IIDFFREFTVHVDGVGDVCSFAIFDFRKHGN 233
           II+F     +++DG+G VC +A FD ++  N
Sbjct: 816 IIEFISSSAIYIDGLGYVCKYASFDIKQFEN 846



>gi|330793179|ref|XP_003284663.1| hypothetical protein DICPUDRAFT_45639 [Dictyostelium purpureum]
 gi|325085462|gb|EGC38869.1| hypothetical protein DICPUDRAFT_45639 [Dictyostelium purpureum]
          Length = 441

 Score =  200 bits (508), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 153/252 (60%), Gaps = 5/252 (1%)

Query: 19  PGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXX 78
           PGS+F SR+W+  ARW+FRE NEL H F  RL  SY  AN Y++ FP             
Sbjct: 70  PGSLF-SREWSPLARWQFRELNELPHYFQNRLSLSYTHANHYVESFPSQFLSIVAKFISF 128

Query: 79  XXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEA 138
             GSF AV I+   ++    + F+I   RT  +Y G+   + A++R +I D++  + P  
Sbjct: 129 IFGSFLAVFIVLGILNDHFIMNFQIF-DRTPIWYIGIFGTVVAITRSLITDENHAYQPAK 187

Query: 139 RLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLAD 198
            + + V++THY P  W G+ HT +VR EF+ LFE ++V ++++IFSVIFTPFIL FSL  
Sbjct: 188 HMARTVQNTHYLPLSWVGKTHTLQVRDEFLSLFEYRIVDFVRDIFSVIFTPFILIFSLPK 247

Query: 199 CSQQIIDFFREFTVHVDGVGDVCSFAIF-DFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
            SQ II+FF + TV++DGVG +C    F + +K G+  +G+ +    N    + +GK+EK
Sbjct: 248 SSQAIINFFGDNTVNLDGVGPICQLGDFTNVKKLGDNSFGSISQ--ANRVSSTNNGKLEK 305

Query: 258 SFLNFKANHPDW 269
           S +NFK  +P+W
Sbjct: 306 SVINFKCLNPEW 317



>gi|125543117|gb|EAY89256.1| hypothetical protein OsI_10753 [Oryza sativa Indica Group]
          Length = 936

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FRE+NE+ H F  R++ S   +  Y+ QFP               
Sbjct: 352 STASSRRWSNLSRWIFREYNEVDHFFRHRMNNSAVHSLNYLKQFPTPLISIMAKFISFVS 411

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G     LI+  ++   +  G     GR +F+YT V   + A+SR ++ D+  V DPE  +
Sbjct: 412 GGLAGALIIIGFLGESVLEGH--IFGRNLFWYTIVFGTIAAISRKVVADELQVIDPEGAM 469

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+ THY P  WRG+  ++ VRREF  LF+  +V+ ++E+ S+  +P++L F +    
Sbjct: 470 CNVVQQTHYMPKRWRGKEDSEVVRREFETLFQFTIVMLLEEMASIFISPYLLIFEVPKRV 529

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FT++VDGVGDVCS ++FDFR+HGN  Y +P   ++     S  GKMEKSFL
Sbjct: 530 DDILQFISDFTIYVDGVGDVCSLSLFDFRRHGNRNYASPFDALKT--LRSSQGKMEKSFL 587

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP +  G  +L+ L +F  +
Sbjct: 588 SFQSVYPSWEP-NAEGKQFLTNLQKFKEK 615



>gi|74831802|emb|CAJ30211.1| autophagy protein 9 [Saccharum officinarum]
          Length = 896

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW  RE+NE+ H F  R+D     +  Y+ QFP               
Sbjct: 361 STASSRRWSNLSRWILREYNEVEHFFRHRMDNCTLHSLNYLKQFPTPLISIVAKFVSFVS 420

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G    +L++  ++   +  G     GR +F+YT V   +  VSR ++ D+  V DPE  +
Sbjct: 421 GGLAGILLILGFLGESILEGH--VFGRNLFWYTVVFGTIATVSRKVVADELQVIDPEGAM 478

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV++THY P  WRG+  ++ VR+EF  LF+  + + ++E+ S+  TP++L F L    
Sbjct: 479 TLVVQYTHYMPKRWRGKESSEVVRKEFETLFQYTITMLLEEMASIFITPYLLIFVLPKRV 538

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  EFT++VDGVGDVCS ++FDF++HGN  YG+P + ++     S  GKMEKSFL
Sbjct: 539 NDILCFISEFTIYVDGVGDVCSLSLFDFKRHGNRNYGSPFNALKG--LRSSQGKMEKSFL 596

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP +  G  +LS L +F  +
Sbjct: 597 SFQSVYPSWEP-NADGKHFLSNLQKFKEK 624



>gi|158260533|dbj|BAF82444.1| unnamed protein product [Homo sapiens]
          Length = 839

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD WRG  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWRGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|222624568|gb|EEE58700.1| hypothetical protein OsJ_10136 [Oryza sativa Japonica Group]
          Length = 936

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FRE+NE+ H F  R++ S   +  Y+ QFP               
Sbjct: 352 STASSRRWSNLSRWIFREYNEVDHFFRHRMNNSAVHSLNYLKQFPTPLISIMAKFISFVS 411

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G     LI+  ++   +  G     GR +F+YT V   + A+SR ++ D+  V DPE  +
Sbjct: 412 GGLAGALIIIGFLGESVLEGH--IFGRNLFWYTIVFGTIAAISRKVVADELQVIDPEGAM 469

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+ THY P  WRG+  ++ VRREF  LF+  +V+ ++E+ S+  +P++L F +    
Sbjct: 470 CNVVQQTHYMPKRWRGKEDSEVVRREFETLFQFTIVMLLEEMASIFISPYLLIFEVPKRV 529

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FT++VDGVGDVCS ++FDFR+HGN  Y +P   ++     S  GKMEKSFL
Sbjct: 530 DDILRFISDFTIYVDGVGDVCSLSLFDFRRHGNRNYASPFDALKT--LRSSQGKMEKSFL 587

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP +  G  +L+ L +F  +
Sbjct: 588 SFQSVYPSWEP-NAEGKQFLTNLQKFKEK 615



>gi|115451905|ref|NP_001049553.1| Os03g0248000 [Oryza sativa Japonica Group]
 gi|108707166|gb|ABF94961.1| Autophagy protein Apg9 containing protein, expressed [Oryza sativa
           Japonica Group]
 gi|113548024|dbj|BAF11467.1| Os03g0248000 [Oryza sativa Japonica Group]
          Length = 902

 Score =  199 bits (506), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FRE+NE+ H F  R++ S   +  Y+ QFP               
Sbjct: 353 STASSRRWSNLSRWIFREYNEVDHFFRHRMNNSAVHSLNYLKQFPTPLISIMAKFISFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G     LI+  ++   +  G     GR +F+YT V   + A+SR ++ D+  V DPE  +
Sbjct: 413 GGLAGALIIIGFLGESVLEGH--IFGRNLFWYTIVFGTIAAISRKVVADELQVIDPEGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+ THY P  WRG+  ++ VRREF  LF+  +V+ ++E+ S+  +P++L F +    
Sbjct: 471 CNVVQQTHYMPKRWRGKEDSEVVRREFETLFQFTIVMLLEEMASIFISPYLLIFEVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FT++VDGVGDVCS ++FDFR+HGN  Y +P   ++     S  GKMEKSFL
Sbjct: 531 DDILRFISDFTIYVDGVGDVCSLSLFDFRRHGNRNYASPFDALKT--LRSSQGKMEKSFL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP +  G  +L+ L +F  +
Sbjct: 589 SFQSVYPSWEP-NAEGKQFLTNLQKFKEK 616



>gi|327260430|ref|XP_003215037.1| PREDICTED: autophagy-related protein 9A-like [Anolis carolinensis]
          Length = 850

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 139/254 (54%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R W+ + R   R FNEL H    RL K YKPA+KY++ F             
Sbjct: 323 EPGSL-GARCWSLYGRCYLRHFNELDHELQSRLSKGYKPASKYMNCFISPLLTIVAKNVA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD HLVF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTIL---GVGV---TVCRSFIPDQHLVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  E R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRYETRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+  + +      + Y  ++DGK E 
Sbjct: 496 PKALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPAWMSAGKTEASIYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPHWQP 569



>gi|432103433|gb|ELK30538.1| Autophagy-related protein 9A [Myotis davidii]
          Length = 600

 Score =  198 bits (504), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 270 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNCA 328

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD HLVF PE
Sbjct: 329 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHLVFCPE 382

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 383 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 442

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 443 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 502

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 503 SLMHFAITNPGWQP 516



>gi|356570636|ref|XP_003553491.1| PREDICTED: autophagy-related protein 9 [Glycine max]
          Length = 941

 Score =  198 bits (503), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 154/277 (55%), Gaps = 5/277 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   S++W+  +RW FREFNE+ HLF  R++     A+ Y+ QFP               
Sbjct: 425 STASSQRWSNLSRWIFREFNEVDHLFKHRINCGVLHASDYLKQFPSPIISIIAKFISFVS 484

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G F A+LI+  +++  L  G     GR +F+Y  V   + A+SR  I ++ LV D +  +
Sbjct: 485 GGFAAILIIIAFLEESLLEGH--VFGRNLFWYAAVFGTITAISRAAITNEVLVLDADGAM 542

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
             VV+HTHY P  WRG+  T+ V  EF  LF+   ++ ++E+ S+  TP++L   +    
Sbjct: 543 SMVVQHTHYMPKRWRGKESTEMVHVEFETLFQYTGMMLLEEMASIFLTPYLLLCIVPKRV 602

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FTV+V+GVG VCSF+ FDF++HGN  YG+P +   +    S  GKMEKS L
Sbjct: 603 DDILQFIADFTVNVEGVGHVCSFSAFDFQEHGNSHYGSPCNAPRSRR--SSQGKMEKSLL 660

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQAHPERPNA 297
           +F++++P WEP+   G  +L  L  F  +  P   N 
Sbjct: 661 SFQSSYPSWEPS-ALGKRFLLNLRRFREETLPVHGNV 696



>gi|21739357|emb|CAD38723.1| hypothetical protein [Homo sapiens]
          Length = 649

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 133 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 191

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 192 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 245

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 246 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 305

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 306 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 365

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 366 SLMHFAITNPGWQP 379



>gi|471376680|ref|XP_004376390.1| PREDICTED: autophagy-related protein 9A isoform 1 [Trichechus
           manatus latirostris]
 gi|471376682|ref|XP_004376391.1| PREDICTED: autophagy-related protein 9A isoform 2 [Trichechus
           manatus latirostris]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD HLVF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHLVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|193786476|dbj|BAG51759.1| unnamed protein product [Homo sapiens]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|397495714|ref|XP_003818691.1| PREDICTED: autophagy-related protein 9A isoform 1 [Pan paniscus]
 gi|397495716|ref|XP_003818692.1| PREDICTED: autophagy-related protein 9A isoform 2 [Pan paniscus]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|332246599|ref|XP_003272440.1| PREDICTED: LOW QUALITY PROTEIN: autophagy-related protein 9A
           [Nomascus leucogenys]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|114583419|ref|XP_001161185.1| PREDICTED: autophagy-related protein 9A isoform 2 [Pan troglodytes]
 gi|114583421|ref|XP_001161225.1| PREDICTED: autophagy-related protein 9A isoform 3 [Pan troglodytes]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|116089282|ref|NP_001070666.1| autophagy-related protein 9A [Homo sapiens]
 gi|116089287|ref|NP_076990.4| autophagy-related protein 9A [Homo sapiens]
 gi|296439428|sp|Q7Z3C6.3|ATG9A_HUMAN RecName: Full=Autophagy-related protein 9A; AltName: Full=APG9-like
           1; AltName: Full=mATG9
 gi|73696301|tpg|DAA05199.1| TPA_exp: autophagy 9-like 1 protein [Homo sapiens]
 gi|119591112|gb|EAW70706.1| ATG9 autophagy related 9 homolog A (S. cerevisiae), isoform CRA_a
           [Homo sapiens]
 gi|119591113|gb|EAW70707.1| ATG9 autophagy related 9 homolog A (S. cerevisiae), isoform CRA_a
           [Homo sapiens]
          Length = 839

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|395527633|ref|XP_003765947.1| PREDICTED: autophagy-related protein 9A [Sarcophilus harrisii]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVAV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFIVEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWMSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|197099732|ref|NP_001127287.1| autophagy-related protein 9A [Pongo abelii]
 gi|62510477|sp|Q5RCS0.1|ATG9A_PONAB RecName: Full=Autophagy-related protein 9A; AltName: Full=APG9-like
           1
 gi|55727363|emb|CAH90437.1| hypothetical protein [Pongo abelii]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|383872529|ref|NP_001244824.1| autophagy related 9A [Macaca mulatta]
 gi|355565203|gb|EHH21692.1| hypothetical protein EGK_04816, partial [Macaca mulatta]
 gi|355750855|gb|EHH55182.1| hypothetical protein EGM_04334, partial [Macaca fascicularis]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|10438450|dbj|BAB15246.1| unnamed protein product [Homo sapiens]
          Length = 668

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 152 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 210

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 211 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 264

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 265 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 324

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 325 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 384

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 385 SLMHFAITNPGWQP 398



>gi|403266809|ref|XP_003925553.1| PREDICTED: autophagy-related protein 9A isoform 1 [Saimiri
           boliviensis boliviensis]
 gi|403266811|ref|XP_003925554.1| PREDICTED: autophagy-related protein 9A isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|296205644|ref|XP_002749853.1| PREDICTED: autophagy-related protein 9A isoform 1 [Callithrix
           jacchus]
 gi|296205646|ref|XP_002749854.1| PREDICTED: autophagy-related protein 9A isoform 2 [Callithrix
           jacchus]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|402889446|ref|XP_003908027.1| PREDICTED: autophagy-related protein 9A isoform 1 [Papio anubis]
 gi|402889448|ref|XP_003908028.1| PREDICTED: autophagy-related protein 9A isoform 2 [Papio anubis]
          Length = 839

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|31874658|emb|CAD98064.1| hypothetical protein [Homo sapiens]
          Length = 778

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 262 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 320

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 321 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 374

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 375 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 434

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 435 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 494

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 495 SLMHFAITNPGWQP 508



>gi|166831531|gb|ABY89796.1| APG9 autophagy 9-like 1 (predicted) [Callithrix jacchus]
          Length = 580

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 227 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 285

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 286 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 339

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 340 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 399

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 400 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 459

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 460 SLMHFAITNPGWQP 473



>gi|449275355|gb|EMC84227.1| Autophagy-related protein 9A, partial [Columba livia]
          Length = 826

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 138/254 (54%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PGS+ G+R W+ + R   R FNEL H  H RL K YKPA+KY++ F             
Sbjct: 298 EPGSL-GARCWSLYGRCYLRHFNELDHELHSRLSKGYKPASKYMNCFISPLLTIVAKNVA 356

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV +    V R  IPD HLVF PE
Sbjct: 357 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVGI---TVCRSFIPDQHLVFCPE 410

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  E R EF QLF+ K V  ++E+ S I TP IL   L 
Sbjct: 411 QLLRVILAHIHYMPDHWQGNAHRYETRDEFAQLFQYKAVFILEELLSPIITPLILIVCLR 470

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             S  I+DFFR FTV V GVGD CSFA  D R+HG+  + +      + Y  ++DGK E 
Sbjct: 471 PKSLDIVDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPAWMSAGKTEASIYQQAEDGKTEL 530

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 531 SLMHFAITNPKWQP 544



>gi|242036325|ref|XP_002465557.1| hypothetical protein SORBIDRAFT_01g041090 [Sorghum bicolor]
 gi|241919411|gb|EER92555.1| hypothetical protein SORBIDRAFT_01g041090 [Sorghum bicolor]
          Length = 888

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  SIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXXXXX 80
           S   SR+W+  +RW FRE+NE+ H F  R++ S   +  Y+ QFP               
Sbjct: 353 STASSRRWSNLSRWIFREYNEVDHFFRHRMNNSAVHSLNYLKQFPTPLVSIMAKFVSFVS 412

Query: 81  GSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPEARL 140
           G     LI+  ++   +  G     GR + +YT V   + A+SR ++ D+  V DPE  +
Sbjct: 413 GGLAGALIIIGFVGESILEGH--IFGRNLLWYTIVFGTIAAISRKVVADELQVIDPEGAM 470

Query: 141 KKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLADCS 200
              V  THY P  WRG+ +++ VRREF  LF+  +++ ++E+ S+  TP++L F +    
Sbjct: 471 CLAVHQTHYMPKRWRGKENSELVRREFETLFQYTIIMLLEEMASIFITPYLLIFEVPKRV 530

Query: 201 QQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEKSFL 260
             I+ F  +FT++VDGVGDVCS ++FDF++HGN  YG+P + ++     S  GKMEKSFL
Sbjct: 531 DDILRFISDFTIYVDGVGDVCSLSMFDFKRHGNRNYGSPFNGLKG--LRSSQGKMEKSFL 588

Query: 261 NFKANHPDWEPTDPFGSLYLSRLTEFNNQ 289
           +F++ +P WEP +  G  +LS L +F  +
Sbjct: 589 SFQSVYPSWEP-NADGKQFLSNLQKFKEK 616



>gi|31874056|emb|CAD97944.1| hypothetical protein [Homo sapiens]
 gi|117646418|emb|CAL38676.1| hypothetical protein [synthetic construct]
          Length = 839

 Score =  197 bits (501), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|334347179|ref|XP_001363840.2| PREDICTED: autophagy-related protein 9A-like [Monodelphis
           domestica]
          Length = 954

 Score =  197 bits (501), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVAV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFIVEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWMSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|348556532|ref|XP_003464075.1| PREDICTED: autophagy-related protein 9A-like [Cavia porcellus]
          Length = 964

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|281340208|gb|EFB15792.1| hypothetical protein PANDA_001527 [Ailuropoda melanoleuca]
          Length = 869

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 353 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 411

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 412 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 465

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 466 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 525

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 526 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 585

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 586 SLMHFAITNPGWQP 599



>gi|505847524|ref|XP_004617227.1| PREDICTED: autophagy-related protein 9A [Sorex araneus]
          Length = 867

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD HLVF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHLVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|148667958|gb|EDL00375.1| autophagy-related 9A (yeast), isoform CRA_b [Mus musculus]
          Length = 704

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 188 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 246

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 247 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 300

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 301 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 360

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 361 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 420

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 421 SLMHFAITNPGWQP 434



>gi|440911044|gb|ELR60773.1| Autophagy-related protein 9A, partial [Bos grunniens mutus]
          Length = 842

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 326 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNCA 384

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 385 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 438

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 439 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 498

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 499 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 558

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 559 SLMHFAITNPGWQP 572



>gi|345797352|ref|XP_536073.3| PREDICTED: uncharacterized protein LOC478914 [Canis lupus
           familiaris]
          Length = 1801

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|354491038|ref|XP_003507663.1| PREDICTED: autophagy-related protein 9A-like [Cricetulus griseus]
          Length = 893

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|301755711|ref|XP_002913735.1| PREDICTED: autophagy-related protein 9A-like [Ailuropoda
           melanoleuca]
          Length = 839

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|77736357|ref|NP_001029878.1| autophagy-related protein 9A [Bos taurus]
 gi|91208328|sp|Q3T904.1|ATG9A_BOVIN RecName: Full=Autophagy-related protein 9A; AltName: Full=APG9-like
           1; AltName: Full=Autophagy protein 9
 gi|74831724|emb|CAJ30197.1| autophagy protein 9 [Bos taurus]
 gi|146186470|gb|AAI40512.1| ATG9A protein [Bos taurus]
 gi|296490307|tpg|DAA32420.1| TPA: autophagy-related protein 9A [Bos taurus]
          Length = 839

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNCA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|470626514|ref|XP_004320383.1| PREDICTED: autophagy-related protein 9A isoform 1 [Tursiops
           truncatus]
          Length = 870

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNCA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569



>gi|291392269|ref|XP_002712644.1| PREDICTED: APG9 autophagy 9-like 1 [Oryctolagus cuniculus]
          Length = 878

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 141/254 (55%), Gaps = 7/254 (2%)

Query: 18  DPGSIFGSRQWTQFARWKFREFNELSHLFHQRLDKSYKPANKYIDQFPKAKTXXXXXXXX 77
           +PG++ G+R W+ + R   R FNEL H    RL++ YKPA+KY++ F             
Sbjct: 323 EPGAL-GARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGA 381

Query: 78  XXXGSFTAVLILATYIDPDLFLGFEITTGRTVFFYTGVLVPLFAVSRGMIPDDHLVFDPE 137
              GS  AVLI  T  D D+     + T  T+    GV V    V R  IPD H+VF PE
Sbjct: 382 FFAGSILAVLIALTIYDEDVLAVEHVLTTVTLL---GVTV---TVCRSFIPDQHMVFCPE 435

Query: 138 ARLKKVVEHTHYSPDEWRGRLHTDEVRREFIQLFEVKVVLYIQEIFSVIFTPFILWFSLA 197
             L+ ++ H HY PD W+G  H  + R EF QLF+ K V  ++E+ S I TP IL F L 
Sbjct: 436 QLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLR 495

Query: 198 DCSQQIIDFFREFTVHVDGVGDVCSFAIFDFRKHGNVKYGAPASEVENEYYLSKDGKMEK 257
             + +IIDFFR FTV V GVGD CSFA  D R+HG+ ++ +      + Y  ++DGK E 
Sbjct: 496 PRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTEL 555

Query: 258 SFLNFKANHPDWEP 271
           S ++F   +P W+P
Sbjct: 556 SLMHFAITNPGWQP 569