BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10036_c0_seq1-m.13 5prime_partial 3-911(+) 303 (+)
         (302 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|328768712|gb|EGF78758.1| hypothetical protein BATDEDRAFT_1309...   379   e-103   Batrachochytrium dendrobatidis JAM81
gi|408391252|gb|EKJ70632.1| hypothetical protein FPSE_09142 [Fus...   357   2e-96   Fusarium pseudograminearum CS3096
gi|475668609|gb|EMT66396.1| Carnitine O-acetyltransferase, mitoc...   356   5e-96   Fusarium oxysporum f. sp. cubense race 4
gi|477509776|gb|ENH63065.1| Carnitine O-acetyltransferase, mitoc...   355   6e-96   Fusarium oxysporum f. sp. cubense race 1
gi|342879991|gb|EGU81221.1| hypothetical protein FOXB_08254 [Fus...   355   6e-96   Fusarium oxysporum Fo5176
gi|384489731|gb|EIE80953.1| hypothetical protein RO3G_05658 [Rhi...   355   7e-96   Rhizopus delemar RA 99-880
gi|302881963|ref|XP_003039892.1| predicted protein [Nectria haem...   352   6e-95   Nectria haematococca mpVI 77-13-4
gi|46110084|ref|XP_382100.1| hypothetical protein FG01924.1 [Fus...   349   4e-94   
gi|115384054|ref|XP_001208574.1| conserved hypothetical protein ...   348   7e-94   Aspergillus terreus NIH2624
gi|367022256|ref|XP_003660413.1| hypothetical protein MYCTH_2298...   348   8e-94   Myceliophthora thermophila ATCC 42464
gi|340960373|gb|EGS21554.1| carnitine O-acetyltransferase-like p...   348   1e-93   Chaetomium thermophilum var. thermophilum DSM 1495
gi|171690892|ref|XP_001910371.1| hypothetical protein [Podospora...   348   1e-93   Podospora anserina S mat+
gi|392868636|gb|EAS34427.2| carnitine acetyl transferase [Coccid...   347   2e-93   
gi|303315017|ref|XP_003067516.1| carnitine O-acetyltransferase, ...   347   2e-93   Coccidioides posadasii C735 delta SOWgp
gi|119190297|ref|XP_001245755.1| hypothetical protein CIMG_05196...   347   3e-93   
gi|116195904|ref|XP_001223764.1| hypothetical protein CHGG_04550...   345   6e-93   Chaetomium globosum CBS 148.51
gi|340513974|gb|EGR44246.1| carnitine acetyl transferase [Tricho...   345   1e-92   Trichoderma reesei QM6a
gi|350292437|gb|EGZ73632.1| putative carnitine O-acetyltransfera...   344   1e-92   Neurospora tetrasperma FGSC 2509
gi|336471344|gb|EGO59505.1| hypothetical protein NEUTE1DRAFT_145...   344   2e-92   Neurospora tetrasperma FGSC 2508
gi|358375839|dbj|GAA92415.1| carnitine acetyl transferase [Asper...   342   5e-92   Aspergillus kawachii IFO 4308
gi|145254415|ref|XP_001398619.1| carnitine acetyl transferase [A...   342   6e-92   Aspergillus niger CBS 513.88
gi|350630484|gb|EHA18856.1| hypothetical protein ASPNIDRAFT_1209...   342   7e-92   Aspergillus niger ATCC 1015
gi|85108947|ref|XP_962672.1| hypothetical protein NCU08002 [Neur...   342   1e-91   
gi|258565413|ref|XP_002583451.1| conserved hypothetical protein ...   341   1e-91   Uncinocarpus reesii 1704
gi|121715852|ref|XP_001275535.1| carnitine acetyl transferase [A...   340   2e-91   Aspergillus clavatus NRRL 1
gi|361131025|gb|EHL02755.1| putative Carnitine O-acetyltransfera...   340   2e-91   Glarea lozoyensis 74030
gi|512197224|gb|EPE26060.1| CoA-dependent acyltransferase [Glare...   340   3e-91   Glarea lozoyensis ATCC 20868
gi|71001808|ref|XP_755585.1| carnitine acetyl transferase [Asper...   340   4e-91   Aspergillus fumigatus Af293
gi|159129645|gb|EDP54759.1| carnitine acetyl transferase [Asperg...   339   5e-91   Aspergillus fumigatus A1163
gi|242809597|ref|XP_002485403.1| carnitine acetyl transferase [T...   338   1e-90   Talaromyces stipitatus ATCC 10500
gi|358382571|gb|EHK20242.1| hypothetical protein TRIVIDRAFT_2133...   338   1e-90   Trichoderma virens Gv29-8
gi|302413782|ref|XP_003004723.1| carnitine O-acetyltransferase [...   338   1e-90   Verticillium alfalfae VaMs.102
gi|472236379|gb|EMR81316.1| putative choline carnitine o-acyltra...   337   2e-90   Botrytis cinerea BcDW1
gi|119481359|ref|XP_001260708.1| carnitine acetyl transferase [N...   337   2e-90   Aspergillus fischeri NRRL 181
gi|407920945|gb|EKG14122.1| Acyltransferase ChoActase/COT/CPT [M...   337   2e-90   Macrophomina phaseolina MS6
gi|358398998|gb|EHK48349.1| carnitine O-acetyltransferase precur...   337   2e-90   Trichoderma atroviride IMI 206040
gi|384497855|gb|EIE88346.1| hypothetical protein RO3G_13057 [Rhi...   337   2e-90   Rhizopus delemar RA 99-880
gi|154293128|ref|XP_001547114.1| hypothetical protein BC1G_14516...   337   3e-90   Botrytis cinerea B05.10
gi|440633991|gb|ELR03910.1| carnitine O-acetyltransferase [Geomy...   337   3e-90   Pseudogymnoascus destructans 20631-21
gi|310792024|gb|EFQ27551.1| choline/Carnitine O-acyltransferase ...   337   3e-90   Colletotrichum graminicola M1.001
gi|429849234|gb|ELA24637.1| carnitine acetyl transferase [Collet...   336   4e-90   Colletotrichum gloeosporioides Nara gc5
gi|402082664|gb|EJT77682.1| carnitine O-acetyltransferase [Gaeum...   336   4e-90   Gaeumannomyces graminis var. tritici R3-111a-1
gi|156034807|ref|XP_001585822.1| hypothetical protein SS1G_13339...   336   4e-90   Sclerotinia sclerotiorum 1980 UF-70
gi|346975434|gb|EGY18886.1| carnitine O-acetyltransferase [Verti...   335   8e-90   Verticillium dahliae VdLs.17
gi|485929347|gb|EOD52767.1| putative carnitine o-acetyltransfera...   335   9e-90   Neofusicoccum parvum UCRNP2
gi|322707647|gb|EFY99225.1| carnitine acetyl transferase [Metarh...   335   1e-89   
gi|511007392|gb|EPB88684.1| carnitine O-acetyltransferase [Mucor...   334   1e-89   Mucor circinelloides f. circinelloides 1006PhL
gi|500258493|gb|EOO01405.1| putative carnitine o-acetyltransfera...   334   2e-89   Phaeoacremonium minimum UCRPA7
gi|399168732|emb|CCE30518.1| probable carnitine O-acetyltransfer...   333   2e-89   Claviceps purpurea 20.1
gi|295662811|ref|XP_002791959.1| carnitine O-acetyltransferase [...   333   3e-89   
gi|226286690|gb|EEH42203.1| carnitine O-acetyltransferase [Parac...   331   1e-88   
gi|212537323|ref|XP_002148817.1| carnitine acetyl transferase [T...   331   2e-88   Talaromyces marneffei ATCC 18224
gi|406866603|gb|EKD19642.1| choline/Carnitine O-acyltransferase ...   329   6e-88   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|320591915|gb|EFX04354.1| carnitine acetyl transferase [Grosma...   329   6e-88   Grosmannia clavigera kw1407
gi|512192583|gb|EPE08342.1| carnitine acetyl transferase [Ophios...   328   1e-87   Ophiostoma piceae UAMH 11346
gi|391868817|gb|EIT78026.1| carnitine O-acyltransferase CRAT [As...   328   2e-87   Aspergillus oryzae 3.042
gi|238496603|ref|XP_002379537.1| carnitine acetyl transferase [A...   327   2e-87   Aspergillus flavus NRRL3357
gi|296812625|ref|XP_002846650.1| carnitine acetyl transferase [A...   327   2e-87   Arthroderma otae CBS 113480
gi|477534538|gb|ENH86074.1| carnitine acetyl transferase [Collet...   327   2e-87   Colletotrichum orbiculare MAFF 240422
gi|239610578|gb|EEQ87565.1| carnitine acetyl transferase [Ajello...   327   3e-87   
gi|83769725|dbj|BAE59860.1| unnamed protein product [Aspergillus...   327   3e-87   Aspergillus oryzae RIB40
gi|315050652|ref|XP_003174700.1| carnitine O-acetyltransferase [...   327   3e-87   Microsporum gypseum CBS 118893
gi|326469628|gb|EGD93637.1| carnitine acetyl transferase [Tricho...   326   4e-87   Trichophyton tonsurans CBS 112818
gi|302509234|ref|XP_003016577.1| hypothetical protein ARB_04866 ...   326   5e-87   Arthroderma benhamiae CBS 112371
gi|327303492|ref|XP_003236438.1| carnitine acetyl transferase [T...   326   5e-87   Trichophyton rubrum CBS 118892
gi|511010252|gb|EPB91477.1| carnitine O-acetyltransferase [Mucor...   326   6e-87   Mucor circinelloides f. circinelloides 1006PhL
gi|302655212|ref|XP_003019399.1| hypothetical protein TRV_06566 ...   325   6e-87   Trichophyton verrucosum HKI 0517
gi|451848963|gb|EMD62267.1| hypothetical protein COCSADRAFT_3822...   324   2e-86   Bipolaris sorokiniana ND90Pr
gi|255946415|ref|XP_002563975.1| Pc20g15010 [Penicillium chrysog...   324   2e-86   Penicillium rubens Wisconsin 54-1255
gi|240275840|gb|EER39353.1| carnitine acetyl transferase [Ajello...   323   3e-86   Histoplasma capsulatum H143
gi|451993441|gb|EMD85914.1| hypothetical protein COCHEDRAFT_1186...   322   6e-86   Bipolaris maydis C5
gi|336268114|ref|XP_003348822.1| hypothetical protein SMAC_01845...   322   6e-86   Sordaria macrospora k-hell
gi|425765352|gb|EKV04050.1| Carnitine acetyl transferase [Penici...   322   7e-86   Penicillium digitatum Pd1
gi|189198249|ref|XP_001935462.1| carnitine O-acetyltransferase [...   322   7e-86   Pyrenophora tritici-repentis Pt-1C-BFP
gi|396487497|ref|XP_003842655.1| similar to carnitine O-acetyltr...   322   9e-86   Leptosphaeria maculans JN3
gi|225563252|gb|EEH11531.1| carnitine acetyl transferase [Ajello...   322   1e-85   Histoplasma capsulatum G186AR
gi|494826657|gb|EON63713.1| carnitine O-acetyltransferase [Conio...   322   1e-85   Coniosporium apollinis CBS 100218
gi|330932707|ref|XP_003303880.1| hypothetical protein PTT_16269 ...   322   1e-85   Pyrenophora teres f. teres 0-1
gi|346325058|gb|EGX94655.1| carnitine O-acetyltransferase [Cordy...   321   1e-85   Cordyceps militaris CM01
gi|367045362|ref|XP_003653061.1| hypothetical protein THITE_2115...   320   2e-85   Thielavia terrestris NRRL 8126
gi|501752124|emb|CCG83848.1| protein of unknown function [Taphri...   320   4e-85   Taphrina deformans PYCC 5710
gi|259479509|tpe|CBF69795.1| TPA: hypothetical protein similar t...   319   5e-85   Aspergillus nidulans FGSC A4
gi|345563481|gb|EGX46481.1| hypothetical protein AOL_s00109g53 [...   319   6e-85   Arthrobotrys oligospora ATCC 24927
gi|400596340|gb|EJP64114.1| putative carnitine O-acetyltransfera...   318   8e-85   Beauveria bassiana ARSEF 2860
gi|67540218|ref|XP_663883.1| hypothetical protein AN6279.2 [Aspe...   318   1e-84   Aspergillus nidulans FGSC A4
gi|482809441|gb|EOA86263.1| hypothetical protein SETTUDRAFT_1104...   317   2e-84   Setosphaeria turcica Et28A
gi|77732544|gb|AAB88887.2| carnitine acetyl transferase [Magnapo...   317   3e-84   Magnaporthe grisea
gi|389634131|ref|XP_003714718.1| carnitine O-acetyltransferase [...   316   4e-84   Magnaporthe oryzae 70-15
gi|302688589|ref|XP_003033974.1| hypothetical protein SCHCODRAFT...   316   5e-84   Schizophyllum commune H4-8
gi|440484718|gb|ELQ64749.1| carnitine O-acetyltransferase [Magna...   316   6e-84   Magnaporthe oryzae P131
gi|471884104|emb|CCO33850.1| carnitine O-acetyltransferase [Rhiz...   315   1e-83   Rhizoctonia solani AG-1 IB
gi|358057937|dbj|GAA96182.1| hypothetical protein E5Q_02846 [Mix...   315   1e-83   Mixia osmundae IAM 14324
gi|50546493|ref|XP_500716.1| YALI0B10340p [Yarrowia lipolytica] ...   315   1e-83   Yarrowia lipolytica CLIB122
gi|378731534|gb|EHY57993.1| carnitine O-acetyltransferase [Exoph...   314   2e-83   Exophiala dermatitidis NIH/UT8656
gi|449300625|gb|EMC96637.1| hypothetical protein BAUCODRAFT_3401...   314   2e-83   Baudoinia panamericana UAMH 10762
gi|471559247|gb|EMR61693.1| putative carnitine acetyl transferas...   313   3e-83   Eutypa lata UCREL1
gi|443916683|gb|ELU37664.1| carnitine acetyl transferase [Rhizoc...   313   4e-83   Rhizoctonia solani AG-1 IA
gi|154281759|ref|XP_001541692.1| conserved hypothetical protein ...   313   4e-83   Histoplasma capsulatum NAm1
gi|452986277|gb|EME86033.1| hypothetical protein MYCFIDRAFT_8824...   312   5e-83   Cercospora fijiensis CIRAD86
gi|169605885|ref|XP_001796363.1| hypothetical protein SNOG_05975...   312   6e-83   Parastagonospora nodorum SN15
gi|440471469|gb|ELQ40477.1| carnitine O-acetyltransferase [Magna...   312   6e-83   Magnaporthe oryzae Y34
gi|395330795|gb|EJF63177.1| acyltransferase ChoActase/COT/CPT [D...   308   1e-81   Dichomitus squalens LYAD-421 SS1
gi|322694247|gb|EFY86082.1| carnitine acetyl transferase [Metarh...   307   2e-81   Metarhizium acridum CQMa 102
gi|452846120|gb|EME48053.1| hypothetical protein DOTSEDRAFT_6985...   306   4e-81   Dothistroma septosporum NZE10
gi|472584724|gb|EMS22310.1| carnitine O-acetyltransferase [Rhodo...   306   7e-81   Rhodotorula toruloides NP11
gi|390603400|gb|EIN12792.1| acyltransferase ChoActase/COT/CPT [P...   304   2e-80   Punctularia strigosozonata HHB-11173 SS5
gi|389744673|gb|EIM85855.1| acyltransferase ChoActase/COT/CPT [S...   304   2e-80   Stereum hirsutum FP-91666 SS1
gi|392592013|gb|EIW81340.1| acyltransferase ChoActase COT CPT [C...   303   3e-80   Coniophora puteana RWD-64-598 SS2
gi|327348987|gb|EGE77844.1| hypothetical protein BDDG_00781 [Aje...   303   6e-80   
gi|392566384|gb|EIW59560.1| acyltransferase ChoActase/COT/CPT [T...   302   8e-80   Trametes versicolor FP-101664 SS1
gi|449548858|gb|EMD39824.1| hypothetical protein CERSUDRAFT_1120...   302   8e-80   Gelatoporia subvermispora B
gi|453087740|gb|EMF15781.1| carnitine O-acetyltransferase [Mycos...   302   1e-79   Sphaerulina musiva SO2202
gi|388855155|emb|CCF51286.1| probable carnitine O-acetyltransfer...   301   2e-79   Ustilago hordei
gi|409042423|gb|EKM51907.1| hypothetical protein PHACADRAFT_2623...   300   2e-79   Phanerochaete carnosa HHB-10118-sp
gi|342320996|gb|EGU12934.1| Nucleolar GTP-binding protein 2 [Rho...   299   8e-79   Rhodotorula toruloides ATCC 204091
gi|71004540|ref|XP_756936.1| hypothetical protein UM00789.1 [Ust...   298   9e-79   
gi|380475398|emb|CCF45273.1| carnitine O-acetyltransferase [Coll...   295   1e-77   Colletotrichum higginsianum
gi|398390866|ref|XP_003848893.1| carnitine O-acetyltransferase [...   295   1e-77   Zymoseptoria tritici IPO323
gi|323508344|emb|CBQ68215.1| probable carnitine O-acetyltransfer...   295   1e-77   Sporisorium reilianum SRZ2
gi|296416695|ref|XP_002838010.1| hypothetical protein [Tuber mel...   294   2e-77   Tuber melanosporum Mel28
gi|336369709|gb|EGN98050.1| hypothetical protein SERLA73DRAFT_18...   292   9e-77   Serpula lacrymans var. lacrymans S7.3
gi|409078725|gb|EKM79087.1| hypothetical protein AGABI1DRAFT_113...   291   1e-76   Agaricus bisporus var. burnettii JB137-S8
gi|393212506|gb|EJC98006.1| acyltransferase ChoActase/COT/CPT [F...   291   1e-76   Fomitiporia mediterranea MF3/22
gi|443896701|dbj|GAC74045.1| carnitine O-acyltransferase CRAT [P...   290   4e-76   Moesziomyces antarcticus T-34
gi|170089767|ref|XP_001876106.1| predicted protein [Laccaria bic...   289   7e-76   Laccaria bicolor S238N-H82
gi|403418223|emb|CCM04923.1| predicted protein [Fibroporia radic...   286   6e-75   Fibroporia radiculosa
gi|393243184|gb|EJD50699.1| acyltransferase ChoActase/COT/CPT [A...   283   5e-74   Auricularia subglabra TFB-10046 SS5
gi|501310807|dbj|GAC99565.1| hypothetical protein PHSY_007167 [P...   276   4e-72   Pseudozyma hubeiensis SY62
gi|169858780|ref|XP_001836034.1| carnitine acetyl transferase [C...   269   6e-70   Coprinopsis cinerea okayama7#130
gi|331220307|ref|XP_003322829.1| hypothetical protein PGTG_04366...   269   7e-70   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|403162635|ref|XP_003322822.2| hypothetical protein PGTG_04359...   268   1e-69   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|254570337|ref|XP_002492278.1| Carnitine acetyl-CoA transferas...   267   3e-69   Komagataella phaffii GS115
gi|403162641|ref|XP_003322828.2| hypothetical protein PGTG_04365...   266   7e-69   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|325093205|gb|EGC46515.1| carnitine acetyl transferase [Ajello...   261   2e-67   Histoplasma capsulatum H88
gi|348681826|gb|EGZ21642.1| hypothetical protein PHYSODRAFT_5575...   258   1e-66   Phytophthora sojae
gi|301107011|ref|XP_002902588.1| choline/Carnitine O-acyltransfe...   258   2e-66   Phytophthora infestans T30-4
gi|260946916|ref|XP_002617755.1| hypothetical protein CLUG_01214...   256   4e-66   Clavispora lusitaniae ATCC 42720
gi|294656940|ref|XP_002770339.1| DEHA2D17996p [Debaryomyces hans...   256   7e-66   Debaryomyces hansenii CBS767
gi|320580332|gb|EFW94555.1| Carnitine acetyl-CoA transferase [Og...   253   6e-65   
gi|465794023|emb|CCU98924.1| unnamed protein product [Malassezia...   250   4e-64   Malassezia sympodialis ATCC 42132
gi|299470771|emb|CBN79817.1| Carnitine/choline O-acyltransferase...   247   2e-63   Ectocarpus siliculosus
gi|150951215|ref|XP_001387498.2| ceramide glucosyltransferase [S...   247   4e-63   Scheffersomyces stipitis CBS 6054
gi|354547593|emb|CCE44328.1| hypothetical protein CPAR2_401300 [...   246   5e-63   Candida parapsilosis
gi|164656533|ref|XP_001729394.1| hypothetical protein MGL_3429 [...   246   5e-63   Malassezia globosa CBS 7966
gi|328859489|gb|EGG08598.1| hypothetical protein MELLADRAFT_4286...   246   7e-63   Melampsora larici-populina 98AG31
gi|321249555|ref|XP_003191489.1| carnitine acetyltransferase [Cr...   244   2e-62   Cryptococcus gattii WM276
gi|401888506|gb|EJT52462.1| carnitine acetyltransferase [Trichos...   244   2e-62   Trichosporon asahii var. asahii CBS 2479
gi|405117894|gb|AFR92669.1| carnitine acetyltransferase [Cryptoc...   244   2e-62   Cryptococcus neoformans var. grubii H99
gi|406702071|gb|EKD05139.1| carnitine acetyltransferase [Trichos...   244   3e-62   Trichosporon asahii var. asahii CBS 8904
gi|149237006|ref|XP_001524380.1| carnitine O-acetyltransferase, ...   244   3e-62   Lodderomyces elongisporus NRRL YB-4239
gi|448529495|ref|XP_003869856.1| Cat2 major carnitine acetyl tra...   244   3e-62   Candida orthopsilosis Co 90-125
gi|402223185|gb|EJU03250.1| acyltransferase ChoActase/COT/CPT [D...   243   3e-62   Dacryopinax primogenitus
gi|344229148|gb|EGV61034.1| acyltransferase ChoActase/COT/CPT [C...   243   3e-62   Candida tenuis ATCC 10573
gi|344229149|gb|EGV61035.1| hypothetical protein CANTEDRAFT_1162...   243   4e-62   Candida tenuis ATCC 10573
gi|58258825|ref|XP_566825.1| carnitine acetyltransferase [Crypto...   241   2e-61   Cryptococcus neoformans var. neoformans JEC21
gi|68466067|ref|XP_722808.1| hypothetical protein CaO19.12060 [C...   241   2e-61   Candida albicans SC5314
gi|238881637|gb|EEQ45275.1| carnitine O-acetyltransferase, mitoc...   240   3e-61   Candida albicans WO-1
gi|241954270|ref|XP_002419856.1| carnitine O-acetyltransferase, ...   239   6e-61   Candida dubliniensis CD36
gi|448079786|ref|XP_004194464.1| Piso0_004958 [Millerozyma farin...   238   1e-60   Millerozyma farinosa CBS 7064
gi|261195310|ref|XP_002624059.1| carnitine acetyl transferase [A...   238   2e-60   Blastomyces gilchristii SLH14081
gi|190348645|gb|EDK41133.2| hypothetical protein PGUG_05231 [Mey...   237   3e-60   Meyerozyma guilliermondii ATCC 6260
gi|146412480|ref|XP_001482211.1| hypothetical protein PGUG_05231...   237   3e-60   Meyerozyma guilliermondii ATCC 6260
gi|363753626|ref|XP_003647029.1| hypothetical protein Ecym_5463 ...   237   3e-60   Eremothecium cymbalariae DBVPG#7215
gi|448084279|ref|XP_004195563.1| Piso0_004958 [Millerozyma farin...   236   5e-60   Millerozyma farinosa CBS 7064
gi|344300434|gb|EGW30755.1| carnitine O-acetyltransferase mitoch...   236   7e-60   Spathaspora passalidarum NRRL Y-27907
gi|156836633|ref|XP_001642368.1| hypothetical protein Kpol_286p3...   234   2e-59   Vanderwaltozyma polyspora DSM 70294
gi|255721055|ref|XP_002545462.1| carnitine O-acetyltransferase, ...   234   2e-59   Candida tropicalis MYA-3404
gi|254581954|ref|XP_002496962.1| ZYRO0D12144p [Zygosaccharomyces...   233   6e-59   Zygosaccharomyces rouxii CBS 732
gi|392579917|gb|EIW73044.1| hypothetical protein TREMEDRAFT_7088...   233   7e-59   Tremella mesenterica DSM 1558
gi|385301244|gb|EIF45448.1| carnitine o- mitochondrial precursor...   232   7e-59   Brettanomyces bruxellensis AWRI1499
gi|512380590|dbj|BAN45673.1| carnitine acetyltransferase [Cyberl...   232   1e-58   Cyberlindnera jadinii [Torula yeast]
gi|2493499|sp|Q00614.1|CACP_CANTR RecName: Full=Carnitine O-acet...   231   2e-58   Candida tropicalis
gi|409081472|gb|EKM81831.1| hypothetical protein AGABI1DRAFT_112...   231   3e-58   Agaricus bisporus var. burnettii JB137-S8
gi|426196711|gb|EKV46639.1| hypothetical protein AGABI2DRAFT_193...   230   3e-58   Agaricus bisporus var. bisporus H97
gi|9624479|gb|AAF90194.1| carnitine acetyltransferase [Candida g...   230   4e-58   [Candida] glabrata
gi|388582677|gb|EIM22981.1| carnitine acetyltransferase [Wallemi...   230   4e-58   Wallemia mellicola CBS 633.66
gi|50291591|ref|XP_448228.1| hypothetical protein [Candida glabr...   229   7e-58   Candida glabrata CBS 138
gi|505760732|gb|EOR04797.1| hypothetical protein J056_000140 [Wa...   229   9e-58   Wallemia ichthyophaga EXF-994
gi|392297542|gb|EIW08642.1| Cat2p [Saccharomyces cerevisiae CEN....   229   1e-57   Saccharomyces cerevisiae CEN.PK113-7D
gi|6323599|ref|NP_013670.1| carnitine O-acetyltransferase CAT2 [...   229   1e-57   Saccharomyces cerevisiae S288c
gi|3462|emb|CAA78399.1| carnitine acetyltransferase [Saccharomyc...   228   1e-57   Saccharomyces cerevisiae [brewer's yeast]
gi|323332271|gb|EGA73681.1| Cat2p [Saccharomyces cerevisiae AWRI...   228   1e-57   Saccharomyces cerevisiae AWRI796
gi|151946122|gb|EDN64353.1| carnitine O-acetyltransferase [Sacch...   228   1e-57   Saccharomyces cerevisiae YJM789
gi|323347085|gb|EGA81360.1| Cat2p [Saccharomyces cerevisiae Lalv...   228   1e-57   Saccharomyces cerevisiae Lalvin QA23
gi|259148536|emb|CAY81781.1| Cat2p [Saccharomyces cerevisiae EC1...   228   1e-57   Saccharomyces cerevisiae EC1118
gi|323336190|gb|EGA77461.1| Cat2p [Saccharomyces cerevisiae Vin13]    228   1e-57   Saccharomyces cerevisiae Vin13
gi|323352978|gb|EGA85278.1| Cat2p [Saccharomyces cerevisiae VL3]...   228   1e-57   Saccharomyces cerevisiae VL3
gi|403214317|emb|CCK68818.1| hypothetical protein KNAG_0B03770 [...   228   2e-57   Kazachstania naganishii CBS 8797
gi|459370200|gb|EMG48361.1| Carnitine O-acetyltransferase, mitoc...   226   5e-57   Candida maltosa Xu316
gi|402223656|gb|EJU03720.1| carnitine acetyl transferase [Dacryo...   226   5e-57   Dacryopinax primogenitus
gi|45184948|ref|NP_982666.1| AAR124Cp [Ashbya gossypii ATCC 1089...   225   9e-57   Eremothecium gossypii ATCC 10895
gi|393221765|gb|EJD07249.1| carnitine acetyl transferase [Fomiti...   225   1e-56   Fomitiporia mediterranea MF3/22
gi|336368333|gb|EGN96676.1| hypothetical protein SERLA73DRAFT_18...   224   2e-56   Serpula lacrymans var. lacrymans S7.3
gi|367008836|ref|XP_003678919.1| hypothetical protein TDEL_0A037...   224   3e-56   Torulaspora delbrueckii
gi|513030072|gb|AGO10116.1| AaceriAAR124Cp [Saccharomycetaceae s...   224   3e-56   Saccharomycetaceae sp. 'Ashbya aceri'
gi|156711904|emb|CAO98877.1| carnitine acetyl-CoA transferase [N...   224   3e-56   Nakaseomyces delphensis
gi|170086754|ref|XP_001874600.1| predicted protein [Laccaria bic...   223   7e-56   Laccaria bicolor S238N-H82
gi|365759150|gb|EHN00957.1| Cat2p [Saccharomyces cerevisiae x Sa...   223   7e-56   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|365984369|ref|XP_003669017.1| hypothetical protein NDAI_0C011...   222   9e-56   Naumovozyma dairenensis CBS 421
gi|255717803|ref|XP_002555182.1| KLTH0G03300p [Lachancea thermot...   222   1e-55   Lachancea thermotolerans CBS 6340
gi|401842188|gb|EJT44443.1| CAT2-like protein [Saccharomyces kud...   221   1e-55   Saccharomyces kudriavzevii IFO 1802
gi|325192484|emb|CCA26921.1| choline/Carnitine Oacyltransferase ...   221   2e-55   Albugo laibachii Nc14
gi|299745241|ref|XP_001831585.2| carnitine acetyl transferase [C...   221   2e-55   Coprinopsis cinerea okayama7#130
gi|325181464|emb|CCA15897.1| choline/Carnitine Oacyltransferase ...   221   2e-55   Albugo laibachii Nc14
gi|401624415|gb|EJS42473.1| cat2p [Saccharomyces arboricola H-6]      221   3e-55   Saccharomyces arboricola H-6
gi|389745727|gb|EIM86908.1| acyltransferase ChoActase/COT/CPT [S...   218   2e-54   Stereum hirsutum FP-91666 SS1
gi|366996288|ref|XP_003677907.1| hypothetical protein NCAS_0H025...   215   9e-54   Naumovozyma castellii CBS 4309
gi|392565359|gb|EIW58536.1| carnitine acetyl transferase [Tramet...   211   1e-52   Trametes versicolor FP-101664 SS1
gi|224073488|ref|XP_002198387.1| PREDICTED: carnitine O-acetyltr...   209   1e-51   
gi|409041212|gb|EKM50698.1| hypothetical protein PHACADRAFT_2641...   208   2e-51   Phanerochaete carnosa HHB-10118-sp
gi|367001987|ref|XP_003685728.1| hypothetical protein TPHA_0E020...   207   2e-51   Tetrapisispora phaffii CBS 4417
gi|126297715|ref|XP_001364014.1| PREDICTED: carnitine O-acetyltr...   207   2e-51   Monodelphis domestica
gi|73967798|ref|XP_548425.2| PREDICTED: carnitine O-acetyltransf...   207   3e-51   Canis lupus familiaris [dogs]
gi|488543217|ref|XP_004463174.1| PREDICTED: carnitine O-acetyltr...   207   3e-51   Dasypus novemcinctus
gi|426226125|ref|XP_004007203.1| PREDICTED: carnitine O-acetyltr...   207   3e-51   
gi|115497686|ref|NP_001069055.1| carnitine O-acetyltransferase [...   207   3e-51   Bos taurus [bovine]
gi|511874227|ref|XP_004757183.1| PREDICTED: carnitine O-acetyltr...   207   4e-51   Mustela putorius furo [black ferret]
gi|51854229|ref|NP_001004085.1| carnitine O-acetyltransferase [R...   206   4e-51   Rattus norvegicus [brown rat]
gi|511874230|ref|XP_004757184.1| PREDICTED: carnitine O-acetyltr...   206   4e-51   Mustela putorius furo [black ferret]
gi|194225917|ref|XP_001917263.1| PREDICTED: carnitine O-acetyltr...   206   4e-51   
gi|440894367|gb|ELR46836.1| Carnitine O-acetyltransferase [Bos g...   206   4e-51   Bos mutus
gi|478498562|ref|XP_004423613.1| PREDICTED: carnitine O-acetyltr...   206   5e-51   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|302680360|ref|XP_003029862.1| hypothetical protein SCHCODRAFT...   206   5e-51   Schizophyllum commune H4-8
gi|410078155|ref|XP_003956659.1| hypothetical protein KAFR_0C053...   206   6e-51   Kazachstania africana CBS 2517
gi|21618331|ref|NP_000746.2| carnitine O-acetyltransferase isofo...   206   6e-51   Homo sapiens [man]
gi|488543209|ref|XP_004463170.1| PREDICTED: carnitine O-acetyltr...   206   6e-51   
gi|471370584|ref|XP_004375804.1| PREDICTED: carnitine O-acetyltr...   206   7e-51   Trichechus manatus latirostris
gi|471370586|ref|XP_004375805.1| PREDICTED: carnitine O-acetyltr...   206   7e-51   Trichechus manatus latirostris
gi|395326643|gb|EJF59050.1| carnitine acetyl transferase [Dichom...   206   7e-51   Dichomitus squalens LYAD-421 SS1
gi|29726705|pdb|1NM8|A Chain A, Structure Of Human Carnitine Ace...   206   7e-51   Homo sapiens [man]
gi|410979274|ref|XP_003996010.1| PREDICTED: carnitine O-acetyltr...   206   7e-51   Felis catus [cat]
gi|472345615|ref|XP_004392545.1| PREDICTED: carnitine O-acetyltr...   206   8e-51   Odobenus rosmarus divergens
gi|383209673|ref|NP_001244292.1| carnitine O-acetyltransferase i...   206   8e-51   Homo sapiens [man]
gi|215274265|sp|P43155.5|CACP_HUMAN RecName: Full=Carnitine O-ac...   206   9e-51   Homo sapiens [man]
gi|390600194|gb|EIN09589.1| acyltransferase ChoActase/COT/CPT [P...   206   9e-51   Punctularia strigosozonata HHB-11173 SS5
gi|472345617|ref|XP_004392546.1| PREDICTED: carnitine O-acetyltr...   205   1e-50   Odobenus rosmarus divergens
gi|431898892|gb|ELK07262.1| Carnitine O-acetyltransferase [Ptero...   205   1e-50   Pteropus alecto
gi|403298520|ref|XP_003940065.1| PREDICTED: carnitine O-acetyltr...   205   1e-50   Saimiri boliviensis boliviensis
gi|472584088|gb|EMS21694.1| carnitine O-acetyltransferase [Rhodo...   205   1e-50   Rhodotorula toruloides NP11
gi|332230200|ref|XP_003264274.1| PREDICTED: carnitine O-acetyltr...   205   1e-50   Nomascus leucogenys [White-cheeked Gibbon]
gi|344271734|ref|XP_003407692.1| PREDICTED: LOW QUALITY PROTEIN:...   204   2e-50   Loxodonta africana [African bush elephant]
gi|403298522|ref|XP_003940066.1| PREDICTED: carnitine O-acetyltr...   204   2e-50   
gi|163915141|ref|NP_001106518.1| carnitine O-acetyltransferase [...   204   2e-50   Sus scrofa [pigs]
gi|332230202|ref|XP_003264275.1| PREDICTED: carnitine O-acetyltr...   204   2e-50   Nomascus leucogenys [White-cheeked Gibbon]
gi|50513719|pdb|1T7Q|A Chain A, Crystal Structure Of The F565a M...   204   2e-50   Mus musculus [mouse]
gi|507692079|ref|XP_004713317.1| PREDICTED: carnitine O-acetyltr...   204   2e-50   Echinops telfairi [lesser hedgehog tenrec]
gi|166183814|gb|ABY84175.1| carnitine acetyltransferase isoform ...   204   3e-50   Callithrix jacchus [common marmoset]
gi|432095350|gb|ELK26549.1| Carnitine O-acetyltransferase [Myoti...   204   3e-50   Myotis davidii
gi|183636983|gb|ACC64540.1| carnitine acetyltransferase (predict...   204   3e-50   Rhinolophus ferrumequinum
gi|85662408|ref|NP_031786.2| carnitine O-acetyltransferase [Mus ...   204   3e-50   Mus musculus [mouse]
gi|74218017|dbj|BAE41993.1| unnamed protein product [Mus musculus]    204   3e-50   Mus musculus [mouse]
gi|112491045|pdb|2H3P|A Chain A, Crystal Structure Of Murine Car...   203   4e-50   Mus musculus [mouse]
gi|28373993|pdb|1NDF|A Chain A, Carnitine Acetyltransferase In C...   203   5e-50   Mus musculus [mouse]
gi|470386694|ref|XP_004334224.1| Choline/Carnitine oacyltransfer...   203   5e-50   Acanthamoeba castellanii str. Neff
gi|332832964|ref|XP_520305.3| PREDICTED: carnitine O-acetyltrans...   202   8e-50   Pan troglodytes
gi|301758828|ref|XP_002915247.1| PREDICTED: carnitine O-acetyltr...   202   9e-50   Ailuropoda melanoleuca
gi|332832966|ref|XP_003312352.1| PREDICTED: carnitine O-acetyltr...   202   9e-50   Pan troglodytes
gi|402896343|ref|XP_003911262.1| PREDICTED: carnitine O-acetyltr...   202   9e-50   
gi|281349480|gb|EFB25064.1| hypothetical protein PANDA_003230 [A...   202   9e-50   Ailuropoda melanoleuca
gi|50513717|pdb|1T7N|A Chain A, Crystal Structure Of The M564g M...   202   9e-50   Mus musculus [mouse]
gi|207342506|gb|EDZ70254.1| YML042Wp-like protein [Saccharomyces...   202   1e-49   Saccharomyces cerevisiae AWRI1631
gi|238582487|ref|XP_002389947.1| hypothetical protein MPER_10858...   202   1e-49   
gi|470594599|ref|XP_004310415.1| PREDICTED: carnitine O-acetyltr...   202   1e-49   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|169409558|gb|ACA57903.1| carnitine acetyltransferase isoform ...   202   1e-49   Plecturocebus moloch [Dusky titi]
gi|386780836|ref|NP_001248042.1| carnitine O-acetyltransferase [...   202   1e-49   Macaca mulatta [rhesus macaque]
gi|504167789|ref|XP_004593553.1| PREDICTED: carnitine O-acetyltr...   201   1e-49   Ochotona princeps [southern American pika]
gi|504167791|ref|XP_004593554.1| PREDICTED: carnitine O-acetyltr...   201   1e-49   Ochotona princeps [southern American pika]
gi|470594601|ref|XP_004310416.1| PREDICTED: carnitine O-acetyltr...   201   1e-49   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|355753009|gb|EHH57055.1| hypothetical protein EGM_06615, part...   201   1e-49   Macaca fascicularis [crab eating macaque]
gi|47214515|emb|CAF96708.1| unnamed protein product [Tetraodon n...   201   2e-49   Tetraodon nigroviridis
gi|466005767|ref|XP_004269163.1| PREDICTED: carnitine O-acetyltr...   201   2e-49   Orcinus orca [Orca]
gi|395506236|ref|XP_003757441.1| PREDICTED: carnitine O-acetyltr...   201   2e-49   Sarcophilus harrisii
gi|758632|emb|CAA59971.1| carnitine acetyltransferase [Mus muscu...   201   2e-49   Mus musculus [mouse]
gi|466005773|ref|XP_004269164.1| PREDICTED: carnitine O-acetyltr...   201   2e-49   
gi|465977138|gb|EMP34692.1| Carnitine O-acetyltransferase [Chelo...   201   2e-49   Chelonia mydas [green seaturtle]
gi|410927759|ref|XP_003977308.1| PREDICTED: carnitine O-acetyltr...   201   2e-49   
gi|406602661|emb|CCH45805.1| carnitine O-palmitoyltransferase 1 ...   201   2e-49   Wickerhamomyces ciferrii
gi|355567413|gb|EHH23754.1| hypothetical protein EGK_07293 [Maca...   201   2e-49   Macaca mulatta [rhesus macaque]
gi|511011615|gb|EPB92823.1| hypothetical protein HMPREF1544_0026...   201   2e-49   Mucor circinelloides f. circinelloides 1006PhL
gi|112491054|pdb|2H3W|A Chain A, Crystal Structure Of The S554aM...   201   3e-49   
gi|927415|emb|CAA55359.1| carnitine acetyltransferase [Homo sapi...   201   3e-49   
gi|392590012|gb|EIW79342.1| carnitine acetyl transferase [Coniop...   201   3e-49   
gi|395844415|ref|XP_003794957.1| PREDICTED: carnitine O-acetyltr...   201   3e-49   
gi|483520538|gb|EOB05945.1| Carnitine O-acetyltransferase, parti...   200   3e-49   
gi|507576591|ref|XP_004671833.1| PREDICTED: carnitine O-acetyltr...   200   4e-49   
gi|507576593|ref|XP_004671834.1| PREDICTED: carnitine O-acetyltr...   199   6e-49   
gi|393233620|gb|EJD41190.1| acyltransferase ChoActase/COT/CPT [A...   199   6e-49   
gi|512822032|ref|XP_004879772.1| PREDICTED: carnitine O-acetyltr...   199   7e-49   
gi|449548341|gb|EMD39308.1| hypothetical protein CERSUDRAFT_8204...   199   7e-49   
gi|73853812|ref|NP_001027489.1| carnitine O-acetyltransferase, g...   199   8e-49   
gi|410922156|ref|XP_003974549.1| PREDICTED: carnitine O-acetyltr...   199   8e-49   
gi|449266753|gb|EMC77769.1| Carnitine O-acetyltransferase, parti...   199   8e-49   
gi|1705537|sp|P52826.1|CACP_COLLI RecName: Full=Carnitine O-acet...   199   8e-49   
gi|170069483|ref|XP_001869241.1| carnitine O-acetyltransferase [...   199   9e-49   
gi|512822040|ref|XP_004879774.1| PREDICTED: carnitine O-acetyltr...   199   1e-48   
gi|225684747|gb|EEH23031.1| carnitine O-acetyltransferase [Parac...   199   1e-48   
gi|505839608|ref|XP_004613329.1| PREDICTED: carnitine O-acetyltr...   198   1e-48   
gi|512822036|ref|XP_004879773.1| PREDICTED: carnitine O-acetyltr...   198   1e-48   
gi|327290034|ref|XP_003229729.1| PREDICTED: carnitine O-acetyltr...   198   1e-48   
gi|388583650|gb|EIM23951.1| acyltransferase ChoActase/COT/CPT [W...   198   1e-48   
gi|260793555|ref|XP_002591777.1| hypothetical protein BRAFLDRAFT...   197   2e-48   
gi|428175775|gb|EKX44663.1| hypothetical protein GUITHDRAFT_8736...   197   2e-48   
gi|507685402|ref|XP_004640518.1| PREDICTED: carnitine O-acetyltr...   197   2e-48   
gi|444721238|gb|ELW61982.1| Carnitine O-acetyltransferase [Tupai...   197   2e-48   
gi|348569739|ref|XP_003470655.1| PREDICTED: carnitine O-acetyltr...   197   3e-48   
gi|507685404|ref|XP_004640519.1| PREDICTED: carnitine O-acetyltr...   197   3e-48   
gi|354506338|ref|XP_003515221.1| PREDICTED: carnitine O-acetyltr...   197   4e-48   
gi|443916869|gb|ELU37803.1| carnitine acetyl transferase [Rhizoc...   197   4e-48   
gi|513212466|ref|XP_004945922.1| PREDICTED: carnitine O-acetyltr...   196   5e-48   
gi|513212463|ref|XP_415478.3| PREDICTED: carnitine O-acetyltrans...   196   8e-48   
gi|444314679|ref|XP_004177997.1| hypothetical protein TBLA_0A068...   196   8e-48   
gi|395741057|ref|XP_002820334.2| PREDICTED: LOW QUALITY PROTEIN:...   196   9e-48   
gi|432874760|ref|XP_004072579.1| PREDICTED: carnitine O-acetyltr...   195   1e-47   
gi|348516302|ref|XP_003445678.1| PREDICTED: carnitine O-acetyltr...   195   1e-47   
gi|397614876|gb|EJK63075.1| hypothetical protein THAOC_16292 [Th...   195   1e-47   
gi|50302319|ref|XP_451094.1| hypothetical protein [Kluyveromyces...   194   2e-47   
gi|498953940|ref|XP_004544206.1| PREDICTED: carnitine O-acetyltr...   194   2e-47   
gi|498953934|ref|XP_004544205.1| PREDICTED: carnitine O-acetyltr...   194   2e-47   
gi|470516603|ref|XP_004353103.1| Choline/Carnitine oacyltransfer...   194   3e-47   
gi|403414655|emb|CCM01355.1| predicted protein [Fibroporia radic...   194   3e-47   
gi|219124371|ref|XP_002182478.1| carnitine o-acetyltransferase [...   193   4e-47   
gi|405959399|gb|EKC25444.1| Carnitine O-acetyltransferase [Crass...   193   5e-47   
gi|223995007|ref|XP_002287187.1| carnitine acetyl transferase [T...   192   8e-47   
gi|91082165|ref|XP_970726.1| PREDICTED: similar to carnitine o-a...   192   1e-46   
gi|507932144|ref|XP_004677313.1| PREDICTED: carnitine O-acetyltr...   191   3e-46   
gi|30583829|gb|AAP36163.1| Homo sapiens carnitine acetyltransfer...   187   2e-45   
gi|13111705|gb|AAH00723.1| Carnitine acetyltransferase [Homo sap...   187   2e-45   
gi|157129118|ref|XP_001655296.1| carnitine o-acetyltransferase [...   187   3e-45   
gi|505757025|gb|EOR01159.1| hypothetical protein J056_004480 [Wa...   187   3e-45   
gi|426363309|ref|XP_004048785.1| PREDICTED: carnitine O-acetyltr...   187   4e-45   
gi|47214645|emb|CAG05165.1| unnamed protein product [Tetraodon n...   186   6e-45   
gi|121583889|ref|NP_001073466.1| carnitine O-acetyltransferase-l...   186   8e-45   
gi|53933230|ref|NP_001005587.1| carnitine O-acetyltransferase [D...   186   9e-45   
gi|470297167|ref|XP_004345542.1| hypothetical protein CAOG_05952...   185   1e-44   
gi|499022385|ref|XP_004561961.1| PREDICTED: carnitine O-acetyltr...   184   2e-44   
gi|348505328|ref|XP_003440213.1| PREDICTED: carnitine O-acetyltr...   184   3e-44   
gi|512919117|ref|XP_004929296.1| PREDICTED: carnitine O-acetyltr...   184   4e-44   
gi|353242717|emb|CCA74336.1| probable carnitine O-acetyltransfer...   183   6e-44   
gi|358058108|dbj|GAA96087.1| hypothetical protein E5Q_02748 [Mix...   182   1e-43   
gi|472588195|gb|EMS25667.1| carnitine O-acetyltransferase [Rhodo...   182   1e-43   
gi|328767680|gb|EGF77729.1| hypothetical protein BATDEDRAFT_3592...   181   3e-43   
gi|28373991|pdb|1NDB|A Chain A, Crystal Structure Of Carnitine A...   180   4e-43   
gi|195385152|ref|XP_002051272.1| GJ14957 [Drosophila virilis] >g...   180   4e-43   
gi|488543211|ref|XP_004463171.1| PREDICTED: carnitine O-acetyltr...   179   7e-43   
gi|156393316|ref|XP_001636274.1| predicted protein [Nematostella...   178   1e-42   
gi|242210292|ref|XP_002470989.1| predicted protein [Postia place...   177   2e-42   
gi|488543215|ref|XP_004463173.1| PREDICTED: carnitine O-acetyltr...   177   2e-42   
gi|488543213|ref|XP_004463172.1| PREDICTED: carnitine O-acetyltr...   177   3e-42   
gi|470303296|ref|XP_004347880.1| carnitine palmitoyltransferase ...   177   3e-42   
gi|296190979|ref|XP_002743435.1| PREDICTED: carnitine O-acetyltr...   177   4e-42   
gi|470304572|ref|XP_004348152.1| conserved hypothetical protein ...   177   4e-42   
gi|488543207|ref|XP_004463169.1| PREDICTED: carnitine O-acetyltr...   177   4e-42   
gi|407838804|gb|EKG00178.1| hypothetical protein TCSYLVIO_008898...   177   4e-42   
gi|449675039|ref|XP_002158057.2| PREDICTED: carnitine O-acetyltr...   176   5e-42   
gi|443691149|gb|ELT93087.1| hypothetical protein CAPTEDRAFT_2188...   176   6e-42   
gi|71657687|ref|XP_817355.1| carnitine O-acetyltransferase [Tryp...   176   7e-42   
gi|195116130|ref|XP_002002609.1| GI17475 [Drosophila mojavensis]...   176   8e-42   
gi|340377605|ref|XP_003387320.1| PREDICTED: carnitine O-acetyltr...   174   3e-41   
gi|115621336|ref|XP_798418.2| PREDICTED: carnitine O-acetyltrans...   173   5e-41   
gi|402224899|gb|EJU04961.1| acyltransferase ChoActase/COT/CPT [D...   173   6e-41   
gi|407400428|gb|EKF28658.1| hypothetical protein MOQ_007586 [Try...   172   7e-41   
gi|449675041|ref|XP_002163219.2| PREDICTED: carnitine O-acetyltr...   172   7e-41   
gi|195502284|ref|XP_002098155.1| GE24102 [Drosophila yakuba] >gi...   172   8e-41   
gi|195051389|ref|XP_001993085.1| GH13284 [Drosophila grimshawi] ...   172   1e-40   
gi|395332578|gb|EJF64957.1| acyltransferase ChoActase/COT/CPT [D...   171   2e-40   
gi|194900486|ref|XP_001979788.1| GG22082 [Drosophila erecta] >gi...   171   2e-40   
gi|195501904|ref|XP_002097995.1| GE10114 [Drosophila yakuba] >gi...   170   4e-40   
gi|384499371|gb|EIE89862.1| hypothetical protein RO3G_14573 [Rhi...   170   5e-40   
gi|392578290|gb|EIW71418.1| hypothetical protein TREMEDRAFT_6775...   170   5e-40   
gi|71754785|ref|XP_828307.1| carnitine O-acetyltransferase [Tryp...   169   7e-40   
gi|242023368|ref|XP_002432106.1| Choline O-acetyltransferase, pu...   169   8e-40   
gi|261334134|emb|CBH17128.1| carnitine O-acetyltransferase, puta...   169   9e-40   
gi|194899043|ref|XP_001979072.1| GG10489 [Drosophila erecta] >gi...   169   1e-39   
gi|195349169|ref|XP_002041119.1| GM15216 [Drosophila sechellia] ...   168   2e-39   
gi|343428541|emb|CBQ72071.1| related to carnitine acetyl transfe...   167   3e-39   
gi|322796029|gb|EFZ18653.1| hypothetical protein SINV_15747 [Sol...   167   3e-39   
gi|260797393|ref|XP_002593687.1| hypothetical protein BRAFLDRAFT...   167   4e-39   
gi|380484895|emb|CCF39705.1| choline/Carnitine O-acyltransferase...   167   4e-39   
gi|45550701|ref|NP_649650.2| CG1041, isoform A [Drosophila melan...   167   5e-39   
gi|116007970|ref|NP_001036684.1| CG1041, isoform B [Drosophila m...   166   5e-39   
gi|24647634|ref|NP_650605.1| CG5265 [Drosophila melanogaster] >g...   166   5e-39   
gi|402218258|gb|EJT98335.1| carnitine acetyl transferase [Dacryo...   166   5e-39   
gi|195570195|ref|XP_002103094.1| GD19146 [Drosophila simulans] >...   166   7e-39   
gi|432950722|ref|XP_004084580.1| PREDICTED: carnitine O-acetyltr...   166   8e-39   
gi|357612413|gb|EHJ67982.1| putative carnitine o-acetyltransfera...   166   8e-39   
gi|164658207|ref|XP_001730229.1| hypothetical protein MGL_2611 [...   166   9e-39   
gi|313482867|ref|NP_001004594.2| carnitine O-acetyltransferase b...   166   9e-39   
gi|195568727|ref|XP_002102365.1| GD19548 [Drosophila simulans] >...   166   9e-39   
gi|51859073|gb|AAH81604.1| Carnitine acetyltransferase [Danio re...   166   1e-38   
gi|426199077|gb|EKV49002.1| hypothetical protein AGABI2DRAFT_660...   165   1e-38   
gi|157374913|ref|YP_001473513.1| carnitine O-acetyltransferase [...   165   1e-38   
gi|501307133|dbj|GAC96101.1| hypothetical protein PHSY_003681 [P...   165   2e-38   
gi|428167322|gb|EKX36283.1| hypothetical protein GUITHDRAFT_1657...   164   2e-38   
gi|321471041|gb|EFX82015.1| hypothetical protein DAPPUDRAFT_3028...   164   2e-38   
gi|342185326|emb|CCC94809.1| putative carnitine O-acetyltransfer...   164   2e-38   
gi|393220964|gb|EJD06449.1| carnitine acetyltransferase [Fomitip...   164   3e-38   
gi|195164518|ref|XP_002023094.1| GL21173 [Drosophila persimilis]...   164   3e-38   
gi|499027961|ref|XP_004564711.1| PREDICTED: carnitine O-acetyltr...   164   3e-38   
gi|498932115|ref|XP_004519314.1| PREDICTED: carnitine O-acetyltr...   164   3e-38   
gi|198473459|ref|XP_002133268.1| GA28753 [Drosophila pseudoobscu...   164   3e-38   
gi|498932113|ref|XP_004519313.1| PREDICTED: carnitine O-acetyltr...   164   3e-38   
gi|224009379|ref|XP_002293648.1| carnitine acetyl transferase [T...   163   4e-38   
gi|21429788|gb|AAM50572.1| AT25667p [Drosophila melanogaster]         163   5e-38   
gi|302684615|ref|XP_003031988.1| hypothetical protein SCHCODRAFT...   163   5e-38   
gi|156545406|ref|XP_001606477.1| PREDICTED: carnitine O-palmitoy...   163   5e-38   
gi|409077734|gb|EKM78099.1| hypothetical protein AGABI1DRAFT_764...   163   6e-38   
gi|195434467|ref|XP_002065224.1| GK14782 [Drosophila willistoni]...   163   7e-38   
gi|343428137|emb|CBQ71667.1| related to CAT2-Carnitine O-acetylt...   162   7e-38   
gi|254577223|ref|XP_002494598.1| ZYRO0A05236p [Zygosaccharomyces...   162   7e-38   
gi|24584005|ref|NP_609601.1| CG5122 [Drosophila melanogaster] >g...   162   7e-38   
gi|384498404|gb|EIE88895.1| hypothetical protein RO3G_13606 [Rhi...   162   8e-38   
gi|312382513|gb|EFR27947.1| hypothetical protein AND_04791 [Anop...   162   8e-38   
gi|214012061|gb|ACJ61705.1| carnitine O-acetyltransferase [Artem...   162   9e-38   
gi|328854005|gb|EGG03140.1| hypothetical protein MELLADRAFT_4468...   162   1e-37   
gi|511009245|gb|EPB90492.1| carnitine O-acetyltransferase [Mucor...   162   1e-37   
gi|401885434|gb|EJT49552.1| carnitine O-acetyltransferase [Trich...   162   1e-37   
gi|195578857|ref|XP_002079280.1| GD23864 [Drosophila simulans] >...   162   1e-37   
gi|470521428|ref|XP_004353715.1| Choline/Carnitine oacyltransfer...   161   2e-37   
gi|392594994|gb|EIW84318.1| acyltransferase ChoActase COT CPT [C...   161   2e-37   
gi|472378471|ref|XP_004408656.1| PREDICTED: choline O-acetyltran...   161   2e-37   
gi|392564369|gb|EIW57547.1| acyltransferase ChoActase/COT/CPT [T...   161   2e-37   
gi|345492148|ref|XP_001602167.2| PREDICTED: carnitine O-acetyltr...   161   2e-37   
gi|472378473|ref|XP_004408657.1| PREDICTED: choline O-acetyltran...   161   2e-37   
gi|71006632|ref|XP_757982.1| hypothetical protein UM01835.1 [Ust...   160   3e-37   
gi|388853111|emb|CCF53285.1| related to carnitine acetyl transfe...   160   3e-37   
gi|432904782|ref|XP_004077414.1| PREDICTED: choline O-acetyltran...   160   4e-37   
gi|403165314|ref|XP_003325349.2| hypothetical protein PGTG_07182...   160   4e-37   
gi|388852689|emb|CCF53607.1| related to CAT2-Carnitine O-acetylt...   160   5e-37   
gi|511011754|gb|EPB92959.1| hypothetical protein HMPREF1544_0003...   160   5e-37   
gi|478252263|gb|ENN72691.1| hypothetical protein YQE_10786, part...   160   5e-37   
gi|465792412|emb|CCU97521.1| unnamed protein product [Malassezia...   160   5e-37   
gi|327266516|ref|XP_003218051.1| PREDICTED: carnitine O-acetyltr...   160   5e-37   
gi|260783676|ref|XP_002586899.1| hypothetical protein BRAFLDRAFT...   160   5e-37   
gi|45190827|ref|NP_985081.1| AER224Wp [Ashbya gossypii ATCC 1089...   160   5e-37   
gi|443899088|dbj|GAC76419.1| predicted alpha-helical protein [Ps...   160   6e-37   
gi|195351169|ref|XP_002042109.1| GM10135 [Drosophila sechellia] ...   160   6e-37   
gi|332019802|gb|EGI60263.1| Carnitine O-acetyltransferase [Acrom...   160   6e-37   
gi|513032572|gb|AGO12564.1| AaceriAER224Wp [Saccharomycetaceae s...   159   6e-37   
gi|358056829|dbj|GAA97179.1| hypothetical protein E5Q_03855 [Mix...   159   7e-37   
gi|431901322|gb|ELK08349.1| Choline O-acetyltransferase, partial...   159   8e-37   
gi|426200763|gb|EKV50687.1| hypothetical protein AGABI2DRAFT_200...   159   1e-36   
gi|393241553|gb|EJD49075.1| acyltransferase ChoActase/COT/CPT [A...   159   1e-36   
gi|443899483|dbj|GAC76814.1| carnitine O-acyltransferase CPT2/YA...   158   1e-36   
gi|170099277|ref|XP_001880857.1| predicted protein [Laccaria bic...   158   1e-36   
gi|348504277|ref|XP_003439688.1| PREDICTED: carnitine O-acetyltr...   158   1e-36   
gi|156393410|ref|XP_001636321.1| predicted protein [Nematostella...   158   2e-36   
gi|301094270|ref|XP_002896241.1| choline/Carnitine O-acyltransfe...   158   2e-36   
gi|392575463|gb|EIW68596.1| hypothetical protein TREMEDRAFT_6908...   158   2e-36   
gi|501307563|dbj|GAC96531.1| hypothetical protein PHSY_004111 [P...   158   2e-36   
gi|408358024|ref|NP_001191548.1| choline acetyltransferase [Aply...   157   2e-36   
gi|332028560|gb|EGI68597.1| Choline O-acetyltransferase [Acromyr...   157   2e-36   
gi|71668432|ref|XP_821099.1| choline/carnitine O-acetyltransfera...   157   2e-36   
gi|350396350|ref|XP_003484525.1| PREDICTED: choline O-acetyltran...   157   3e-36   
gi|410975583|ref|XP_003994210.1| PREDICTED: choline O-acetyltran...   157   3e-36   
gi|157116360|ref|XP_001658439.1| carnitine o-acyltransferase [Ae...   157   3e-36   
gi|348687485|gb|EGZ27299.1| hypothetical protein PHYSODRAFT_4700...   157   3e-36   
gi|511004477|gb|EPB85846.1| carnitine O-acetyltransferase [Mucor...   157   3e-36   
gi|256079321|ref|XP_002575937.1| choline o-acyltransferase [Schi...   157   3e-36   
gi|407408570|gb|EKF31958.1| choline/carnitine O-acetyltransferas...   157   3e-36   
gi|493271199|ref|WP_006229018.1| carnitine o-acyltransferase [Ph...   157   4e-36   
gi|336370548|gb|EGN98888.1| hypothetical protein SERLA73DRAFT_54...   157   4e-36   
gi|505756976|gb|EOR01110.1| Carnitine O-acetyltransferase [Walle...   157   4e-36   
gi|407847828|gb|EKG03421.1| choline/carnitine O-acetyltransferas...   157   4e-36   
gi|449540321|gb|EMD31314.1| hypothetical protein CERSUDRAFT_1631...   157   4e-36   
gi|167537257|ref|XP_001750298.1| hypothetical protein [Monosiga ...   157   4e-36   
gi|195539332|ref|NP_001124191.1| choline O-acetyltransferase [Da...   157   4e-36   
gi|71005882|ref|XP_757607.1| hypothetical protein UM01460.1 [Ust...   156   6e-36   
gi|409048799|gb|EKM58277.1| hypothetical protein PHACADRAFT_2679...   156   6e-36   
gi|307209212|gb|EFN86319.1| Carnitine O-acetyltransferase [Harpe...   156   7e-36   
gi|426255948|ref|XP_004021609.1| PREDICTED: choline O-acetyltran...   156   7e-36   
gi|478516529|ref|XP_004432499.1| PREDICTED: choline O-acetyltran...   156   8e-36   
gi|345494307|ref|XP_001605246.2| PREDICTED: choline O-acetyltran...   156   8e-36   
gi|443733453|gb|ELU17808.1| hypothetical protein CAPTEDRAFT_1718...   155   9e-36   
gi|345792955|ref|XP_543902.3| PREDICTED: LOW QUALITY PROTEIN: ch...   155   9e-36   
gi|328772199|gb|EGF82238.1| hypothetical protein BATDEDRAFT_1014...   155   1e-35   
gi|149243602|ref|XP_001526503.1| conserved hypothetical protein ...   155   1e-35   
gi|54303408|ref|YP_133401.1| carnitine o-acyltransferase [Photob...   155   1e-35   
gi|389749900|gb|EIM91071.1| carnitine acetyltransferase [Stereum...   155   1e-35   
gi|302691660|ref|XP_003035509.1| hypothetical protein SCHCODRAFT...   155   1e-35   
gi|126341529|ref|XP_001377581.1| PREDICTED: peroxisomal carnitin...   155   1e-35   
gi|260803263|ref|XP_002596510.1| hypothetical protein BRAFLDRAFT...   155   1e-35   
gi|443919846|gb|ELU39907.1| carnitine acetyl transferase [Rhizoc...   155   1e-35   
gi|384491754|gb|EIE82950.1| hypothetical protein RO3G_07655 [Rhi...   155   2e-35   
gi|194860944|ref|XP_001969684.1| GG23813 [Drosophila erecta] >gi...   155   2e-35   
gi|511892477|ref|XP_004765912.1| PREDICTED: choline O-acetyltran...   155   2e-35   
gi|507710877|ref|XP_004647024.1| PREDICTED: choline O-acetyltran...   155   2e-35   
gi|47213138|emb|CAF96633.1| unnamed protein product [Tetraodon n...   154   2e-35   
gi|348560748|ref|XP_003466175.1| PREDICTED: choline O-acetyltran...   154   2e-35   
gi|340729942|ref|XP_003403252.1| PREDICTED: choline O-acetyltran...   154   2e-35   
gi|358339856|dbj|GAA47840.1| choline O-acetyltransferase [Clonor...   154   2e-35   
gi|195999174|ref|XP_002109455.1| hypothetical protein TRIADDRAFT...   154   2e-35   
gi|410901226|ref|XP_003964097.1| PREDICTED: choline O-acetyltran...   154   3e-35   
gi|402586918|gb|EJW80854.1| hypothetical protein WUBG_08236 [Wuc...   154   3e-35   
gi|321474990|gb|EFX85954.1| hypothetical protein DAPPUDRAFT_4534...   154   3e-35   
gi|299754515|ref|XP_001840991.2| carnitine acetyl transferase [C...   154   3e-35   
gi|505798800|ref|XP_004607599.1| PREDICTED: choline O-acetyltran...   154   3e-35   
gi|406695114|gb|EKC98429.1| carnitine O-acetyltransferase [Trich...   153   4e-35   
gi|391332579|ref|XP_003740711.1| PREDICTED: carnitine O-acetyltr...   153   4e-35   
gi|270003254|gb|EEZ99701.1| hypothetical protein TcasGA2_TC00246...   153   4e-35   
gi|499006223|ref|XP_004535771.1| PREDICTED: carnitine O-palmitoy...   153   5e-35   


>gi|328768712|gb|EGF78758.1| hypothetical protein BATDEDRAFT_13099 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 612

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 221/302 (73%), Gaps = 3/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+F+NGKAGFNGEHS MD TPTSR  +FVC  +    +D G       LP P++L F+L
Sbjct: 314 FIIFDNGKAGFNGEHSMMDATPTSRCCEFVCKGLDQGTIDLGYNVPSLSLPEPKKLKFDL 373

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T  ++  I  A++ +D   A HDLRV+ +E YGKN++KK   SPDAY QM IQLAYYKMY
Sbjct: 374 TPALVQTIEIAKQKFDKQTALHDLRVVVFESYGKNLVKKFQVSPDAYAQMAIQLAYYKMY 433

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G  KATYESAQT+K+ +GRTE CR+VS++SV WVKAMED  VPI VK E+G KAI +   
Sbjct: 434 GVCKATYESAQTKKYAYGRTETCRSVSIESVAWVKAMEDPLVPISVKGEMGRKAIASQSS 493

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           YMA AVEGRG DRHL GLR  +K++E KP +FTDPAYA S HWNLSTSQ++SEY+ GYGW
Sbjct: 494 YMAAAVEGRGVDRHLLGLRFLIKADEPKPALFTDPAYAMSCHWNLSTSQITSEYYDGYGW 553

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
           G+VV DGYGIAY + N++ +FN+VSL LNN+ L  YL E+  EMR VFE   A A   KA
Sbjct: 554 GQVVSDGYGIAYQVKNNAFHFNLVSLHLNNEHLHTYLIEALHEMRTVFE---ATAPIPKA 610

Query: 301 KL 302
           KL
Sbjct: 611 KL 612



>gi|408391252|gb|EKJ70632.1| hypothetical protein FPSE_09142 [Fusarium pseudograminearum CS3096]
          Length = 658

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/288 (57%), Positives = 217/288 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V ++I  NK+D   P++RS LP PQ + F +
Sbjct: 360 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDFSDPSIRSNLPDPQLVKFEI 419

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K+++D I+KH L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 420 TQEVQSEIDRATKDFNDVISKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 479

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TR+FQ GRTE CRTVS DS  WVKAM D  V  + + EL  KAINAH++
Sbjct: 480 GKSRPTYESAATRRFQLGRTETCRTVSDDSTAWVKAMADSSVDDKTRVELFRKAINAHIE 539

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L++ ++ P I+ DPA+A S+ W+LSTSQLSSE+F GYGW
Sbjct: 540 YITAASDGKGVDRHLFGLKKLLEAGQEVPAIYKDPAFAYSSSWHLSTSQLSSEFFNGYGW 599

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFNIVS  L +D + +YL E+A +MR++ 
Sbjct: 600 SQVIDAGFGIAYMINENSLNFNIVSKGLGSDRMSYYLNEAANDMRELL 647



>gi|475668609|gb|EMT66396.1| Carnitine O-acetyltransferase, mitochondrial [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 610

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 217/288 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V ++I  NK+D   P++RS LP PQ + F++
Sbjct: 312 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDFSDPSIRSNLPEPQVVKFDI 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K+++D I+KH L V AY+GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 372 TKEVQSEIDRATKDFNDVISKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA  R+FQ GRTE CRTVS DSV WVK+M D  +  + + +L  KAINAHV+
Sbjct: 432 GKSRPTYESAAVRRFQLGRTETCRTVSDDSVAWVKSMSDSSIDDKTRVDLFRKAINAHVE 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPAY+ S+ W+LSTSQLSSE+F GYGW
Sbjct: 492 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYQDPAYSYSSSWHLSTSQLSSEFFNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFN+VS  L +D + +YL E+A +MR++ 
Sbjct: 552 SQVIDAGFGIAYMINENSLNFNVVSKGLGSDRMSYYLNEAANDMRELL 599



>gi|477509776|gb|ENH63065.1| Carnitine O-acetyltransferase, mitochondrial [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 609

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 217/288 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V ++I  NK+D   P++RS LP PQ + F++
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDFSDPSIRSNLPEPQVVKFDI 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K+++D I+KH L V AY+GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 371 TKEVQSEIDRATKDFNDVISKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA  R+FQ GRTE CRTVS DSV WVK+M D  +  + + +L  KAINAHV+
Sbjct: 431 GKSRPTYESAAVRRFQLGRTETCRTVSDDSVAWVKSMSDSSIDDKTRVDLFRKAINAHVE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPAY+ S+ W+LSTSQLSSE+F GYGW
Sbjct: 491 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYQDPAYSYSSSWHLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFN+VS  L +D + +YL E+A +MR++ 
Sbjct: 551 SQVIDAGFGIAYMINENSLNFNVVSKGLGSDRMSYYLNEAANDMRELL 598



>gi|342879991|gb|EGU81221.1| hypothetical protein FOXB_08254 [Fusarium oxysporum Fo5176]
          Length = 638

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 217/288 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V ++I  NK+D   P++RS LP PQ + F++
Sbjct: 340 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDFSDPSIRSNLPEPQVVKFDI 399

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K+++D I+KH L V AY+GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 400 TKEVQSEIDRATKDFNDVISKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 459

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA  R+FQ GRTE CRTVS DSV WVK+M D  +  + + +L  KA+NAHV+
Sbjct: 460 GKSRPTYESAAVRRFQLGRTETCRTVSDDSVAWVKSMSDSSIDDKTRVDLFRKAVNAHVE 519

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPAY+ S+ W+LSTSQLSSE+F GYGW
Sbjct: 520 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYQDPAYSYSSSWHLSTSQLSSEFFNGYGW 579

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFN+VS  L +D + +YL E+A +MR++ 
Sbjct: 580 SQVIDAGFGIAYMINENSLNFNVVSKGLGSDRMSYYLNEAANDMRELL 627



>gi|384489731|gb|EIE80953.1| hypothetical protein RO3G_05658 [Rhizopus delemar RA 99-880]
          Length = 623

 Score =  355 bits (912), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 167/267 (62%), Positives = 201/267 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVFENGKAGF GEHS MDG  T RLN+++C+ +A NK+ HGS  VRS LP PQ+L FN+
Sbjct: 316 FIVFENGKAGFMGEHSCMDGMATCRLNEYICDGLAKNKIAHGSSEVRSNLPQPQELQFNV 375

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + L  I+ AE N+D  I KH+L VL Y+ YGK++IKK   SPD Y QM+IQLAYYKM+
Sbjct: 376 NDQTLKDIASAESNFDRLIGKHELTVLNYQAYGKDLIKKYKCSPDGYAQMVIQLAYYKMF 435

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT++ TYESAQTRK+Q GRTE  RTV+VDSV +VKAMED  VP   K     KAI A   
Sbjct: 436 GTSRPTYESAQTRKYQRGRTETARTVTVDSVAFVKAMEDPHVPTTEKIAAFRKAIKAQGA 495

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           YMA+AV G G DRHLFGL+ SLK NE+KP IFTDPAYA S+HW LSTSQLSSE+F GYGW
Sbjct: 496 YMADAVNGHGVDRHLFGLKNSLKENEEKPDIFTDPAYAYSSHWYLSTSQLSSEHFDGYGW 555

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLR 267
           G+VV DG+G+AYM+    L FN+ S++
Sbjct: 556 GQVVNDGFGVAYMVKKHGLQFNVASVK 582



>gi|302881963|ref|XP_003039892.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256720759|gb|EEU34179.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 621

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 216/288 (75%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V ++I  NK+D+ +P+VRS LP PQ + F +
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDYSNPSVRSNLPDPQVVKFEI 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            +EV + I +A K++++ I KH L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 371 NNEVQAEIDRATKDFNEVIGKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +S  W KAMED  V  + + +L  KAINAH++
Sbjct: 431 GKNRPTYESAATRRFQLGRTETCRTVSDESTTWCKAMEDASVDEKSRVDLFRKAINAHLE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPAYA S  W+LSTSQLSSE+F GYGW
Sbjct: 491 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYKDPAYAYSGSWHLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFN+VS  L +D + HYL E+A +MR++ 
Sbjct: 551 SQVIDAGFGIAYMINENSLNFNVVSKGLGSDRMSHYLNEAANDMRELL 598



>gi|46110084|ref|XP_382100.1| hypothetical protein FG01924.1 [Fusarium graminearum PH-1]
          Length = 600

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 217/291 (74%), Gaps = 3/291 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V ++I  NK+D   P++RS LP PQ + F +
Sbjct: 299 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNDLIFGNKLDFSDPSIRSNLPDPQLVKFEI 358

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A K+++D I+KH L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 359 TQEVQNEIDRATKDFNDVISKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 418

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TR+FQ GRTE CRTVS DS  WVKAM D  V  + + EL  KAINAH++
Sbjct: 419 GKSRPTYESAATRRFQLGRTETCRTVSDDSTAWVKAMADSSVDDKTRVELFRKAINAHIE 478

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L++ ++ P I+ DPA+A S+ W+LSTSQLSSE+F GYGW
Sbjct: 479 YITAASDGKGVDRHLFGLKKLLEAGQEVPAIYKDPAFAYSSSWHLSTSQLSSEFFNGYGW 538

Query: 241 GEVVPDGYGIAYMINND---SLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +   SLNFNIVS  L +D + +YL E+A +MR++ 
Sbjct: 539 SQVIDAGFGIAYMINENSYYSLNFNIVSKGLGSDRMSYYLNEAANDMRELL 589



>gi|115384054|ref|XP_001208574.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114196266|gb|EAU37966.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 608

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 169/288 (58%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT R+ND + N+I NNK+D    +VRS LP P+ L+F+L
Sbjct: 308 FIINDNGTAGFMGEHSMMDGSPTHRMNDHLNNLIFNNKIDLSEKSVRSDLPDPRPLNFHL 367

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV  AI  A K +   IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 368 NQEVREAIDAATKEHRSQIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 427

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS DSV + KA+ D  VP E    L  +A+ AH K
Sbjct: 428 GKNRPTYESASTRKFQEGRTETIRSVSDDSVAFCKAISDPAVPREEAVRLFRQALAAHSK 487

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  L+  EK P ++ DPAYA S  W LSTSQLSSE+F GYGW
Sbjct: 488 YTAEASDGRGVDRHLFGLKKLLREGEKLPALYEDPAYAYSGSWYLSTSQLSSEFFNGYGW 547

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  R+  D + +YL E+AT++R + 
Sbjct: 548 SQVIDDGFGIAYMINENSLNFNIVCKRIGADRMSYYLNEAATDLRDML 595



>gi|367022256|ref|XP_003660413.1| hypothetical protein MYCTH_2298711 [Myceliophthora thermophila ATCC
           42464]
 gi|347007680|gb|AEO55168.1| hypothetical protein MYCTH_2298711 [Myceliophthora thermophila ATCC
           42464]
          Length = 611

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 164/288 (56%), Positives = 212/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V +VI NNK+D   P VRS LP PQ + F +
Sbjct: 313 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDVIFNNKLDFSDPTVRSNLPEPQPIRFVV 372

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A ++++  I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 373 TKEVQAEIDRAVRDFNAVIGQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 432

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W +AM D+ V    +  L  KAI+AH++
Sbjct: 433 GKNRPTYESAATRRFQQGRTETCRSVSEESVAWCRAMADETVDNATRVALFRKAIDAHLE 492

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  ++ P ++ DPAYA S+ W LSTSQLSSEYF GYGW
Sbjct: 493 YISAASDGKGVDRHLFGLKRLLEPGQEVPALYKDPAYAYSSSWYLSTSQLSSEYFNGYGW 552

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFN+VS  L +D +  YL E+A +MR + 
Sbjct: 553 SQVIDDGFGIAYMINENSLNFNVVSKGLGSDKMSFYLNEAANDMRDML 600



>gi|340960373|gb|EGS21554.1| carnitine O-acetyltransferase-like protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 611

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 164/288 (56%), Positives = 210/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND++C+VI NNK++   P VRS LP P  + F +
Sbjct: 313 FIINDNGTSGFMGEHSMMDGTPTHRLNDWICDVIFNNKLNFDEPTVRSNLPEPVPIRFVV 372

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  ++ + I +H L V AY+ YGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 373 TKEVQAEIDRAITDFRNVIDQHQLAVQAYQAYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 432

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS DSV W +AM D+ V  E +  L  KAI+AHV+
Sbjct: 433 GKNRPTYESAATRRFQQGRTETCRTVSEDSVAWCRAMADESVSNEERIRLFRKAIDAHVE 492

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  ++  E+ P ++ DPAY  ST W LSTSQLSSEYF GYGW
Sbjct: 493 YITAASDGKGVDRHLFGLKRLIEPGEELPALYKDPAYKYSTSWFLSTSQLSSEYFNGYGW 552

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SLNFNIVS +L +D +  YL E+A E+R + 
Sbjct: 553 SQVIDEGFGIAYMINENSLNFNIVSKKLGSDKMSFYLNEAANEIRDML 600



>gi|171690892|ref|XP_001910371.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945394|emb|CAP71506.1| unnamed protein product [Podospora anserina S mat+]
          Length = 643

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLNDFV +VI NNK+D   P VRS LP PQ + F +
Sbjct: 345 FIVNDNGTSGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFADPTVRSNLPEPQVVKFVV 404

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV S I +A  ++++ I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 405 NKEVQSEIDRAITDFNNVIGQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 464

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +S NW K+M D  +P   K  L  KAI+ H++
Sbjct: 465 GKNRPTYESAATRRFQQGRTETCRTVSEESANWCKSMADPAIPDSEKVTLFRKAIDGHLE 524

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L   E+ P ++ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 525 YISAASDGKGVDRHLFGLKRLLGKGEEVPALYQDPAYGYSSSWYLSTSQLSSEFFNGYGW 584

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SLNFNIVS  L ++ + +YL E+A EMR + 
Sbjct: 585 SQVIDEGFGIAYMINENSLNFNIVSKGLGSEKMSYYLSEAAGEMRDLL 632



>gi|392868636|gb|EAS34427.2| carnitine acetyl transferase [Coccidioides immitis RS]
          Length = 638

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 216/302 (71%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P+VRS LP PQ ++FNL
Sbjct: 338 FIVNDNGTAGFLGEHSMMDGTPTHRLNDYVNNLIFNNRLDYSNPSVRSNLPEPQPVNFNL 397

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S VL  I+ A+K++   I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 398 DSAVLEDITTAQKDFASVIGKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 457

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTE  RTVS +SV + KA  D  VP E  A+L   A+ AH K
Sbjct: 458 GKNRPTYESASTRKFKQGRTETTRTVSDESVAFCKAHCDPAVPREETAKLFRAALAAHTK 517

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A+A  G+G DRHLFGL+  ++  EK P ++ DPAY  S  W LSTSQLSSEYF GYGW
Sbjct: 518 YIADASVGKGVDRHLFGLKQLIQKGEKVPALYEDPAYGYSGSWYLSTSQLSSEYFNGYGW 577

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SL FNIV  +L  D +  YL E+A E+R +       A Q KA
Sbjct: 578 SQVIDDGFGIAYMINENSLQFNIVCKKLGADRMSFYLNEAACEVRDLL-MPDLLAQQEKA 636

Query: 301 KL 302
           KL
Sbjct: 637 KL 638



>gi|303315017|ref|XP_003067516.1| carnitine O-acetyltransferase, mitochondrial precursor, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240107186|gb|EER25371.1| carnitine O-acetyltransferase, mitochondrial precursor, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320035745|gb|EFW17686.1| carnitine acetyl transferase [Coccidioides posadasii str. Silveira]
          Length = 638

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 216/302 (71%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P+VRS LP PQ ++FNL
Sbjct: 338 FIVNDNGTAGFLGEHSMMDGTPTHRLNDYVNNLIFNNRLDYSNPSVRSNLPEPQPVNFNL 397

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S VL  I+ A+K++   I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 398 DSAVLEDITTAQKDFASVIGKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 457

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTE  RTVS +SV + KA  D  VP E  A+L   A+ AH K
Sbjct: 458 GKNRPTYESASTRKFKQGRTETTRTVSDESVAFCKAHCDPAVPREETAKLFRAALAAHTK 517

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A+A  G+G DRHLFGL+  ++  EK P ++ DPAY  S  W LSTSQLSSEYF GYGW
Sbjct: 518 YIADASIGKGVDRHLFGLKQLIQKGEKVPALYEDPAYGYSGSWYLSTSQLSSEYFNGYGW 577

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SL FNIV  +L  D +  YL E+A E+R +       A Q KA
Sbjct: 578 SQVIDDGFGIAYMINENSLQFNIVCKKLGADRMSFYLNEAACEVRDLL-MPDLLAQQEKA 636

Query: 301 KL 302
           KL
Sbjct: 637 KL 638



>gi|119190297|ref|XP_001245755.1| hypothetical protein CIMG_05196 [Coccidioides immitis RS]
          Length = 610

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 216/302 (71%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P+VRS LP PQ ++FNL
Sbjct: 310 FIVNDNGTAGFLGEHSMMDGTPTHRLNDYVNNLIFNNRLDYSNPSVRSNLPEPQPVNFNL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S VL  I+ A+K++   I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 DSAVLEDITTAQKDFASVIGKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTE  RTVS +SV + KA  D  VP E  A+L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKFKQGRTETTRTVSDESVAFCKAHCDPAVPREETAKLFRAALAAHTK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A+A  G+G DRHLFGL+  ++  EK P ++ DPAY  S  W LSTSQLSSEYF GYGW
Sbjct: 490 YIADASVGKGVDRHLFGLKQLIQKGEKVPALYEDPAYGYSGSWYLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SL FNIV  +L  D +  YL E+A E+R +       A Q KA
Sbjct: 550 SQVIDDGFGIAYMINENSLQFNIVCKKLGADRMSFYLNEAACEVRDLL-MPDLLAQQEKA 608

Query: 301 KL 302
           KL
Sbjct: 609 KL 610



>gi|116195904|ref|XP_001223764.1| hypothetical protein CHGG_04550 [Chaetomium globosum CBS 148.51]
 gi|88180463|gb|EAQ87931.1| hypothetical protein CHGG_04550 [Chaetomium globosum CBS 148.51]
          Length = 611

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 161/288 (55%), Positives = 212/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V ++I NNK+D   P++RS LP PQ + F +
Sbjct: 313 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDLILNNKLDFSDPSIRSNLPDPQPVKFAV 372

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  +++  I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 373 TKEVQAEIDRAVHDFNAVIGQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 432

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS DSV W ++M D+ +  E +A L  KAI AH++
Sbjct: 433 GKNRPTYESAATRRFQQGRTETCRSVSEDSVAWCRSMADESLDSEARAALFRKAIAAHIE 492

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  ++ P ++ DPAY  S+ W LSTSQLSSEYF GYGW
Sbjct: 493 YISAASDGKGVDRHLFGLKRLLEPGQQVPALYQDPAYGYSSSWYLSTSQLSSEYFNGYGW 552

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +S+NFNIVS  L +D +  YL E+A +MR + 
Sbjct: 553 SQVIDEGFGIAYMINENSINFNIVSKGLGSDKMSFYLNEAAGDMRDML 600



>gi|340513974|gb|EGR44246.1| carnitine acetyl transferase [Trichoderma reesei QM6a]
          Length = 609

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 160/288 (55%), Positives = 210/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND++ ++I  NK+D   P++RS LP PQ + F++
Sbjct: 311 FIINDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGNKIDFSDPSIRSSLPDPQPIKFDI 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I +A  +++  I KH L V AY+GYGK +IKK   SPDAYVQMIIQLAY KMY
Sbjct: 371 TPEIQSEIDRAVADFNSVIGKHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYAKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W KAM D  +  + K +L  KAI AH++
Sbjct: 431 GKNRPTYESAATRRFQQGRTETCRSVSDESVAWCKAMADPSIDDKTKIDLFRKAIAAHLE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 491 YITAASDGKGVDRHLFGLKKLLEPGQELPAIYKDPAYTYSSSWYLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +S+NFN+VS  L +D + +YL E+A EMR + 
Sbjct: 551 SQVIDDGFGIAYMINENSINFNVVSKGLGSDRMSYYLNEAAGEMRDLL 598



>gi|350292437|gb|EGZ73632.1| putative carnitine O-acetyltransferase precursor [Neurospora
           tetrasperma FGSC 2509]
          Length = 643

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 213/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLNDFV +VI NNK+D   P+VRS LP P+ + FN+
Sbjct: 345 FIVNDNGTSGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFSDPSVRSNLPEPEAVKFNV 404

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  ++++ I +H L V A++GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 405 TKEVQAEIDRAITDFNNVIGQHQLAVQAFQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 464

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV + KA  D  V  + K EL  KAI++H++
Sbjct: 465 GKNRPTYESAATRRFQQGRTETCRSVSEASVAFCKAANDASVDDKTKVELFRKAIDSHLE 524

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+ N++ P ++ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 525 YISAASDGKGVDRHLFGLKRLLEPNQEVPALYQDPAYGYSSSWYLSTSQLSSEFFNGYGW 584

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFNIVS  L +D + +YL E+A ++R + 
Sbjct: 585 SQVIDQGFGIAYMINENSLNFNIVSKGLGSDRMSYYLNEAANDLRDLL 632



>gi|336471344|gb|EGO59505.1| hypothetical protein NEUTE1DRAFT_145504 [Neurospora tetrasperma
           FGSC 2508]
          Length = 625

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 213/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLNDFV +VI NNK+D   P+VRS LP P+ + FN+
Sbjct: 327 FIVNDNGTSGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFSDPSVRSNLPEPEAVKFNV 386

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  ++++ I +H L V A++GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 387 TKEVQAEIDRAITDFNNVIGQHQLAVQAFQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 446

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV + KA  D  V  + K EL  KAI++H++
Sbjct: 447 GKNRPTYESAATRRFQQGRTETCRSVSEASVAFCKAANDASVDDKTKVELFRKAIDSHLE 506

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+ N++ P ++ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 507 YISAASDGKGVDRHLFGLKRLLEPNQEVPALYQDPAYGYSSSWYLSTSQLSSEFFNGYGW 566

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFNIVS  L +D + +YL E+A ++R + 
Sbjct: 567 SQVIDQGFGIAYMINENSLNFNIVSKGLGSDRMSYYLNEAANDLRDLL 614



>gi|358375839|dbj|GAA92415.1| carnitine acetyl transferase [Aspergillus kawachii IFO 4308]
          Length = 610

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT RLND + N+I N+K+D     VRS LP P+ + F+L
Sbjct: 310 FIINDNGTAGFMGEHSMMDGSPTHRLNDHLNNLIFNHKIDLSEQPVRSDLPDPRPITFHL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              VL AI  A K +   I+ H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 370 DGPVLEAIDAANKEHRQQISSHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  RTVS +SV + KA+ D  VP E    L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKFQEGRTETIRTVSDESVAFCKAISDPAVPREEAVRLLRSALAAHTK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  L+  EK P ++ DPA+A S+ W LSTSQLSSE+F GYGW
Sbjct: 490 YTAEASDGRGVDRHLFGLKKLLREGEKLPALYEDPAFAYSSSWYLSTSQLSSEFFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+A++MR + 
Sbjct: 550 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAASDMRDML 597



>gi|145254415|ref|XP_001398619.1| carnitine acetyl transferase [Aspergillus niger CBS 513.88]
 gi|134084199|emb|CAK47232.1| unnamed protein product [Aspergillus niger]
          Length = 643

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT R+ND + N+I N+K+D     VRS LP P+ + F+L
Sbjct: 343 FIINDNGTAGFMGEHSMMDGSPTHRMNDHLNNLIFNHKIDLSEKPVRSDLPDPRPITFHL 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              VL AI  A K +   I+ H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 403 DGPVLEAIDAANKEHRQQISSHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  RTVS +SV + KA+ D  VP E    L   A+ AH K
Sbjct: 463 GKNRPTYESASTRKFQEGRTETIRTVSDESVAFCKAISDPAVPREEAVRLLRSALAAHTK 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  L+  EK P ++ DPA+A S+ W LSTSQLSSE+F GYGW
Sbjct: 523 YTAEASDGRGVDRHLFGLKKLLREGEKLPALYEDPAFAYSSSWYLSTSQLSSEFFNGYGW 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+A++MR + 
Sbjct: 583 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAASDMRDML 630



>gi|350630484|gb|EHA18856.1| hypothetical protein ASPNIDRAFT_120926 [Aspergillus niger ATCC
           1015]
          Length = 643

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 205/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT RLND + N+I N+K+D     VRS LP P+ + F+L
Sbjct: 343 FIINDNGTAGFMGEHSMMDGSPTHRLNDHLNNLIFNHKIDLSEQPVRSDLPDPRPITFHL 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              VL AI  A K +   I+ H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 403 DGPVLEAIDAANKEHRQQISSHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  RTVS +SV + KA+ D  VP E    L   A+ AH K
Sbjct: 463 GKNRPTYESASTRKFQEGRTETIRTVSDESVAFCKAISDPAVPREEAVRLLRSALAAHTK 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  L+  EK P ++ DPA+A S  W LSTSQLSSE+F GYGW
Sbjct: 523 YTAEASDGRGVDRHLFGLKKLLREGEKLPALYEDPAFAYSGSWYLSTSQLSSEFFNGYGW 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+A++MR + 
Sbjct: 583 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAASDMRDML 630



>gi|85108947|ref|XP_962672.1| hypothetical protein NCU08002 [Neurospora crassa OR74A]
 gi|28924283|gb|EAA33436.1| hypothetical protein NCU08002 [Neurospora crassa OR74A]
 gi|39979153|emb|CAE85527.1| probable carnitine O-acetyltransferase precursor [Neurospora
           crassa]
          Length = 609

 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 211/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLNDFV +VI NNK+D   P+VRS LP P+ + F +
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFSDPSVRSNLPEPEAVKFTV 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  ++ + I +H L V A++GYGK +IKK   SPDAYVQMIIQLAYYKMY
Sbjct: 371 TKEVQAEIDRAITDFSNVIGQHQLAVQAFQGYGKGLIKKFKCSPDAYVQMIIQLAYYKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV + KA  D  V  + K EL  KAI++H++
Sbjct: 431 GKNRPTYESAATRRFQQGRTETCRSVSEASVAFCKAANDASVDDKTKVELFRKAIDSHLE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+ N++ P ++ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 491 YISAASDGKGVDRHLFGLKRLLEPNQEVPALYQDPAYGYSSSWYLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFNIVS  L +D + +YL E+A ++R + 
Sbjct: 551 SQVIDQGFGIAYMINENSLNFNIVSKGLGSDRMSYYLNEAANDLRDLL 598



>gi|258565413|ref|XP_002583451.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237907152|gb|EEP81553.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 610

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 211/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P++RS L  PQ ++F L
Sbjct: 310 FIINDNGTAGFLGEHSMMDGTPTHRLNDYVNNLIFNNRLDYSNPSIRSNLAEPQPVNFKL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S VL  I+ A+K++   ++KH+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 DSAVLEDIATAQKDFATVMSKHELRVQAFQGYGKALIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTE  RTVS +SV + KA  D  VP E    L   A++AH K
Sbjct: 430 GKNRPTYESASTRKFKQGRTETTRTVSDESVAFCKAHSDPSVPREEVVRLFRAALSAHTK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A+A  G+G DRHLFGL+  +++ EK P ++ DPAY  S+ W LSTSQLSSEYF GYGW
Sbjct: 490 YIADASIGKGVDRHLFGLKQLIQNGEKVPALYQDPAYGYSSSWYLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SL FNIV  +L  + +  YL E+A EMR V 
Sbjct: 550 SQVIDDGFGIAYMINENSLQFNIVCKKLGAERMSFYLNEAACEMRDVL 597



>gi|121715852|ref|XP_001275535.1| carnitine acetyl transferase [Aspergillus clavatus NRRL 1]
 gi|119403692|gb|EAW14109.1| carnitine acetyl transferase [Aspergillus clavatus NRRL 1]
          Length = 610

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT RLND + N+I NNK+D    +VRS LP P+ + F+L
Sbjct: 310 FIINDNGTAGFMGEHSMMDGSPTHRLNDHLNNLIFNNKIDLSEQSVRSNLPDPRPIEFHL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            SEVL AI  A+K +   I+ H+L+V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 370 NSEVLEAIDAAQKEHRQQISAHELKVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  RTVS +SV + KA  D  V  E    L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKFQEGRTETIRTVSDESVAFCKAQADSSVSREEVVRLFRAALAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +  G DRHLFGL+ SL+  EK P +F DPAYA S  W LSTSQLSSE+F GYGW
Sbjct: 490 YTATASDAMGVDRHLFGLKKSLREGEKLPALFEDPAYAYSGSWYLSTSQLSSEFFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+A+++R++ 
Sbjct: 550 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAASDLRELL 597



>gi|361131025|gb|EHL02755.1| putative Carnitine O-acetyltransferase, mitochondrial [Glarea
           lozoyensis 74030]
          Length = 565

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 160/288 (55%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V  VI  NK+D   P+VRS LP P  + F++
Sbjct: 232 FIVNDNGTSGFTGEHSMMDGTPTHRLNDYVNEVIFANKLDFSDPSVRSNLPEPTPIKFHV 291

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV + + +A K+++  I  H+LRV AY+GYGK +IKK  +SPDAYVQMIIQLAY+KMY
Sbjct: 292 NKEVQAEVERATKDFNQVIGSHELRVQAYQGYGKGLIKKFKSSPDAYVQMIIQLAYFKMY 351

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TR+FQ GRTE CR+VS DSV + KAM+D  +  E    L  KAIN+HV+
Sbjct: 352 GKSRPTYESAATRRFQQGRTETCRSVSDDSVAFCKAMQDSSISPEETVSLFRKAINSHVE 411

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L  N++ P I+ DPA+A S+ W +S+SQLSSEYF GYGW
Sbjct: 412 YITAASDGKGVDRHLFGLKKLLGPNDEMPAIYKDPAFAYSSKWFISSSQLSSEYFNGYGW 471

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FN+ S  L +D +  YL E+A +MR + 
Sbjct: 472 SQVVDDGWGIAYMINENSIQFNVCSKGLGSDRMSFYLNEAAGDMRDLL 519



>gi|512197224|gb|EPE26060.1| CoA-dependent acyltransferase [Glarea lozoyensis ATCC 20868]
          Length = 639

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 160/288 (55%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V  VI  NK+D   P+VRS LP P  + F++
Sbjct: 341 FIVNDNGTSGFTGEHSMMDGTPTHRLNDYVNEVIFANKLDFSDPSVRSNLPEPTPIKFHV 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV + + +A K+++  I  H+LRV AY+GYGK +IKK  +SPDAYVQMIIQLAY+KMY
Sbjct: 401 NKEVQAEVERATKDFNQVIGSHELRVQAYQGYGKGLIKKFKSSPDAYVQMIIQLAYFKMY 460

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TR+FQ GRTE CR+VS DSV + KAM+D  +  E    L  KAIN+HV+
Sbjct: 461 GKSRPTYESAATRRFQQGRTETCRSVSDDSVAFCKAMQDSSISPEETVSLFRKAINSHVE 520

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L  N++ P I+ DPA+A S+ W +S+SQLSSEYF GYGW
Sbjct: 521 YITAASDGKGVDRHLFGLKKLLGPNDEMPAIYKDPAFAYSSKWFISSSQLSSEYFNGYGW 580

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FN+ S  L +D +  YL E+A +MR + 
Sbjct: 581 SQVVDDGWGIAYMINENSIQFNVCSKGLGSDRMSFYLNEAAGDMRDLL 628



>gi|71001808|ref|XP_755585.1| carnitine acetyl transferase [Aspergillus fumigatus Af293]
 gi|66853223|gb|EAL93547.1| carnitine acetyl transferase [Aspergillus fumigatus Af293]
          Length = 644

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 169/302 (55%), Positives = 211/302 (69%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT RLND + N+I NNK+D     VRS LP P+ + F+L
Sbjct: 344 FIINDNGTAGFMGEHSMMDGSPTHRLNDHLNNLIFNNKIDLSEKPVRSNLPDPRPIEFHL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            SEVL AI  A K +   ++ H+L+V +Y+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 404 NSEVLEAIDAASKEHRQQMSAHELKVQSYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + KA  D  VP E    L   A+ AH K
Sbjct: 464 GKNRPTYESASTRKFQEGRTETIRSVSDESVAFCKAQADPSVPREEVVRLFRAALAAHSK 523

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  L+  EK P ++ DPAYA S+ W LSTSQLSSE+F GYGW
Sbjct: 524 YTALASDGQGVDRHLFGLKKLLREGEKLPALYEDPAYAYSSSWYLSTSQLSSEFFNGYGW 583

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+AT++R +       A   KA
Sbjct: 584 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAATDLRDLL-MPDLLAESAKA 642

Query: 301 KL 302
           KL
Sbjct: 643 KL 644



>gi|159129645|gb|EDP54759.1| carnitine acetyl transferase [Aspergillus fumigatus A1163]
          Length = 644

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 164/288 (56%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT RLND + N+I NNK+D     VRS LP P+ + F+L
Sbjct: 344 FIINDNGTAGFMGEHSMMDGSPTHRLNDHLNNLIFNNKIDLSEKPVRSNLPDPRPIEFHL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            SEVL AI  A K +   ++ H+L+V +Y+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 404 NSEVLEAIDAASKEHRQQMSAHELKVQSYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + KA  D  VP E    L   A+ AH K
Sbjct: 464 GKNRPTYESASTRKFQEGRTETIRSVSDESVAFCKAQADPSVPREEVVRLFRAALAAHSK 523

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  L+  EK P ++ DPAYA S+ W LSTSQLSSE+F GYGW
Sbjct: 524 YTALASDGQGVDRHLFGLKKLLREGEKLPALYEDPAYAYSSSWYLSTSQLSSEFFNGYGW 583

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+AT++R + 
Sbjct: 584 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAATDLRDLL 631



>gi|242809597|ref|XP_002485403.1| carnitine acetyl transferase [Talaromyces stipitatus ATCC 10500]
 gi|218716028|gb|EED15450.1| carnitine acetyl transferase [Talaromyces stipitatus ATCC 10500]
          Length = 644

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 205/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RLND+V ++I  NK+D  +  VRS LP P  ++F L
Sbjct: 344 FIINDNGTAGFMGEHSMMDGTPTHRLNDYVNSLIFGNKLDFDNTPVRSTLPPPAPINFEL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E   AI++A + +   IA H+LRV A++ YGK +IKK   SPDAYVQM+IQLAYYKMY
Sbjct: 404 NLETEKAINEALQEHKSQIAAHELRVQAFQAYGKGLIKKFKCSPDAYVQMVIQLAYYKMY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  RTVS +SV + +A +D KVP E   +L  +A+  H K
Sbjct: 464 GINRPTYESASTRKFQEGRTETTRTVSDESVAFCRAHQDPKVPREEVVKLFREALKQHTK 523

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y  EA +G+G DRHLFGL+  L+  EK P I+ DPAY  S+ W LSTSQLSSEYF GYGW
Sbjct: 524 YTLEASDGKGVDRHLFGLKKLLQEGEKLPEIYQDPAYTYSSSWYLSTSQLSSEYFNGYGW 583

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN DSL FNIVS RL ++ +  YL E+A E+R V 
Sbjct: 584 SQVIDDGFGIAYMINEDSLQFNIVSKRLGSERMSFYLNEAALEIRDVL 631



>gi|358382571|gb|EHK20242.1| hypothetical protein TRIVIDRAFT_213380 [Trichoderma virens Gv29-8]
          Length = 609

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 162/302 (53%), Positives = 215/302 (71%), Gaps = 3/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I  NK+D   PNVRS LP PQ ++F++
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGNKIDLSDPNVRSDLPEPQPINFDI 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T ++ S I +A  +++  I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 371 TPKIQSEIDRAVTDFNSVIGQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  +M D     + + +L  KAI AH++
Sbjct: 431 GKNRPTYESAATRRFQLGRTETCRSVSDESVAWCTSMADHSADDKSRVDLFRKAIAAHIE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  E+ P I+ DP+Y  S+ W LSTSQLSSE+F GYGW
Sbjct: 491 YISAASDGKGVDRHLFGLKKLLEPGEEVPAIYKDPSYGYSSSWYLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+  G+GIAYMIN +S+NFN+VS  L +D + +YL E+A EMR +          IKA
Sbjct: 551 SQVIDGGFGIAYMINENSINFNVVSKGLGSDRMSYYLNEAAGEMRDLL---VPTLEPIKA 607

Query: 301 KL 302
           KL
Sbjct: 608 KL 609



>gi|302413782|ref|XP_003004723.1| carnitine O-acetyltransferase [Verticillium albo-atrum VaMs.102]
 gi|261355792|gb|EEY18220.1| carnitine O-acetyltransferase [Verticillium albo-atrum VaMs.102]
          Length = 401

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I NNK+D  +P +RS L  PQ + F +
Sbjct: 103 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFNNKIDLSNPAIRSNLADPQPVKFEI 162

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T +V + I +A K+++D I +H+L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 163 TKDVQTEIDRATKDFNDVIGQHELAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 222

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS  S  W ++M D +     + +L  KAI++H++
Sbjct: 223 GKNRPTYESAATRRFQQGRTETCRTVSDASTAWCRSMADAESTDATRTDLFRKAIDSHLE 282

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L   E+ P+I+ DPAY  S  W LSTSQLSSE+F GYGW
Sbjct: 283 YISAASDGKGVDRHLFGLKKLLGPGEELPSIYKDPAYTYSATWFLSTSQLSSEFFNGYGW 342

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +S+NFNIVS  L +  +  YL E+A +MR + 
Sbjct: 343 SQVIDDGFGIAYMINENSINFNIVSKGLGSQRMSFYLNEAAGDMRDLL 390



>gi|472236379|gb|EMR81316.1| putative choline carnitine o-acyltransferase protein [Botryotinia
           fuckeliana BcDW1]
          Length = 639

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 212/298 (71%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V  VI NNK+D   P++RS LP P  L F++
Sbjct: 341 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNEVIFNNKLDFSDPSIRSNLPDPTPLKFHI 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K++++ IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 401 TKEVQSEIERATKDFNEVIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 460

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS DSV + KA+ D  V           AIN+HV+
Sbjct: 461 GKNRPTYESAATRRFQQGRTETCRSVSDDSVAFCKAISDHTVEPSKAVAAFRAAINSHVE 520

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  E+ P I+ DP Y  S+ W +S+SQLSSEYF GYGW
Sbjct: 521 YITAASDGKGVDRHLFGLKKLLEPGEELPAIYQDPTYGYSSKWFISSSQLSSEYFNGYGW 580

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV----FEYAQAK 294
            +VV DG+GIAYMIN +S+ FN+VS  L ++ +  YL E+A ++R +     E A+AK
Sbjct: 581 SQVVDDGWGIAYMINENSIQFNVVSKGLGSERMSFYLNEAAGDIRDLLMPTLEPAKAK 638



>gi|119481359|ref|XP_001260708.1| carnitine acetyl transferase [Neosartorya fischeri NRRL 181]
 gi|119408862|gb|EAW18811.1| carnitine acetyl transferase [Neosartorya fischeri NRRL 181]
          Length = 644

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 205/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PT R+ND + N+I NNK+D     VRS LP P+ + F+L
Sbjct: 344 FIINDNGTAGFMGEHSMMDGSPTHRMNDHLNNLIFNNKIDLSEKPVRSNLPDPRSIEFHL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            SEVL AI  A K +   ++ H+L+V +Y+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 404 NSEVLEAIDAASKEHRQQMSAHELKVQSYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + KA  D  VP E    L   A+ AH K
Sbjct: 464 GKNRPTYESASTRKFQEGRTETIRSVSDESVAFCKAQADPSVPREEVVRLFRAALAAHSK 523

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  L+  EK P ++ DPAYA S  W LSTSQLSSE+F GYGW
Sbjct: 524 YTALASDGQGVDRHLFGLKKLLREGEKLPALYEDPAYAYSGSWYLSTSQLSSEFFNGYGW 583

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + +YL E+AT++R + 
Sbjct: 584 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSYYLNEAATDLRDLL 631



>gi|407920945|gb|EKG14122.1| Acyltransferase ChoActase/COT/CPT [Macrophomina phaseolina MS6]
          Length = 639

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 213/298 (71%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND +  +IA N +    P+VRS LP P  L+F L
Sbjct: 341 FIVNDNGTSGFMGEHSMMDGTPTHRLNDHINMLIATNALPFDDPSVRSNLPEPIPLNFKL 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            + +   I++A+K++D  I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 401 NTRLQEDINEAQKHFDGQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 460

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM D  VP +   +L   A++AHVK
Sbjct: 461 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFCSAMADPSVPDDKCRDLFRAALDAHVK 520

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+ +A +GRG DRHLFGL+  L+  E  P+I+TDP +A S+HW +S+SQLSSEYF GYGW
Sbjct: 521 YITDASDGRGVDRHLFGLKKCLQHGEDIPSIYTDPTFAYSSHWYISSSQLSSEYFNGYGW 580

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV----FEYAQAK 294
            +VV DG+GIAYMIN +S+ FNIVS  L ++ +  YL E+A ++R +     E A+AK
Sbjct: 581 SQVVDDGWGIAYMINENSIQFNIVSKNLGSERMSFYLNEAAGDIRDIMLPTLEAAKAK 638



>gi|358398998|gb|EHK48349.1| carnitine O-acetyltransferase precursor [Trichoderma atroviride IMI
           206040]
          Length = 608

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I  NK+D   PNVRS LP PQ + F +
Sbjct: 310 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGNKIDFSDPNVRSDLPEPQPIKFEI 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T +V S I +A  ++++ I +H L V AY+ YGK +IK+   SPDAYVQMIIQLAYYKMY
Sbjct: 370 TPKVQSEIDRAVTDFNNVIGQHQLAVQAYQAYGKGLIKQFRCSPDAYVQMIIQLAYYKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  +M D     + + +L  KAI AH++
Sbjct: 430 GKNRPTYESAATRRFQLGRTETCRSVSDESVAWCTSMADPAAEDKTRVDLFRKAIAAHIE 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L   E+ PTI+ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 490 YISAASDGKGVDRHLFGLKKLLAPGEELPTIYKDPAYGYSSSWYLSTSQLSSEFFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFN+VS  L ++ + +YL E+A EMR + 
Sbjct: 550 SQVIDGGFGIAYMINENSINFNVVSKGLGSERMSYYLNEAAGEMRDLL 597



>gi|384497855|gb|EIE88346.1| hypothetical protein RO3G_13057 [Rhizopus delemar RA 99-880]
          Length = 614

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 159/267 (59%), Positives = 197/267 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVFENGKAGF GEHS MDGT T RLN++VC+ +A N + HGS  VRS +P P QL F L
Sbjct: 307 FIVFENGKAGFMGEHSCMDGTATCRLNEYVCDGLARNLIKHGSEQVRSSIPQPVQLQFVL 366

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              V  AI  AEK+++  I KH++ VL Y  +GKN+IKK   SPD + QM IQLAYYKM+
Sbjct: 367 NPNVEKAIETAEKDFEQLINKHEMTVLTYNAFGKNLIKKFKCSPDGFAQMAIQLAYYKMF 426

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT++ TYES QTRKFQ GRTE CR+VS +S+ +VKAMED  +  E K      A+ A  +
Sbjct: 427 GTSRPTYESGQTRKFQRGRTETCRSVSDESIAFVKAMEDHSIKTEEKIVKLRAALKAQGQ 486

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           YMA AV GRG DRHLFGL+ SLK  E+KP +FTD AY+ S+HW LSTSQLSSE+F GYGW
Sbjct: 487 YMAAAVNGRGVDRHLFGLKNSLKEGEEKPALFTDYAYSYSSHWYLSTSQLSSEHFDGYGW 546

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLR 267
           G+VV DG+G+AYMI N++L FN+ S++
Sbjct: 547 GQVVDDGFGVAYMIKNNALQFNVASVK 573



>gi|154293128|ref|XP_001547114.1| hypothetical protein BC1G_14516 [Botryotinia fuckeliana B05.10]
          Length = 632

 Score =  337 bits (864), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 212/298 (71%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V  VI NNK+D   P++RS LP P  L F++
Sbjct: 334 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNEVIFNNKLDFSDPSIRSNLPDPTPLKFHI 393

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K++++ IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 394 TKEVQSEIERATKDFNEVIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 453

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS DSV + KA+ D  V           AIN+HV+
Sbjct: 454 GKNRPTYESAATRRFQQGRTETCRSVSDDSVAFCKAISDHTVEPSKAVAAFRAAINSHVE 513

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  E+ P I+ DP Y  S+ W +S+SQLSSEYF GYGW
Sbjct: 514 YITAASDGKGVDRHLFGLKKLLEPGEELPAIYQDPTYGYSSKWFISSSQLSSEYFNGYGW 573

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV----FEYAQAK 294
            +VV DG+GIAYMIN +S+ FN+VS  L ++ +  YL E+A ++R +     E A+AK
Sbjct: 574 SQVVDDGWGIAYMINENSIQFNVVSKGLGSERMSFYLNEAAGDIRDLLMPTLEPAKAK 631



>gi|440633991|gb|ELR03910.1| carnitine O-acetyltransferase [Geomyces destructans 20631-21]
          Length = 637

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 212/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V +VI NNK+D  + NVRS LP P  + F++
Sbjct: 339 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNDVIFNNKLDFSATNVRSSLPEPAPVKFHV 398

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +AEK++ D I +H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KM+
Sbjct: 399 TKEVASEIHRAEKDFADVIGQHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMF 458

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE  RTVS DSV + KA+ +     +   EL  KAIN+H++
Sbjct: 459 GKNRGTYESAATRRFQLGRTETTRTVSDDSVAFCKAISNADNDSKTTVELFRKAINSHLE 518

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A A +G+G DRHLFGL+  L   E+ P I+ DPA++ S+ W +S+SQLSSEYF GYGW
Sbjct: 519 YIAAASDGKGVDRHLFGLKKLLAPGEELPAIYKDPAFSYSSKWFISSSQLSSEYFNGYGW 578

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +SL FN+VS  L ++ +  YL E+A ++R + 
Sbjct: 579 SQVVDDGWGIAYMINENSLQFNVVSKGLGSERMSFYLNEAAGDIRDLM 626



>gi|310792024|gb|EFQ27551.1| choline/Carnitine O-acyltransferase [Glomerella graminicola M1.001]
          Length = 604

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +N  +GF GEHS MDGTPT RLNDF+ ++I NNK+D   P++RS LP PQ + F +
Sbjct: 306 FIVNDNATSGFMGEHSMMDGTPTHRLNDFINDLIFNNKIDLSDPSIRSNLPDPQVVKFEV 365

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A K++ D I++H+L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 366 TKEVQAEIDRARKDFHDVISQHELAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKMY 425

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS  SV W  AM D  V  + K +L  +AI++H++
Sbjct: 426 GKNRPTYESAATRRFQQGRTETCRTVSDASVAWCNAMADPNVEDKDKVDLFRQAIDSHLE 485

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPA+  S+ W LSTSQLSSEYF GYGW
Sbjct: 486 YITAASDGKGVDRHLFGLKKLLEPGQELPAIYQDPAFTYSSSWYLSTSQLSSEYFNGYGW 545

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFN+VS  L +  +  +L E+A +MR + 
Sbjct: 546 SQVIDAGFGIAYMINENSINFNVVSKGLGSQRMSFFLNEAAGDMRDLL 593



>gi|429849234|gb|ELA24637.1| carnitine acetyl transferase [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 610

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +N  +GF GEHS MDGTPT RLNDF+ ++I NNK+D   P++RS LP PQ + F++
Sbjct: 312 FIVNDNATSGFMGEHSMMDGTPTHRLNDFINDLIFNNKIDLSDPSIRSNLPEPQVVKFDV 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A K++ D I +H+L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 372 TKEVQAEIDRATKDFHDVIGQHELAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKMY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS  SV W  AM D  +  + K +L  +AI+AH++
Sbjct: 432 GKNRPTYESAATRRFQQGRTETCRTVSDASVTWCSAMADPNIEDKDKVDLFRQAIDAHLE 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ DPA++ S  W LSTSQLSSE+F GYGW
Sbjct: 492 YITAASDGKGVDRHLFGLKKLLEPGQEIPAIYQDPAFSYSASWYLSTSQLSSEFFNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFN+VS  L +  +  +L E+A +MR + 
Sbjct: 552 SQVIDAGFGIAYMINENSINFNVVSKGLGSQRMSFFLNEAAGDMRDLL 599



>gi|402082664|gb|EJT77682.1| carnitine O-acetyltransferase [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 653

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLNDFV +VI NNK+D   P VRSGLP P Q+ F +
Sbjct: 355 FIVNDNGTSGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFSDPTVRSGLPDPAQVKFAV 414

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + ++   I +A +++   I +H+L V AY+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 415 SEDLKGEIERATRDFAAVIGQHELAVQAYQGYGKGLIKKFRCSPDAYVQMVIQLAYHKMY 474

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV W  AM D       +  L   A+++H++
Sbjct: 475 GKNRPTYESAATRRFQQGRTETCRSVSEASVAWCSAMADPHAADADRVRLFRAAVDSHIE 534

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+A A +G+G DRHLFGL+  L+  ++ P I+ DPAYA S+ W LSTSQLSSEYF GYGW
Sbjct: 535 YIAAASDGKGVDRHLFGLKRLLEPGQEVPAIYKDPAYAYSSSWYLSTSQLSSEYFNGYGW 594

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  + +YL ESA +MR + 
Sbjct: 595 SQVIDAGFGIAYMINENSINFNIVSKGLGSQKMSYYLSESAGDMRDLL 642



>gi|156034807|ref|XP_001585822.1| hypothetical protein SS1G_13339 [Sclerotinia sclerotiorum 1980]
 gi|154698742|gb|EDN98480.1| hypothetical protein SS1G_13339 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 646

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 211/298 (70%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+  NG +GF GEHS MDGTPT RLND+V  VI NNK+D  +P+ RS LP P  L F++
Sbjct: 348 FIINNNGTSGFMGEHSMMDGTPTHRLNDYVNEVIFNNKLDFSNPSTRSNLPEPTPLKFHI 407

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I +A K++ + IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 408 TKEVQSEIERATKDFTEVIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 467

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS DSV + KA+ D  V           AIN+HV+
Sbjct: 468 GKNRPTYESAATRRFQQGRTETCRSVSDDSVAFCKAISDHTVDPSKAIATFRAAINSHVE 527

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  E+ P IF DP Y+ S+ W +S+SQLSSEYF GYGW
Sbjct: 528 YITAASDGKGVDRHLFGLKKLLEPGEELPAIFKDPTYSYSSKWFISSSQLSSEYFNGYGW 587

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV----FEYAQAK 294
            +VV DG+GIAYMIN +S+ FN+VS  L ++ +  YL E+A ++R +     E A+AK
Sbjct: 588 SQVVDDGWGIAYMINENSIQFNVVSKGLGSERMSFYLNEAAGDIRDLLIPTLEPAKAK 645



>gi|346975434|gb|EGY18886.1| carnitine O-acetyltransferase [Verticillium dahliae VdLs.17]
          Length = 610

 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 209/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I NNK+D  +P +RS L  PQ + F +
Sbjct: 312 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFNNKIDLSNPAIRSNLADPQPVKFEI 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T +V + I +A K+++D I +H+L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 372 TKDVQTEIDRATKDFNDVIGQHELAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS  S  W ++M D +     + +L  KAI++H++
Sbjct: 432 GKNRPTYESAATRRFQQGRTETCRTVSDASTAWCRSMADAESTDATRTDLFRKAIDSHLE 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L   E+ P+I+ DPAY  S  W LSTSQLSSE+F GYGW
Sbjct: 492 YISAASDGKGVDRHLFGLKKLLGPGEELPSIYKDPAYTYSATWFLSTSQLSSEFFNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +S+NFNIVS  L +  +  YL E+A ++R + 
Sbjct: 552 SQVIDDGFGIAYMINENSINFNIVSKGLGSQRMSFYLNEAAGDIRDLL 599



>gi|485929347|gb|EOD52767.1| putative carnitine o-acetyltransferase protein [Neofusicoccum
           parvum UCRNP2]
          Length = 639

 Score =  335 bits (859), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND +  +I  N +    P+VRS LP P  L+F L
Sbjct: 341 FIVNDNGTSGFMGEHSMMDGTPTHRLNDHINMLITTNALPFDDPSVRSNLPEPIPLNFKL 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            + +   I++A+K++D  I  H+LRV AY+GYGK +IKK   SPDAYVQM+IQLAY+K Y
Sbjct: 401 NTRLQEDINEAQKHFDGQINAHELRVQAYQGYGKGLIKKFKCSPDAYVQMVIQLAYHKFY 460

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  +M D  VP E   EL   A++AHVK
Sbjct: 461 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFCSSMADPSVPPEKSRELFRAALDAHVK 520

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+ +A +GRG DRHLFGL+  L+S E  P I+ DP +A S+HW +S+SQLSSEYF GYGW
Sbjct: 521 YITDASDGRGVDRHLFGLKKCLQSGEDVPAIYNDPTFAYSSHWFISSSQLSSEYFNGYGW 580

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FN+VS  L ++ +  YL E+A ++R + 
Sbjct: 581 SQVVDDGWGIAYMINENSIQFNVVSKNLGSERMSFYLNEAAGDIRDLM 628



>gi|322707647|gb|EFY99225.1| carnitine acetyl transferase [Metarhizium anisopliae ARSEF 23]
          Length = 624

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 207/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I  NK+D   P++RS LP PQ + F++
Sbjct: 324 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGNKIDFSDPSIRSDLPEPQLIQFDI 383

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T+ + + I +A  ++   I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 384 TAPIQAEIDRAVTDFHTVINQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 443

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV W K+M D     + +  L   AI+AH++
Sbjct: 444 GKNRPTYESAATRRFQLGRTETCRTVSDESVAWCKSMSDASQDDQARINLFRSAIDAHLE 503

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L  +E+ P I+ DPA+  S+ W LSTSQLSSE+F GYGW
Sbjct: 504 YITAASDGKGADRHLFGLKKLLAPDEEVPAIYKDPAFGYSSSWYLSTSQLSSEFFNGYGW 563

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFN+VS  L +D + +YL E+A EMR + 
Sbjct: 564 SQVIDGGFGIAYMINENSINFNVVSKSLGSDRMSYYLNEAAGEMRDLL 611



>gi|511007392|gb|EPB88684.1| carnitine O-acetyltransferase [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 613

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 157/267 (58%), Positives = 200/267 (74%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVF+NG+AGF GEHS MDGT T RLN++VC+ +A N + HG  +VRS +P PQQL+F L
Sbjct: 306 FIVFDNGRAGFMGEHSCMDGTATCRLNEYVCDGLARNLIKHGHNSVRSNIPQPQQLNFVL 365

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             ++  +I  AEK++D  IA H++ VLAY+ +GKN+IKK   SPD + QM IQLAYYKM+
Sbjct: 366 NKKIEDSIQVAEKHFDQLIANHEMTVLAYQSFGKNLIKKFKCSPDGFAQMAIQLAYYKMF 425

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT++ TYES QTRKFQ GRTE  RTVS +SV +VKAMED  +P E K      A+ +  +
Sbjct: 426 GTSRPTYESGQTRKFQRGRTETSRTVSDESVAFVKAMEDPNLPNEQKIAAFRAALKSQGQ 485

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           YMA AV   G DRHLFGL+ SLK+ E KP +FTDPA+A S+HW LSTSQLSSE+F GYGW
Sbjct: 486 YMATAVNAHGVDRHLFGLKNSLKAGEPKPELFTDPAFAYSSHWYLSTSQLSSEHFDGYGW 545

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLR 267
           G+VV DG+G AYMI N++L FN+ S++
Sbjct: 546 GQVVNDGFGCAYMIKNNALQFNVASVK 572



>gi|500258493|gb|EOO01405.1| putative carnitine o-acetyltransferase protein [Togninia minima
           UCRPA7]
          Length = 622

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 211/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V +VI NNK+D   P+VRS LP P  ++F++
Sbjct: 324 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDVIFNNKLDFSDPSVRSNLPEPVAVNFHI 383

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + + +A K+++D I +H+L V AY+GYGK +IKK   SPDAY QMIIQLAYYKMY
Sbjct: 384 TPEVQAELDRAVKDFNDVIGQHELAVQAYQGYGKGLIKKFRCSPDAYTQMIIQLAYYKMY 443

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV W  AM D  +    + EL   AI++H++
Sbjct: 444 GKNRPTYESAATRRFQLGRTETCRSVSDASVAWCNAMADPTLDDPKRVELFRAAIDSHLE 503

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  E+ P ++ DPAY  S+ W LSTSQLSSE+F GYGW
Sbjct: 504 YISAASDGKGVDRHLFGLKKLLEPGEEVPALYKDPAYGYSSSWFLSTSQLSSEFFNGYGW 563

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  + +YL E+A ++R++ 
Sbjct: 564 SQVIDAGFGIAYMINENSINFNIVSKGLGSKKMSYYLNEAAGDIRELM 611



>gi|399168732|emb|CCE30518.1| probable carnitine O-acetyltransferase precursor [Claviceps
           purpurea 20.1]
          Length = 609

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I   K+D   P +RS LP PQ L FNL
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGKKLDFFDPVIRSDLPEPQLLRFNL 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T  + + I +A  ++   I +H+L V AY+GYGK++IK+   SPDAYVQM+IQLAYYKM+
Sbjct: 371 TPPIRAEIDRAVTDFHAVIKQHELAVQAYQGYGKSLIKQFKCSPDAYVQMLIQLAYYKMF 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV W  +M D     E+K +L  KA+ AH++
Sbjct: 431 GKNRPTYESATTRRFQLGRTETCRTVSDESVAWCASMLDSSKTNELKVDLFRKAVKAHLE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G G DRHLFGL+  L+  E+ P I+ DPA+A S+ W LSTSQLSSE+F GYGW
Sbjct: 491 YISAASDGNGVDRHLFGLKKLLRQGEETPAIYKDPAFAYSSSWYLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+NFNIVS  L +  + +YL E+A EMR + 
Sbjct: 551 SQVVDDGFGIAYMINANSINFNIVSKGLGSAHMSYYLNEAAGEMRDLL 598



>gi|295662811|ref|XP_002791959.1| carnitine O-acetyltransferase [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226279611|gb|EEH35177.1| carnitine O-acetyltransferase [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 610

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND++ N+I NN++D+ +P++RS LP PQ + F L
Sbjct: 310 FIVNENGTAGFMGEHSMMDGTPTHRLNDYINNMIFNNRLDYSNPSIRSTLPEPQPVRFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             +V+  I+ A   ++  I +H+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NDQVVDDIATATHAFNTVIGQHELRVQAFQGYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + ++  D  VP E   +    A+ AHVK
Sbjct: 430 GKNRPTYESASTRKFQLGRTETTRSVSDESVAFCRSHADTNVPREEVVKNFRAALAAHVK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  LK  EK P IF DPAYA S  W +STSQLSSEYF GYGW
Sbjct: 490 YTADASVGKGVDRHLFGLKKLLKDGEKVPQIFQDPAYAYSGTWYISTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVVDDGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDLL 597



>gi|226286690|gb|EEH42203.1| carnitine O-acetyltransferase [Paracoccidioides brasiliensis Pb18]
          Length = 610

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 161/288 (55%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND++ N+I N+++D+ +P++RS LP PQ + F L
Sbjct: 310 FIVNENGTAGFMGEHSMMDGTPTHRLNDYINNMIFNDRLDYSNPSIRSTLPEPQPVRFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             +V+  I+ A   ++  I +H+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KM+
Sbjct: 370 NDQVVDDIATATHAFNTVIGQHELRVQAFQGYGKGLIKKFKCSPDAYVQMLIQLAYFKMF 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + K+  D  VP E   +    A+ AHVK
Sbjct: 430 GKNRPTYESASTRKFQLGRTETTRSVSDESVAFCKSHADTNVPREEVVKNFRAALAAHVK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  LK  EK P IF DPAYA S  W +STSQLSSEYF GYGW
Sbjct: 490 YTADASVGKGVDRHLFGLKKLLKDGEKVPQIFQDPAYAYSGTWYISTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVVDDGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDLL 597



>gi|212537323|ref|XP_002148817.1| carnitine acetyl transferase [Talaromyces marneffei ATCC 18224]
 gi|210068559|gb|EEA22650.1| carnitine acetyl transferase [Talaromyces marneffei ATCC 18224]
          Length = 613

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 161/288 (55%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RLND+V ++I  NK+++ +  VRS LP P  ++F L
Sbjct: 313 FIINDNGTAGFMGEHSMMDGTPTQRLNDYVNSLIFGNKLEYDNTPVRSTLPPPAPINFEL 372

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+  AI++A + +   IA H+LRV A++ YGK +IKK   SPDAYVQM+IQLAYYKMY
Sbjct: 373 NVELEQAINEAHQEHKSLIAAHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYYKMY 432

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTEV RTVS DS  + +A +D  VP E   +L  +A+  H K
Sbjct: 433 GINRPTYESASTRKFKEGRTEVIRTVSDDSTAFCRAHQDPNVPREEVVKLFREALKQHTK 492

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y  EA +G+G DRHL GL+  ++  EK P IF DPAY  S+ W LSTSQLSSEYF GYGW
Sbjct: 493 YTMEASDGKGVDRHLLGLKKLVQEGEKLPEIFEDPAYGYSSSWYLSTSQLSSEYFNGYGW 552

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN DSL FN+VS RL  + L  YL E+A E+R + 
Sbjct: 553 SQVIDDGFGIAYMINEDSLQFNVVSKRLGCERLSFYLNEAALEVRDLL 600



>gi|406866603|gb|EKD19642.1| choline/Carnitine O-acyltransferase [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 641

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT R+ND+V  VI NNK+D   P++RS LP P  + F++
Sbjct: 343 FIVNDNGTAGFMGEHSMMDGTPTQRINDYVNEVIFNNKLDFSDPSIRSNLPEPSVVKFHV 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV S I +A K++ + I  H+LRV AY+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 403 NKEVQSEIERATKDFTEVIGAHELRVQAYQGYGKAMIKKFKCSPDAYVQMVIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA  R+FQ GRTE CR+VS +SV + KA+ D  V  E        A+ AHV+
Sbjct: 463 GKNRPTYESAAVRRFQQGRTETCRSVSDESVAFCKAITDHSVDNETAIAAFRAALKAHVE 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  +  NE+ P IF DPAY+ S+ W +S+SQLSSEYF GYGW
Sbjct: 523 YITAASDGKGVDRHLFGLKKLVGPNEELPAIFKDPAYSYSSKWFISSSQLSSEYFNGYGW 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FN+VS  L ++ +  YL E+  ++R + 
Sbjct: 583 SQVVDDGWGIAYMINENSIQFNVVSKGLGSERMSFYLNEACGDLRDLL 630



>gi|320591915|gb|EFX04354.1| carnitine acetyl transferase [Grosmannia clavigera kw1407]
          Length = 621

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 216/304 (71%), Gaps = 10/304 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDH-GSPNVRSGLPVPQQLHFN 59
           FIV +NG AGF GEHS MDGTPT RLND+VC+ I NNK+D    P+VR+ LP P  + F 
Sbjct: 317 FIVNDNGTAGFIGEHSMMDGTPTHRLNDWVCDAIFNNKLDALNDPHVRADLPEPVAVDFR 376

Query: 60  LTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKM 119
           LT  + +AI+ A +++ D I +H+L V AY+GYGK +IKK   SPDAYVQM+IQLAY+KM
Sbjct: 377 LTEPLTAAIAAAGEHFADVIGRHELAVQAYQGYGKGLIKKFRCSPDAYVQMVIQLAYFKM 436

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAM-----EDQKVPIEVKAELGYKA 174
           YG N+ TYESA TR+FQ GRTE CR+VS +SV + +AM     +   V    + +L   A
Sbjct: 437 YGKNRPTYESATTRRFQLGRTETCRSVSEESVAFCRAMAGPGSDADSVDAATRQKLFRAA 496

Query: 175 INAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
           I+AH++Y+A A +G+G DRHLFGLR  L+  E+ P I+ DPAYA S+ W LSTSQLSSE+
Sbjct: 497 IDAHLEYIAAASDGKGVDRHLFGLRKLLEPGEEVPAIYADPAYAYSSKWFLSTSQLSSEF 556

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV----FEY 290
           F GYGW +VV +G+GIAYMIN +SLNFNIVS  L +  +  YL E+A ++R +     E 
Sbjct: 557 FNGYGWSQVVDEGFGIAYMINENSLNFNIVSKGLGSTRMSFYLNEAAGDIRDLLLPTLET 616

Query: 291 AQAK 294
           A+AK
Sbjct: 617 AKAK 620



>gi|512192583|gb|EPE08342.1| carnitine acetyl transferase [Ophiostoma piceae UAMH 11346]
          Length = 674

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 201/288 (69%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLND+V   I  NK+D  +P VR  LP P  + F L
Sbjct: 377 FIVCDNGTAGFMGEHSMMDGTPTHRLNDWVNEAIFKNKLDFDNPTVRPDLPEPTPIEFKL 436

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T ++   I+ A +++ D + +H+L V +++GYGK +IKK   SPDAYVQM+IQLAYYKMY
Sbjct: 437 TEDLSKTIAAAGEHFKDIMGRHELAVQSFQGYGKGLIKKFRCSPDAYVQMVIQLAYYKMY 496

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA  R+FQ GRTE CR+VS DSV + K+M D  V    + +L   A+NAHV+
Sbjct: 497 GKNRPTYESAAVRRFQQGRTETCRSVSEDSVAFCKSMNDDSVDAATREKLFRTAVNAHVE 556

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  E  P I+ DPA++ S  W LSTSQLSSEYF GYGW
Sbjct: 557 YITAASDGKGVDRHLFGLKQLLEPGEALPAIYADPAFSYSCKWFLSTSQLSSEYFNGYGW 616

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V  +G+GIAYMIN +SLNFNIVS  L +  +  YL E+A ++R + 
Sbjct: 617 SQVTDEGFGIAYMINENSLNFNIVSKGLGSPRMSFYLNEAANDIRDLL 664



>gi|391868817|gb|EIT78026.1| carnitine O-acyltransferase CRAT [Aspergillus oryzae 3.042]
          Length = 643

 Score =  328 bits (840), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PTSRLND + N+I NNK+D     VRSGL  P+ ++F+L
Sbjct: 343 FIINDNGTAGFMGEHSMMDGSPTSRLNDHLNNLIFNNKIDLSEQPVRSGLSDPRPINFHL 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EVL AI  A K +   I+ H+L+V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 403 NDEVLEAIDAATKEHRQQISAHELKVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS DSV + KA  D  VP E    L   A+ +H K
Sbjct: 463 GKNRPTYESASTRKFQEGRTETIRSVSDDSVAFCKAQSDPSVPREEVVRLFRTALASHSK 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  LK  EK P ++ DPAY+ S+ W LSTSQLSSE+F GYGW
Sbjct: 523 YTAEASDGRGVDRHLFGLKKVLKEGEKLPALYEDPAYSYSSSWYLSTSQLSSEFFNGYGW 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + +YL E+A+++R + 
Sbjct: 583 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAASDLRDLL 630



>gi|238496603|ref|XP_002379537.1| carnitine acetyl transferase [Aspergillus flavus NRRL3357]
 gi|317147067|ref|XP_001821862.2| carnitine acetyl transferase [Aspergillus oryzae RIB40]
 gi|220694417|gb|EED50761.1| carnitine acetyl transferase [Aspergillus flavus NRRL3357]
          Length = 643

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PTSRLND + N+I NNK+D     VRSGL  P+ ++F+L
Sbjct: 343 FIINDNGTAGFMGEHSMMDGSPTSRLNDHLNNLIFNNKIDLSEQPVRSGLSDPRPINFHL 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EVL AI  A K +   I+ H+L+V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 403 NDEVLEAIDAATKEHRQQISAHELKVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS DSV + KA  D  VP E    L   A+ +H K
Sbjct: 463 GKNRPTYESASTRKFQEGRTETIRSVSDDSVAFCKAQSDPSVPREEVVRLFRTALASHSK 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  LK  EK P ++ DPAY+ S+ W LSTSQLSSE+F GYGW
Sbjct: 523 YTAEASDGRGVDRHLFGLKKVLKEGEKLPALYEDPAYSYSSSWYLSTSQLSSEFFNGYGW 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + +YL E+A+++R + 
Sbjct: 583 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAASDLRDLL 630



>gi|296812625|ref|XP_002846650.1| carnitine acetyl transferase [Arthroderma otae CBS 113480]
 gi|238841906|gb|EEQ31568.1| carnitine acetyl transferase [Arthroderma otae CBS 113480]
          Length = 610

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 203/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ ++F L
Sbjct: 310 FIVNENGTAGFLGEHSMMDGTPTHRLNDYVNQLIFSNSLDYSNPSIRSNLPEPQPINFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              VL  I+ A ++++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NPSVLKDIATATQDFETVINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF+ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKFKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRTAVAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E  P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASVGKGVDRHLFGLKKLIRDGEDVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +S+ FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVIDDGFGIAYMINENSIQFNIVCKKIGAERMSFYLNEAACEVRDML 597



>gi|477534538|gb|ENH86074.1| carnitine acetyl transferase [Colletotrichum orbiculare MAFF
           240422]
          Length = 610

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +N  +GF GEHS MDGTPT RLNDF+ ++I NNK+D   P++RS LP PQ + F +
Sbjct: 312 FIVNDNATSGFMGEHSMMDGTPTHRLNDFINDLIFNNKIDLSDPSIRSNLPDPQVVKFEV 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV   I +A +++ D I++H+L V AY+GYGK +IKK   SPDAYVQM+IQLAY+KM+
Sbjct: 372 TKEVQVEIDRATRDFHDVISQHELAVQAYQGYGKGLIKKFKCSPDAYVQMVIQLAYHKMH 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS  SV W  AM D  +  + K ++  +AI++H++
Sbjct: 432 GKNRPTYESAATRRFQQGRTETCRTVSDTSVAWCNAMADPNIGDKDKIDMFRQAIDSHLE 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+   + P I+ DPA+  S  W+LSTSQLSSE+F GYGW
Sbjct: 492 YITAASDGKGVDRHLFGLKKLLEPGAELPAIYQDPAFTYSASWHLSTSQLSSEFFNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN  S+NFNIVS  L +  +  +L E+A ++R + 
Sbjct: 552 SQVIDAGFGIAYMINESSINFNIVSKSLGSQRMSFFLNEAAGDLRDLL 599



>gi|239610578|gb|EEQ87565.1| carnitine acetyl transferase [Ajellomyces dermatitidis ER-3]
          Length = 610

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P +RS LP PQ + F L
Sbjct: 310 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNNMIFNNRLDYSNPEIRSTLPDPQPIKFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + +  I+ A   +   I +H+LRV A++GYGK +IK+   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NKQAIDDIATATHAFTTVIGQHELRVQAFQGYGKGLIKRFRCSPDAYVQMVIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TRKFQ GRTE  R+VS +SV + K+  D  VP EV A+    A+ AH K
Sbjct: 430 GKSRPTYESASTRKFQLGRTETTRSVSDESVAFCKSHTDINVPREVVAKNFRAAVVAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   EK P +F DPAYA S  W +S+SQLSSEYF GYGW
Sbjct: 490 YTADASLGKGVDRHLFGLKKLIAEGEKVPALFEDPAYAYSGKWFISSSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 550 SQVVDDGFGIAYMINENSIQFNIVCKKLGAERMSFYLNEAACEIRELL 597



>gi|83769725|dbj|BAE59860.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 610

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/288 (57%), Positives = 208/288 (72%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDG+PTSRLND + N+I NNK+D     VRSGL  P+ ++F+L
Sbjct: 310 FIINDNGTAGFMGEHSMMDGSPTSRLNDHLNNLIFNNKIDLSEQPVRSGLSDPRPINFHL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EVL AI  A K +   I+ H+L+V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 370 NDEVLEAIDAATKEHRQQISAHELKVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS DSV + KA  D  VP E    L   A+ +H K
Sbjct: 430 GKNRPTYESASTRKFQEGRTETIRSVSDDSVAFCKAQSDPSVPREEVVRLFRTALASHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +GRG DRHLFGL+  LK  EK P ++ DPAY+ S+ W LSTSQLSSE+F GYGW
Sbjct: 490 YTAEASDGRGVDRHLFGLKKVLKEGEKLPALYEDPAYSYSSSWYLSTSQLSSEFFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + +YL E+A+++R + 
Sbjct: 550 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAASDLRDLL 597



>gi|315050652|ref|XP_003174700.1| carnitine O-acetyltransferase [Arthroderma gypseum CBS 118893]
 gi|311340015|gb|EFQ99217.1| carnitine O-acetyltransferase [Arthroderma gypseum CBS 118893]
          Length = 610

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ L+F L
Sbjct: 310 FVINENGTAGFIGEHSMMDGTPTHRLNDYVNQLIFSNGLDYSNPSIRSNLPEPQPLNFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +L  IS A K+++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NPTILEDISTATKDFEALINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK++ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKYKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRAAVAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E+ P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASIGKGVDRHLFGLKKLIRDGEEVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVIDEGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDML 597



>gi|326469628|gb|EGD93637.1| carnitine acetyl transferase [Trichophyton tonsurans CBS 112818]
          Length = 640

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ ++F L
Sbjct: 340 FVINENGTAGFLGEHSMMDGTPTHRLNDYVNQLIFSNALDYSNPSIRSNLPEPQPINFEL 399

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +L  IS A K+++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 400 NPAILEDISTATKDFEALINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 459

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK++ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 460 GKNRPTYESASTRKYKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRAAVAAHSK 519

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E+ P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 520 YTAEASVGKGVDRHLFGLKKLIRDGEEVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 579

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 580 SQVIDEGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDML 627



>gi|302509234|ref|XP_003016577.1| hypothetical protein ARB_04866 [Arthroderma benhamiae CBS 112371]
 gi|291180147|gb|EFE35932.1| hypothetical protein ARB_04866 [Arthroderma benhamiae CBS 112371]
          Length = 610

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ ++F L
Sbjct: 310 FVINENGTAGFLGEHSMMDGTPTHRLNDYVNQLIFSNALDYSNPSIRSNLPEPQPINFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +L  IS A K+++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NPAILEDISTATKDFEALINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK++ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKYKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRAAVAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E+ P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASVGKGVDRHLFGLKKLIRDGEEVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVIDEGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDML 597



>gi|327303492|ref|XP_003236438.1| carnitine acetyl transferase [Trichophyton rubrum CBS 118892]
 gi|326461780|gb|EGD87233.1| carnitine acetyl transferase [Trichophyton rubrum CBS 118892]
          Length = 610

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ ++F L
Sbjct: 310 FVINENGTAGFLGEHSMMDGTPTHRLNDYVSQLIFSNALDYSNPSIRSNLPEPQPINFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +L  IS A ++++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NPAILEDISTATRDFEALINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK++ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKYKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRAAVAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E+ P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASVGKGVDRHLFGLKKLIRDGEEVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVIDEGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDML 597



>gi|511010252|gb|EPB91477.1| carnitine O-acetyltransferase [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 617

 Score =  326 bits (835), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 195/267 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV+ENGKAGF GEHS MDGT T RLN++VC+ +  +K++HG   VRS LP P++L F++
Sbjct: 310 FIVYENGKAGFMGEHSCMDGTATCRLNEYVCDGLNRDKINHGDVEVRSDLPNPEELKFHV 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +   I  AE N+D  I+KHDL VL+Y+ YGKN+IKK   SPD + QM+IQLAYYKM+
Sbjct: 370 NDSITKDIQSAESNFDQLISKHDLTVLSYQSYGKNLIKKFKCSPDGFTQMVIQLAYYKMF 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT++ TYESAQTRKFQ GRTE  RTV+ +SV +VKAMED  +  + K      A+     
Sbjct: 430 GTSRPTYESAQTRKFQRGRTETARTVTTESVAFVKAMEDPHLDNQSKIAAFRAALKTQGA 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           YMA+AV G G DRH FGL+  ++  E+KP +FT P +A S+HW LSTSQLSSE+F GYGW
Sbjct: 490 YMADAVNGHGVDRHFFGLKNCIQPGEEKPELFTQPVHAYSSHWYLSTSQLSSEHFDGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLR 267
           G+VV DG+G AYMI N++L FN+ S++
Sbjct: 550 GQVVNDGFGCAYMIKNNALQFNVASVK 576



>gi|302655212|ref|XP_003019399.1| hypothetical protein TRV_06566 [Trichophyton verrucosum HKI 0517]
 gi|291183118|gb|EFE38754.1| hypothetical protein TRV_06566 [Trichophyton verrucosum HKI 0517]
 gi|326478845|gb|EGE02855.1| carnitine acetyl transferase [Trichophyton equinum CBS 127.97]
          Length = 610

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 204/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ ENG AGF GEHS MDGTPT RLND+V  +I +N +D+ +P++RS LP PQ ++F L
Sbjct: 310 FVINENGTAGFLGEHSMMDGTPTHRLNDYVNQLIFSNALDYSNPSIRSNLPEPQPINFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              +L  IS A K+++  I KH+LRV A++ YGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NPAILEDISTATKDFEALINKHELRVQAFQAYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK++ GRTE  R+VS DSV + KA  D  V  E   +L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKYKLGRTETTRSVSDDSVAFCKAQADPSVSREELVKLFRAAVAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA  G+G DRHLFGL+  ++  E+ P++F DP YA S  W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASVGKGVDRHLFGLKKLIRDGEEVPSLFKDPTYAYSGSWFLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +SL FNIV  ++  + +  YL E+A E+R + 
Sbjct: 550 SQVIDEGFGIAYMINENSLQFNIVCKKIGAERMSFYLNEAACEVRDML 597



>gi|451848963|gb|EMD62267.1| hypothetical protein COCSADRAFT_38227 [Bipolaris sorokiniana
           ND90Pr]
          Length = 608

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/303 (52%), Positives = 208/303 (68%), Gaps = 5/303 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ ENG +GF GEHS MDGTPT RLND+    I +N +    PN+RS LP P+ L F L
Sbjct: 310 FIINENGTSGFMGEHSMMDGTPTHRLNDYANQQIFSNALPFDDPNIRSDLPSPKPLRFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E+   I  A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 370 SRELQQDIEDAQSHFSRQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMED-QKVPIEVKAELGYKAINAHV 179
           G N+ TYESA TR+FQ GRTE CR+VS +SV +  AM D    P E + +L   AI+AHV
Sbjct: 430 GKNRPTYESAATRRFQQGRTETCRSVSDESVAFCNAMADANATPEECQQKLR-AAIDAHV 488

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  LK  E+ P ++ DPA+  S+ W +S+SQLSSEYF GYG
Sbjct: 489 KYISDASDGRGVDRHLFGLKKCLKEGEELPALYKDPAFTYSSTWYISSSQLSSEYFNGYG 548

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIK 299
           W +V+ DG+G+AYMIN +S+ FN+ S  L +D +  YL E+A +MR +      KA   K
Sbjct: 549 WSQVIDDGWGLAYMINENSIQFNVCSKGLGSDKMSFYLNEAAGDMRDIMMPTLEKA---K 605

Query: 300 AKL 302
           AKL
Sbjct: 606 AKL 608



>gi|255946415|ref|XP_002563975.1| Pc20g15010 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211588710|emb|CAP86830.1| Pc20g15010 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 639

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/288 (55%), Positives = 197/288 (68%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLND+V NVI N K+D  + +VRS L  P+ ++F L
Sbjct: 339 FIVNDNGTAGFMGEHSMMDGTPTHRLNDYVNNVIFNKKLDLSAQSVRSQLADPKPINFKL 398

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
                 AI  A + +   I  H+L V AY+GYGK +IKK   SPDA+VQM IQLAY+KMY
Sbjct: 399 NDAANEAIDFATQYHRKQIGSHELVVQAYQGYGKGLIKKFKCSPDAFVQMTIQLAYFKMY 458

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF  GRTE  RTVS +SV + KA ED   P E   +L   A+  H K
Sbjct: 459 GKNRPTYESASTRKFAEGRTETTRTVSDESVAFCKAHEDHTTPREETVKLFRAALAQHTK 518

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y  EA  G G DRHLFGL+  L+  EK P I+ DPAYA S+ W LSTSQLSSE+F GYGW
Sbjct: 519 YTQEASAGHGVDRHLFGLKKLLQPGEKLPEIYQDPAYAYSSSWYLSTSQLSSEFFNGYGW 578

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + H+L E+ATE+R + 
Sbjct: 579 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSHFLSEAATELRDLL 626



>gi|240275840|gb|EER39353.1| carnitine acetyl transferase [Ajellomyces capsulatus H143]
          Length = 622

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 202/288 (70%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V  +I NN++D+ +P +RS LP PQ +HF L
Sbjct: 322 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNYMIFNNRLDYSNPEIRSTLPDPQPIHFEL 381

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + L  I+ A   +   I +H+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 382 NKQALDDIATASHAFTTVIGQHELRVQAFQGYGKGLIKKFKCSPDAYVQMVIQLAYFKMY 441

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + ++  D  V  E   +    A+ AH K
Sbjct: 442 GKNRPTYESASTRKFQLGRTETTRSVSDESVAFCRSHADINVTREQVVKNFRAALAAHTK 501

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   EK P +F DPAY+ S+ W +S+SQLSSEYF GYGW
Sbjct: 502 YTADASVGKGVDRHLFGLKKLIADGEKVPALFQDPAYSYSSTWFISSSQLSSEYFNGYGW 561

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 562 SQVVDDGFGIAYMINENSIQFNIVCKKLGAERMSFYLNEAACEIRELL 609



>gi|451993441|gb|EMD85914.1| hypothetical protein COCHEDRAFT_1186893 [Bipolaris maydis C5]
 gi|477584825|gb|ENI01915.1| hypothetical protein COCC4DRAFT_175602 [Bipolaris maydis ATCC
           48331]
          Length = 608

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 208/303 (68%), Gaps = 5/303 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ ENG +GF GEHS MDGTPT RLND+    I +N +    PN+RS LP P+ L F L
Sbjct: 310 FIINENGTSGFMGEHSMMDGTPTHRLNDYANQQIFSNALPFDDPNIRSDLPSPKPLRFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+   I +A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 370 NRELQQDIEEAQSHFSRQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMED-QKVPIEVKAELGYKAINAHV 179
           G N+ TYESA TR+FQ GRTE CR+VS +SV +  AM D    P E + +L   A++AHV
Sbjct: 430 GKNRPTYESAATRRFQQGRTETCRSVSDESVAFCNAMADANATPEECQQKLR-AALDAHV 488

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  LK  E+ P ++ DPA+  S+ W +S+SQLSSEYF GYG
Sbjct: 489 KYISDASDGRGVDRHLFGLKKCLKEGEELPALYKDPAFTYSSTWYISSSQLSSEYFNGYG 548

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIK 299
           W +V+ DG+G+AYMIN +S+ FN+ S  L +D +  YL E+A +MR +      KA   K
Sbjct: 549 WSQVIDDGWGLAYMINENSIQFNVCSKGLGSDKMSFYLNEAAGDMRDIMMPTLDKA---K 605

Query: 300 AKL 302
           AKL
Sbjct: 606 AKL 608



>gi|336268114|ref|XP_003348822.1| hypothetical protein SMAC_01845 [Sordaria macrospora k-hell]
 gi|380094080|emb|CCC08297.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 609

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 211/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG AGF GEHS MDGTPT RLNDFV +VI NNK+D   P+VRS LP P+ + F +
Sbjct: 311 FIVNDNGTAGFMGEHSMMDGTPTHRLNDFVNDVIFNNKLDFSDPSVRSNLPEPEAVKFTV 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV + I +A  ++ + I +H L V AY+GYGK +IKK   SPDA+VQMIIQLAYYKMY
Sbjct: 371 TKEVQAEIDRAVTDFTNVIGQHQLAVQAYQGYGKGLIKKFKCSPDAFVQMIIQLAYYKMY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS  SV + KA  D  V  + K EL  KAI++H++
Sbjct: 431 GKNRPTYESAATRRFQQGRTETCRSVSEASVAFCKAANDASVNDKTKVELFRKAIDSHLE 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  ++ P ++ DPAY+ S+ W LSTSQLSSE+F GYGW
Sbjct: 491 YISAASDGKGVDRHLFGLKRLLEPGQEVPALYQDPAYSYSSSWYLSTSQLSSEFFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +SLNFNIVS  L +D + +YL E+A ++R + 
Sbjct: 551 SQVIDQGFGIAYMINENSLNFNIVSKGLGSDRMSYYLNEAANDLRDLL 598



>gi|425765352|gb|EKV04050.1| Carnitine acetyl transferase [Penicillium digitatum Pd1]
 gi|425766783|gb|EKV05380.1| Carnitine acetyl transferase [Penicillium digitatum PHI26]
          Length = 610

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 196/288 (68%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RLND++ NVI N K+D  + +VRS L  P+ ++F L
Sbjct: 310 FIINDNGTAGFTGEHSMMDGTPTHRLNDYINNVIFNKKIDLSAQSVRSQLADPKPINFKL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
                 AI+ A   +   I  H+L V AY+GYGK +IKK   SPDA+VQM IQLAY+KMY
Sbjct: 370 DDAANEAINVAAVYHRKQIGSHELVVQAYQGYGKGLIKKFKCSPDAFVQMTIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK+  GRTE  R+VS +SV + KA ED   P E    L   A+  H K
Sbjct: 430 GKNRPTYESASTRKYAEGRTETTRSVSDESVAFCKAHEDHTTPREETVRLFRAALAQHTK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y  EA  G G DRHLFGL+  L+  E+ P I+ DPAYA S+ W LSTSQLSSEYF GYGW
Sbjct: 490 YTQEASSGHGVDRHLFGLKKLLQPGERLPEIYQDPAYAYSSSWYLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ DG+GIAYMIN +SLNFNIV  RL  + + HYL E+ATE+R + 
Sbjct: 550 SQVIDDGFGIAYMINENSLNFNIVCKRLGAERMSHYLNEAATELRDLL 597



>gi|189198249|ref|XP_001935462.1| carnitine O-acetyltransferase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187981410|gb|EDU48036.1| carnitine O-acetyltransferase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 607

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 201/289 (69%), Gaps = 2/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG +GF GEHS MDGTPT RLND+    I  N +    PNVRS LP P+ L F +
Sbjct: 309 FIVNENGTSGFMGEHSMMDGTPTHRLNDYANQQIFTNALPFDDPNVRSDLPNPKPLRFEI 368

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E+   I  A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 369 SKELQQDIEDAQAHFARQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 428

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMED-QKVPIEVKAELGYKAINAHV 179
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM D    P E + +L   AI+AHV
Sbjct: 429 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFCAAMADANATPEECQQKL-RAAIDAHV 487

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  LK  E+ P ++ DPAY  S+ W +S+SQLSSEYF GYG
Sbjct: 488 KYISDASDGRGVDRHLFGLKKCLKEGEELPALYQDPAYTYSSTWFVSSSQLSSEYFNGYG 547

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           W +VV DG+GIAYMIN +++ FN+ S  L ++ +  YL E+A +MR + 
Sbjct: 548 WSQVVDDGWGIAYMINENTIQFNVCSKGLGSEKMSFYLNEAAGDMRDIM 596



>gi|396487497|ref|XP_003842655.1| similar to carnitine O-acetyltransferase [Leptosphaeria maculans
           JN3]
 gi|312219232|emb|CBX99176.1| similar to carnitine O-acetyltransferase [Leptosphaeria maculans
           JN3]
          Length = 609

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 205/298 (68%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+    I  N +    PNVRS LP P+ L F +
Sbjct: 311 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYANQQIFTNALPFDDPNVRSDLPNPKPLRFEI 370

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T ++   I+ A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 371 TKDLEQDITAAQLHFAQQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 430

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM D     E   +L   AI+AHV+
Sbjct: 431 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFTAAMADPNATPEQCQKLLRAAIDAHVR 490

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+++A +GRG DRHLFGL+  L++ E  P ++ DPAY  S+ W +S+SQLSSEYF GYGW
Sbjct: 491 YISDASDGRGVDRHLFGLKKCLQAGEPVPALYEDPAYTYSSTWFISSSQLSSEYFNGYGW 550

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF----EYAQAK 294
            +VV DG+GIAYMIN +S+ FN+ S  L ++ +  YL E+A +MR +     E A+AK
Sbjct: 551 SQVVDDGWGIAYMINENSIQFNVCSKGLGSEKMSFYLNEAAGDMRDLMMPTVEPAKAK 608



>gi|225563252|gb|EEH11531.1| carnitine acetyl transferase [Ajellomyces capsulatus G186AR]
          Length = 641

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 201/288 (69%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V  +I NN++D+ +P +RS LP PQ +HF L
Sbjct: 341 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNYMIFNNRLDYSNPEIRSTLPDPQPIHFEL 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + L  I+ A   +   I +H+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 401 NKQALDDIATASHAFTTVIGQHELRVQAFQGYGKGLIKKFKCSPDAYVQMVIQLAYFKMY 460

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + ++  D  V  E   +    A+ AH K
Sbjct: 461 GKNRPTYESASTRKFQLGRTETTRSVSDESVAFCRSHADINVTREQVVKNFRAALAAHTK 520

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   E  P +F DPAY+ S+ W +S+SQLSSEYF GYGW
Sbjct: 521 YTADASVGKGVDRHLFGLKKLIADGENVPALFQDPAYSYSSTWFISSSQLSSEYFNGYGW 580

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 581 SQVVDDGFGIAYMINENSIQFNIVCKKLGAERMSFYLNEAACEIRELL 628



>gi|494826657|gb|EON63713.1| carnitine O-acetyltransferase [Coniosporium apollinis CBS 100218]
          Length = 610

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++ +NG +GF GEHS MDGTPT RLND+    I  NK+D  +PNVRS LP P  ++F +
Sbjct: 312 FVINDNGTSGFIGEHSMMDGTPTHRLNDYANATIFGNKLDFDNPNVRSSLPEPVPVNFKI 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            +E+   + +A+++++  I +H+LRV AY+GYGK +IKK   SPDAYVQM+IQLAY+K Y
Sbjct: 372 DAELQDDLLEAQRHFEKQIGQHELRVQAYQGYGKGLIKKFKCSPDAYVQMLIQLAYHKFY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV + +AM +  V  E   +L   A+  HV+
Sbjct: 432 GRNRPTYESAATRRFQQGRTETCRTVSDESVAFCEAMANPDVTPEDCVKLFRDALKMHVQ 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+++A +GRG DRHLFGL+  LK  E+ P I+ DPAY  S+ W +S+SQLSSEYF GYGW
Sbjct: 492 YISDASDGRGVDRHLFGLKKCLKKGEEVPEIYNDPAYTYSSTWFISSSQLSSEYFNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +S+ FNIVS  L  D +  +L E+A E+R + 
Sbjct: 552 SQVIDEGWGIAYMINENSIQFNIVSKGLGADRMAFWLSEAANEIRDLL 599



>gi|330932707|ref|XP_003303880.1| hypothetical protein PTT_16269 [Pyrenophora teres f. teres 0-1]
 gi|311319833|gb|EFQ88024.1| hypothetical protein PTT_16269 [Pyrenophora teres f. teres 0-1]
          Length = 607

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/289 (53%), Positives = 201/289 (69%), Gaps = 2/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG +GF GEHS MDGTPT RLND+    I  N +    PNVRS LP P+ L F +
Sbjct: 309 FIVNENGTSGFMGEHSMMDGTPTHRLNDYANQQIFTNALPFDDPNVRSDLPNPKPLRFEI 368

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E+   I  A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 369 SKELQQDIEDAQAHFTRQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 428

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMED-QKVPIEVKAELGYKAINAHV 179
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM D    P E + +L   A++AHV
Sbjct: 429 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFCAAMADANATPEECQKKL-RAALDAHV 487

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  LK  E+ P ++ DPAY  S+ W +S+SQLSSEYF GYG
Sbjct: 488 KYISDASDGRGVDRHLFGLKKCLKEGEELPALYQDPAYTYSSTWFISSSQLSSEYFNGYG 547

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           W +V+ DG+GIAYMIN +++ FN+ S  L ++ +  YL E+A +MR + 
Sbjct: 548 WSQVIDDGWGIAYMINENTIQFNVCSKGLGSEKMSFYLNEAAGDMRDIM 596



>gi|346325058|gb|EGX94655.1| carnitine O-acetyltransferase [Cordyceps militaris CM01]
          Length = 755

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 207/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V ++I NNK+D     VRS LP PQ LHF++
Sbjct: 457 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVGDLIFNNKLDLSEVPVRSDLPEPQPLHFDI 516

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T  V + I +A  ++   I +H L V A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 517 TPAVQTEIDRAVADFKRVIGEHQLAVQAFQGYGKGLIKKFKCSPDAYVQMLIQLAYFKMY 576

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRT+S DS NW K M D  V  + K +L +KAI  H++
Sbjct: 577 GKNRPTYESAATRRFQLGRTETCRTLSEDSANWCKVMADASVDDKTKVDLFHKAIKGHLE 636

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ D AYA S+ W +S+SQLSSEYF GYGW
Sbjct: 637 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYKDSAYAYSSSWYISSSQLSSEYFNGYGW 696

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN DS+NFNIVS  L +D +  YL E+A +MR++ 
Sbjct: 697 SQVIDGGFGIAYMINEDSINFNIVSKGLGSDRMSFYLNEAAVDMRELL 744



>gi|367045362|ref|XP_003653061.1| hypothetical protein THITE_2115063 [Thielavia terrestris NRRL 8126]
 gi|347000323|gb|AEO66725.1| hypothetical protein THITE_2115063 [Thielavia terrestris NRRL 8126]
          Length = 611

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 211/288 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V +VI NNK+D   P+VRS LP PQ + F +
Sbjct: 313 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVNDVIFNNKLDFSDPSVRSNLPEPQPIRFVV 372

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T  V + I +A +++ + I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 373 TKAVQAEIDRAVRDFGNVIGQHQLAVQAYQGYGKGLIKKFRCSPDAYVQMIIQLAYFKMY 432

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W +AM D+ V    +  L  KA++AH++
Sbjct: 433 GKNRPTYESAATRRFQLGRTETCRSVSEESVAWCRAMADESVDNATRVALFRKALDAHLE 492

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHL GL+  L+  ++ P ++ DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 493 YISAASDGKGVDRHLLGLKRLLEPGQELPALYKDPAYSYSSSWYLSTSQLSSEYFNGYGW 552

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+ +G+GIAYMIN +S+NFNIVS  L +D +  YL E+A +MR + 
Sbjct: 553 SQVIDEGFGIAYMINENSINFNIVSKNLGSDKMSFYLNEAAGDMRDML 600



>gi|501752124|emb|CCG83848.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 633

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 156/291 (53%), Positives = 209/291 (71%), Gaps = 4/291 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG +GF GEHS MDGTPT RLND+VC+ I   ++DHG    +S LP P+++ F  
Sbjct: 335 FIVCENGASGFLGEHSMMDGTPTHRLNDYVCHAIKTGQLDHGHAVAQSALPEPEEISFKT 394

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           ++E+   I  A+  ++     HDLRV+ Y+GYGKN+IKK  +SPD++VQMIIQLAYYKMY
Sbjct: 395 STEIKEHIESAKVQFNALKDSHDLRVMNYQGYGKNLIKKFKSSPDSFVQMIIQLAYYKMY 454

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAME--DQKVPIEVKAELGYKAINAH 178
           G ++ TYESA TR+FQHGRTE CRTVS ++V + +  +  D  V  ++ A  G  AI +H
Sbjct: 455 GVSRPTYESAATRRFQHGRTETCRTVSEETVKFCQTFQAADSTVAEQIAAFRG--AIASH 512

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
            +Y+  A  G G DRHLFGL+  +    + P I+ DPA++ S+ W +S+SQLSSEYF GY
Sbjct: 513 GEYINAASAGYGVDRHLFGLKQLVPKGGELPAIYKDPAFSYSSSWYISSSQLSSEYFNGY 572

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           GWGEV+P+G+GIAYMINN+S+NFN+VS  L  D + HYL+E+A EMR+V E
Sbjct: 573 GWGEVIPEGFGIAYMINNNSINFNVVSRHLGCDKMQHYLREAADEMREVLE 623



>gi|259479509|tpe|CBF69795.1| TPA: hypothetical protein similar to carnitine acetyl transferase
           (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 644

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 210/302 (69%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDG+PT RLND +  +I NNK+D  +  VRS LP P+ + F+L
Sbjct: 344 FIVNENGTAGFMGEHSMMDGSPTHRLNDHLNALIFNNKIDLSAKPVRSNLPDPRPIDFHL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV  AI  A K +   IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 404 NEEVQEAIDVAAKEHRQQIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF  GRTE  RTVS +SV + KA+ +  VP E    L   A+ AH K
Sbjct: 464 GKNRPTYESASTRKFAEGRTETIRTVSDESVAFCKAITNSSVPREEAVRLFRTALAAHSK 523

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +G+G DRHLFGL+  ++  E  P IF+DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 524 YTAEASDGKGVDRHLFGLKKLVREGEPLPAIFSDPAYSYSSSWYLSTSQLSSEYFNGYGW 583

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + +YL E+A ++R +     A   + KA
Sbjct: 584 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAAGDIRDMLMPDLAAEAE-KA 642

Query: 301 KL 302
           KL
Sbjct: 643 KL 644



>gi|345563481|gb|EGX46481.1| hypothetical protein AOL_s00109g53 [Arthrobotrys oligospora ATCC
           24927]
          Length = 651

 Score =  319 bits (818), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 209/289 (72%), Gaps = 1/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RLND++ + I NNK+D G  +VRS LP P+ + F L
Sbjct: 354 FIINDNGTAGFMGEHSMMDGTPTHRLNDYINDQIFNNKLDFGG-SVRSHLPEPKAVKFTL 412

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV  AI  AE ++ D I  H+LRV  Y+GYGK +IKK   SPDAYVQMIIQLAY KMY
Sbjct: 413 NKEVEQAIDAAEAHFADLIGLHELRVQQYQGYGKGLIKKFKCSPDAYVQMIIQLAYKKMY 472

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE CR+VS +SV +  A+ D +V  +   EL  KAINAHVK
Sbjct: 473 GKNRPTYESAATRKFQQGRTETCRSVSDESVAFCNAITDPEVDDKTARELFRKAINAHVK 532

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+AEA EG+G DRHL+GL+  LK  E+ P I+ DP Y+ S+ W LSTSQLSSEYF GYGW
Sbjct: 533 YIAEASEGKGVDRHLWGLKQLLKPGEEVPAIYQDPTYSYSSSWYLSTSQLSSEYFNGYGW 592

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
            +V+  G+GIAYMIN +S+ FN+VS +L  + +  YL+++A ++R + E
Sbjct: 593 SQVIDGGWGIAYMINENSIQFNVVSKKLGAERMSFYLRDAADDLRTLME 641



>gi|400596340|gb|EJP64114.1| putative carnitine O-acetyltransferase precursor [Beauveria
           bassiana ARSEF 2860]
          Length = 606

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 205/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+V ++I NNK+D     +RS LP PQ L F +
Sbjct: 308 FIINDNGTSGFMGEHSMMDGTPTHRLNDYVGDLIFNNKLDLSEAPIRSDLPEPQVLRFEI 367

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           TS V + I +A  ++   I +H L V A++GYGK +IKK   SPDAYVQM+IQ AY+KMY
Sbjct: 368 TSAVQAEIDRAVTDFKRVIGEHQLAVQAFQGYGKGLIKKFKCSPDAYVQMLIQYAYFKMY 427

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRT+S +S NW K+M D  V  + K EL +KAI  H++
Sbjct: 428 GKNRPTYESAATRRFQLGRTETCRTLSEESSNWCKSMADASVDDKTKIELFHKAIKGHLE 487

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  ++ P I+ D A+A S+ W +S+SQLSSEYF GYGW
Sbjct: 488 YITAASDGKGVDRHLFGLKKLLEPGQEVPAIYKDSAFAYSSSWYISSSQLSSEYFNGYGW 547

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN DS+NFNIVS  L +D +  YL E+A EMR + 
Sbjct: 548 SQVIDGGFGIAYMINEDSINFNIVSKGLGSDRMSFYLNEAACEMRDLL 595



>gi|67540218|ref|XP_663883.1| hypothetical protein AN6279.2 [Aspergillus nidulans FGSC A4]
 gi|40739473|gb|EAA58663.1| hypothetical protein AN6279.2 [Aspergillus nidulans FGSC A4]
          Length = 610

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 210/302 (69%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDG+PT RLND +  +I NNK+D  +  VRS LP P+ + F+L
Sbjct: 310 FIVNENGTAGFMGEHSMMDGSPTHRLNDHLNALIFNNKIDLSAKPVRSNLPDPRPIDFHL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV  AI  A K +   IA H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 370 NEEVQEAIDVAAKEHRQQIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKF  GRTE  RTVS +SV + KA+ +  VP E    L   A+ AH K
Sbjct: 430 GKNRPTYESASTRKFAEGRTETIRTVSDESVAFCKAITNSSVPREEAVRLFRTALAAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y AEA +G+G DRHLFGL+  ++  E  P IF+DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 490 YTAEASDGKGVDRHLFGLKKLVREGEPLPAIFSDPAYSYSSSWYLSTSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+GIAYMIN +SLNFNIV  R+  + + +YL E+A ++R +     A   + KA
Sbjct: 550 SQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAAGDIRDMLMPDLAAEAE-KA 608

Query: 301 KL 302
           KL
Sbjct: 609 KL 610



>gi|482809441|gb|EOA86263.1| hypothetical protein SETTUDRAFT_110413 [Setosphaeria turcica Et28A]
          Length = 640

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/289 (53%), Positives = 201/289 (69%), Gaps = 2/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG +GF GEHS MDGTPT RLND+    I +N +    P+VRS LP P+ L F L
Sbjct: 342 FIINDNGTSGFMGEHSMMDGTPTHRLNDYANQQIFSNALPFDDPSVRSDLPNPKPLRFEL 401

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+   I  A+ ++   I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K Y
Sbjct: 402 TKELEQDIVDAQAHFARQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKFY 461

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKV-PIEVKAELGYKAINAHV 179
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM +    P E + +L   A++AHV
Sbjct: 462 GKNRPTYESAATRRFQQGRTETCRTVSDESVAFCNAMANPDASPQECQQKLR-AALDAHV 520

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  L+  E  P +F D AYA S+ W +S+SQLSSEYF GYG
Sbjct: 521 KYISDASDGRGVDRHLFGLKKCLQPGEDVPALFKDAAYAYSSTWYISSSQLSSEYFNGYG 580

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           W +VV DG+G+AYMIN +S+ FN+ S  L +D +  YL E+A +MR + 
Sbjct: 581 WSQVVDDGWGLAYMINENSIQFNVCSKGLGSDKMSFYLNEAAGDMRDIM 629



>gi|77732544|gb|AAB88887.2| carnitine acetyl transferase [Magnaporthe grisea]
          Length = 614

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V + I NNK+D   P+VRSGLP P  + F +
Sbjct: 316 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDAIVNNKLDFSDPSVRSGLPDPSPVRFTV 375

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+ S I +A++++D  I +H+L V +Y+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 376 NEELQSEIDRAKRDFDAVIGQHELAVQSYQGYGKGLIKKFRCSPDAYVQMVIQLAYHKMY 435

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  AM D       K +L   AI++HV+
Sbjct: 436 GKNRPTYESAATRRFQQGRTETCRSVSEESVAWCNAMADASAQDADKVKLFRAAIDSHVE 495

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  +  P I+ DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 496 YITAASDGKGVDRHLFGLKRLLEPGQAVPEIYQDPAYSYSSSWYLSTSQLSSEYFNGYGW 555

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  +  YL E+A +MR + 
Sbjct: 556 SQVIDAGFGIAYMINENSINFNIVSKGLASQRMSFYLNEAAGDMRDLL 603



>gi|389634131|ref|XP_003714718.1| carnitine O-acetyltransferase [Magnaporthe oryzae 70-15]
 gi|351647051|gb|EHA54911.1| carnitine O-acetyltransferase [Magnaporthe oryzae 70-15]
          Length = 649

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V + I NNK+D   P+VRSGLP P  + F +
Sbjct: 351 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDAIVNNKLDFLDPSVRSGLPDPSPIRFTV 410

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+ S I +A++++D  I +H+L V +Y+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 411 NEELQSEIDRAKRDFDAVIGQHELAVQSYQGYGKGLIKKFRCSPDAYVQMVIQLAYHKMY 470

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  AM D       K +L   AI++HV+
Sbjct: 471 GKNRPTYESAATRRFQQGRTETCRSVSEESVAWCNAMADASAQDADKVKLFRAAIDSHVE 530

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  +  P I+ DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 531 YITAASDGKGVDRHLFGLKRLLEPGQAVPEIYKDPAYSYSSSWYLSTSQLSSEYFNGYGW 590

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  +  YL E+A +MR + 
Sbjct: 591 SQVIDAGFGIAYMINENSINFNIVSKGLASQRMSFYLNEAAGDMRDLL 638



>gi|302688589|ref|XP_003033974.1| hypothetical protein SCHCODRAFT_15006 [Schizophyllum commune H4-8]
 gi|300107669|gb|EFI99071.1| hypothetical protein SCHCODRAFT_15006 [Schizophyllum commune H4-8]
          Length = 622

 Score =  316 bits (810), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 153/289 (52%), Positives = 197/289 (68%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVF+NG++GF GEHS MDGTPT R+N+ V   +A  K D G       LP P QL F L
Sbjct: 318 LIVFDNGRSGFLGEHSCMDGTPTLRMNESVLASLALGKADLGPSEPSPSLPEPTQLKFTL 377

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             EV SAI  +EK +D+ +  HDL VL YEGYGKN IKK  ASPDA+ Q++ QLA+ KMY
Sbjct: 378 NDEVKSAIKASEKRFDELVGAHDLYVLHYEGYGKNAIKKYKASPDAWAQLVKQLAFQKMY 437

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G    TYESAQTRK+Q GRTEV R+ S +S  W +AM D +     +A+L   A+  H++
Sbjct: 438 GRPAVTYESAQTRKYQLGRTEVIRSASNESKAWTEAMADPERSDVERAKLFRAAVARHLQ 497

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  LK  E  P I+ DPA+A+++HW LSTSQLSS YF+G+G+
Sbjct: 498 YAAWAADGQGVDRHLFGLKKVLKEGEDLPAIYKDPAFARTSHWELSTSQLSSPYFEGWGY 557

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           GEVVPDGYG++Y I +D + + I SL+ N   L HYL E+ATE R + +
Sbjct: 558 GEVVPDGYGLSYAIGDDYIRWTITSLKRNTAELRHYLAEAATETRVMMD 606



>gi|440484718|gb|ELQ64749.1| carnitine O-acetyltransferase [Magnaporthe oryzae P131]
          Length = 614

 Score =  316 bits (809), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 206/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V + I NNK+D   P+VRSGLP P  + F +
Sbjct: 316 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDAIVNNKLDFLDPSVRSGLPDPSPIRFTV 375

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+ S I +A++++D  I +H+L V +Y+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 376 NEELQSEIDRAKRDFDAVIGQHELAVQSYQGYGKGLIKKFRCSPDAYVQMVIQLAYHKMY 435

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  AM D       K +L   AI++HV+
Sbjct: 436 GKNRPTYESAATRRFQQGRTETCRSVSEESVAWCNAMADASAQDADKVKLFRAAIDSHVE 495

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  +  P I+ DPAY+ S+ W LSTSQLSSEYF GYGW
Sbjct: 496 YITAASDGKGVDRHLFGLKRLLEPGQAVPEIYKDPAYSYSSSWYLSTSQLSSEYFNGYGW 555

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  +  YL E+A +MR + 
Sbjct: 556 SQVIDAGFGIAYMINENSINFNIVSKGLASQRMSFYLNEAAGDMRDLL 603



>gi|471884104|emb|CCO33850.1| carnitine O-acetyltransferase [Rhizoctonia solani AG-1 IB]
          Length = 344

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 202/303 (66%), Gaps = 4/303 (1%)

Query: 2   IVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNLT 61
           IV+ENGK+GF GEHS MDGTPT R+N+FV   +A  KVDHGS  V S LP P+++ F L 
Sbjct: 42  IVYENGKSGFLGEHSCMDGTPTLRMNEFVLAALAKGKVDHGSATVSSNLPTPKEITFELD 101

Query: 62  SEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMYG 121
           S   S I  A KN++  + +HDL VL YEGYGK  IK   ASPDA+ QM+ QLA++KM+ 
Sbjct: 102 STSKSHIQTATKNFNTLVGQHDLHVLHYEGYGKAAIKTYKASPDAWAQMVKQLAFHKMFN 161

Query: 122 TNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVKY 181
                YES QTRKF+ GRTEV R+ SV S  W +AM D  V    + +L   A+  H+ Y
Sbjct: 162 RPGVCYESCQTRKFKRGRTEVIRSASVQSGEWSRAMLDPNVDDITRHDLFRAALKQHLTY 221

Query: 182 MAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGWG 241
              A +G+G DRHLFGL+  +K  E  P I+TDP+Y KS HW LSTSQLSS+YF G+G+G
Sbjct: 222 AGWAADGQGVDRHLFGLKKLIKEGEPVPEIYTDPSYGKSNHWELSTSQLSSDYFDGWGYG 281

Query: 242 EVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYA----QAKAGQ 297
           EVVPDGYG++Y I ++ + +   SL+ +  VL HYL E+ATE +Q+ + A     A+ GQ
Sbjct: 282 EVVPDGYGLSYSIADNYIRWTATSLKRDTAVLKHYLAEAATETKQMMDRAAKAIAARDGQ 341

Query: 298 IKA 300
            +A
Sbjct: 342 KQA 344



>gi|358057937|dbj|GAA96182.1| hypothetical protein E5Q_02846 [Mixia osmundae IAM 14324]
          Length = 652

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 153/302 (50%), Positives = 213/302 (70%), Gaps = 1/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVFENGK+GFNGEHS MDGTPTSRLND++   +A  K+D G+   +  LP PQQ+  +L
Sbjct: 352 LIVFENGKSGFNGEHSCMDGTPTSRLNDWLLRSLAAGKIDLGARTAQHDLPAPQQVKISL 411

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            +   +AI+KA K++ + ++KH L VL YEGYGKN IKK   SPD++ Q+++QLAY+KM 
Sbjct: 412 DTTAKTAIAKAIKDHSELMSKHRLTVLHYEGYGKNAIKKFKTSPDSWTQLVMQLAYFKMT 471

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G+   TYESAQTRK++ GRTEV R+ + +++ W KAMED  V    + EL  +A  AHVK
Sbjct: 472 GSLAPTYESAQTRKYKLGRTEVIRSATPEALAWCKAMEDPTVSNPRRLELLRRAGAAHVK 531

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A +G+G DRHLFGL+  LK  E+ P ++ DP+Y+ S HW LSTSQLSSE F  +G+
Sbjct: 532 YATWAADGQGVDRHLFGLKKCLKEGEELPELYNDPSYSLSGHWILSTSQLSSELFDCWGY 591

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            EVVPDGYG+AY +NN++L F I S+  + + L +++ E+ATE+ +  + A  + G+ +A
Sbjct: 592 SEVVPDGYGLAYSVNNNTLRFCITSMTGDVERLRYFIAEAATEVMETMQEA-IEEGEGRA 650

Query: 301 KL 302
           KL
Sbjct: 651 KL 652



>gi|50546493|ref|XP_500716.1| YALI0B10340p [Yarrowia lipolytica]
 gi|49646582|emb|CAG82961.1| YALI0B10340p [Yarrowia lipolytica CLIB122]
          Length = 607

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/302 (51%), Positives = 207/302 (68%), Gaps = 4/302 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +N  +GF GEHS MDGTPT RLND+VC+V+ N+KV+  + N R GL  P+++ FNL
Sbjct: 310 FIVNDNATSGFMGEHSMMDGTPTHRLNDYVCDVMFNDKVEFSTSN-RGGLAAPEEVKFNL 368

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            SE+   I K+E ++   I +H+L V  Y GYGKN+IKK  ASPDA++QMIIQLAY+KM+
Sbjct: 369 NSEIEQGIKKSEADFASVIGEHELAVFQYHGYGKNLIKKFKASPDAFMQMIIQLAYFKMF 428

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G NK TYESA  R+FQ GRTE CR+VS ++V + KA          K      A NAHVK
Sbjct: 429 GKNKPTYESAAVRRFQQGRTETCRSVSDEAVAFCKAFTSDTATNAEKVAAARAAFNAHVK 488

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+ +A  G+G DRHLFGL+  LK  EK P IF D  Y  S +W LSTSQLSS+YF GYGW
Sbjct: 489 YIGDASAGKGVDRHLFGLKKCLKEGEKVPQIFQDKMYGYSCNWYLSTSQLSSDYFNGYGW 548

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+G+AYMIN++SL  N VS +L ++ + ++L E+A +M+  FE    +  + KA
Sbjct: 549 SQVIDDGFGLAYMINSNSLQVNCVSKKLGSEKMRYFLTEAAEDMKIAFE---TELAEPKA 605

Query: 301 KL 302
           KL
Sbjct: 606 KL 607



>gi|378731534|gb|EHY57993.1| carnitine O-acetyltransferase [Exophiala dermatitidis NIH/UT8656]
          Length = 622

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 198/288 (68%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ +NG AGF GEHS MDGTPT RL D V   I +NK+D  +PNVRS LP P  L F  
Sbjct: 317 FIITDNGTAGFMGEHSMMDGTPTHRLCDTVNAYIVHNKLDFDNPNVRSDLPDPTPLKFET 376

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           ++ V   ++ A+  +   IA HDLRV AY+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 377 SAAVFEDLANAQAQFRQVIAAHDLRVQAYQGYGKGLIKKFKCSPDAYVQMVIQLAYHKMY 436

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRK+Q GRTE  RTVS +SV +  AM D  V  E    L   A+ AHV+
Sbjct: 437 GKNRPTYESAATRKYQLGRTETTRTVSDESVAFCDAMADPSVSREECERLFRAAVKAHVE 496

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A EG G DRHLFGL+  ++  E+ P ++ DPAY+ S+ W +S+SQLSSEYF GYGW
Sbjct: 497 YTAAAGEGYGVDRHLFGLKKLIQEGEEVPELYKDPAYSYSSTWYISSSQLSSEYFNGYGW 556

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV  G+GIAYMIN +SL FN+VS +L  + +  +L E+A ++R + 
Sbjct: 557 SQVVDQGWGIAYMINENSLQFNVVSKKLGCERMSFFLNEAANDIRDML 604



>gi|449300625|gb|EMC96637.1| hypothetical protein BAUCODRAFT_34012 [Baudoinia compniacensis UAMH
           10762]
          Length = 645

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 205/291 (70%), Gaps = 6/291 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GFNGEHS MDGTPT RLND + + I NNK+D   P+VRS LP PQ + F L
Sbjct: 348 FIVNDNGTSGFNGEHSMMDGTPTHRLNDTIMDWIFNNKLDFDQPDVRSDLPNPQPIKFQL 407

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E  + I+ A  ++   + +H+LRV AY+GYGK ++KK   SPDAYVQMIIQLAY+K Y
Sbjct: 408 NGENYADIALAMTHHVGLMTQHELRVEAYQGYGKGLMKKFKCSPDAYVQMIIQLAYHKFY 467

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAE---LGYKAINA 177
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  A+     P+   AE   L  KAINA
Sbjct: 468 GKNRPTYESAATRRFQEGRTETCRTVSDESVAFCDAIAH---PLATDAECRDLFRKAINA 524

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV+Y+ +A +G+G DRHLFGL+  +K  E+ P ++ DPAY  S+ W +S+SQLSSEY+ G
Sbjct: 525 HVQYITDASDGKGVDRHLFGLKKLIKEGEEVPDLYKDPAYTYSSTWFISSSQLSSEYYNG 584

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           YGW +VV DG+G+AYMIN +S+ FNIVS  L  + +  +L E+A ++R + 
Sbjct: 585 YGWSQVVDDGWGMAYMINENSVQFNIVSKNLGCERMAFFLNEAAGDIRDIM 635



>gi|471559247|gb|EMR61693.1| putative carnitine acetyl transferase protein [Eutypa lata UCREL1]
          Length = 615

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 158/289 (54%), Positives = 202/289 (69%), Gaps = 1/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKV-DHGSPNVRSGLPVPQQLHFN 59
           F+V +NG +GF GEHS MDGTPT RLND+V  VI  NK+ D   P VRS L  P  + F 
Sbjct: 316 FVVNDNGTSGFLGEHSMMDGTPTHRLNDYVNEVIFGNKLADLSDPAVRSNLADPAPVTFE 375

Query: 60  LTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKM 119
           +T+EV + I +A +++   I +H+L V AY+GYGK +IKK   SPDAYVQ++IQLAY+KM
Sbjct: 376 VTAEVQAEIDRATRDFGAVIGQHELAVQAYQGYGKGLIKKFRTSPDAYVQLVIQLAYHKM 435

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           +G N+ TYESA TR+FQ GRTE CR+VS DSV +  AM D       + EL  KA  AH+
Sbjct: 436 HGRNRPTYESAATRRFQLGRTETCRSVSDDSVAFCSAMADSAAADSDRIELFRKAAAAHI 495

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           +Y++ A EG+G DRHLFGL+  L+  E  P I+ DPAY  ST W LSTSQLSSEYF GYG
Sbjct: 496 EYISAASEGKGVDRHLFGLKRLLEPGEDLPAIYKDPAYGYSTSWFLSTSQLSSEYFNGYG 555

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           W +V+  G+GIAYMIN +SLNFNIVS  L    + HYL+E+A ++R + 
Sbjct: 556 WSQVIDQGFGIAYMINENSLNFNIVSKGLGCQKMSHYLREAADDIRDLL 604



>gi|443916683|gb|ELU37664.1| carnitine acetyl transferase [Rhizoctonia solani AG-1 IA]
          Length = 810

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 202/300 (67%), Gaps = 6/300 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV+ENGK+GF GEHS MDGTPT R+N+FV   +A  KVDHGS  V S LP P+++ F L
Sbjct: 502 LIVYENGKSGFLGEHSCMDGTPTLRMNEFVLASLAKGKVDHGSATVSSNLPAPKEITFEL 561

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S   S I  A KN++  + +HDL VL YEGYGK  IK   ASPDA+ QM+ QLA++KM+
Sbjct: 562 DSTSKSHIQTATKNFNTLVGQHDLHVLQYEGYGKAAIKTFKASPDAWAQMVKQLAFHKMF 621

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIE-----VKAELGYKAI 175
                 YES QTRKF+ GRTEV R+ SV S  W +AM D  V +       + +L   A+
Sbjct: 622 NRPGVCYESCQTRKFKRGRTEVIRSASVQSGEWARAMLDPNVDVRSVVDITRHDLFRAAL 681

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             H+ Y A A +G+G DRHLFGL+  ++  E  P I+ DP+Y+KS HW LSTSQLSS+YF
Sbjct: 682 KQHLTYAAWAADGQGVDRHLFGLKKLIREGEPVPEIYNDPSYSKSNHWELSTSQLSSDYF 741

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
            G+G+GEVVPDGYG++Y I+++ + +   SL+ +  VL HYL E+ATE +Q+ + A AKA
Sbjct: 742 DGWGYGEVVPDGYGLSYSISDNYIRWTATSLKRDTAVLKHYLAEAATETKQMMDRA-AKA 800



>gi|154281759|ref|XP_001541692.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150411871|gb|EDN07259.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 612

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 199/288 (69%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V  +I NN++D+ +P +RS LP PQ +HF L
Sbjct: 312 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNYMIFNNRLDYSNPEIRSTLPDPQPIHFEL 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + L  I+ A   +   I +H+LRV A++GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 372 NKQALDDIATASHAFTTVIGQHELRVQAFQGYGKGLIKKFKCSPDAYVQMVIQLAYFKMY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE  R+VS +SV + ++  D  V  E   +    A+ AH K
Sbjct: 432 GKNRPTYESASTRKFQLGRTETTRSVSDESVAFCRSHADINVTREQVVKNFRAALAAHTK 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   EK P +F DPAY+ S+ W +S++Q+SSEYF GYG 
Sbjct: 492 YTADASVGKGVDRHLFGLKKLIADGEKVPALFQDPAYSYSSTWFISSTQVSSEYFNGYGG 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMI   S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 552 SQVVDDGFGIAYMIKGKSIQFNIVCKKLGAERMSFYLNEAACEIRELL 599



>gi|452986277|gb|EME86033.1| hypothetical protein MYCFIDRAFT_88243 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 641

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 204/292 (69%), Gaps = 6/292 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GFNGEHS MDGTPT RLND V + I N K+D  +P  RS +P P  L F L
Sbjct: 344 FIVNDNGTSGFNGEHSMMDGTPTHRLNDTVMHWIFNEKLDFENPEFRSDIPDPMPLKFKL 403

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E  + I+ A  ++   I++H+LRV A++GYGK ++KK   SPDAYVQ+IIQLAY+K Y
Sbjct: 404 SGENYADIALATTHHVGLISQHELRVEAFQGYGKGLMKKFKCSPDAYVQLIIQLAYHKFY 463

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAE---LGYKAINA 177
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM+    P+   AE   L  KA++A
Sbjct: 464 GKNRPTYESAATRRFQEGRTETCRTVSDESVAFCSAMQH---PLSTDAECRDLFRKALSA 520

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H +Y+  A +G+G DRHLFGL+  L+S E  P IF DPAY  S+ W +S+SQLSSEY+ G
Sbjct: 521 HTEYITAASDGKGVDRHLFGLKKLLQSGEDTPEIFKDPAYTYSSTWFISSSQLSSEYYNG 580

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           YGW +V+ DG+GIAYMIN +S+ FNIVS  L  + +  YL E+A ++R V E
Sbjct: 581 YGWSQVIDDGWGIAYMINENSVQFNIVSKNLGCERMAFYLNEAAQDIRAVME 632



>gi|169605885|ref|XP_001796363.1| hypothetical protein SNOG_05975 [Phaeosphaeria nodorum SN15]
 gi|160706864|gb|EAT87039.2| hypothetical protein SNOG_05975 [Phaeosphaeria nodorum SN15]
          Length = 638

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 150/289 (51%), Positives = 201/289 (69%), Gaps = 1/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+    I  N +    PN+RS LP P+ L F++
Sbjct: 339 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYANQQIFTNALPFDDPNIRSDLPNPKPLRFDI 398

Query: 61  TSEVLSAISKAEKNYDDH-IAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKM 119
             ++   IS A+ ++  + I  H+LRV AY+GYGK +IKK   SPDAYVQMIIQLAY+K 
Sbjct: 399 NEQLKQDISDAQSHFSRYQIGAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYHKF 458

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           YG N+ TYESA TR+FQ GRTE CRTVS +SV +  AM       E   +L   A++AHV
Sbjct: 459 YGKNRPTYESAATRRFQQGRTETCRTVSDESVAFCAAMNGSDASPEECQKLFRAALDAHV 518

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           KY+++A +GRG DRHLFGL+  L++ E+ P ++ DPAY  S+ W +S+SQLSSEYF GYG
Sbjct: 519 KYISDASDGRGVDRHLFGLKKCLQAGEEVPALYQDPAYTYSSTWFISSSQLSSEYFNGYG 578

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           W +VV DG+G+AYMIN +S+ FN+ S  L ++ +  YL E+A ++R + 
Sbjct: 579 WSQVVDDGWGLAYMINENSIQFNVCSKGLGSEKMSFYLNEAAGDIRDMM 627



>gi|440471469|gb|ELQ40477.1| carnitine O-acetyltransferase [Magnaporthe oryzae Y34]
          Length = 614

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 205/288 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND+V + I NNK+D   P+VRSGLP P  + F +
Sbjct: 316 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYVNDAIVNNKLDFLDPSVRSGLPDPSPIRFTV 375

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             E+ S I +A++++D  I +H+L V +Y+GYGK +IKK   SPDAYVQM+IQLAY+KMY
Sbjct: 376 NEELQSEIDRAKRDFDAVIGQHELAVQSYQGYGKGLIKKFRCSPDAYVQMVIQLAYHKMY 435

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV W  AM D       K +L   AI++HV+
Sbjct: 436 GKNRPTYESAATRRFQQGRTETCRSVSEESVAWCNAMADASAQDADKVKLFRAAIDSHVE 495

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  +  P I+ DPAY+ S+ W LSTSQLSSE F GYGW
Sbjct: 496 YITAASDGKGVDRHLFGLKRLLEPGQAVPEIYKDPAYSYSSSWYLSTSQLSSECFNGYGW 555

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +V+  G+GIAYMIN +S+NFNIVS  L +  +  YL E+A +MR + 
Sbjct: 556 SQVIDAGFGIAYMINENSINFNIVSKGLASQRMSFYLNEAAGDMRDLL 603



>gi|395330795|gb|EJF63177.1| acyltransferase ChoActase/COT/CPT [Dichomitus squalens LYAD-421
           SS1]
          Length = 622

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 196/289 (67%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVFENGK+GF GEHS MDGTPT RLN+F+   +A  K+D       + L  PQ+L F L
Sbjct: 318 LIVFENGKSGFLGEHSCMDGTPTLRLNEFILASLAAGKIDLNGAGTNAELEPPQELQFTL 377

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             +    I++AE+N+D  +AKHDL VL YEGYGK  IK   ASPDA+ Q++ QLA++KM+
Sbjct: 378 DGKTREYIAQAEENFDALVAKHDLEVLHYEGYGKEYIKAFKASPDAWAQLVKQLAFHKMF 437

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
                 YESAQTRK+Q GRTEV R+ S +S  W +AM D     E +A L  KAI+ H++
Sbjct: 438 NRPGVCYESAQTRKYQFGRTEVIRSASNESKAWAEAMLDPTQTDEHRAALFRKAISRHLQ 497

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+ SLK  E  P I+TD A++K++HW LSTSQLSS Y  G+G+
Sbjct: 498 YAAWAADGQGVDRHLFGLKKSLKEGEPVPDIYTDEAFSKTSHWELSTSQLSSPYLDGWGY 557

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           GEVVPDGYG++Y I +  + + I SL+ N   L HYL E+ATE R + E
Sbjct: 558 GEVVPDGYGLSYSIGDYYIRWTITSLKRNTAELKHYLAEAATETRAMME 606



>gi|322694247|gb|EFY86082.1| carnitine acetyl transferase [Metarhizium acridum CQMa 102]
          Length = 547

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 188/257 (73%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GF GEHS MDGTPT RLND++ ++I  NK+D   P++RS LP PQ + F++
Sbjct: 288 FIVNDNGTSGFMGEHSMMDGTPTHRLNDYINDLIFGNKIDFSDPSIRSDLPEPQLIQFDI 347

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T+ + + I +A  ++   I +H L V AY+GYGK +IKK   SPDAYVQMIIQLAY+KMY
Sbjct: 348 TAPIQAEIDRAVTDFHTVINQHQLAVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMY 407

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV W K+M D     + +  L  +AI+AH++
Sbjct: 408 GKNRPTYESAATRRFQLGRTETCRTVSDESVAWCKSMSDPSQDEQTRINLFRRAIDAHIE 467

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L  +E+ P I+ DPA++ S+ W LSTSQLSSE+F GYGW
Sbjct: 468 YITAASDGKGVDRHLFGLKKLLAPDEEVPAIYKDPAFSYSSSWYLSTSQLSSEFFNGYGW 527

Query: 241 GEVVPDGYGIAYMINND 257
            +V+ +G+GIAYMIN +
Sbjct: 528 SQVIDEGFGIAYMINEN 544



>gi|452846120|gb|EME48053.1| hypothetical protein DOTSEDRAFT_69850 [Dothistroma septosporum
           NZE10]
          Length = 641

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 200/289 (69%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV +NG +GFNGEHS MDGTPT RLND V + I N K+D  +P +RS +P P  + F L
Sbjct: 342 MIVNDNGTSGFNGEHSMMDGTPTHRLNDTVMHWIFNEKLDFENPQLRSDIPDPMPIKFQL 401

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           +SE  + ++ A  ++   +++H+LRV A++GYGK ++KK   SPDAYVQMIIQL YYK Y
Sbjct: 402 SSENYADVALATTHHIGLMSQHELRVEAFQGYGKGLMKKFKCSPDAYVQMIIQLGYYKFY 461

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM+          +L  KAI+AH +
Sbjct: 462 GKNRPTYESAATRRFQEGRTETCRTVSDESVAFCSAMQHALSTDAECRDLFRKAISAHTE 521

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGLR  LK  E  P IF D A+A S +W +S+SQLSSEY+ GYGW
Sbjct: 522 YITAASDGKGVDRHLFGLRKLLKDGEDVPEIFKDAAFAYSGNWYISSSQLSSEYYNGYGW 581

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
            +V+ DG+GIAYMIN +S+ FNIVS  L  + +  +L E+A ++R V E
Sbjct: 582 SQVIDDGWGIAYMINENSVQFNIVSKNLGAERMAFFLNEAAQDIRAVME 630



>gi|472584724|gb|EMS22310.1| carnitine O-acetyltransferase [Rhodosporidium toruloides NP11]
          Length = 658

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 203/308 (65%), Gaps = 6/308 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGS--PNVRSGLPVPQQLHF 58
            +VFENGK+GFNGEHS MDGTPTSRLND++   + + K+D GS  P   S LP    L F
Sbjct: 351 LVVFENGKSGFNGEHSCMDGTPTSRLNDWLLRSLDHGKIDLGSSTPRAASALPKITPLAF 410

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           NL   V SAIS +   ++  +AKHDL VL Y GYGK+ IK+   SPD+Y Q+++ LAYYK
Sbjct: 411 NLPDSVKSAISSSIAAHESTMAKHDLAVLEYAGYGKDQIKQYKTSPDSYAQLVMGLAYYK 470

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
           M G    TYESAQTRK++ GRTEV R+ S +++ W KAMED K       EL  KA   H
Sbjct: 471 MEGKVAPTYESAQTRKYKLGRTEVIRSTSPEALEWYKAMEDPKRSSTECVELFRKAAAKH 530

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
           +K   EA +GRG DRHLFGL+  L+ +E+ P ++ DP +A+S +W LSTSQLSSEYF G+
Sbjct: 531 IKLAGEAADGRGVDRHLFGLKKVLREDEELPALYQDPTFAQSGNWILSTSQLSSEYFAGW 590

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIVSLRL----NNDVLWHYLKESATEMRQVFEYAQAK 294
           G+GEVV +GYG+AY +NN +L F I S+      N     HYL+++  E+R++ E   A 
Sbjct: 591 GYGEVVDEGYGLAYAVNNRTLRFTITSMNRGKHNNVHAFRHYLEQACNEVREMMEKGGAV 650

Query: 295 AGQIKAKL 302
               KAKL
Sbjct: 651 PSADKAKL 658



>gi|390603400|gb|EIN12792.1| acyltransferase ChoActase/COT/CPT [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 626

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/309 (48%), Positives = 208/309 (67%), Gaps = 7/309 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP---NVRSGLPVPQQLH 57
            IVFENGK+GF GEHS MDGTPT R+N+F+   +A NK+D G+P   +  S +P P++L 
Sbjct: 318 LIVFENGKSGFLGEHSCMDGTPTLRMNEFMLASLAANKIDLGAPRTSSTASSVPPPRELS 377

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L ++    I +AE  +D+   +HD+ VL YEGYGK  IKK  ASPDA+ Q++ QLA++
Sbjct: 378 FVLDAKTKKHIEEAETRFDELAGQHDMEVLHYEGYGKEYIKKFKASPDAWAQLVKQLAFH 437

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           KM+G     YESAQTRK+Q GRTEV R+ S +S  W +AM +     E ++ L  +A+  
Sbjct: 438 KMFGRPGVCYESAQTRKYQLGRTEVIRSASNESKAWAEAMLNPDETDEHRSTLFRRAVAR 497

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H++Y A A +G+G DRHLFGL+  L+  E  P I+TDPA++K+ HW LSTSQLSS++  G
Sbjct: 498 HLQYAAWAADGQGVDRHLFGLKKMLREGEPVPEIYTDPAFSKTNHWELSTSQLSSKFVDG 557

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAG- 296
           +G+GEVVPDGYG++Y I ++ + + I SL+     L HYL E+ATE +++ E A   AG 
Sbjct: 558 WGYGEVVPDGYGLSYSIGDNYIRWTITSLKRRTAELKHYLAEAATETKEMMERAATAAGV 617

Query: 297 ---QIKAKL 302
                KAKL
Sbjct: 618 STADSKAKL 626



>gi|389744673|gb|EIM85855.1| acyltransferase ChoActase/COT/CPT [Stereum hirsutum FP-91666 SS1]
          Length = 615

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 206/300 (68%), Gaps = 3/300 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVF+NG++GF GEHS MDGTPT RLN+F+   +A NKVD G     S LP P++L F  
Sbjct: 317 LIVFDNGRSGFLGEHSCMDGTPTLRLNEFMLASLAANKVDLGPSEPCSSLPSPKELGFTT 376

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              ++S +  AEK++D+ + KH++ VL YEGYGK  IK+   SPDA+VQMI QLA++K  
Sbjct: 377 NDAIVSDVHIAEKHFDELVGKHEMHVLHYEGYGKAEIKRYKVSPDAWVQMIKQLAFHKFQ 436

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPI-EVKAELGYKAINAHV 179
           G    TYES QTRKFQ GRTEV R+ S +S  WV+AM D KV   E +A L  +AI  HV
Sbjct: 437 GRPAVTYESTQTRKFQLGRTEVTRSASSESKAWVEAMADAKVSQDEQRANLFRRAIARHV 496

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           +Y A A +G+G DRHLFGL+  +   E  P +++D A++++ HW LSTSQLSS Y  G+G
Sbjct: 497 QYAAWAADGQGVDRHLFGLKKMVGEGEPVPELYSDEAFSRTNHWELSTSQLSSPYIDGWG 556

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIK 299
           +GEVVPDGYG++Y I ++ + + I S R ++ VL HYL E+ATE+R +   A A++G+ K
Sbjct: 557 YGEVVPDGYGLSYAIGDEHIRWTITSERGDSAVLKHYLAEAATEVRGLM--AAAESGRAK 614



>gi|392592013|gb|EIW81340.1| acyltransferase ChoActase COT CPT [Coniophora puteana RWD-64-598
           SS2]
          Length = 625

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/292 (48%), Positives = 203/292 (69%), Gaps = 3/292 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP---NVRSGLPVPQQLH 57
           F+VF+NG++GF GEHS MDGTPT R+N+F+   +A NK D G+P   +  S LP P +L 
Sbjct: 318 FLVFDNGRSGFLGEHSCMDGTPTLRMNEFILASLAANKADLGAPRDASTGSSLPAPTELT 377

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L  +V   + +A +++D  + +HD+ VL YEGYGK+++KK  ASPDA+ Q++ QLA++
Sbjct: 378 FKLDGKVTKFVDEACEHFDALVGRHDMHVLHYEGYGKDLMKKFKASPDAWAQLVKQLAFH 437

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           KM G    TYES QTRKFQ GRTEV R+ S ++  W +AM +  V    +A L  +A++ 
Sbjct: 438 KMEGRPAVTYESCQTRKFQRGRTEVIRSASNENKAWAEAMLNPDVSDTRRATLFRQAVSR 497

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H++Y A A +G+G DRHLFGL+  LK  E  P I+ DP+++KS+HW LSTSQLSS +  G
Sbjct: 498 HLQYAAWAADGQGVDRHLFGLKKMLKEGESLPKIYEDPSFSKSSHWELSTSQLSSRFVDG 557

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           +G+GEVV DGYG++Y I++  + + I SL+ N   L HYL E+ATE+RQ+ E
Sbjct: 558 WGYGEVVEDGYGLSYSIDDHYIRWTITSLKRNTAELKHYLAEAATEVRQMME 609



>gi|327348987|gb|EGE77844.1| hypothetical protein BDDG_00781 [Ajellomyces dermatitidis ATCC
           18188]
          Length = 588

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 184/257 (71%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V N+I NN++D+ +P +RS LP PQ + F L
Sbjct: 310 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNNMIFNNRLDYSNPEIRSTLPDPQPIKFEL 369

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + +  I+ A   +   I +H+LRV A++GYGK +IK+   SPDAYVQM+IQLAY+KMY
Sbjct: 370 NKQAIDDIATATHAFTTVIGQHELRVQAFQGYGKGLIKRFRCSPDAYVQMVIQLAYFKMY 429

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G ++ TYESA TRKFQ GRTE  R+VS +SV + K+  D  VP EV A+    A+ AH K
Sbjct: 430 GKSRPTYESASTRKFQLGRTETTRSVSDESVAFCKSHTDINVPREVVAKNFRAAVVAHSK 489

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   EK P +F DPAYA S  W +S+SQLSSEYF GYGW
Sbjct: 490 YTADASLGKGVDRHLFGLKKLIAEGEKVPALFEDPAYAYSGKWFISSSQLSSEYFNGYGW 549

Query: 241 GEVVPDGYGIAYMINND 257
            +VV DG+GIAYMIN +
Sbjct: 550 SQVVDDGFGIAYMINEN 566



>gi|392566384|gb|EIW59560.1| acyltransferase ChoActase/COT/CPT [Trametes versicolor FP-101664
           SS1]
          Length = 622

 Score =  302 bits (773), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 146/283 (51%), Positives = 193/283 (68%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVFENGK+GF GEHS MDGTPT RLN+F+   +A+NKVD GS    + L  PQ+L   L
Sbjct: 318 LIVFENGKSGFLGEHSCMDGTPTLRLNEFILAALAHNKVDLGSAPTNAQLEPPQELTLTL 377

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            ++    IS++E  +D+ +  H++ VL YEGYGK  IK   ASPDA+ QM+ QLA++KM+
Sbjct: 378 DAQTKKNISESEARFDELVGAHEMEVLHYEGYGKEFIKGHKASPDAWAQMVKQLAFHKMF 437

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G     YESAQTRK+Q GRTEV R+ S +S  W +AM D     E +A L  KA++ H++
Sbjct: 438 GRPGVCYESAQTRKYQLGRTEVIRSASKESKAWAEAMLDASQSDEHRAALFRKAVSRHLQ 497

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  LK  E  P I+TD A++K+ HW LSTSQLSS Y  G+G+
Sbjct: 498 YAAWAADGQGVDRHLFGLKKCLKEGEPVPEIYTDEAFSKTNHWELSTSQLSSPYLDGWGY 557

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATE 283
           GEVVPDGYG++Y I +  + + I SL+L    L H+L E+ATE
Sbjct: 558 GEVVPDGYGLSYSIGDHYIRWTITSLKLRTAELKHFLAEAATE 600



>gi|449548858|gb|EMD39824.1| hypothetical protein CERSUDRAFT_112084 [Ceriporiopsis subvermispora
           B]
          Length = 653

 Score =  302 bits (773), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 151/286 (52%), Positives = 189/286 (66%), Gaps = 3/286 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG---SPNVRSGLPVPQQLH 57
            IVFENGK+GF GEHS MDGTPT RLN+FV   +A  K D G   +P     L  P++L 
Sbjct: 346 LIVFENGKSGFLGEHSCMDGTPTLRLNEFVLGSLAKGKADLGPARTPETGKKLASPKELT 405

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L S+  S I+ AEK +D+ + KHDL VL YEGYGK  IKK  ASPDA+ QM+ QLA++
Sbjct: 406 FILDSKTRSHIASAEKAFDELVGKHDLHVLTYEGYGKEHIKKFKASPDAWAQMVKQLAFH 465

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           KM+      YESAQTRKFQ GRTEV R+ S +S  W +AM D       +AEL  KA+  
Sbjct: 466 KMFARPGVCYESAQTRKFQRGRTEVIRSASNESKAWAEAMLDPAESDARRAELFRKAMAR 525

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV+Y   A +G+G DRHLFGL+  L+  E  P I+ D A+AK+ HW LSTS LSS Y  G
Sbjct: 526 HVQYATWAADGQGVDRHLFGLKRMLREGEPLPEIYKDEAFAKTNHWELSTSNLSSPYLSG 585

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATE 283
           +G+GEVVPDGYG++Y I +D + + I SL+     L HYL E+ATE
Sbjct: 586 WGYGEVVPDGYGLSYSIGDDYIRWTITSLKRRTAELKHYLAEAATE 631



>gi|453087740|gb|EMF15781.1| carnitine O-acetyltransferase [Mycosphaerella populorum SO2202]
          Length = 610

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 212/302 (70%), Gaps = 3/302 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV +NG +GFNGEHS MDGTPT RLND + + I N+K+D  +P  RS +P P  L F L
Sbjct: 312 FIVNDNGTSGFNGEHSMMDGTPTHRLNDTIMHWIFNDKLDFENPQFRSDIPDPAPLKFQL 371

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           +SEV + ++ A++++ + +++H+LRV A++GYGK ++KK   SPDAYVQMIIQL YYK Y
Sbjct: 372 SSEVYADVATAQEHHINLMSQHELRVEAFQGYGKGLMKKFKCSPDAYVQMIIQLGYYKFY 431

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CR+VS +SV +  AM+      E   +L  KAI AH +
Sbjct: 432 GKNRPTYESAATRRFQEGRTETCRSVSDESVAFCNAMQSPSSTNEECRDLFRKAIAAHGE 491

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A +G+G DRHLFGL+  L+  E  P IF DPA+  S+ W +S+SQLSSEY+ GYGW
Sbjct: 492 YISAASDGKGVDRHLFGLKKLLQEGEDVPEIFKDPAFTYSSSWFISSSQLSSEYYNGYGW 551

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+ DG+G+AYMIN +S+ FNIVS  L  + +  +L E+A ++R + E   ++    KA
Sbjct: 552 SQVIDDGWGMAYMINENSVQFNIVSKSLGAERMAFFLNEAAQDIRAILE---SEGTSAKA 608

Query: 301 KL 302
           +L
Sbjct: 609 RL 610



>gi|388855155|emb|CCF51286.1| probable carnitine O-acetyltransferase, mitochondrial precursor
           [Ustilago hordei]
          Length = 647

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 193/300 (64%), Gaps = 1/300 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            I F NGK+GF GEHS MDGTPT RLNDF    +   K+D GS N R+ LP P+Q+ F  
Sbjct: 349 IITFANGKSGFMGEHSMMDGTPTLRLNDFALQALQAGKIDLGSSN-RTDLPAPKQIKFKT 407

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              V + I ++ K++D  + +HDL VL ++GYGK  IKK   SPDA+VQM+IQLAYYKMY
Sbjct: 408 DKTVQAKIEESIKDFDSLMGRHDLSVLDFQGYGKGAIKKFKCSPDAWVQMVIQLAYYKMY 467

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G    TYESAQTRKF+ GRTE  R+ S++S  + +AME        + E    A+  H+ 
Sbjct: 468 GKPCPTYESAQTRKFKWGRTETIRSASIESKAFCEAMESHSSSDAERYEKFQAAVKQHLS 527

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y + A +G+G DRHLFGL+  LK  EK P I+ DPAY  S+ W LSTSQ+SSE F  +G+
Sbjct: 528 YASAAADGQGVDRHLFGLKKLLKEGEKVPAIYEDPAYGLSSTWKLSTSQISSEVFACWGF 587

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
           GEV P+G+G AY I  +SL F I SL+L    L HY+ E+A E+R +    Q +  + KA
Sbjct: 588 GEVTPEGFGCAYAIKENSLTFTITSLKLGASNLRHYINEAAVELRDLHLRLQNEGAKAKA 647



>gi|409042423|gb|EKM51907.1| hypothetical protein PHACADRAFT_262313 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 627

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 197/293 (67%), Gaps = 3/293 (1%)

Query: 2   IVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP---NVRSGLPVPQQLHF 58
           IVFENGK+GF GEHS MDGTPT R+ +FV   +A  K+D G+P   +  S L  P++L F
Sbjct: 319 IVFENGKSGFLGEHSCMDGTPTLRMTEFVIGALAQGKLDLGAPRSADTGSTLEPPRELTF 378

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
            L +    AI++AE+++D  +  HD+ VL YEGYGK  IKK   SPDA+ Q++ QLA++K
Sbjct: 379 VLDTVSREAIARAEEHFDTLVGAHDMEVLHYEGYGKEYIKKFKTSPDAWAQLVKQLAFHK 438

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
           M+G     YESAQTRK+Q GRTEV R  S +S  W +AM D +  +  +A+L  KA+  H
Sbjct: 439 MFGRPGVCYESAQTRKYQLGRTEVIRAASNESKAWAEAMLDPETTVAQRADLFRKAMARH 498

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
           ++Y A A +G+G DRHLFGL+  L+  E  P I+TDPAY+++ HW LSTS LSS    G+
Sbjct: 499 LQYAAWAADGQGVDRHLFGLKKMLQEGEPTPEIYTDPAYSRTNHWELSTSNLSSPCLDGW 558

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYA 291
           G+GEVVPDGYG++Y I ++ + + I SL+       HYL E+ATE R++ E A
Sbjct: 559 GYGEVVPDGYGLSYTIGDEYIRWTITSLKRGTKEFKHYLAEAATETREMMEQA 611



>gi|342320996|gb|EGU12934.1| Nucleolar GTP-binding protein 2 [Rhodotorula glutinis ATCC 204091]
          Length = 1450

 Score =  299 bits (765), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 157/308 (50%), Positives = 201/308 (65%), Gaps = 6/308 (1%)

Query: 1    FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGS--PNVRSGLPVPQQLHF 58
             IVFENGK+GFNGEHS MDGTPTSRLND++   + + K+D GS  P   S LP    L F
Sbjct: 1143 LIVFENGKSGFNGEHSCMDGTPTSRLNDWLLRSLDHGKIDLGSSTPRSASALPKITPLAF 1202

Query: 59   NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
            NL   V SAIS +   ++  ++KHDL VL Y GYGK+ IK+   SPD+Y Q+++ LAYYK
Sbjct: 1203 NLPESVKSAISSSISAHESTMSKHDLAVLEYAGYGKDQIKQYKTSPDSYAQLVMGLAYYK 1262

Query: 119  MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
            M G    TYESAQTRK++ GRTEV R+ S +++ W KAMED K       EL  KA   H
Sbjct: 1263 MEGKVAPTYESAQTRKYKLGRTEVIRSTSPEALEWYKAMEDPKRSSTECVELFRKAAAKH 1322

Query: 179  VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
            +K   EA +GRG DRHLFGL+  LK  E  P ++ DP +A+S +W LSTSQLSSEYF G+
Sbjct: 1323 IKLAGEAADGRGVDRHLFGLKKVLKEGENLPALYQDPTFAQSGNWILSTSQLSSEYFAGW 1382

Query: 239  GWGEVVPDGYGIAYMINNDSLNFNIVSLRL----NNDVLWHYLKESATEMRQVFEYAQAK 294
            G+GEVV +GYG+AY +NN +L F I S+      N     HYL+++  E+R++ E   A 
Sbjct: 1383 GYGEVVDEGYGLAYAVNNRTLRFTITSMNRGKHNNVHAFRHYLEQACNEVREMMEKGGAV 1442

Query: 295  AGQIKAKL 302
                KAKL
Sbjct: 1443 PSADKAKL 1450



>gi|71004540|ref|XP_756936.1| hypothetical protein UM00789.1 [Ustilago maydis 521]
 gi|46095585|gb|EAK80818.1| hypothetical protein UM00789.1 [Ustilago maydis 521]
          Length = 648

 Score =  298 bits (764), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 143/287 (49%), Positives = 187/287 (65%), Gaps = 1/287 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            I F NGK+GF GEHS MDGTPT RLNDF    +   K+D GS N R+ LP P+Q+ F  
Sbjct: 349 IITFANGKSGFMGEHSMMDGTPTLRLNDFALQALQAGKIDLGSSN-RTDLPAPKQIQFKT 407

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              V + I ++ K ++D + +HDL +L ++GYGK  IKK   SPDA+VQM+IQLAY+KM+
Sbjct: 408 DKTVEAKIEESIKEFNDLMGRHDLAILDFQGYGKGAIKKFKCSPDAWVQMVIQLAYFKMF 467

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G    TYESAQTRKF+ GRTE  R+ SV+S+ + KAME        + E    A+  H+ 
Sbjct: 468 GKPCPTYESAQTRKFKWGRTETIRSASVESLAFCKAMESHSASDAERFEKFQAAVKQHLS 527

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A +G+G DRHLFGL+  LK  EK P I+ DPAY  S  W LSTSQ+SSE F  +G+
Sbjct: 528 YATAAADGQGVDRHLFGLKKLLKQGEKVPAIYEDPAYGLSATWKLSTSQISSEVFASWGF 587

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV 287
           GEV P+G+G AY I  +SL F + SL+L    L HY+ E+A E+R +
Sbjct: 588 GEVTPEGFGCAYAIKENSLTFTLTSLKLGAADLRHYINEAALELRDL 634



>gi|380475398|emb|CCF45273.1| carnitine O-acetyltransferase [Colletotrichum higginsianum]
          Length = 282

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/271 (53%), Positives = 197/271 (72%)

Query: 18  MDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNLTSEVLSAISKAEKNYDD 77
           MDGTPT RLNDF+ ++I NNK+D   P++RS LP PQ + F +T EV + I +A K++ D
Sbjct: 1   MDGTPTHRLNDFINDLIFNNKIDLSDPSIRSNLPDPQIVKFEITKEVQAEIDRARKDFHD 60

Query: 78  HIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMYGTNKATYESAQTRKFQH 137
            I++H+L V AY+GYGK +IKK   SPDAYVQM+IQLAY+KMYG N+ TYESA TR+FQ 
Sbjct: 61  VISQHELAVQAYQGYGKGLIKKFKCSPDAYVQMVIQLAYHKMYGKNRPTYESAATRRFQQ 120

Query: 138 GRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVKYMAEAVEGRGCDRHLFG 197
           GRTE CRTVS  SV W  AM D  V  + K +L  +AI++H++Y+  A +G+G DRHLFG
Sbjct: 121 GRTETCRTVSDSSVAWCNAMADPNVEDKDKVDLFRQAIDSHLEYITAASDGKGVDRHLFG 180

Query: 198 LRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGWGEVVPDGYGIAYMINND 257
           L+  L+  ++ P I+ DPA+  S+ W LS+SQLSSEYF GYGW +V+  G+GIAYMIN +
Sbjct: 181 LKKLLEPGQELPAIYQDPAFTYSSSWYLSSSQLSSEYFNGYGWSQVIDGGFGIAYMINEN 240

Query: 258 SLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           S+NFN+VS  L +  +  +L E+A +MR + 
Sbjct: 241 SINFNVVSKGLGSQRMSFFLNEAAGDMRDLL 271



>gi|398390866|ref|XP_003848893.1| carnitine O-acetyltransferase [Zymoseptoria tritici IPO323]
 gi|339468769|gb|EGP83869.1| acyltransferase ChoActase [Zymoseptoria tritici IPO323]
          Length = 642

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 154/302 (50%), Positives = 207/302 (68%), Gaps = 4/302 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG +GF GEHS MDGTPT RLND + + I N+K+D  +P +RS +P PQ L F L
Sbjct: 345 FIVNENGTSGFTGEHSMMDGTPTHRLNDTIMHWIFNDKLDFDAPTLRSTIPDPQPLRFQL 404

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E  + ++ A+ ++   I++H+LRV A++GYGK  +KK   SPDAYVQMIIQLAY+K Y
Sbjct: 405 SGENHADVALAQTHHVGLISQHELRVEAFQGYGKGAMKKFKCSPDAYVQMIIQLAYHKFY 464

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TR+FQ GRTE CRTVS +SV +  AM       E   +L   A+ AH +
Sbjct: 465 GKNRPTYESAATRRFQEGRTETCRTVSDESVAFCNAMAHPLSTDEECRKLFRNALKAHGE 524

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G+G DRHLFGL+  L+  E+ P IF DPAY  S+ W +S+SQLSSEY+ GYGW
Sbjct: 525 YITAASDGKGVDRHLFGLKKLLQQGEEVPEIFKDPAYTYSSSWYISSSQLSSEYYNGYGW 584

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIKA 300
            +V+  G+GIAYMIN +S+ FNIVS  L ++ +  +L +SA ++R++     A   Q KA
Sbjct: 585 SQVIDAGFGIAYMINENSIQFNIVSKNLGSERMAFFLNQSALDIREIL----ASEEQPKA 640

Query: 301 KL 302
           KL
Sbjct: 641 KL 642



>gi|323508344|emb|CBQ68215.1| probable carnitine O-acetyltransferase, mitochondrial precursor
           [Sporisorium reilianum SRZ2]
          Length = 643

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 140/287 (48%), Positives = 190/287 (66%), Gaps = 1/287 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            I F NGK+GF GEHS MDGTPT RLNDF    +   K+D GS N R+ LP P+ + F  
Sbjct: 344 IITFANGKSGFMGEHSMMDGTPTLRLNDFALQALQAGKIDLGSSN-RTDLPAPKPIAFKT 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            + V + I+++ K++D+ + +HDL +L ++GYGK  IKK   SPDA+VQM+IQLAY+KMY
Sbjct: 403 DATVEAQIAESIKDFDELMGRHDLAILDFQGYGKGAIKKFKCSPDAWVQMVIQLAYFKMY 462

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESAQTRKF+ GRTE  R+ SV+S  + +AME        + E    A+  H+ 
Sbjct: 463 GQPCATYESAQTRKFKWGRTETIRSASVESKAFCEAMESHTASDAERYEKFQAAVKQHLS 522

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A +G G DRHLFGL+  L+  EK P ++ DPA+A S+ W LSTSQ+SSE F  +G+
Sbjct: 523 YATAAADGHGVDRHLFGLKKLLREGEKLPALYEDPAFALSSTWKLSTSQISSEVFACWGF 582

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV 287
           GEV P+G+G AY I  ++L F + SL+L    L HY+ E+A E+R +
Sbjct: 583 GEVTPEGFGCAYAIKENALTFTLTSLQLGAADLRHYINEAAVELRDL 629



>gi|296416695|ref|XP_002838010.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633905|emb|CAZ82201.1| unnamed protein product [Tuber melanosporum]
          Length = 621

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 184/289 (63%), Gaps = 30/289 (10%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FI+ ENG AGF GEHS MDGTPT RLND++ + I +NK+D    +VRS LP P       
Sbjct: 354 FIINENGTAGFMGEHSMMDGTPTHRLNDYLNDQIFHNKIDLAVGDVRSNLPEP------- 406

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
                                  L+VLAY GYGK +IKK   SPDAYVQM+IQLAYYKMY
Sbjct: 407 -----------------------LKVLAYLGYGKGLIKKFKCSPDAYVQMVIQLAYYKMY 443

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G N+ TYESA TRKFQ GRTE CRTVS +SV W K+M D     +        AINAHV 
Sbjct: 444 GKNRPTYESAATRKFQVGRTETCRTVSEESVAWCKSMMDPDTDPKTCISNFRAAINAHVV 503

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y++ A EG+G DRHLFGL+  L      P I+ DPAY  S+ W LSTSQLSSEYF GYGW
Sbjct: 504 YISTASEGKGVDRHLFGLKKLLPPGAALPKIYADPAYGYSSSWFLSTSQLSSEYFNGYGW 563

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
            +V+  GYGIAYMIN ++L FNIVS +   + +  YL ++A ++R++ E
Sbjct: 564 SQVIDQGYGIAYMINENNLQFNIVSKKQGCERMQFYLTDAANDLRELME 612



>gi|336369709|gb|EGN98050.1| hypothetical protein SERLA73DRAFT_182914 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382490|gb|EGO23640.1| hypothetical protein SERLADRAFT_469798 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 649

 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 205/311 (65%), Gaps = 9/311 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRS---GLPVPQQLH 57
            +VF+NG++GF GEHS MDGTPT RLN+F+   +A  KVD G P   S    LP P++L 
Sbjct: 339 LLVFDNGRSGFLGEHSCMDGTPTLRLNEFILASLAAKKVDLGEPRTSSTGGSLPEPRELK 398

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F+L     + IS + +++++ + KHDL VL YEGYGK+++K   ASPDA+ Q++ QLA++
Sbjct: 399 FDLDDRCKAFISDSCQHFNELVGKHDLHVLHYEGYGKSLMKTFKASPDAWAQLVKQLAFH 458

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           KM+     TYES QTRK+Q GRTEV R+ S ++  W +AM       E +A L  KA++ 
Sbjct: 459 KMFNRPGVTYESCQTRKYQLGRTEVIRSASSETKAWAEAMLSADETDEHRAALFRKAVSR 518

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H++Y A A +G G DRH FGL+  L+  E  P ++ D A+A+++HW LSTSQLSS++  G
Sbjct: 519 HLQYAAWAADGHGVDRHFFGLKKMLREGEPTPEVYEDSAFARTSHWELSTSQLSSKFLDG 578

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQA---- 293
           +G+GEVVPDGYG++Y I++  + + I SL+ +   L HYL E+ATE R + E A A    
Sbjct: 579 WGYGEVVPDGYGLSYSIDDHYIRWTITSLKSDVAELKHYLAEAATETRMMMEKAAASEQR 638

Query: 294 --KAGQIKAKL 302
             +A   KAKL
Sbjct: 639 KKEAADGKAKL 649



>gi|409078725|gb|EKM79087.1| hypothetical protein AGABI1DRAFT_113708 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 608

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 151/311 (48%), Positives = 212/311 (68%), Gaps = 10/311 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVR--SGLPVPQQLHF 58
            IV+ENG++GF GEHS MDGTPT R+N+F+   +A  KVD G P V   S LP P+ L F
Sbjct: 299 LIVYENGRSGFLGEHSCMDGTPTLRMNEFIIATLAGGKVDLGPPTVSDPSSLPEPEHLIF 358

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           NL   V S I+ A   +D  ++KH+L VL YEGYGKN++K    SPDA+VQ++ QLA++K
Sbjct: 359 NLNDNVKSLITGATHRFDTLVSKHELHVLHYEGYGKNLMKHFKFSPDAWVQLVKQLAFHK 418

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKV--PIEVKAELGYKAIN 176
           M+G    TYESAQTRKFQ GRTEV R+ S +S  W +AM  + +  PI+++ EL  KA++
Sbjct: 419 MFGRPGVTYESAQTRKFQLGRTEVIRSASAESKEWAEAMVGEPLTDPIQLR-ELFRKAVS 477

Query: 177 AHVKYMAEAVEGRGCDRHLFGLR--MSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
            H++Y   A +G+G DRHLFGL+  ++L+  E+ P ++ D A+ KS++W LSTSQLSS +
Sbjct: 478 RHIQYSTWAADGQGVDRHLFGLKKLVNLEKGEEIPELYKDEAFGKSSYWELSTSQLSSRW 537

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR-LNNDVLWHYLKESATEMRQVFEYAQ- 292
           F G+G+GEVV  G+G+AY I +  + + I  LR +  + L  YL E+ATE+R++ E A+ 
Sbjct: 538 FDGWGYGEVVEHGFGLAYAIGDGYVRWTITGLREMRGEELKFYLGEAATEVREMLEAAER 597

Query: 293 -AKAGQIKAKL 302
             K G  K+KL
Sbjct: 598 REKEGGNKSKL 608



>gi|393212506|gb|EJC98006.1| acyltransferase ChoActase/COT/CPT [Fomitiporia mediterranea MF3/22]
          Length = 629

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 198/294 (67%), Gaps = 3/294 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVF+NG++GF GEHS MDGTPT RLN+++   +A  KVD     VR  L  P++++F  
Sbjct: 319 FIVFDNGRSGFLGEHSCMDGTPTLRLNEYMLASLAAGKVDRNKSGVRENLTQPKEINFEQ 378

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + +  I   EK +D+ + +H+L VL YEGYGKN IK   ASPDA+ QM+ QLA++K+ 
Sbjct: 379 DQKSIRYIKSGEKQFDELVGRHELLVLHYEGYGKNFIKTQRASPDAWAQMVKQLAFHKLE 438

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G     YES+QTRKFQ GRTEV R+ S +S  WV+AM D       +++L  +AI  H++
Sbjct: 439 GRPGVCYESSQTRKFQLGRTEVIRSASNESKAWVEAMLDPNRTDAYRSQLFKRAIARHLQ 498

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A +G+G DRHLFGL+  L+ +E  P IF+DPAY+ ++HW LSTSQLSS +  G+G+
Sbjct: 499 YSTWAADGQGVDRHLFGLKKMLREDEPLPEIFSDPAYSLTSHWELSTSQLSSPFLDGWGY 558

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVS---LRLNNDVLWHYLKESATEMRQVFEYA 291
           GEVVP+GYG++Y I +D + + I S   L+ +   L HYL E+ATE R++ E A
Sbjct: 559 GEVVPNGYGLSYSIGDDYIRWTITSQSDLKRHAAALRHYLAEAATETRKMMERA 612



>gi|443896701|dbj|GAC74045.1| carnitine O-acyltransferase CRAT [Pseudozyma antarctica T-34]
          Length = 646

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 189/287 (65%), Gaps = 1/287 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            I F NGK+GF GEHS MDGTPT RLNDF    +   K+D GS + R+ LP P+Q+ F+ 
Sbjct: 347 IIAFANGKSGFMGEHSMMDGTPTLRLNDFALQALEAGKIDLGS-SKRTDLPAPKQITFST 405

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              V + I+++  +++  + +HDL VL ++GYGK  IKK   SPDA+VQM+IQLAY+KMY
Sbjct: 406 DKNVEAKIAESIGDFESLMGRHDLAVLDFQGYGKGAIKKFKCSPDAWVQMVIQLAYFKMY 465

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G    TYESAQTRKF+ GRTE  R+ SV+S  + +AME        + E    A+  H+ 
Sbjct: 466 GKPCPTYESAQTRKFKWGRTETIRSASVESKAFCEAMESHSATDAERFEKFQAAVKQHLG 525

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y + A +G+G DRHLFGL+  LK  EK P I+ D AYA S+ W LSTSQ+SSE F  +G+
Sbjct: 526 YASAAADGQGVDRHLFGLKKLLKEGEKVPAIYEDAAYAASSTWKLSTSQISSEVFSCWGF 585

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV 287
           GEV P+G+G AY I  +SL F + SL+L    L HY+ E+A E+R +
Sbjct: 586 GEVTPEGFGCAYAIKENSLTFTLTSLKLGAADLKHYINEAAVELRDL 632



>gi|170089767|ref|XP_001876106.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649366|gb|EDR13608.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 631

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 202/302 (66%), Gaps = 11/302 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVR---SGLPVPQQLH 57
            IV+ENG++GF GEHS MDGTPT R+N+FV   IA+NKV     +V    + LP   +L 
Sbjct: 317 LIVYENGRSGFLGEHSCMDGTPTLRMNEFVLASIASNKVPLTPSSVPIDITSLPPVSELQ 376

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L     S I  +EK +DD +  HDL VL YEG+GKN++KK   SPDA  Q+I QLA++
Sbjct: 377 FTLNDTTKSLIRASEKRFDDLVGAHDLHVLHYEGFGKNLLKKHKFSPDAGAQLIQQLAFH 436

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAM-------EDQKVPIEVKAEL 170
           KM+G    TYESAQTRKF+ GRTEV R+ S +S  W +AM            P E+KA  
Sbjct: 437 KMFGRPGVTYESAQTRKFKLGRTEVIRSASKESKTWAEAMLSTSPSSPSSSSPRELKALF 496

Query: 171 GYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQL 230
           G KA+  H++Y A A +G+G DRHLFGL+  ++ +E+ P I+ D A+ +S+HW LSTSQL
Sbjct: 497 G-KAVARHMQYSAWAADGQGVDRHLFGLKKLVREDEEVPAIYKDLAFGRSSHWELSTSQL 555

Query: 231 SSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEY 290
           SS +F G+G+GEVVPDGYG++Y I ++ + + I SL+ +  VL HYL E+A+E++ + E 
Sbjct: 556 SSRFFDGWGYGEVVPDGYGLSYSIGDNYIRWTITSLKRDTKVLKHYLAEAASEVKAMLEA 615

Query: 291 AQ 292
           A+
Sbjct: 616 AE 617



>gi|403418223|emb|CCM04923.1| predicted protein [Fibroporia radiculosa]
          Length = 627

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 142/292 (48%), Positives = 193/292 (66%), Gaps = 3/292 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG---SPNVRSGLPVPQQLH 57
            IVFENGK+GF GEHS MDGTPT RLN+F+   +A  KVD G   +P   + L  P++L 
Sbjct: 319 LIVFENGKSGFLGEHSCMDGTPTLRLNEFMLAALAAGKVDLGPARTPETGNDLEAPKELM 378

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L S+    + +AE  +D+ + KHD+ VL YEGYGK  IKK  ASPDA+ Q++ QLA++
Sbjct: 379 FVLDSKTQQYVKQAEAAFDELVGKHDMEVLHYEGYGKEYIKKFKASPDAWAQLVKQLAFH 438

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           KM+      YESAQTRK+Q GRTEV R  S +S  W +AM + +   E +A L  KA+  
Sbjct: 439 KMFNRPGVCYESAQTRKYQLGRTEVIRAASNESKAWAEAMLNPEESDEHRATLFRKAVTR 498

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H++Y A A +G+G DRHLFGL+  L+  E  P+I+TD A++K+ +W LSTS LSS +  G
Sbjct: 499 HLQYAAWAADGQGVDRHLFGLKKMLREGEPVPSIYTDEAFSKTNNWELSTSNLSSPFLDG 558

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           +G+GEVV DGYG++Y I +  + + I SL+     L HYL E+ATE R + E
Sbjct: 559 WGYGEVVTDGYGLSYSIGDYHIRWTITSLKRQTAELKHYLAEAATETRLMME 610



>gi|393243184|gb|EJD50699.1| acyltransferase ChoActase/COT/CPT [Auricularia delicata TFB-10046
           SS5]
          Length = 637

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 186/291 (63%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVFENG++GF GEHS MDGTPT R+N+F+   IA  K+DHGS  V S L  P +L F+ 
Sbjct: 338 LIVFENGRSGFLGEHSCMDGTPTLRMNEFILGSIAKGKLDHGSAEVSSALLPPVELKFDE 397

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T  V   ++ +E  +D+ I KHDL VL Y  YGK +IK  G SPDA+ QM+ QLA+ K++
Sbjct: 398 TPAVKELVAASETRFDELIGKHDLHVLHYTAYGKALIKTFGVSPDAWAQMVKQLAFQKLF 457

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G     YES QTR+F  GRTEV R+ S +S  W +AM +       +A L   A   H +
Sbjct: 458 GRPGVCYESCQTRRFALGRTEVIRSASNESRAWAEAMLNPNATDAERARLLRAANVRHAQ 517

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A A +G+G DRHLFGL+  LK  E  P I+TD A+ ++ HW LSTSQLSS+Y  G+G+
Sbjct: 518 YAAWAADGQGVDRHLFGLKRMLKEGEDVPEIYTDKAFGQTNHWELSTSQLSSDYIDGWGY 577

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYA 291
           GEVV DGYG++Y I ++ L + I SL+ N + L   L+ +A E R + E A
Sbjct: 578 GEVVEDGYGLSYAIGDNYLRWTITSLKRNTEELKKALEWAANETRAMMERA 628



>gi|501310807|dbj|GAC99565.1| hypothetical protein PHSY_007167 [Pseudozyma hubeiensis SY62]
          Length = 650

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 186/287 (64%), Gaps = 1/287 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            I F NGK+GF GEHS MDGTPT RLNDF    +   ++D GS + R+ LP P+Q+ F  
Sbjct: 351 IITFANGKSGFMGEHSMMDGTPTLRLNDFAIQALQAGQIDLGS-SKRTDLPAPKQIQFKT 409

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              V + I ++ K+++  +  HDL +L ++GYGK  IKK   SPDA+VQM+IQLAY+KM+
Sbjct: 410 DKTVEAQIEESIKDFEKLMGSHDLSILDFQGYGKGAIKKFKCSPDAWVQMVIQLAYFKMF 469

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G    TYESAQTRKF+ GRTE  R+ SV+S+ + KAME  +     + E    A+  H+ 
Sbjct: 470 GKPCPTYESAQTRKFKWGRTETIRSASVESLAFCKAMESHEASDTERYEKFQAAVKQHLS 529

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A +G+G DRHLFGL+  LK  EK P I+ DPAY  S  W LSTSQ+SSE F  +G+
Sbjct: 530 YATAAADGQGVDRHLFGLKKLLKEGEKVPAIYEDPAYGASATWKLSTSQISSEVFACWGF 589

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV 287
           GEV P+G+G AY I  +SL   + SL+L    L HY+ E+A E+R +
Sbjct: 590 GEVTPEGFGCAYAIKENSLTLTLTSLKLGASDLRHYINEAAVELRDM 636



>gi|169858780|ref|XP_001836034.1| carnitine acetyl transferase [Coprinopsis cinerea okayama7#130]
 gi|116502915|gb|EAU85810.1| carnitine acetyl transferase [Coprinopsis cinerea okayama7#130]
          Length = 671

 Score =  269 bits (688), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 139/319 (43%), Positives = 197/319 (61%), Gaps = 31/319 (9%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP---NVRSGLPVPQQLH 57
            +++ENGK+ F GEHS MDGTPT R+N+F+   I   K+D        V   +  P++L 
Sbjct: 339 IVIYENGKSAFLGEHSCMDGTPTLRMNEFILASIDKGKIDLTPKLYEQVIDNVAAPEELV 398

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F    EV  A++ A + Y+  I  HDL+VL YEGYGK ++K+   SPDA+ Q++ QLA++
Sbjct: 399 FETNKEVEEAVNGALERYERLIGGHDLQVLHYEGYGKELMKQFKLSPDAWAQLVKQLAFH 458

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKV--PIEVKAELGYKAI 175
           KMY      YES QTRKF+ GRTEV RTVS +S  WV+AMED  V  P  ++  L   A+
Sbjct: 459 KMYKRPGVCYESCQTRKFKLGRTEVIRTVSNESKKWVEAMEDPSVTDPTYLRT-LFQTAV 517

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
           + H++Y   A +G+G DRHLFGL+  LK  E+ P I+TD A++KS HW LSTSQLSS+YF
Sbjct: 518 SRHIQYAGWAADGQGVDRHLFGLKKLLKEGEQVPAIYTDKAFSKSNHWELSTSQLSSKYF 577

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSL-------------------------RLNN 270
            G+G+GEVVPDG+G++Y I ++ + + + S                          R  N
Sbjct: 578 DGWGYGEVVPDGFGLSYSIGDNYVRWCVTSCEDEGVWDTEGKDEALRRRKVENGKARERN 637

Query: 271 DVLWHYLKESATEMRQVFE 289
            ++ HYL E+AT++R++ E
Sbjct: 638 ALMKHYLAEAATQVREMLE 656



>gi|331220307|ref|XP_003322829.1| hypothetical protein PGTG_04366 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309301819|gb|EFP78410.1| hypothetical protein PGTG_04366 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 643

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 189/303 (62%), Gaps = 3/303 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV ENG++GFN EHS MDGTP SR+ND++ + +AN K+D GS +  S LP P  + F L
Sbjct: 343 LIVCENGQSGFNAEHSCMDGTPVSRMNDWILDALANKKIDLGS-SFDSNLPAPTPIEFVL 401

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIK-KLGASPDAYVQMIIQLAYYKM 119
           +      I ++   + + ++   L VL Y GYGK VIK +   SPDA  Q+  QL +YK+
Sbjct: 402 SDTTKQNILRSVTKFHNLMSLQTLDVLEYPGYGKRVIKNQFKTSPDAIAQLTFQLGHYKL 461

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           +G    TYES QTRKF+ GRTEV R+ S++++ W KAMED       + E    A  AH+
Sbjct: 462 FGRVPVTYESCQTRKFKLGRTEVIRSCSIEALEWCKAMEDVNADWPTRLEKFKLAAKAHL 521

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
            Y  EA +G+G DRHL GLR+SLK  E+ P +F DP Y +ST+W LSTS L SEYF G G
Sbjct: 522 AYAKEASDGQGVDRHLLGLRLSLKPGEEMPALFQDPIYKESTNWILSTSTLPSEYFNGLG 581

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIK 299
           +G VVP+G+G+AY +N +S+ F + +   N   L + L E+A ++ ++   +Q   G   
Sbjct: 582 YGAVVPEGFGLAYAVNEESMRFTVTTTTGNGARLKYCLHEAADDIHKMMR-SQDGKGVPS 640

Query: 300 AKL 302
           AKL
Sbjct: 641 AKL 643



>gi|403162635|ref|XP_003322822.2| hypothetical protein PGTG_04359 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375173017|gb|EFP78403.2| hypothetical protein PGTG_04359 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 584

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 187/298 (62%), Gaps = 4/298 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV ENG++GFN EHS MDGTP +R+ND++ +V+AN K+D GS + ++ LP P  + F L
Sbjct: 284 LIVCENGESGFNAEHSCMDGTPVARMNDWIVDVLANKKIDLGS-SSQANLPAPSPIEFVL 342

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIK-KLGASPDAYVQMIIQLAYYKM 119
           +      I KA   +   +  H L V  Y  YG  VIK +  +SP+   QMI QL YYK+
Sbjct: 343 SDTTKQNILKAIMKFGRLMYPHTLEVFDYSSYGSRVIKSQFKSSPNTVAQMIFQLGYYKL 402

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           +G    T+E +QTRKF+ GRTEV R+ S++++ W KAME+       + E    A+ AH+
Sbjct: 403 FGRVPVTWEPSQTRKFKLGRTEVIRSCSIEALEWCKAMENDGADWSARLEKFKIAVKAHL 462

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
            Y  +A EG+  DRHL GLR+SLK  E+ P +F DP Y +ST W ++TS + SE F G+G
Sbjct: 463 SYSQQASEGQAVDRHLLGLRLSLKPGEEIPPLFQDPVYKESTSWKVATSHMPSENFSGFG 522

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQV--FEYAQAKA 295
           +G VVPDG+G+ Y +N +S+ F I +   N   L HYL+E+A ++ Q+  FE  Q+ A
Sbjct: 523 YGAVVPDGFGLGYAVNKESIRFTITTPTKNGARLNHYLQEAADDILQMMKFEKGQSSA 580



>gi|254570337|ref|XP_002492278.1| Carnitine acetyl-CoA transferase present in both mitochondria and
           peroxisomes, transfers activated a [Komagataella
           pastoris GS115]
 gi|238032076|emb|CAY69998.1| Carnitine acetyl-CoA transferase present in both mitochondria and
           peroxisomes, transfers activated a [Komagataella
           pastoris GS115]
 gi|328353716|emb|CCA40114.1| carnitine O-acetyltransferase [Komagataella pastoris CBS 7435]
          Length = 629

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 194/309 (62%), Gaps = 14/309 (4%)

Query: 2   IVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQ---LHF 58
            V ENG +GF GEHS MDGTPT  LND+V     N K+   + +  +     +Q   L++
Sbjct: 327 FVAENGSSGFLGEHSKMDGTPTLGLNDYV-----NKKLKSETYSFETASTSDKQWKFLNW 381

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           ++T    +AI +    +D  +   D+RV  Y G GK++IKK   SPDA++QM+IQLAYYK
Sbjct: 382 DITPATQTAIKQELATFDQTVNSLDIRVWQYPGLGKSLIKKFKLSPDAFIQMLIQLAYYK 441

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
           M G ++ TYESA TRKF  GRTE CR+VS +S+ +VK  +D  V    K      A+++H
Sbjct: 442 MTGISRPTYESASTRKFFRGRTETCRSVSKESLEYVKKWQDANVSDAEKVAAFRNAVSSH 501

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
           + Y+ +A  G+GCDRHLFGL+   +S E    +FTDP  A S HW LSTSQLSSE F GY
Sbjct: 502 LNYITKASNGQGCDRHLFGLKQQYQSGETVHELFTDPICAYSQHWFLSTSQLSSEEFNGY 561

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIV-----SLRLNNDVLWHYLKESATEMRQVFEYAQA 293
           GW  VVPDGYG+AYM+NN+ L+ N+       L L  DV+ +YL E+A E++++    + 
Sbjct: 562 GWSPVVPDGYGLAYMVNNEWLHVNVTVAKDNGLGLRADVMHYYLTEAANEIKELLT-NEL 620

Query: 294 KAGQIKAKL 302
              Q+KAKL
Sbjct: 621 NQNQLKAKL 629



>gi|403162641|ref|XP_003322828.2| hypothetical protein PGTG_04365 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375173020|gb|EFP78409.2| hypothetical protein PGTG_04365 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 622

 Score =  266 bits (679), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 130/303 (42%), Positives = 191/303 (63%), Gaps = 3/303 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV ENG++GFN EHS MDGTP +R+ND++ +V+A  K+D G+ + +S LP P  + F L
Sbjct: 322 LIVCENGESGFNAEHSCMDGTPVARMNDWIVDVLAKEKIDLGT-SSQSNLPTPSPIEFVL 380

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIK-KLGASPDAYVQMIIQLAYYKM 119
           +      I KA   ++  +  H L VL Y GYG  VIK +  +SPDA  QMI QL YYK+
Sbjct: 381 SDTNKQNILKAITKFESLMYPHTLEVLDYAGYGSRVIKSQFKSSPDAVAQMIFQLGYYKL 440

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           +G    T+E + TRKF+ GRTEV R+ S++++ W KAME+       + E    A+ AH+
Sbjct: 441 FGRVPVTWEPSHTRKFKLGRTEVIRSCSIEALEWCKAMENDGADWNGRLERFKIAVKAHL 500

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
            Y  +A EG+  DRHL GLR+SL   E+ P +F DP Y +ST W L+TS + SE F G+G
Sbjct: 501 SYSQQASEGQAVDRHLLGLRLSLNPGEEIPALFRDPVYKESTSWTLATSPMPSENFNGFG 560

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQIK 299
           +G VVPDG+G+ Y +N +S+ F + +   N   L H L+E+A ++ ++ ++ + ++  I 
Sbjct: 561 YGAVVPDGFGLGYAVNKESIRFTVTTPTENGARLKHCLQEAADDILKMMKFEKGQSS-IS 619

Query: 300 AKL 302
           AKL
Sbjct: 620 AKL 622



>gi|325093205|gb|EGC46515.1| carnitine acetyl transferase [Ajellomyces capsulatus H88]
          Length = 624

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 179/288 (62%), Gaps = 17/288 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV ENG AGF GEHS MDGTPT RLND+V  +I NN++D+ +P +RS LP PQ +HF L
Sbjct: 341 FIVNENGTAGFMGEHSMMDGTPTHRLNDYVNYMIFNNRLDYSNPEIRSTLPDPQPIHFEL 400

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
             + L  I+ A   +   I +H+LRV +  G  K +IK   A+                 
Sbjct: 401 NKQALDDIATASHAFTTVIGQHELRVPSLPGLRKGLIKNSNAA----------------- 443

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
            T   TYESA TRKFQ GRTE  R+VS +SV + ++  D  V  E   +    A+ AH K
Sbjct: 444 QTPIPTYESASTRKFQLGRTETTRSVSDESVAFCRSHADINVTREQVVKNFRAALAAHTK 503

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y A+A  G+G DRHLFGL+  +   EK P +F DPAY+ S+ W +S+SQLSSEYF GYGW
Sbjct: 504 YTADASVGKGVDRHLFGLKKLIADGEKVPALFQDPAYSYSSTWFISSSQLSSEYFNGYGW 563

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            +VV DG+GIAYMIN +S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 564 SQVVDDGFGIAYMINENSIQFNIVCKKLGAERMSFYLNEAACEIRELL 611



>gi|348681826|gb|EGZ21642.1| hypothetical protein PHYSODRAFT_557588 [Phytophthora sojae]
          Length = 633

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 192/310 (61%), Gaps = 14/310 (4%)

Query: 2   IVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQL 56
           +VFENGKAG  GEHS +DG P +R  D++ + + + +VD G     +  +   L  P+QL
Sbjct: 329 VVFENGKAGLLGEHSMLDGMPMARYADYLLSRLHHGQVDLGPRGQTTAQLERSLVAPKQL 388

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F  T++ L  I++AEK +D  +  H++ V A+ GYG   IK    SPDA+VQ+ IQLAY
Sbjct: 389 TFRFTAQTLRNIAEAEKVFDQTVIDHEVFVQAFYGYGARAIKGFRCSPDAFVQLAIQLAY 448

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQK--VPIEVKAELGYKA 174
            K++  N ATYE++QTR F HGRTE  R+ S  S  +  AMED    V  E K +L   A
Sbjct: 449 KKLFKKNVATYEASQTRVFLHGRTETTRSCSAASARFTDAMEDASGAVTAEEKKKLLLAA 508

Query: 175 INAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
            NAHV YM +A  GRG DRH+ GL++ ++  E+ P  F DP  A+++ W +STS L++E 
Sbjct: 509 ANAHVAYMRKAGAGRGVDRHILGLKLLVQPGERVP-FFEDPVMARASRWLISTSHLTNEL 567

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN--DVLWHYLKESATEMRQVFEYAQ 292
           F G+GWGEVVP+G GIAY + + S+ FNI   +  +    + H L+ES  EM+Q+F    
Sbjct: 568 FDGWGWGEVVPEGLGIAYSVKDQSIQFNIACRQHGSWGARMGHLLEESLIEMQQLF---- 623

Query: 293 AKAGQIKAKL 302
           A++  I AKL
Sbjct: 624 AQSKDIGAKL 633



>gi|301107011|ref|XP_002902588.1| choline/Carnitine O-acyltransferase, putative [Phytophthora
           infestans T30-4]
 gi|262098462|gb|EEY56514.1| choline/Carnitine O-acyltransferase, putative [Phytophthora
           infestans T30-4]
          Length = 633

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 191/311 (61%), Gaps = 14/311 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
            +VFENGKAG  GEHS +DG P +R  +++ + + N ++D G     +  +   L  P+Q
Sbjct: 328 LVVFENGKAGLLGEHSMLDGMPMARYTEYLVSRLHNGQIDLGPRGQTTQQLELSLAAPKQ 387

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F  T++ L  I++AEK +D  +  H++ V  + GYG   IK    SPDA+VQ+ IQLA
Sbjct: 388 LTFRFTTQTLRNIAEAEKVFDQTVVDHEVFVQVFYGYGARSIKGFRCSPDAFVQLAIQLA 447

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQ--KVPIEVKAELGYK 173
           Y K++  N ATYE++QTR F HGRTE  R+ SV S  +  AMED    V  E K +L   
Sbjct: 448 YKKLFKKNAATYEASQTRLFLHGRTETTRSCSVASAKFTDAMEDASGSVATEEKKKLLLA 507

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           A NAHV YM +A  GRG DRH+ GL++ ++  E+ P  F DP  A+++ W +STS L++E
Sbjct: 508 AANAHVAYMRKAGGGRGVDRHILGLKLLVQPGERVP-FFEDPVMARASRWLISTSHLTNE 566

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN--DVLWHYLKESATEMRQVFEYA 291
            F G+GWGEVVP+G GIAY + + S+ FNI   +  +    + H L+ES  EM+Q+F   
Sbjct: 567 LFDGWGWGEVVPEGLGIAYSVKDQSIQFNIACRQHGSWGARMGHLLEESLVEMQQLF--- 623

Query: 292 QAKAGQIKAKL 302
             +  +I AKL
Sbjct: 624 -TEQKEIGAKL 633



>gi|260946916|ref|XP_002617755.1| hypothetical protein CLUG_01214 [Clavispora lusitaniae ATCC 42720]
 gi|238847627|gb|EEQ37091.1| hypothetical protein CLUG_01214 [Clavispora lusitaniae ATCC 42720]
          Length = 620

 Score =  256 bits (655), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 191/312 (61%), Gaps = 17/312 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN-------NKVDHGSPNVRSGLP-V 52
           F + +NG +GF GEHS MD TPT +LN+F+   I+        + +   S +  S +P +
Sbjct: 312 FFISKNGNSGFLGEHSRMDATPTVQLNNFILQNISKEDPEAFISDILADSAHAASLVPEL 371

Query: 53  PQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMII 112
           P  L F+++ +  + IS A   +   IA HD  V  Y GYGKN+IK+   SPDAYVQM+I
Sbjct: 372 PSVLPFDISLQTRADISSAIAKFQRTIASHDQEVFQYYGYGKNLIKQFKVSPDAYVQMMI 431

Query: 113 QLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
           QLAYYK+ G  + TYESA TRK+  GRTE  R+VSV+S  +V+   + K   E K     
Sbjct: 432 QLAYYKLTGKVRPTYESAATRKYLKGRTETGRSVSVESKKFVETWTNTKASAEEKIASFN 491

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSS 232
            A   HVKY+ EA +G+G DRHLFGL   +K  E  P IFTDP +  S+ W LSTSQ+ S
Sbjct: 492 AACKQHVKYLVEAADGKGVDRHLFGLSQMIKQGENTPAIFTDPVFKYSSTWYLSTSQVPS 551

Query: 233 EYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVFE 289
           E+FQ +GW +V+ +G+G+AY++NN+ L  +I   +   L +D + +YL E+A EM+QV  
Sbjct: 552 EFFQSWGWSQVIDEGFGLAYLVNNEWLQVHISCKKGSGLRSDYMKYYLTETANEMKQVL- 610

Query: 290 YAQAKAGQIKAK 301
                + Q+ AK
Sbjct: 611 -----SAQLPAK 617



>gi|294656940|ref|XP_002770339.1| DEHA2D17996p [Debaryomyces hansenii CBS767]
 gi|199431852|emb|CAR65693.1| DEHA2D17996p [Debaryomyces hansenii CBS767]
          Length = 632

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 138/303 (45%), Positives = 183/303 (60%), Gaps = 18/303 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFV------------CNVIANNKVDHGSPNVRS 48
           F +  NG +GF GEHS MD TPT +LN+FV             + IAN+        V +
Sbjct: 323 FFISSNGNSGFLGEHSKMDATPTVQLNNFVYSQLAKENPATVLSEIANDTKQLTDLQVEA 382

Query: 49  GLPVPQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYV 108
              +PQ L F++   V + I++A   +++ I+  D     Y GYGKN+IK+   SPDAYV
Sbjct: 383 ---IPQVLQFDINPVVRNEINQAVVKFNETISSLDQETFQYFGYGKNLIKQFKVSPDAYV 439

Query: 109 QMIIQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKA 168
           QM++QLAY+KM G  + TYESA TRK+  GRTE  R VSV+S  +VK   D     E K 
Sbjct: 440 QMLMQLAYFKMTGKIRPTYESAATRKYLKGRTETGRPVSVESAAFVKTWTDNNATTEDKV 499

Query: 169 ELGYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTS 228
                A   HVKY+ +A +G+G DRHLFGL+  LK NE  P IFTD  Y  S+ W LSTS
Sbjct: 500 AAFQAACKQHVKYLGDAADGKGVDRHLFGLKQMLKPNEPVPEIFTDDVYGYSSSWYLSTS 559

Query: 229 QLSSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMR 285
           Q+ SEYFQ +G+ +V  DG+G+AY+IN+D LN +I   +   L +DVL  YL ESA EM+
Sbjct: 560 QIPSEYFQSWGFSQVTDDGFGLAYLINSDWLNVHISCRKGNGLRSDVLKWYLVESANEMK 619

Query: 286 QVF 288
           Q+ 
Sbjct: 620 QIL 622



>gi|320580332|gb|EFW94555.1| Carnitine acetyl-CoA transferase [Ogataea parapolymorpha DL-1]
          Length = 623

 Score =  253 bits (645), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 191/307 (62%), Gaps = 16/307 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F V  NG +GF GEHS MDGTPT R+ND++   +   +     P      P+ ++L F++
Sbjct: 328 FFVSRNGTSGFLGEHSKMDGTPTLRMNDWLVRELEKMQ----PPEDTYSTPLFRELQFDV 383

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           +++  +AI +A+ ++D  +   DLRV  + G GK+ IK   ASPDA++QM+IQLAYYK  
Sbjct: 384 SAKTQTAIEEAKASFDKTVDALDLRVWQFHGLGKSHIKLFKASPDAFIQMLIQLAYYKYT 443

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT + TYESA TRK+  GRTE CR+VS +S+++V+  ED     E K      A++AHV+
Sbjct: 444 GTVRPTYESASTRKYFAGRTETCRSVSNESLHFVRTWEDVSATKEQKIAAFRDAVSAHVE 503

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G G DRHLFGL  +    E+K   F DP +A S++W LSTSQLSSE F GYGW
Sbjct: 504 YITAASDGHGVDRHLFGL--AQMCEEEKHDFFKDPIFAYSSYWYLSTSQLSSEQFNGYGW 561

Query: 241 GEVVPDGYGIAYMINNDSLNFNIV-----SLRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
             VVP+G G+AYM+NND L+ N+       L L  D + +YL  +A E+++        +
Sbjct: 562 APVVPEGLGLAYMVNNDWLHVNVTVFKNNQLGLEADKMVYYLGLAARELKEAL-----TS 616

Query: 296 GQIKAKL 302
             IKAKL
Sbjct: 617 ETIKAKL 623



>gi|465794023|emb|CCU98924.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 599

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 180/297 (60%), Gaps = 2/297 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IVF+NG +G+ GEHS MDGT T RLN+F+   +   K+D    +  S L  P++L   +
Sbjct: 303 IIVFDNGMSGYVGEHSMMDGTQTLRLNNFMLAALQAGKIDLTGTSSGSVLDEPERLDIKV 362

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           + E+  A   A   + + +   D+ VL +  YGK+ IK    SPDA+ QM IQL +YK+Y
Sbjct: 363 SPEISKAAKDASAGFVELMDGQDISVLDFSAYGKSAIKSYKCSPDAWAQMCIQLGFYKLY 422

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYE+AQTRKF+ GRTE  R+ SV+S+ + KAMED  V    +      A   H+K
Sbjct: 423 GHPCATYEAAQTRKFKLGRTETIRSTSVESLAFCKAMEDPNVSDAERLSKFQAAAAQHIK 482

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y  EA EG G DRHLFGL+  +K  E+ P +F DP  A S  W LSTSQ+SS+ F  +G+
Sbjct: 483 YAKEASEGAGVDRHLFGLKRLIKEGEEVPALFKDPMNAISGTWILSTSQISSDMFDAWGF 542

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV--LWHYLKESATEMRQVFEYAQAKA 295
           GEV P G+G+AY I +++L F I+ L+  +    L HY+ ++A E+R V +    +A
Sbjct: 543 GEVTPKGFGVAYAIKDNALTFTIMCLKAEHKASRLTHYIHQAALELRAVHDRVALQA 599



>gi|299470771|emb|CBN79817.1| Carnitine/choline O-acyltransferase [Ectocarpus siliculosus]
          Length = 636

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 184/310 (59%), Gaps = 13/310 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCN-----VIANNKVDHGSPNVRSGLPV--P 53
            +VF NGKAG  GEHS MDG PT RL DF+          ++     SP   S + V  P
Sbjct: 328 IVVFRNGKAGLVGEHSMMDGMPTLRLADFMMKKTMGFSADSSAGSDSSPESWSPVAVTPP 387

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
           + L   L+   L AI+ AE  +D  + +H++ VL + GYG N IKK   SPDA+VQM +Q
Sbjct: 388 RPLDLALSPASLRAIASAEVAFDRLVNQHEMDVLEFTGYGANTIKKFKISPDAFVQMALQ 447

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQ--KVPIEVKAELG 171
           LA +KM G   ATYE AQ RKF HGRT   R++S  + +WV +MED+  + P   +  L 
Sbjct: 448 LAVFKMTGEMWATYEPAQVRKFLHGRTACVRSLSSAAKDWVLSMEDEGDRRPTPHRLGLL 507

Query: 172 YKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            +A  +H++Y   A EG+  DRHLFGL+  L ++E   ++FTDP +++S HW +STS L+
Sbjct: 508 RRAAESHIEYARSAAEGKDVDRHLFGLQRVLAADESC-SVFTDPVFSRSKHWRMSTSHLT 566

Query: 232 SEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLN---NDVLWHYLKESATEMRQVF 288
            E F G+GWGEVVPDG G+AY I   SL F +   R     +  L H+L+E+  +MR + 
Sbjct: 567 HEQFDGWGWGEVVPDGVGVAYSIKKSSLLFTVACRRRPEGWSSGLCHHLQEALLDMRALC 626

Query: 289 EYAQAKAGQI 298
           E+A     ++
Sbjct: 627 EHADGVGSKL 636



>gi|150951215|ref|XP_001387498.2| ceramide glucosyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149388411|gb|EAZ63475.2| ceramide glucosyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 611

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 182/295 (61%), Gaps = 8/295 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPV----PQQL 56
           F V  NG +GF GEHS MD TPT +LN+ V   I           + +G PV     + L
Sbjct: 307 FFVSANGNSGFLGEHSRMDATPTVQLNNTVYKKITEEDPKALLQEIAAG-PVEIAKTELL 365

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F+L     + I+ A + +D  IA H   +  + GYGK +IKK   SPDAYVQ+++QLAY
Sbjct: 366 EFDLNPTSRANIATAVEKFDKTIAAHHEEIFQHYGYGKGLIKKFKVSPDAYVQLLMQLAY 425

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAIN 176
           YK+ G  + TYESA TRKF  GRTE  R+VS++S  +V+   +    IE K E   KA  
Sbjct: 426 YKLTGKVRPTYESAATRKFLKGRTETGRSVSIESKAFVETWTNPDASIEQKVESFQKAAK 485

Query: 177 AHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQ 236
            HV Y++EA +G+G DRHLFGL+  L+  EK P IFTDP ++ S  W +S+SQ+ SEYFQ
Sbjct: 486 QHVAYLSEAADGKGVDRHLFGLKQMLQPGEKVPEIFTDPIFSYSQTWYISSSQIPSEYFQ 545

Query: 237 GYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
            +GW +V+ +G+G+AY+INND ++ +I + R   L +D L  +L ESA +M+ V 
Sbjct: 546 SWGWSQVIDEGFGLAYLINNDWIHVHISAKRGNGLRSDHLKWFLVESANQMKDVL 600



>gi|354547593|emb|CCE44328.1| hypothetical protein CPAR2_401300 [Candida parapsilosis]
          Length = 636

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 180/299 (60%), Gaps = 16/299 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDH-------GSPNVRSGLPVP 53
           F V  NG +GF GEHS MD TPT ++N+ V   IA    D         +P V     +P
Sbjct: 332 FFVSANGNSGFLGEHSRMDATPTVQMNNTVLKQIAETNPDELIAEIATVTPKVGRAEIIP 391

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
             L+      ++SA++K    +D  IA HD  +  + GYGKN+IKK   SPDAYVQM++Q
Sbjct: 392 FDLNPTSRQNIVSAVAK----FDATIAAHDEEIFQHYGYGKNLIKKFKTSPDAYVQMLMQ 447

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           LAYYK+ G  + TYESA TRKF  GRTE  RTVS +S  +V+   D K  IE K      
Sbjct: 448 LAYYKLTGKVRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTDPKASIEEKVATFQA 507

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           A   HV Y++ A +G+G DRHLFGL+  LK  E+ P IFTDP +  S  W +S+SQ+ SE
Sbjct: 508 ATKQHVAYLSSAADGKGVDRHLFGLKQMLKPGEEVPEIFTDPIFTYSQSWYISSSQVPSE 567

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV----LWHYLKESATEMRQVF 288
           +FQ +GW +V+ DG+G+AY+INND ++ +I S +  N +    L  +L +SA EM+ V 
Sbjct: 568 FFQSWGWSQVIDDGFGLAYLINNDWIHVHI-SCKYGNGLSSAQLKWFLVDSANEMQDVL 625



>gi|164656533|ref|XP_001729394.1| hypothetical protein MGL_3429 [Malassezia globosa CBS 7966]
 gi|159103285|gb|EDP42180.1| hypothetical protein MGL_3429 [Malassezia globosa CBS 7966]
          Length = 545

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 189/301 (62%), Gaps = 3/301 (0%)

Query: 2   IVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNLT 61
           +V ENG +G+ GEHS MDG+ T RLN+F+ + +   K++ G P+  S L  P+ L F++ 
Sbjct: 244 VVSENGASGYIGEHSMMDGSQTLRLNNFMVSALEAGKIELGGPSSGSVLDDPEFLSFDVN 303

Query: 62  SEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMYG 121
           +++ +A + A +++   + + D+ VL +  YGK  IK+   SPDA+ QM IQLA+YKM+G
Sbjct: 304 ADLSNASNAAGQDFASLMDEQDMSVLDFTAYGKEAIKQYKCSPDAWAQMCIQLAFYKMFG 363

Query: 122 TNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVKY 181
              ATYE+AQTRKF+ GRTE  R+ S++S+ + +AM+D       + E    A+  HVK 
Sbjct: 364 HPCATYEAAQTRKFKLGRTETIRSCSLESLAFCQAMQDTNATDAERYEKFQAAVTRHVKN 423

Query: 182 MAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGWG 241
             EA EG G DRHLFGL+  ++  E+ P +F DP  A+S  W LSTSQ+SSE F  +G+G
Sbjct: 424 AKEAAEGAGVDRHLFGLKRLIQQGEEPPALFRDPMNAQSGTWILSTSQISSEVFDAWGFG 483

Query: 242 EVVPDGYGIAYMINNDSLNFNIVSLRLNNDV--LWHYLKESATEMRQVFEYA-QAKAGQI 298
           EV P G+G+AY I N++L F I+ L+  +       +L E+  E+R + +   QAK+   
Sbjct: 484 EVTPKGFGVAYAIKNNALTFTIMCLKKVHSASRFTFFLNEAGIELRAMHDRLNQAKSASP 543

Query: 299 K 299
           K
Sbjct: 544 K 544



>gi|328859489|gb|EGG08598.1| hypothetical protein MELLADRAFT_42869 [Melampsora larici-populina
           98AG31]
          Length = 615

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 181/289 (62%), Gaps = 2/289 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV ENG++GFN EHS MDGTP + +ND++ + + N  +D GS +  S LP P+ + F +
Sbjct: 316 LIVCENGQSGFNAEHSCMDGTPVATMNDWILSRLENKSIDLGS-SSDSNLPTPKPITFEI 374

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKK-LGASPDAYVQMIIQLAYYKM 119
           ++     ISKA +N+   ++   L VL Y G+GK  IKK   ASPDA  Q+ +QL +YK+
Sbjct: 375 STRTKENISKAIENHQKLMSAQTLDVLQYVGFGKQTIKKYFKASPDAIAQLTLQLGHYKL 434

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHV 179
           +G+   TYESAQTRKF+ GRTEV R  S++++ W KAM +  V  E K +   +A  +HV
Sbjct: 435 FGSVPVTYESAQTRKFKMGRTEVIRACSIEALEWCKAMVNLDVDQETKIQKFREAEKSHV 494

Query: 180 KYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           +Y   A  G G DRHL GLR+ LK  EK P +F D  Y KST W  STS L SEYF G G
Sbjct: 495 RYANWASNGEGVDRHLLGLRLLLKPGEKMPKLFEDETYKKSTTWIFSTSTLPSEYFNGLG 554

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
           +G VV +GYGIAY +N+ S+ F I +   N   L   L+E+A +++ + 
Sbjct: 555 YGPVVSEGYGIAYAVNDQSMRFTITTTTGNGKRLKESLQEAAEDIKALL 603



>gi|321249555|ref|XP_003191489.1| carnitine acetyltransferase [Cryptococcus gattii WM276]
 gi|317457956|gb|ADV19702.1| Carnitine acetyltransferase, putative [Cryptococcus gattii WM276]
          Length = 630

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 188/311 (60%), Gaps = 13/311 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVD---HGSPNVRSGLPVPQQLH 57
            IV   G++GFNGEHS +DGTPT RLN+F+     +NK+      S   R     P++L 
Sbjct: 322 IIVDSQGESGFNGEHSMLDGTPTLRLNEFILASTDSNKIPLELDSSETSRRSTTEPEELK 381

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L  ++   ++++++ +++ + K DL+++A+  YGKN+IK    SPDA+ Q+I QLA+Y
Sbjct: 382 FELDDKLKQIVAQSKREFEEEMEKQDLKMVAFGEYGKNLIKTYRVSPDAWTQLIFQLAFY 441

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKV--PIEVKAELGYKAI 175
           +++     TYES QTRKF  GRTEV R+ S +   WV+AM ++      + +  L  KA+
Sbjct: 442 RLFQRLPVTYESCQTRKFLLGRTEVIRSASNEGKAWVEAMVNENFLGGDQGRERLFRKAV 501

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV+Y   A + +G DRHLFGL+  +   E  P IF+DPA+A+S+HW LSTS L S Y 
Sbjct: 502 ERHVQYAVWAADAQGVDRHLFGLKKLIAPGEPTPEIFSDPAFARSSHWELSTSNLGSRYL 561

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV------LWHYLKESATEMRQVFE 289
            G+G+GEVV DG+G++Y I +DSL + I   +  N        L H L  +A EM  + E
Sbjct: 562 DGWGYGEVVEDGFGLSYSIEDDSLKWGITKKKGANGALASAAELGHALGAAAREMASMME 621

Query: 290 YAQAKAGQIKA 300
             +AK  + KA
Sbjct: 622 --RAKTAKTKA 630



>gi|401888506|gb|EJT52462.1| carnitine acetyltransferase [Trichosporon asahii var. asahii CBS
           2479]
          Length = 608

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 191/304 (62%), Gaps = 5/304 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP-NVRS-GLPVPQQLHF 58
            IV     +GFNGEHS +DGTPT RLN+F+   +    +    P N R+ G   P+++ F
Sbjct: 308 IIVDSEANSGFNGEHSMLDGTPTLRLNEFILASLDKGVIPLELPENERAKGELKPEEITF 367

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           +L  +    I+K++K + + +AK DL ++ + GYGK++IK+   SPDA+ Q++ QLA+Y+
Sbjct: 368 DLDQKAKDDITKSQKGFGEEMAKQDLTMVTFTGYGKSLIKQFKVSPDAWAQIVKQLAFYR 427

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
           + G     YES QTRKF  GRTEV RTVS +   +++AM D K   E +A+L   A   H
Sbjct: 428 LKGRPGTCYESCQTRKFLLGRTEVIRTVSNELRAFLEAMTDPKCSDEKRAKLFRAACARH 487

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
            +Y A A   +G DRHL+GL+  +K  E+ P +F DP +AKS+HW LSTSQL+S+Y  G+
Sbjct: 488 SQYSAWAANAQGVDRHLYGLKKLIKEGEEVPAMFQDPIFAKSSHWELSTSQLTSKYLDGW 547

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQI 298
           G+GEVV DGYG++Y I++  L + I +L  +   +   L+++A E++ V   A   A Q 
Sbjct: 548 GYGEVVADGYGMSYAIHDGKLCWGITTLNGDAKEMAQALQDAAEELKNVMTRA---AEQE 604

Query: 299 KAKL 302
           K+KL
Sbjct: 605 KSKL 608



>gi|405117894|gb|AFR92669.1| carnitine acetyltransferase [Cryptococcus neoformans var. grubii
           H99]
          Length = 630

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 172/269 (63%), Gaps = 5/269 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVD---HGSPNVRSGLPVPQQLH 57
            IV   G++GFNGEHS +DGTPT RLN+F+   I + K+      S   R     P++L 
Sbjct: 322 IIVDSEGESGFNGEHSMLDGTPTLRLNEFILASIDSQKIPLELDSSETSRYSTTEPEELK 381

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L  ++   + ++++ +++ + K DL+++ +  YGKN+IK    SPDA+ Q+I QLA+Y
Sbjct: 382 FELDDKLKQIVEQSKRGFEEEMEKQDLKMVTFREYGKNLIKTYRTSPDAWAQLIFQLAFY 441

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVP--IEVKAELGYKAI 175
           +++    ATYES QTRKF  GRTEV R+ S +   WV+AM ++  P   E + +L  KA+
Sbjct: 442 RLFQRLPATYESCQTRKFLLGRTEVIRSASNEGKAWVEAMINESFPEGDEGREKLFRKAV 501

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV+Y   A + +G DRHLFGL+  +   E  P IF+DPA+A+S+HW LSTS L S Y 
Sbjct: 502 ERHVQYAVWAADAQGVDRHLFGLKKLIAPGEPTPEIFSDPAFARSSHWELSTSNLGSRYL 561

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIV 264
            G+G+GEVV DG+G++Y I +D+L + I 
Sbjct: 562 DGWGYGEVVEDGFGLSYSIEDDALRWGIT 590



>gi|406702071|gb|EKD05139.1| carnitine acetyltransferase [Trichosporon asahii var. asahii CBS
           8904]
          Length = 772

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 191/304 (62%), Gaps = 5/304 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSP-NVRS-GLPVPQQLHF 58
            IV     +GFNGEHS +DGTPT RLN+F+   +    +    P N R+ G   P+++ F
Sbjct: 472 IIVDSEANSGFNGEHSMLDGTPTLRLNEFILASLDKGVIPLELPENERAKGELKPEEITF 531

Query: 59  NLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           +L  +    I+K++K + + +AK DL ++ + GYGK++IK+   SPDA+ Q++ QLA+Y+
Sbjct: 532 DLDQKAKDDITKSQKGFGEEMAKQDLTMVTFTGYGKSLIKQFKVSPDAWAQIVKQLAFYR 591

Query: 119 MYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAH 178
           + G     YES QTRKF  GRTEV RTVS +   +++AM D K   E +A+L   A   H
Sbjct: 592 LKGRPGTCYESCQTRKFLLGRTEVIRTVSNELRAFLEAMTDPKCSDEKRAKLFRAACARH 651

Query: 179 VKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGY 238
            +Y A A   +G DRHL+GL+  +K  E+ P +F DP +AKS+HW LSTSQL+S+Y  G+
Sbjct: 652 SQYSAWAANAQGVDRHLYGLKKLIKEGEEVPAMFQDPIFAKSSHWELSTSQLTSKYLDGW 711

Query: 239 GWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAGQI 298
           G+GEVV DGYG++Y I++  L + I +L  +   +   L+++A E++ V   A   A Q 
Sbjct: 712 GYGEVVADGYGMSYAIHDGKLCWGITTLNGDAKEMAQALQDAAEELKNVMTRA---AEQE 768

Query: 299 KAKL 302
           K+KL
Sbjct: 769 KSKL 772



>gi|149237006|ref|XP_001524380.1| carnitine O-acetyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146451915|gb|EDK46171.1| carnitine O-acetyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 636

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/294 (43%), Positives = 177/294 (60%), Gaps = 6/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLP---VPQQLH 57
           F V  NG +GF GEHS MD TPT ++N+ +   I+  K +     + S  P      +L 
Sbjct: 332 FFVSANGNSGFLGEHSRMDATPTVQMNNTILKQISETKPEELIAEIGSVAPKVGPADKLS 391

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F++     + I+ A   +D+ IA HD  +  + GYGK +IKK   SPDAYVQM++QLAYY
Sbjct: 392 FDINPTTRANIASAIVKFDETIAAHDEEIFQHYGYGKGLIKKFKCSPDAYVQMLMQLAYY 451

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           K+ G  + TYESA TRKF  GRTE  RTVS +S  +V+   D    IE K      A   
Sbjct: 452 KLTGKVRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTDPNSSIEDKVATFQAATKQ 511

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV Y++ A +G+G DRHLFGL+  LK  E  P IF DP +A S  W +S+SQ+ SE+FQ 
Sbjct: 512 HVAYLSAAADGKGVDRHLFGLKSMLKPGEPVPEIFQDPIFAYSQTWYISSSQVPSEFFQS 571

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  +L +SA +M+ V 
Sbjct: 572 WGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLKSDQLKWFLVDSANQMQDVL 625



>gi|448529495|ref|XP_003869856.1| Cat2 major carnitine acetyl transferase [Candida orthopsilosis Co
           90-125]
 gi|380354210|emb|CCG23723.1| Cat2 major carnitine acetyl transferase [Candida orthopsilosis]
          Length = 637

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/295 (44%), Positives = 176/295 (59%), Gaps = 8/295 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQ---LH 57
           F V  NG +GF GEHS MD TPT ++N+ V   IA    D     + +  P   +   L 
Sbjct: 333 FFVSANGNSGFLGEHSRMDATPTVQMNNTVLKQIAETNPDELIAEIATVAPKVGKADILP 392

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F+L       I  A   +D  IA HD  +  + GYGKN+IKK   SPDAYVQM++QLAYY
Sbjct: 393 FDLNPTSRQNIGSAVAKFDATIAAHDEEIFQHYGYGKNLIKKFKTSPDAYVQMLMQLAYY 452

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           K+ G  + TYESA TRKF  GRTE  RTVS +S  +V+   + K  IE K      A   
Sbjct: 453 KLTGKVRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTNPKATIEEKVATFQAATKQ 512

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV Y++ A +G+G DRHLFGL+  LK  E+ P IFTDP +  S  W +S+SQ+ SEYFQ 
Sbjct: 513 HVAYLSSAADGKGVDRHLFGLKQMLKPGEEIPEIFTDPIFTYSQTWYISSSQVPSEYFQS 572

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV----LWHYLKESATEMRQVF 288
           +GW +V+ DG+G+AY+INND ++ +I S +  N +    L  +L +SA EM+ V 
Sbjct: 573 WGWSQVIDDGFGLAYLINNDWIHVHI-SCKYGNGLSSAQLKWFLVDSANEMQDVL 626



>gi|402223185|gb|EJU03250.1| acyltransferase ChoActase/COT/CPT [Dacryopinax sp. DJM-731 SS1]
          Length = 634

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 187/303 (61%), Gaps = 13/303 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGL--PV---PQQ 55
           FIVF+N ++GF GEHS+MDGTPT R+N+F+   +   K++    +   G   P+   P++
Sbjct: 311 FIVFDNARSGFLGEHSAMDGTPTLRMNEFILAALEAGKLESPKKDQDEGKSNPLNLDPEE 370

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +  +V   I+++E  +D+ +AKH++RVL Y  YG ++IK    SPDA+ Q+++QLA
Sbjct: 371 LVFEVNDQVKEKIAESETMFDEVMAKHEMRVLHYTAYGSDLIKSYKCSPDAWAQLVMQLA 430

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           ++  +      YES QTRKF+ GRTEV R+ S +S  W + M D  V   V+ E+  KA+
Sbjct: 431 WHLSFSRPGVCYESCQTRKFRRGRTEVIRSSSEESRLWAEGMLDPDVSDGVRKEMFLKAV 490

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             H++Y  +A  G G DRHL GLRM L+ +E  P     P   K+ +W +STSQLSS Y 
Sbjct: 491 QRHLEYAGQAANGLGVDRHLLGLRMVLRPSESHP-FLDSPLMQKTKNWEMSTSQLSSAYV 549

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNND------VLWHYLKESATEMRQVFE 289
           QG+G+ EVVP+GYG+AY I+ D L + I  L+   +      + W Y++E+A  +R++  
Sbjct: 550 QGWGYAEVVPEGYGLAYAIHPDHLRWTITCLKGEGEGGRAERMAW-YIEEAAGRVRRMMR 608

Query: 290 YAQ 292
            A+
Sbjct: 609 SAR 611



>gi|344229148|gb|EGV61034.1| acyltransferase ChoActase/COT/CPT [Candida tenuis ATCC 10573]
          Length = 617

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 180/296 (60%), Gaps = 8/296 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIA--NNKVDHGSPNVRSGLP---VPQQ 55
           F V  NG +GF GEHS MD TPT ++N++V + I+  N K   G   +   L    VP+ 
Sbjct: 313 FFVGANGNSGFLGEHSRMDATPTVQMNNWVLSEISKENPKNFIGEATLEPTLSAELVPEL 372

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L +++  +V S I  A ++++  I  HD  +  Y GYGKN+IK+   SPDAYVQM++QLA
Sbjct: 373 LEWDINPKVRSDIYNAIESFNKTIEAHDEEIFQYYGYGKNLIKQFKVSPDAYVQMLMQLA 432

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           YYK  G  + TYESA TRKF  GRTE  R  S +S  +V+   D     E K      A 
Sbjct: 433 YYKYTGKVRPTYESAATRKFLKGRTETGRVTSNESKKFVETWTDVDASTEDKINTFNAAC 492

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV Y+ EA +G+G DRHLFGL+  LKS E  P IFTDP ++ S  W +S+SQ+ SEYF
Sbjct: 493 KQHVGYLVEAADGKGVDRHLFGLKQMLKSGEPVPEIFTDPVFSYSQTWYISSSQIPSEYF 552

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           Q +GW +V+ DG+G+AY+IN D ++ +I   +   L +  L  YL E+A EM+++ 
Sbjct: 553 QSWGWSQVIDDGFGLAYLINKDWIHVHISCKKGNGLESKYLKWYLTEAANEMKEIL 608



>gi|344229149|gb|EGV61035.1| hypothetical protein CANTEDRAFT_116222 [Candida tenuis ATCC 10573]
          Length = 605

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 180/296 (60%), Gaps = 8/296 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIA--NNKVDHGSPNVRSGLP---VPQQ 55
           F V  NG +GF GEHS MD TPT ++N++V + I+  N K   G   +   L    VP+ 
Sbjct: 301 FFVGANGNSGFLGEHSRMDATPTVQMNNWVLSEISKENPKNFIGEATLEPTLSAELVPEL 360

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L +++  +V S I  A ++++  I  HD  +  Y GYGKN+IK+   SPDAYVQM++QLA
Sbjct: 361 LEWDINPKVRSDIYNAIESFNKTIEAHDEEIFQYYGYGKNLIKQFKVSPDAYVQMLMQLA 420

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           YYK  G  + TYESA TRKF  GRTE  R  S +S  +V+   D     E K      A 
Sbjct: 421 YYKYTGKVRPTYESAATRKFLKGRTETGRVTSNESKKFVETWTDVDASTEDKINTFNAAC 480

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV Y+ EA +G+G DRHLFGL+  LKS E  P IFTDP ++ S  W +S+SQ+ SEYF
Sbjct: 481 KQHVGYLVEAADGKGVDRHLFGLKQMLKSGEPVPEIFTDPVFSYSQTWYISSSQIPSEYF 540

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           Q +GW +V+ DG+G+AY+IN D ++ +I   +   L +  L  YL E+A EM+++ 
Sbjct: 541 QSWGWSQVIDDGFGLAYLINKDWIHVHISCKKGNGLESKYLKWYLTEAANEMKEIL 596



>gi|58258825|ref|XP_566825.1| carnitine acetyltransferase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134106983|ref|XP_777804.1| hypothetical protein CNBA5020 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260502|gb|EAL23157.1| hypothetical protein CNBA5020 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222962|gb|AAW41006.1| carnitine acetyltransferase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 630

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 172/269 (63%), Gaps = 5/269 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVD---HGSPNVRSGLPVPQQLH 57
            IV   G++GFNGEHS +DGTPT RLN+F+   I + ++      S   R     P++L 
Sbjct: 322 IIVDSEGESGFNGEHSMLDGTPTLRLNEFMLASIDSQRIPLELDSSEMSRCSTMEPEELK 381

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L  ++   I ++++ +++ + K DL+++ +  YGKN+IK    SPDA+ Q+I QLA+Y
Sbjct: 382 FELDDKLKQIIEQSKRGFEEEMEKQDLKMVTFREYGKNLIKTYRVSPDAWAQLIFQLAFY 441

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVP--IEVKAELGYKAI 175
           +++    ATYES QTRKF  GRTEV R+ S +   WV+AM ++  P   E + +L  KA+
Sbjct: 442 RLFQRLPATYESCQTRKFLLGRTEVIRSASNEGKAWVEAMVNENFPEGDEGREKLFRKAV 501

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV+Y   A + +G DRHLFGL+  +   E  P IF+DPA+A+S+HW LSTS L S Y 
Sbjct: 502 ERHVQYAVWAADAQGVDRHLFGLKKLIAPGEPIPEIFSDPAFARSSHWELSTSNLGSRYL 561

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIV 264
            G+G+GEVV DG+G++Y I +D+L + I 
Sbjct: 562 DGWGYGEVVEDGFGLSYSIEDDALRWGIT 590



>gi|68466067|ref|XP_722808.1| hypothetical protein CaO19.12060 [Candida albicans SC5314]
 gi|68466362|ref|XP_722663.1| hypothetical protein CaO19.4591 [Candida albicans SC5314]
 gi|23394954|gb|AAN31660.1|AF525684_1 putative mitochondrial/peroxisomal carnitine acetyl transferase
           [Candida albicans]
 gi|46444653|gb|EAL03926.1| hypothetical protein CaO19.4591 [Candida albicans SC5314]
 gi|46444808|gb|EAL04080.1| hypothetical protein CaO19.12060 [Candida albicans SC5314]
          Length = 632

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 183/313 (58%), Gaps = 18/313 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPN---VRSGLPVP---- 53
           F V  NG +GF GEHS MD TPT +LN+ V       K+   SP    V  G   P    
Sbjct: 327 FFVSANGNSGFLGEHSRMDATPTVQLNNTVYK-----KITEESPEDLIVEIGGSAPKIGP 381

Query: 54  -QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMII 112
            + L F++     + I+ A   +D  IA HD  +  + GYGK +IKK   SPDAYVQM++
Sbjct: 382 AEILPFDINPTTRANIADAIAKFDATIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQMLM 441

Query: 113 QLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
           QLAY+K  G  + TYESA TRKF  GRTE  RTVS +S  +V+   + K   E K     
Sbjct: 442 QLAYFKYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTNPKATNEEKVSTFQ 501

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSS 232
            A   HV Y++ A +G+G DRHLFGL+  L+ NE  P IFTDP ++ S  W +S+SQ+ S
Sbjct: 502 AAAKQHVAYLSAAADGKGVDRHLFGLKQMLQPNEPVPEIFTDPIFSYSQTWYISSSQVPS 561

Query: 233 EYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVFE 289
           EYFQ +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  YL ESA EM+ +  
Sbjct: 562 EYFQSWGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLKSDHLKWYLVESANEMKDIL- 620

Query: 290 YAQAKAGQIKAKL 302
             +    + KAKL
Sbjct: 621 -TKGLLSEPKAKL 632



>gi|238881637|gb|EEQ45275.1| carnitine O-acetyltransferase, mitochondrial precursor [Candida
           albicans WO-1]
          Length = 632

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 183/313 (58%), Gaps = 18/313 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPN---VRSGLPVP---- 53
           F V  NG +GF GEHS MD TPT +LN+ V       K+   SP    V  G   P    
Sbjct: 327 FFVSANGNSGFLGEHSRMDATPTVQLNNTVYK-----KITEESPEDLIVEIGGSAPKIGP 381

Query: 54  -QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMII 112
            + L F++     + I+ A   +D  IA HD  +  + GYGK +IKK   SPDAYVQM++
Sbjct: 382 AEILPFDINPTTRANIADAIAKFDATIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQMLM 441

Query: 113 QLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
           QLAY+K  G  + TYESA TRKF  GRTE  RTVS +S  +V+   + K   E K     
Sbjct: 442 QLAYFKYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTNPKATNEEKVSTFQ 501

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSS 232
            A   HV Y++ A +G+G DRHLFGL+  L+ NE  P IFTDP ++ S  W +S+SQ+ S
Sbjct: 502 AAAKQHVAYLSAAADGKGVDRHLFGLKQMLQPNEPVPEIFTDPIFSYSQTWYISSSQVPS 561

Query: 233 EYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVFE 289
           EYFQ +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  YL ESA EM+ +  
Sbjct: 562 EYFQSWGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLKSDHLKWYLVESANEMKDIL- 620

Query: 290 YAQAKAGQIKAKL 302
             +    + KAKL
Sbjct: 621 -TKGLLSEPKAKL 632



>gi|241954270|ref|XP_002419856.1| carnitine O-acetyltransferase, mitochondrial precursor, putative;
           carnitine acetylase, putative; ceramide
           glucosyltransferase, putative [Candida dubliniensis
           CD36]
 gi|223643197|emb|CAX42071.1| carnitine O-acetyltransferase, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
          Length = 632

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 180/308 (58%), Gaps = 8/308 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLP---VPQQLH 57
           F V  NG +GF GEHS MD TPT +LN+ V   I     +     +    P     + L 
Sbjct: 327 FFVSANGNSGFLGEHSRMDATPTVQLNNTVYKKITEESPEELIVEIGGSAPKIGPAEILP 386

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F++     + IS A   ++  IA HD  +  + GYGK +IKK   SPDAYVQM++QLAY+
Sbjct: 387 FDINPTTRANISDAISKFNATIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQMLMQLAYF 446

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           K  G  + TYESA TRKF  GRTE  RTVS +S  +V+   + K   E K      A   
Sbjct: 447 KYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTNPKATNEEKVSSFQAAAKQ 506

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV Y++ A +G+G DRHLFGL+  L+ NE  P IFTDP ++ S  W +S+SQ+ SEYFQ 
Sbjct: 507 HVAYLSAAADGKGVDRHLFGLKQMLQPNEPVPEIFTDPIFSYSQTWYISSSQVPSEYFQS 566

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVFEYAQAK 294
           +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  YL ESA EM+ +    +  
Sbjct: 567 WGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLKSDHLKWYLVESANEMKDIL--TKGL 624

Query: 295 AGQIKAKL 302
             + KAKL
Sbjct: 625 LSEPKAKL 632



>gi|448079786|ref|XP_004194464.1| Piso0_004958 [Millerozyma farinosa CBS 7064]
 gi|359375886|emb|CCE86468.1| Piso0_004958 [Millerozyma farinosa CBS 7064]
          Length = 633

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/314 (40%), Positives = 186/314 (59%), Gaps = 20/314 (6%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFV------------CNVIANNKVDHGSPNVRS 48
           F V  NG +GF GEHS MD TPT ++N+++             + IA +       NV +
Sbjct: 324 FFVSANGNSGFLGEHSRMDATPTVQMNNYIYSQITKEDPVKLISEIAQDTKTISQLNVEA 383

Query: 49  GLPVPQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYV 108
               P  L F++++ V   I+ A + +   +   D  +  Y GYGKN+IK+   SPDAYV
Sbjct: 384 A---PAALPFDVSAVVRKDIADAVEKFHKTVDTLDSAIFQYHGYGKNLIKQFKVSPDAYV 440

Query: 109 QMIIQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKA 168
           QM++QLAYYK+ G  + TYESA TRK+  GRTE  R VS +SV +VK   + +   E K 
Sbjct: 441 QMLMQLAYYKLTGKIRPTYESAATRKYLKGRTETGRAVSPESVAFVKTWSNPEASTEEKV 500

Query: 169 ELGYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTS 228
                A   HVKY++EA +GRG DRH FGL+  LK NE  P +FTDP +  S+ W +S+S
Sbjct: 501 ATFQAACKQHVKYLSEAADGRGVDRHFFGLKQMLKPNEPVPEVFTDPVFGYSSTWFISSS 560

Query: 229 QLSSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVL--WH--YLKESATEM 284
           Q+ SEYFQ +GW +V+ +G+G+AY+IN++ L+ +I S R  N +   W+  YL ++A EM
Sbjct: 561 QIPSEYFQSWGWSQVIDEGFGLAYLINSEWLHVHI-SCRKGNGLRPDWYKWYLTDTANEM 619

Query: 285 RQVFEYAQAKAGQI 298
           ++V     A   ++
Sbjct: 620 KEVLSSTLAPKAKL 633



>gi|261195310|ref|XP_002624059.1| carnitine acetyl transferase [Ajellomyces dermatitidis SLH14081]
 gi|239587931|gb|EEQ70574.1| carnitine acetyl transferase [Ajellomyces dermatitidis SLH14081]
          Length = 596

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 173/284 (60%), Gaps = 6/284 (2%)

Query: 6   NGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNLTSEVL 65
           +G+A  +G H +    P  RL     + +        +  +RS LP PQ + F L  + +
Sbjct: 305 HGRAQHDGRHPN---PPPQRLRQ--QHDLQQPPSTTPTQKIRSILPDPQPIKFELNKKAI 359

Query: 66  SAISKAEKNYDDHIAKHDL-RVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMYGTNK 124
             I+ A   +   I +H+  R        K  IK+   SPDAYVQM+IQLAY+KMYG ++
Sbjct: 360 DDIATATHAFTTVIGQHEAARPKPSRDTVKGWIKRFRCSPDAYVQMVIQLAYFKMYGKSR 419

Query: 125 ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVKYMAE 184
            TYESA TRKFQ GRTE  R+VS +SV + K+  D  VP EV A+    A+ AH KY A+
Sbjct: 420 PTYESASTRKFQLGRTETTRSVSDESVAFCKSHTDINVPREVVAKNFRAAVVAHSKYTAD 479

Query: 185 AVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGWGEVV 244
           A  G+G DRHLFGL+  +   EK P +F DPAYA S  W +S+SQLSSEYF GYGW +VV
Sbjct: 480 ASLGKGVDRHLFGLKKLIAEGEKVPALFEDPAYAYSGKWFISSSQLSSEYFNGYGWSQVV 539

Query: 245 PDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVF 288
            DG+GIAYMIN +S+ FNIV  +L  + +  YL E+A E+R++ 
Sbjct: 540 DDGFGIAYMINENSIQFNIVCKKLGAERMSFYLNEAACEIRELL 583



>gi|190348645|gb|EDK41133.2| hypothetical protein PGUG_05231 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 622

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 184/310 (59%), Gaps = 12/310 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNK----VDHGSPNVRSGLPV---- 52
           F V  NG +GF GEHS MD TPT ++N+++ + I+       V   + N +S   V    
Sbjct: 313 FFVAANGNSGFLGEHSRMDATPTVQMNNYIMDSISKEDPTALVAELTANNKSVAEVDVEA 372

Query: 53  -PQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMI 111
            P  L F+++  V   I+ A   +++ +   D  +  Y GYGKN+IK+   SPDAYVQM+
Sbjct: 373 LPTALAFDISPVVRQDIADAIVKFNETVNSLDEELFQYHGYGKNLIKQFKVSPDAYVQMM 432

Query: 112 IQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELG 171
           IQLAYYK+ G  + TYESA TRK+  GRTE  R+VS +S  +VK   +    IE K +  
Sbjct: 433 IQLAYYKLTGKIRPTYESAATRKYLKGRTETGRSVSKESAAFVKTWTNPGSTIEEKIDTF 492

Query: 172 YKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            KA   HV Y+ EA +GRG DRHLFGL+  L+  E  P IF DP ++ S  W +STSQ+ 
Sbjct: 493 NKACKQHVTYLTEAADGRGVDRHLFGLKQMLQPGEPVPAIFQDPVFSYSGTWYISTSQVP 552

Query: 232 SEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           SE+ Q +GW +V+ +G+G+AY++N D ++ +I   +   L +D L  YL +SA EM++V 
Sbjct: 553 SEHLQSWGWSQVIDEGFGLAYLVNKDWIHTHISCKKGNGLRSDALKWYLTDSANEMKEVL 612

Query: 289 EYAQAKAGQI 298
               A   ++
Sbjct: 613 STQLAPKAKL 622



>gi|146412480|ref|XP_001482211.1| hypothetical protein PGUG_05231 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 622

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 184/310 (59%), Gaps = 12/310 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNK----VDHGSPNVRSGLPV---- 52
           F V  NG +GF GEHS MD TPT ++N+++ + I+       V   + N +S   V    
Sbjct: 313 FFVAANGNSGFLGEHSRMDATPTVQMNNYIMDSISKEDPTALVAELTANNKSVAEVDVEA 372

Query: 53  -PQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMI 111
            P  L F+++  V   I+ A   +++ +   D  +  Y GYGKN+IK+   SPDAYVQM+
Sbjct: 373 LPTALAFDISPVVRQDIADAIVKFNETVNSLDEELFQYHGYGKNLIKQFKVSPDAYVQMM 432

Query: 112 IQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELG 171
           IQLAYYK+ G  + TYESA TRK+  GRTE  R+VS +S  +VK   +    IE K +  
Sbjct: 433 IQLAYYKLTGKIRPTYESAATRKYLKGRTETGRSVSKESAAFVKTWTNPGSTIEEKIDTF 492

Query: 172 YKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            KA   HV Y+ EA +GRG DRHLFGL+  L+  E  P IF DP ++ S  W +STSQ+ 
Sbjct: 493 NKACKQHVTYLTEAADGRGVDRHLFGLKQMLQPGEPVPAIFQDPVFSYSGTWYISTSQVP 552

Query: 232 SEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           SE+ Q +GW +V+ +G+G+AY++N D ++ +I   +   L +D L  YL +SA EM++V 
Sbjct: 553 SEHLQSWGWSQVIDEGFGLAYLVNKDWIHTHISCKKGNGLRSDALKWYLTDSANEMKEVL 612

Query: 289 EYAQAKAGQI 298
               A   ++
Sbjct: 613 STQLAPKAKL 622



>gi|363753626|ref|XP_003647029.1| hypothetical protein Ecym_5463 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356890665|gb|AET40212.1| hypothetical protein Ecym_5463 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 653

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 183/310 (59%), Gaps = 12/310 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLP----VPQQL 56
           F V  NG +GF  EHS MDGTP   LN +VC  + N   +  + +++SGL     +P  L
Sbjct: 348 FFVCGNGVSGFLAEHSKMDGTPNLFLNQYVCQELLNLDPNEFADSIKSGLSSEEHLPVHL 407

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F LT  + S I+ A   + + I +HDLRV  Y  YGK  IK  G SPDAY+Q IIQLA 
Sbjct: 408 PFVLTPFIQSIIASARTAFHEVIGEHDLRVWNYIRYGKKTIKGFGFSPDAYIQQIIQLAV 467

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAIN 176
           YK  G    TYE+  TRK+  GRTE  R+VS  S  +VK  +  K     K     ++  
Sbjct: 468 YKYLGKQLPTYEAGSTRKYFKGRTETGRSVSSASAEFVKTWQSPKATPAEKISALRESAR 527

Query: 177 AHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQ 236
            H  Y+A A +G+G DRH FG++  LK +++ P +F DP +  S  W +STSQLSSEYF+
Sbjct: 528 FHSNYLAMAADGQGIDRHFFGMKNMLKPDDEVPELFKDPLFQYSCTWLVSTSQLSSEYFE 587

Query: 237 GYGWGEVVPDGYGIAYMINNDSLNFNIVS--LRLNNDV-LWHY-LKESATEMRQVFEYAQ 292
           GYGW +V  +G+G+AYM+NND +N NIV+   +   DV  +HY L ++A EM ++     
Sbjct: 588 GYGWSQVNENGFGLAYMLNNDWMNINIVTKPKKSGYDVNEFHYCLTQAANEMYELL---- 643

Query: 293 AKAGQIKAKL 302
           ++  Q KAKL
Sbjct: 644 SREAQSKAKL 653



>gi|448084279|ref|XP_004195563.1| Piso0_004958 [Millerozyma farinosa CBS 7064]
 gi|359376985|emb|CCE85368.1| Piso0_004958 [Millerozyma farinosa CBS 7064]
          Length = 633

 Score =  236 bits (602), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 124/303 (40%), Positives = 180/303 (59%), Gaps = 18/303 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFV------------CNVIANNKVDHGSPNVRS 48
           F V  NG +GF GEHS MD TPT ++N+++             + IA +       NV +
Sbjct: 324 FFVSANGNSGFLGEHSRMDATPTVQMNNYIYSQITKEDPVKLISEIAQDTKTVAQLNVET 383

Query: 49  GLPVPQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYV 108
               P  L F++++ V   I+ A + +   +   D  V  Y GYGKN+IK+   SPDAY+
Sbjct: 384 ---TPAALPFDVSAVVRKDIADAVEKFHKTVDTVDSAVFQYHGYGKNLIKQFKVSPDAYM 440

Query: 109 QMIIQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKA 168
           QM++QLAYYK+ G  + TYESA TRK+  GRTE  R VS +SV +VK   + +   E K 
Sbjct: 441 QMLMQLAYYKLTGKIRPTYESAATRKYLKGRTETGRVVSPESVAFVKTWSNPEASTEEKV 500

Query: 169 ELGYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTS 228
                A   HVKY++EA +GRG DRH FGL+  LK NE  P +F DP +  S+ W +S+S
Sbjct: 501 ATFQAACKQHVKYLSEAADGRGVDRHFFGLKQMLKPNEPVPEVFADPVFGYSSTWFISSS 560

Query: 229 QLSSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMR 285
           Q+ SEYFQ +GW +V+ +G+G+AY+IN++ L+ +I   +   L +D    YL ++A EM+
Sbjct: 561 QIPSEYFQSWGWSQVIDEGFGLAYLINSEWLHVHISCRKGNGLRSDWCKWYLTDTADEMK 620

Query: 286 QVF 288
           +V 
Sbjct: 621 EVL 623



>gi|344300434|gb|EGW30755.1| carnitine O-acetyltransferase mitochondrial precursor [Spathaspora
           passalidarum NRRL Y-27907]
          Length = 640

 Score =  236 bits (601), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 180/295 (61%), Gaps = 7/295 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVC-NVIANNKVDHGSPNVRSGLPV---PQQL 56
           F +  NG +GF GEHS MD TPT +LN+ V   VIA N+  +    V + LP     + +
Sbjct: 329 FFIGANGNSGFLGEHSRMDATPTVQLNNTVYKQVIAENENSNLVEEVATFLPRVGKAEII 388

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F++     + I +A   +++ I  HD  +  Y G+GKN+IKK   SPDAYVQM++QLAY
Sbjct: 389 PFDIDPVSRTNIVEAIVKFEETITAHDEEIFQYYGHGKNLIKKFKTSPDAYVQMMMQLAY 448

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAIN 176
           YK+ G  + TYESA TRK+  GRTE  RTVS +S  +V+   +    I  K      A  
Sbjct: 449 YKLTGKVRPTYESAATRKYLKGRTETGRTVSNESKKFVETWTNPTATIADKVATFQAACK 508

Query: 177 AHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQ 236
            HV Y++ A +G+G DRH FGL+  L   E  P IFTDP ++ S+ W +S+SQ+ SEYFQ
Sbjct: 509 QHVSYLSSAADGQGVDRHFFGLKNMLAQGEPVPEIFTDPIFSYSSKWYISSSQIPSEYFQ 568

Query: 237 GYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
            +GW +V+ DG+G+AY+INN+ ++ +I   R   L++D L  YL ESA EM+ V 
Sbjct: 569 SWGWSQVIDDGFGLAYLINNEWIHVHISCKRGNGLSSDHLKWYLVESANEMKDVL 623



>gi|156836633|ref|XP_001642368.1| hypothetical protein Kpol_286p3 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156112880|gb|EDO14510.1| hypothetical protein Kpol_286p3 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 692

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 187/312 (59%), Gaps = 10/312 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN---NKVDHGSPNVRSGLPV--PQQ 55
           F V  NG +GF GEHS MDGTP   LN+++C  +     N+      N  + + V  P++
Sbjct: 381 FFVTANGSSGFLGEHSKMDGTPNLFLNNYMCQEMLKLNPNEFVAEVLNNETSVEVAKPEK 440

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T E+   I  A   + + + +HD++V  Y  YGKN+IKK   SPDA++  IIQLA
Sbjct: 441 LEFLITPEINQTIKTATTVFTNLMKEHDVKVWHYNKYGKNLIKKHKMSPDAFIHQIIQLA 500

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K +G    TYE+A TRKF  GRTE  R+VS++S ++V+  +D KV +E K E   ++ 
Sbjct: 501 VFKYFGKQLPTYEAASTRKFFKGRTETGRSVSMESFDFVRKWQDDKVSLEEKVEYLRRSA 560

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLR-MSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
            AH  Y+  A  G+  DRH +GL+ M  K  ++ P +F DP +  S+ W +STSQLSSE+
Sbjct: 561 KAHATYLGMASNGQAIDRHFYGLKNMVNKETDEVPELFKDPLFNYSSTWLISTSQLSSEH 620

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVS--LRLNNDV--LWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYMIN D L+ NI +   +   DV  + HYL ++A E+ +V E 
Sbjct: 621 FDGYGWSQVNDNGFGLAYMINKDWLHINICTKPAKSGFDVNKMHHYLNQAADEIMEVLEA 680

Query: 291 AQAKAGQIKAKL 302
             A    + AKL
Sbjct: 681 TSAPQESLSAKL 692



>gi|255721055|ref|XP_002545462.1| carnitine O-acetyltransferase, mitochondrial precursor [Candida
           tropicalis MYA-3404]
 gi|240135951|gb|EER35504.1| carnitine O-acetyltransferase, mitochondrial precursor [Candida
           tropicalis MYA-3404]
          Length = 628

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 171/294 (58%), Gaps = 6/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPV---PQQLH 57
           F V  NG +GF GEHS MD TPT +LN+ +   I     +     + +  P     + L 
Sbjct: 323 FFVSANGNSGFLGEHSRMDATPTVQLNNTIYKQIIETDPNELITEIGTSSPRFGNAELLT 382

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F++     + I  A   +D  IA HD  +  + GYGK +IKK   SPDAYVQ+++QLAY+
Sbjct: 383 FDINPTTRANIKDAIAKFDKTIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQLMMQLAYF 442

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           K  G  + TYESA TRKF  GRTE  RTVS +S  +V+   D       K      A   
Sbjct: 443 KYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWSDPNASNADKVATFQAAAKQ 502

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV Y++ A +G+G DRHLFGL+  LK  E  P+IF+DP +  S  W +S+SQ+ SEYFQ 
Sbjct: 503 HVSYLSAAADGKGVDRHLFGLKQMLKPGEPIPSIFSDPIFTYSQTWYISSSQVPSEYFQS 562

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  YL ESA EM+ + 
Sbjct: 563 WGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLQSDHLKWYLVESANEMKDIL 616



>gi|254581954|ref|XP_002496962.1| ZYRO0D12144p [Zygosaccharomyces rouxii]
 gi|238939854|emb|CAR28029.1| ZYRO0D12144p [Zygosaccharomyces rouxii]
          Length = 657

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 182/313 (58%), Gaps = 18/313 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN-------NKVDHGSPNVRSGLPVP 53
           F V  NG +GF  EHS +DGTPTS LNDFV   +++        KV   +  ++     P
Sbjct: 352 FFVARNGTSGFLAEHSKIDGTPTSTLNDFVAKNLSHLDLKQFLKKVVQPTTRLKQ---TP 408

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
           + L F +T +V   I+ A   + D+I  H+LRV  Y   GKN  KK G SPD+++Q IIQ
Sbjct: 409 EHLPFVITPKVQDFINSARSQFHDNIYNHELRVWHYNRLGKNFAKKNGMSPDSFIQQIIQ 468

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           LA YK  G    TYE+A TRK+  GRTE  R VSV S N+V   ED +   E K +    
Sbjct: 469 LAVYKYLGKQLPTYEAASTRKYFRGRTETGRPVSVASANFVATWEDPQSTDEEKIQALKD 528

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           +   H  Y+  A EG G DRH FGL+  LK +++ P +F DP ++ ++ W +STSQLSSE
Sbjct: 529 SAKYHSSYLKMAAEGHGIDRHFFGLKNMLKESDQIPALFQDPLFSYASTWLISTSQLSSE 588

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           YF GYGW +V  +G+G+AYM+NN+ L+ NIV+     +L+   L +YL ++A E+     
Sbjct: 589 YFDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSKLSVHRLHYYLSQAADEIADTL- 647

Query: 290 YAQAKAGQIKAKL 302
               +   +KAKL
Sbjct: 648 ---VRNQHLKAKL 657



>gi|392579917|gb|EIW73044.1| hypothetical protein TREMEDRAFT_70888 [Tremella mesenterica DSM
           1558]
          Length = 641

 Score =  233 bits (593), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 185/299 (61%), Gaps = 5/299 (1%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPN---VRSGLPVPQQLH 57
            IV E+G++GFNGEHS +DGTPT RLN+F+   +   K+    P      S +P P+++ 
Sbjct: 339 IIVDESGESGFNGEHSMLDGTPTLRLNEFMLAGLQAGKIPLELPEGEKATSPMPDPEEIT 398

Query: 58  FNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYY 117
           F L + +   I K+   + + +A  DL++L +  YGK  IK   ASPDA+ QMI QLA++
Sbjct: 399 FELDAHLRGLIDKSRIGFGEEMALQDLKMLNFTHYGKEAIKAHKASPDAWAQMIKQLAFF 458

Query: 118 KMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           +++      YES QTRKF  GRTEV R+ S +S  + +AM D KV    + +   +A++ 
Sbjct: 459 RLFNRPGVAYESCQTRKFLLGRTEVIRSASNESKAFCEAMIDPKVSDTEREKAFRRAVSR 518

Query: 178 HVKYMAEAVEGRGCDRHLFGLR--MSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
           H++Y   A + +G DRH+FGLR  +  K  EK P +F D  + +S+HW LSTSQLSSEY 
Sbjct: 519 HIQYSTWAADAQGVDRHMFGLRKLVREKEGEKMPEVFKDEVFGRSSHWELSTSQLSSEYL 578

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAK 294
            G+G+GEVV DGYG++Y I+++++ + I +   + +     L  +A E++ + + A+++
Sbjct: 579 DGWGYGEVVEDGYGLSYSIHDNNIRWCITTKNSDAEKFAEALVNAADELKAMMDRAKSQ 637



>gi|385301244|gb|EIF45448.1| carnitine o- mitochondrial precursor [Dekkera bruxellensis
           AWRI1499]
          Length = 484

 Score =  232 bits (592), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 171/300 (57%), Gaps = 6/300 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
             V +N  +GF GEHS MDGTPT R+ND++   I+   V       ++  P    L F +
Sbjct: 184 LFVAKNASSGFLGEHSRMDGTPTLRMNDWITKQISKMSVTEFHDEKKTA-PQYTXLVFEV 242

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
              + S I K +K +        + V  + G+GK  IK  G SPDA+VQM+IQLAYYK  
Sbjct: 243 DPFIQSQIQKEKKAFKQVTESLSINVWQFHGFGKEEIKAYGMSPDAFVQMLIQLAYYKYT 302

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           GT + TYESA TR +  GRTE CR+VS +S+ +V+  E+       K      AIN+HV+
Sbjct: 303 GTVRPTYESASTRMYFKGRTETCRSVSEESLQFVRDWENTSKSXXEKIASLRSAINSHVR 362

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y+  A +G G DRHL GL   L+  EK P IF +P Y  S HW LSTSQLSS  F GYGW
Sbjct: 363 YVKVASKGLGVDRHLLGLTKMLRDGEKIPXIFKNPMYTYSQHWFLSTSQLSSNEFNGYGW 422

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLR-----LNNDVLWHYLKESATEMRQVFEYAQAKA 295
             VV +G+G+AYMIN   L+ NI + +     LN D +  YL ZS  E++ +   +  +A
Sbjct: 423 SPVVXEGFGLAYMINPHWLHVNITAFKNNPLGLNPDYMAFYLTZSIQELKXILSKSVIRA 482



>gi|512380590|dbj|BAN45673.1| carnitine acetyltransferase [Cyberlindnera jadinii]
          Length = 615

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 177/296 (59%), Gaps = 8/296 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPV-----PQQ 55
           F V +NG + F  EHS MDGTPT  LN+ V   +          ++  G+        + 
Sbjct: 312 FFVAKNGYSAFIAEHSKMDGTPTLLLNEVVNRELHKLNPQEFLKSLEFGISEQGSVEAKH 371

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F ++  V SAI+ A+ N+   I  HD+ V  Y  YGKN IK+   SPDA++QMIIQL 
Sbjct: 372 LRFEVSPVVESAIANAKANFKSEIDNHDVSVFHYNKYGKNQIKQFKTSPDAFIQMIIQLG 431

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           +YKM GT   TYE+A TRKF  GRTE  R+VS +S+ +V+  E+  V    +A    +A+
Sbjct: 432 FYKMSGTVWPTYEAASTRKFYGGRTEATRSVSEESLRFVQNWENPSVSDAQRAVDFQEAV 491

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
            +H++Y+  A  G GCDRHL GL+  LK  EK   +F+DP +  S+ W +STSQLSS Y 
Sbjct: 492 KSHMEYIRAASNGEGCDRHLLGLKFQLKDGEKPHPLFSDPLFNYSSTWLISTSQLSSNYH 551

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLN-ND--VLWHYLKESATEMRQVF 288
             YGW EV P G+G+AY +NND L+ N+ + R + ND   L  YL+E+ATE+ +V 
Sbjct: 552 DAYGWSEVNPIGWGLAYQVNNDFLHINVCTRRSSGNDSKTLRFYLEEAATEIFEVL 607



>gi|2493499|sp|Q00614.1|CACP_CANTR RecName: Full=Carnitine O-acetyltransferase, mitochondrial;
           Short=Carnitine acetylase; Flags: Precursor
 gi|1311487|dbj|BAA12696.1| carnitine acetyltransferase [Candida tropicalis]
          Length = 627

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 173/296 (58%), Gaps = 10/296 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNK-----VDHGSPNVRSGLPVPQQ 55
           F V  NG +GF GEHS MD TPT +LN+ +   I         V+ GS   R G    + 
Sbjct: 322 FFVSANGNSGFLGEHSRMDATPTVQLNNTIYKQILETNPNDLIVEIGSSAPRFG--NAEI 379

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F++     + I  A   +D  IA HD  +  + GYGK +IKK   SPDAYVQ+++QLA
Sbjct: 380 LPFDINPTTRANIKDAIAKFDATIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQLLMQLA 439

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           Y+K  G  + TYESA TRKF  GRTE  RTVS +S  +V+   D       K      A 
Sbjct: 440 YFKYTGKIRPTYESAATRKFLKGRTETGRTVSNESKKFVETWSDPNASSADKVATFQAAA 499

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV Y++ A +G+G DRHLFGL+  ++  E  P IFTDP ++ S  W +S+SQ+ SE+F
Sbjct: 500 KQHVAYLSAAADGKGVDRHLFGLKQMIQPGEPIPEIFTDPIFSYSQTWYISSSQVPSEFF 559

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           Q +GW +V+ DG+G+AY+INND ++ +I   R   L +D L  YL +SA EM+ V 
Sbjct: 560 QSWGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLQSDHLKWYLVDSANEMKDVL 615



>gi|409081472|gb|EKM81831.1| hypothetical protein AGABI1DRAFT_112064 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 644

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 163/271 (60%), Gaps = 6/271 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F+VF+N +AG  GEHS MDGTPT RL D V ++  + K DHG P      PVPQ L F +
Sbjct: 344 FVVFDNSEAGLVGEHSVMDGTPTVRLCDEVLDLTYDPKFDHGPPASLDS-PVPQPLDFEI 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T    +AI KA+    + I    L       YGK  IK+ G SPD++ QMI+QLA+ +  
Sbjct: 403 TPATKNAIEKADAAACELIESQTLN-YHKTTYGKKAIKQFGVSPDSWAQMIVQLAFRRFL 461

Query: 121 GTNK---ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           G  K    TYE+A TRKF  GRTE  R V+ ++  WV +M+D  V  E + +L   A   
Sbjct: 462 GNKKRYGGTYEAATTRKFYKGRTEAIRVVTSEADAWVSSMDDISVSHEERKKLFDAATQK 521

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV     A   +G DRH+FGL+  L+S E+ PTIF DP + +S+HW LSTS + S++F  
Sbjct: 522 HVALAKLAGNAQGVDRHMFGLKKLLQSGEEVPTIFNDPVFQRSSHWVLSTSAIFSKHFSV 581

Query: 238 YGWGEVVPDGYGIAYMIN-NDSLNFNIVSLR 267
           YGWGEVVPDG+G+AYM   +D L + I S +
Sbjct: 582 YGWGEVVPDGFGVAYMTGFDDYLQYTITSRK 612



>gi|426196711|gb|EKV46639.1| hypothetical protein AGABI2DRAFT_193306 [Agaricus bisporus var.
           bisporus H97]
          Length = 644

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 164/271 (60%), Gaps = 6/271 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F+VF+N +AG  GEHS MDGTPT RL D V ++  + K DHG+P      PVPQ L F +
Sbjct: 344 FVVFDNSEAGLVGEHSVMDGTPTVRLCDEVLDLTYDPKFDHGAPASLDS-PVPQPLDFEI 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T    +AI +A+    + I    L       YGK  IK+ G SPD++ QMI+QLA+ +  
Sbjct: 403 TPATKNAIERADAAACELIESQTLN-YHKTTYGKKAIKQFGVSPDSWAQMIVQLAFRRFL 461

Query: 121 GTNK---ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           G  K    TYE+A TRKF  GRTE  R V+ ++  WV +M+D  V  E + +L   A   
Sbjct: 462 GDKKRYGGTYEAATTRKFYKGRTEAIRVVTSEADAWVSSMDDISVSHEERKKLFDAATQK 521

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV     A   +G DRH+FGL+  L+S E+ PTIF DP + +S+HW LSTS + S++F  
Sbjct: 522 HVALAKLAGNAQGVDRHMFGLKKLLQSGEEVPTIFNDPVFQRSSHWVLSTSAIFSKHFSV 581

Query: 238 YGWGEVVPDGYGIAYMIN-NDSLNFNIVSLR 267
           YGWGEVVPDG+G+AYM   +D L + I S +
Sbjct: 582 YGWGEVVPDGFGVAYMTGFDDYLQYTITSRK 612



>gi|9624479|gb|AAF90194.1| carnitine acetyltransferase [Candida glabrata]
          Length = 661

 Score =  230 bits (586), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 175/313 (55%), Gaps = 15/313 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-------SPNVRSGLPVP 53
           F V  NG +GF  EHS MDGTPT  LN FVC  +   K+D          P   +    P
Sbjct: 353 FFVTGNGTSGFLAEHSKMDGTPTLFLNTFVCQQL--RKIDQSKFINSVFEPVRETDYHQP 410

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
           + L F +T  +  ++  A+  + D I +HDLRV  Y  YGK  +KK G SPDA++  +IQ
Sbjct: 411 KLLPFVITPRISESVQAAQIQFRDVIEEHDLRVWHYNRYGKEFMKKNGMSPDAFIHQVIQ 470

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           LA YK  G    TYE+A TRK+  GRTE  R+VS  S N+VK  E      E + E    
Sbjct: 471 LAIYKYLGRQLPTYEAASTRKYFKGRTEAGRSVSEPSANFVKTWESTNASDEERIEALKA 530

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           +   H +Y+  A EG+  DRH FGL+  +K+ E+ P +F DP +  S  W +STSQLS E
Sbjct: 531 SAKYHAQYLKMAAEGQTIDRHFFGLKNMIKNGEEVPALFEDPIFKYSCTWYVSTSQLSCE 590

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           YF GYGW +V  +G G+AYM+N D ++ NIV+      L+ D L +YL E+A E+     
Sbjct: 591 YFDGYGWSQVNDNGVGLAYMLNKDWMHINIVTKPEKSMLSVDKLHYYLSEAADEIADTLN 650

Query: 290 YAQAKAGQIKAKL 302
             ++    IKAKL
Sbjct: 651 --RSPTSTIKAKL 661



>gi|388582677|gb|EIM22981.1| carnitine acetyltransferase [Wallemia sebi CBS 633.66]
          Length = 570

 Score =  230 bits (586), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 170/291 (58%), Gaps = 1/291 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV++NGK+ FN EHS+MDG  T RLN+F+   +A+ K+  G       L V ++L F L
Sbjct: 281 IIVYKNGKSAFNAEHSAMDGMITLRLNEFIMGALASKKISLGESTPVKQLEV-EELKFEL 339

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            ++    I+ AEK++D  +  H + V+ Y+GYG N+IK    SPDA+VQM+ QLA++K+ 
Sbjct: 340 DNKAREYIANAEKHHDAIMGAHTMDVIQYDGYGSNLIKSKKISPDAWVQMVKQLAFWKLR 399

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G     YES QTRKF +GRTEV R  S +S  +V+ M D     + +    + A   H+ 
Sbjct: 400 GRAPGVYESCQTRKFLYGRTEVIRPTSNESTEFVRLMRDFNASDDARINALHAAAKRHLT 459

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A  G   DRH++GL+  LK  E+      D A A+S  W LSTSQLSS +F G+G+
Sbjct: 460 YAGWAANGVAVDRHIYGLKNCLKEGEELHPALKDAALARSNKWELSTSQLSSPFFDGWGY 519

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYA 291
            EV  DG+G+AY I + S+ + I         L H L ESA E+R++ E A
Sbjct: 520 SEVAADGFGLAYSIQDKSIRWTITCTNGEGKDLGHCLTESANELRELMEKA 570



>gi|50291591|ref|XP_448228.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527539|emb|CAG61179.1| unnamed protein product [Candida glabrata]
          Length = 661

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 175/313 (55%), Gaps = 15/313 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-------SPNVRSGLPVP 53
           F V  NG +GF  EHS MDGTPT  LN FVC  +   K+D          P   +    P
Sbjct: 353 FFVTGNGTSGFLAEHSKMDGTPTLFLNTFVCQQL--RKIDQSKFINSVFEPVRETDYHQP 410

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
           + L F +T  +  ++  A+  + D I +HDLRV  Y  YGK  +KK G SPDA++  +IQ
Sbjct: 411 KLLPFVITPRISESVQAAQIQFRDVIEEHDLRVWHYNRYGKEFMKKNGMSPDAFIHQVIQ 470

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           LA YK  G    TYE+A TRK+  GRTE  R+VS  S N+VK  E      E + E    
Sbjct: 471 LAIYKYLGRQLPTYEAASTRKYFKGRTEAGRSVSEPSANFVKTWESTNASDEERIEALKA 530

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           +   H +Y+  A EG+  DRH FGL+  +++ E+ P +F DP +  S  W +STSQLS E
Sbjct: 531 SAKYHAQYLKMAAEGQTIDRHFFGLKNMIRNGEEVPALFEDPIFKYSCTWYVSTSQLSCE 590

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           YF GYGW +V  +G G+AYM+N D ++ NIV+      L+ D L +YL E+A E+     
Sbjct: 591 YFDGYGWSQVNDNGVGLAYMLNKDWMHINIVTKPEKSMLSVDKLHYYLSEAADEIADTLN 650

Query: 290 YAQAKAGQIKAKL 302
             ++    IKAKL
Sbjct: 651 --RSPTSTIKAKL 661



>gi|505760732|gb|EOR04797.1| hypothetical protein J056_000140 [Wallemia ichthyophaga EXF-994]
          Length = 570

 Score =  229 bits (583), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 168/291 (57%), Gaps = 1/291 (0%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV++NGK+ FN EHS+MDG  T RLN+F+   +A+ K+  G  +      V ++L F L
Sbjct: 281 IIVYKNGKSAFNAEHSTMDGMITLRLNEFIMGTLASKKITLGEKSSVKQSDV-EELPFEL 339

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S+ L  I+ AEK++D  +  H + V+ Y+GYG N+IK    SPDA+VQMI QLA++K+ 
Sbjct: 340 DSKALDYITNAEKHHDAIMGAHTMDVIQYDGYGANLIKSNKISPDAWVQMIKQLAFWKLR 399

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G     YES QTRKF +GRTEV R  S +S  +V  M D       +    + A   H+K
Sbjct: 400 GRAPGVYESCQTRKFLYGRTEVIRPTSNESTKFVHLMRDVNASDADRISALHAAAKRHLK 459

Query: 181 YMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYGW 240
           Y   A  G   DRH++GL+  ++  E       D A A+S+ W LSTSQLSS  F G+G+
Sbjct: 460 YAGWAANGVAVDRHIYGLKNCIEQGEDIHPALKDAALARSSKWELSTSQLSSPLFDGWGF 519

Query: 241 GEVVPDGYGIAYMINNDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYA 291
            EV PDG+G+ Y I + S+ + I         L H L ESA EMR + E A
Sbjct: 520 SEVTPDGFGLGYAIQDKSIRWTITCTNGEGKELGHCLTESANEMRDLMEKA 570



>gi|392297542|gb|EIW08642.1| Cat2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 670

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|6323599|ref|NP_013670.1| carnitine O-acetyltransferase CAT2 [Saccharomyces cerevisiae S288c]
 gi|1345654|sp|P32796.2|CACP_YEAST RecName: Full=Carnitine O-acetyltransferase, mitochondrial;
           Short=Carnitine acetylase; Flags: Precursor
 gi|683665|emb|CAA88327.1| Cat2p [Saccharomyces cerevisiae]
 gi|285813962|tpg|DAA09857.1| TPA: carnitine O-acetyltransferase CAT2 [Saccharomyces cerevisiae
           S288c]
 gi|349580246|dbj|GAA25406.1| K7_Cat2p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 670

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|3462|emb|CAA78399.1| carnitine acetyltransferase [Saccharomyces cerevisiae]
          Length = 670

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|323332271|gb|EGA73681.1| Cat2p [Saccharomyces cerevisiae AWRI796]
          Length = 670

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|151946122|gb|EDN64353.1| carnitine O-acetyltransferase [Saccharomyces cerevisiae YJM789]
 gi|190408201|gb|EDV11466.1| carnitine O-acetyltransferase [Saccharomyces cerevisiae RM11-1a]
 gi|256270873|gb|EEU06011.1| Cat2p [Saccharomyces cerevisiae JAY291]
          Length = 670

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|323347085|gb|EGA81360.1| Cat2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 670

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|259148536|emb|CAY81781.1| Cat2p [Saccharomyces cerevisiae EC1118]
          Length = 670

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 483 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 662

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 663 ENKRKAKL 670



>gi|323336190|gb|EGA77461.1| Cat2p [Saccharomyces cerevisiae Vin13]
          Length = 648

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 342 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 400

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 401 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 460

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 461 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 520

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 521 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 580

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 581 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 640

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 641 ENKRKAKL 648



>gi|323352978|gb|EGA85278.1| Cat2p [Saccharomyces cerevisiae VL3]
 gi|365763704|gb|EHN05230.1| Cat2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 648

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 11/308 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +P+    +  P +
Sbjct: 342 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCRQLNKLDVDDFMRKVITPSSTVAMK-PME 400

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  YGK  IK+ G SPDA++Q +IQLA
Sbjct: 401 LPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLA 460

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++  VPI  K +    + 
Sbjct: 461 VFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSA 520

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  LKSN+ + P +F DP +  S+ W +STSQLSSEY
Sbjct: 521 KEHSTYLRNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY 580

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+    +    + L +YL ++A E+    E 
Sbjct: 581 FDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDALEN 640

Query: 291 AQAKAGQI 298
              +  ++
Sbjct: 641 ENKRKAKL 648



>gi|403214317|emb|CCK68818.1| hypothetical protein KNAG_0B03770 [Kazachstania naganishii CBS
           8797]
          Length = 695

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 160/270 (59%), Gaps = 9/270 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPV------PQ 54
           F V  NGK+GF GEHS MDGTPT  LN F+C  +   K+D      +   P+      P 
Sbjct: 362 FFVTGNGKSGFLGEHSKMDGTPTLFLNTFLCQQLV--KMDPAQFISQLRQPIVGVAEQPA 419

Query: 55  QLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQL 114
            L F L++ V +AI++A+  +     +H+L+V  Y  YGKN+IK+   SPDAYVQ IIQL
Sbjct: 420 LLPFTLSAPVKNAIAQAKAQFQGVTQEHELKVCHYNRYGKNLIKQFKMSPDAYVQQIIQL 479

Query: 115 AYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKA 174
           A YK  G    TYE+A TRKF  GRTE  R+V+  S  +V   +   VP++ K  L   A
Sbjct: 480 AIYKYLGKQLPTYEAASTRKFFKGRTETGRSVTEASAQFVTNWDKPDVPLDTKITLLRNA 539

Query: 175 INAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
           I  H  Y+  A  G+G DRH FGL+  LK  E  P +F DP +  S +W +STSQLS E 
Sbjct: 540 IKDHAAYLTMAANGQGIDRHFFGLKNVLKEGESVP-LFNDPLFNYSANWYVSTSQLSGEL 598

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIV 264
           F GYGW +V   G G+AYM+N D L+FNIV
Sbjct: 599 FDGYGWSQVNDVGLGLAYMVNKDWLHFNIV 628



>gi|459370200|gb|EMG48361.1| Carnitine O-acetyltransferase, mitochondrial [Candida maltosa
           Xu316]
          Length = 615

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 174/297 (58%), Gaps = 11/297 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQ-----Q 55
           F +  NG +GF GEHS MD TPT +LN+ + N I   K +        GL  P+      
Sbjct: 306 FFISANGNSGFLGEHSRMDATPTVQLNNTIYNKIL--KTNPAELIEEIGLTTPKFGKADL 363

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           + F++     + I  A   ++  IA HD  +  + GYGKN+IKK   SPDAYVQ+++QLA
Sbjct: 364 ITFDINPTTRANIKDAIAKFNTTIAAHDEEIFQHYGYGKNLIKKFKVSPDAYVQLLMQLA 423

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
           YYK  G  + TYESA TRKF  GRTE  RTVS +S  +V+   D     + K      A 
Sbjct: 424 YYKYTGKVRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTDANASAQDKVATFQTAA 483

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLK-SNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
             HV Y+  A +G+G DRHLFGL+  ++ S+   P IFTDP +  S  W +S+SQ+ SE+
Sbjct: 484 KQHVNYLLAAADGKGVDRHLFGLKQMIQPSDGAVPEIFTDPIFTYSQTWYISSSQVPSEF 543

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR---LNNDVLWHYLKESATEMRQVF 288
           FQ +GW +V+ DG+G+AY+INND ++ +I   R   L+++    YL ESA EM+ V 
Sbjct: 544 FQSWGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLSSEHFKWYLIESANEMKDVL 600



>gi|402223656|gb|EJU03720.1| carnitine acetyl transferase [Dacryopinax sp. DJM-731 SS1]
          Length = 624

 Score =  226 bits (576), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 187/307 (60%), Gaps = 12/307 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           +IVF+NG+AGF GEHS MDGTPT RL D V   +     D+GS +  + LP P++L ++L
Sbjct: 325 WIVFDNGRAGFMGEHSVMDGTPTVRLCDAVVRGLQRPDFDNGSVSP-TPLPNPEELEWHL 383

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYE--GYGKNVIKKLGASPDAYVQMIIQLAYYK 118
           TS   SAI  A +++   I     + ++Y    YGK  IKK   SPD++ QM+IQLA+ +
Sbjct: 384 TSADHSAILSATESFSTLIHS---QAMSYHCTSYGKAEIKKFSVSPDSWAQMLIQLAHAR 440

Query: 119 MYGTNK-ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           ++ +    TYE+A TR+F+ GRTE  RTVS ++  WV++M D  V  E K +   +A   
Sbjct: 441 VFPSPPVGTYEAATTRRFERGRTETIRTVSEETRLWVESMLDPAVGDEEKRKRFREACAR 500

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H+    EA   RG DRH+FGL+  L+ NE  P I+TDP Y + + W LSTS + SE+F  
Sbjct: 501 HIALAREAGAARGVDRHMFGLKHLLRENEPMPEIYTDPLYQRGSTWVLSTSAIFSEHFPS 560

Query: 238 YGWGEVVPDGYGIAYMIN-NDSLNFNIVSLR-LNNDVLWHYLKESATEMRQVFEYAQAKA 295
           YGWGEVV +G+G+AYM   +D + F I S + + N      ++++A E++ +FE  +   
Sbjct: 561 YGWGEVVREGFGVAYMTGYDDRIQFTITSRKEMPNARFCEEIEKAAEEVKDLFEREKQDG 620

Query: 296 GQIKAKL 302
              KAKL
Sbjct: 621 ---KAKL 624



>gi|45184948|ref|NP_982666.1| AAR124Cp [Ashbya gossypii ATCC 10895]
 gi|44980557|gb|AAS50490.1| AAR124Cp [Ashbya gossypii ATCC 10895]
 gi|374105866|gb|AEY94777.1| FAAR124Cp [Ashbya gossypii FDAG1]
          Length = 650

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 169/297 (56%), Gaps = 10/297 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLP----VPQQL 56
           F V  NG +GF  EHS MDGTPT  LN +V + ++          +++  P     P+ L
Sbjct: 345 FFVCGNGVSGFLAEHSKMDGTPTLFLNQYVMSELSRLDAADFINQIKTTAPGSNYQPKHL 404

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F +T  +   I  AE  + D I +HDLRV  Y  YGK  IK  G SPDAY+Q IIQLA 
Sbjct: 405 PFVVTPALQEMIRDAEGQFRDVIGEHDLRVWNYVKYGKKAIKAFGFSPDAYIQQIIQLAI 464

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKV-PIEVKAELGYKAI 175
           YK  G    TYE+  TRKF  GRTE  R VS  S  +VK  +  +  P E  A L   A 
Sbjct: 465 YKYVGRQLPTYEAGSTRKFFKGRTEAGRGVSPASAKFVKTWQSPEASPSEKIAALRESAK 524

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
           N H   +  A +G+G DRH FG++  L+  E+ P +F DP +  S  W +STSQLSSEYF
Sbjct: 525 N-HSSLLKMAADGQGVDRHFFGMKNMLRDGEEHPALFRDPLFQHSCTWYVSTSQLSSEYF 583

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV----LWHYLKESATEMRQVF 288
           +GYGW +V  +G+G+AYMINND L+ NIV+    +      L +YL E+A EM ++ 
Sbjct: 584 EGYGWSQVNENGFGLAYMINNDWLHINIVTKPKKSGYSVHELHYYLTEAANEMYELL 640



>gi|393221765|gb|EJD07249.1| carnitine acetyl transferase [Fomitiporia mediterranea MF3/22]
          Length = 622

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 183/307 (59%), Gaps = 16/307 (5%)

Query: 5   ENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNLTSEV 64
           E+  AG  GEHS MDGTPT+R+ D + N +A++  D+GSP+  S   +P+ L +N++   
Sbjct: 323 EDAHAGIMGEHSIMDGTPTARMCDDILNALASSSFDNGSPS--SSFTLPKPLDWNISGTT 380

Query: 65  LSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKM----- 119
            +AI +A           +LRV     YGK  IK  G SPD++ Q+++QLAY ++     
Sbjct: 381 RAAIERAIGAAQKLTDDQELRVYK-TSYGKRAIKTFGVSPDSWSQLVVQLAYARLLARMG 439

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIE--VKAELGYKAINA 177
           +  N  TYE+A TRKF  GRTE  R V+ +S  WV+AM+ Q+  I    +  L   A + 
Sbjct: 440 WKRNGGTYEAASTRKFAKGRTEAVRVVTAESDAWVRAMDSQEPDISDSTRRALFRSAASR 499

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV+ + EA   +G DRHL GL+  L+S+E KP +FTDP Y ++ +W LSTS + S++F  
Sbjct: 500 HVQNVREAGAAQGIDRHLLGLQTLLRSSEPKPALFTDPLYLRAKNWVLSTSAVYSKHFMA 559

Query: 238 YGWGEVVPDGYGIAYMI-NNDSLNFNIVS-LRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
           YGWGEVVPDG+G+AYM  ++D L FNI S + +  DV    ++ +  ++  +F    AK 
Sbjct: 560 YGWGEVVPDGFGVAYMTGSDDELFFNITSRVEMPLDVFMEEIERATRDVHVLF----AKE 615

Query: 296 GQIKAKL 302
               AKL
Sbjct: 616 KNPDAKL 622



>gi|336368333|gb|EGN96676.1| hypothetical protein SERLA73DRAFT_184805 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336381142|gb|EGO22294.1| hypothetical protein SERLADRAFT_472938 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 641

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 179/297 (60%), Gaps = 17/297 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVF+N +AG  GEHS MDGTPT RL D V + + N   D G+P+  S  P P  L + +
Sbjct: 344 FIVFDNAEAGIMGEHSVMDGTPTVRLCDDVLDYLHNPSSDLGTPSTSSLAP-PIPLDWVI 402

Query: 61  TSEVLSAISKAEKNYDDHIAKHDL---RVLAYE--GYGKNVIKKLGASPDAYVQMIIQLA 115
           +     A+S+A+      +A  +L   +VL+Y    YGK  IK+ G SPD++ QMI+QLA
Sbjct: 403 SPATEKAVSEAD------VAARELIESQVLSYHLTKYGKAAIKQFGVSPDSWTQMIVQLA 456

Query: 116 YYKMYGTNKA--TYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           Y ++ G  ++  TYE+A TRKF  GRTE  R V+  S  W K+M+D  V I+ K +L  +
Sbjct: 457 YRRLVGDRRSGGTYEAATTRKFYKGRTEAIRVVTSQSDAWEKSMDDAAVDIQEKKKLFDE 516

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           A   H++    A    G DRHL GL+  L+  E  P++FTDP  A+S++W LSTS + S+
Sbjct: 517 ATKKHIQLAKGAGNAEGVDRHLTGLKKVLRDGEPLPSVFTDPLVARSSNWVLSTSAIFSK 576

Query: 234 YFQGYGWGEVVPDGYGIAYMIN-NDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFE 289
           +F  YGWGEVVPDG+G+AYM   +D L F + S + + +    +LKE A     ++E
Sbjct: 577 HFPVYGWGEVVPDGFGVAYMTGYDDRLQFTLTSRKESPNA--EFLKEIARAADDIYE 631



>gi|367008836|ref|XP_003678919.1| hypothetical protein TDEL_0A03760 [Torulaspora delbrueckii]
 gi|359746576|emb|CCE89708.1| hypothetical protein TDEL_0A03760 [Torulaspora delbrueckii]
          Length = 662

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 177/312 (56%), Gaps = 18/312 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN------NKVDHGSPNVRSGLPVPQ 54
           FIV +NG +G   EHS MDGTPT  LND+VC  I+        K  H S        +P 
Sbjct: 359 FIVAQNGSSGCMNEHSKMDGTPTCFLNDYVCRQISKLNPETFTKAVHRSAKEHEVTHLP- 417

Query: 55  QLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQL 114
              F +T  V   I+ A+ +++  I +HDLRV  Y   GK  IKK G SPDA++Q +IQL
Sbjct: 418 ---FLITPAVKEWINVAQDSFNAEILQHDLRVWHYNRLGKKFIKKNGMSPDAFIQQVIQL 474

Query: 115 AYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKA 174
           A YK  G    TYE+A TR+F  GRTE  R VS  S ++V A E+ K     K  L  K+
Sbjct: 475 AVYKYLGKQLPTYEAASTRRFFKGRTEAGRPVSEPSHDFVTAWENPKSSTSEKVSLLKKS 534

Query: 175 INAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
              H  Y+  A  G+G DRH FGL+  L S +  P +FTD  +  S+ W +STSQLSSE 
Sbjct: 535 AKFHSDYLKAAAAGQGVDRHFFGLKNMLTSTDSVPPLFTDSLFNYSSTWLISTSQLSSEM 594

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NND L+ NIV+  L +    D L +YL  +A E+      
Sbjct: 595 FDGYGWSQVNDNGFGLAYMLNNDWLHINIVNKPLASGLSVDRLHYYLNVAADEIHDAL-- 652

Query: 291 AQAKAGQIKAKL 302
             A+ G +KAKL
Sbjct: 653 -IAEEG-LKAKL 662



>gi|513030072|gb|AGO10116.1| AaceriAAR124Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 650

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 170/301 (56%), Gaps = 18/301 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN-------NKVDHGSP--NVRSGLP 51
           F V  NG +GF  EHS MDGTPT  LN +V + ++        NK+ + +P  N R    
Sbjct: 345 FFVCGNGVSGFLAEHSKMDGTPTLFLNQYVMSELSRLDAADFINKIKNTAPESNYR---- 400

Query: 52  VPQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMI 111
            PQ L F +T  +   I  AEK + + I +HDLRV  Y  YGK  IK  G SPDAY+Q I
Sbjct: 401 -PQHLPFVVTPALQEMIRDAEKQFHEVIGEHDLRVWNYVKYGKKAIKAFGFSPDAYIQQI 459

Query: 112 IQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELG 171
           IQLA YK  G    TYE+  TRKF  GRTE  R VS  S  +VK  +        K    
Sbjct: 460 IQLAVYKYVGRQLPTYEAGSTRKFFKGRTEAGRGVSPASAQFVKTWQSPDASPSEKIAAL 519

Query: 172 YKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            ++   H   +  A +G+G DRH FG++  L+  E+ P +F +P +  S  W +STSQLS
Sbjct: 520 RESAKHHSSLLKMAADGQGVDRHFFGMKNMLREGEEAPALFRNPLFQHSCTWYVSTSQLS 579

Query: 232 SEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLRLNN----DVLWHYLKESATEMRQV 287
           SE+F+GYGW +V  +G+G+AYMINND L+ NIV+    +    +   +YL E+A EM ++
Sbjct: 580 SEFFEGYGWSQVNENGFGLAYMINNDWLHINIVTKPKKSGYSVNEFHYYLTEAANEMYEL 639

Query: 288 F 288
            
Sbjct: 640 L 640



>gi|156711904|emb|CAO98877.1| carnitine acetyl-CoA transferase [Nakaseomyces delphensis]
          Length = 660

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 175/312 (56%), Gaps = 15/312 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F V  NG +GF  EHS MDGTPT  LN FVC  ++    D        P   +    P+ 
Sbjct: 354 FFVTGNGTSGFLAEHSKMDGTPTLFLNTFVCQQMSKISQDKFINSVFEPVRETDYHQPKL 413

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++ +++  A   + D + +HDLRV  Y  YGK  +KK G SPDA++Q +IQLA
Sbjct: 414 LPFVVTPKIAASVDSALTQFRDVMGQHDLRVWHYNRYGKEFMKKNGMSPDAFIQQVIQLA 473

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            YK  G    TYE+A TRK+  GRTE  R VS  S ++VK  E      E +      + 
Sbjct: 474 IYKYLGRQVPTYEAASTRKYFKGRTETGRPVSEASAHFVKTWESTNATNEERVAALKASA 533

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             H +YM  A EG+  DRH FGL+  L+  E+ P +F D  +  S+ W +STSQLSSEYF
Sbjct: 534 KYHGQYMKMASEGQAPDRHFFGLKNMLQKGEEVPALFKDSIFNYSSTWYVSTSQLSSEYF 593

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFEYA 291
            GYGW EV  +G G+AYMIN D ++ NIV+      L+ D + HYL E+A E+       
Sbjct: 594 DGYGWSEVNENGLGLAYMINKDWMHINIVTNPEKSMLSVDKMHHYLNEAADEIAMAL--- 650

Query: 292 QAKAGQ-IKAKL 302
              AG+ +KAKL
Sbjct: 651 --MAGETMKAKL 660



>gi|170086754|ref|XP_001874600.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649800|gb|EDR14041.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 593

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 116/265 (43%), Positives = 160/265 (60%), Gaps = 7/265 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F+VF+N  AGF GEHS MDGTPT+R+ D V +++ +   +HG+  V      P  L + +
Sbjct: 325 FVVFDNACAGFMGEHSVMDGTPTARMCDDVLDMLYDPAFEHGTAAVSL---TPAALDWEI 381

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           +  +  AIS A+    D     +L       YGK  IK+ G SPD++ QMIIQLAY ++ 
Sbjct: 382 SPAISKAISVADAAARDLTESQELN-FHLTSYGKAAIKEFGVSPDSWAQMIIQLAYKRLI 440

Query: 121 GTNK---ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           G      ATYE+A TRKF  GRTE  R V+ +S  WV++M+D+ V    + +L  +A   
Sbjct: 441 GNENRIGATYEAATTRKFYKGRTEAIRVVTNESDAWVRSMDDKNVNAVQRKKLFDQATKK 500

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           HV     A +G+G DRHLFGL+  L+  E  P +FTDP Y +S++W LSTS + S++F  
Sbjct: 501 HVSLAKTAGQGQGVDRHLFGLKKLLREGEATPALFTDPVYIRSSYWCLSTSAIFSKHFPV 560

Query: 238 YGWGEVVPDGYGIAYMINNDSLNFN 262
           YGWGEVVPDG+G+AYM   D   F 
Sbjct: 561 YGWGEVVPDGFGVAYMTGYDGDFFT 585



>gi|365759150|gb|EHN00957.1| Cat2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 670

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 184/312 (58%), Gaps = 15/312 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN+FVC  +     D       +P+ ++ L  P +
Sbjct: 364 FVVTGNGSSGFLAEHSKMDGTPTLFLNNFVCQQLNKLSADEFVRKVFTPSSKAALK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++   I  A+  + + + +HDLRV  Y  +GK  IK  G SPDA++Q I+QLA
Sbjct: 423 LPFIITPKINKFIESAQSQFKETMNEHDLRVWHYNKFGKTFIKSHGMSPDAFIQQIMQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K +     TYE+A TRK+  GRTE  R+VS  S+ +V   ++ +V I  K +    + 
Sbjct: 483 VFKYFKRPLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGEVSIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSN-EKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  +K + ++ P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSNYLKNAANGHGVDRHFFGLKNMMKPDSDQVPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR----LNNDVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+      L+ + L +YL ++A E+ +  E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNNWLHINIVNKPAKSGLSVNRLHYYLSQAADEIYEALE- 661

Query: 291 AQAKAGQIKAKL 302
                 ++KAKL
Sbjct: 662 ---NEKKLKAKL 670



>gi|365984369|ref|XP_003669017.1| hypothetical protein NDAI_0C01130 [Naumovozyma dairenensis CBS 421]
 gi|343767785|emb|CCD23774.1| hypothetical protein NDAI_0C01130 [Naumovozyma dairenensis CBS 421]
          Length = 732

 Score =  222 bits (566), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 173/312 (55%), Gaps = 26/312 (8%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGS----------------- 43
           F V  NG +GF  EHS MDGTPT  LN FVC  +  NK++                    
Sbjct: 407 FFVTGNGSSGFLAEHSKMDGTPTLFLNTFVCQQL--NKLNQDEFLSQFSLNPSSSSSSSS 464

Query: 44  ---PNVRSGLPVPQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKL 100
               +  S LP P  L F  T ++ S I  A++ + + I +H LRV  Y  YGKN IK +
Sbjct: 465 SSSSSSSSSLPPPSPLPFLKTPQIQSDIKSAQEQFQNQINQHKLRVWQYNKYGKNFIKSM 524

Query: 101 GASPDAYVQMIIQLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQ 160
             SPDAY+Q IIQLA YK+ G    TYE+A TRKF  GRTE  R+VS  S   V      
Sbjct: 525 KFSPDAYIQQIIQLALYKLLGKQLPTYEAASTRKFFKGRTETGRSVSSSSYELVTNWSKP 584

Query: 161 KVPIEVKAELGYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKS 220
            +  E + +L   +I  H  Y+  A EG   DRH FGL+  LK+NE  P +F D  +  S
Sbjct: 585 HITNEQRCKLLTNSIMDHSNYLKMASEGMAIDRHFFGLKKMLKTNETIPPLFKDELFNYS 644

Query: 221 THWNLSTSQLSSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR----LNNDVLWHY 276
           + W +STSQLSSEYFQGYGW +V  +G G+AYM+NND L+ NIV+       + D L +Y
Sbjct: 645 STWLVSTSQLSSEYFQGYGWSQVYDNGVGLAYMLNNDWLHINIVNKPKIAGFDPDQLHYY 704

Query: 277 LKESATEMRQVF 288
           L ++A E+ QV 
Sbjct: 705 LTQAADEIAQVL 716



>gi|255717803|ref|XP_002555182.1| KLTH0G03300p [Lachancea thermotolerans]
 gi|238936566|emb|CAR24745.1| KLTH0G03300p [Lachancea thermotolerans CBS 6340]
          Length = 649

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 169/297 (56%), Gaps = 8/297 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPV----PQQL 56
           F V  NG +GF  EHS MDGTPT  LND+VC  + +  V      +   +      PQ L
Sbjct: 344 FFVAGNGNSGFLAEHSKMDGTPTLHLNDYVCKQMHSLNVAEFLGQINCSVAQNENKPQYL 403

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F +T    S I  A+  +   I +H L+V  Y  YGKN +K +G SPDA++Q +IQLA 
Sbjct: 404 PFFVTPATRSHIEAAQVGFHKRIGEHHLKVWHYNKYGKNFMKNVGFSPDAFLQQVIQLAI 463

Query: 117 YKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAIN 176
           YK +G    TYE+A TR+F  GRTE  R+VS DS  +V   E+  V    K      +  
Sbjct: 464 YKYFGKQLPTYEAASTRRFYKGRTETGRSVSTDSAKFVADWENPDVADSQKVASLRSSAK 523

Query: 177 AHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQ 236
           AH  Y+  A  G G DRH FGL+  ++  E  P +F +P +  S+ W +STSQLSSE+F 
Sbjct: 524 AHSTYLKMASAGHGVDRHFFGLKNMIQPGENMPELFKNPLFIYSSTWLVSTSQLSSEHFD 583

Query: 237 GYGWGEVVPDGYGIAYMINNDSLNFNIVSLR----LNNDVLWHYLKESATEMRQVFE 289
           GYGW +V  +G+G+AYM+N D ++ NIV+      L+   L +YL ++A EM ++ +
Sbjct: 584 GYGWSQVNDNGFGLAYMLNKDWMHINIVNKPNASGLSVSRLHYYLTQAADEMFELLD 640



>gi|401842188|gb|EJT44443.1| CAT2-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 670

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 184/312 (58%), Gaps = 15/312 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN+FVC  +     D       +P+ ++ L  P +
Sbjct: 364 FVVTGNGSSGFLAEHSKMDGTPTLFLNNFVCQQLNKLSADEFVRKVFTPSSKAALK-PME 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++   I  A+  + + + +HDLRV  Y  +GK  IK  G SPDA++Q ++QLA
Sbjct: 423 LPFIITPKINKFIESAQSQFKETMNEHDLRVWHYNKFGKTFIKSHGMSPDAFIQQVMQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K +     TYE+A TRK+  GRTE  R+VS  S+ +V   ++ ++ I  K +    + 
Sbjct: 483 VFKYFKRPLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGEISIAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSN-EKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A  G G DRH FGL+  +K + ++ P +F DP +  S+ W +STSQLSSEY
Sbjct: 543 KEHSNYLKNAANGHGVDRHFFGLKNMMKPDSDQVPPLFKDPLFNYSSTWLISTSQLSSEY 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR----LNNDVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NN+ L+ NIV+      L+ + L +YL ++A E+ +  E 
Sbjct: 603 FDGYGWSQVNDNGFGLAYMLNNNWLHINIVNKPAKSGLSVNRLHYYLSQAADEIYEALE- 661

Query: 291 AQAKAGQIKAKL 302
                 ++KAKL
Sbjct: 662 ---NEKKLKAKL 670



>gi|325192484|emb|CCA26921.1| choline/Carnitine Oacyltransferase putative [Albugo laibachii Nc14]
          Length = 656

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 158/273 (57%), Gaps = 8/273 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
             VF N KAG  GEH+ +DG P S   DF+   +  +++D G   VR  LP PQ+L F  
Sbjct: 337 LFVFRNAKAGLLGEHAMLDGMPMSVYADFIITRLHRSQIDLGRGAVRD-LPKPQKLQFYF 395

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKN-VIKKLGASPDAYVQMIIQLAYYKM 119
           +  VLS+I  A K Y   I  H + V  + G+GK+ +IK+   SPDA+VQ+ IQ+AY ++
Sbjct: 396 SPSVLSSIYFAGKLYQHLIHAHTVNVTLFHGFGKHKIIKEYSCSPDAFVQVAIQVAYRRL 455

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAM--EDQKVPIEVKAELGYKAINA 177
           +G + ATYE+ QTR F HGRTE  R+ S  S  + ++M  E+       K  L   A+  
Sbjct: 456 FGKSTATYEAIQTRSFLHGRTETARSCSRQSAEFARSMAEENSTSSPAKKKSLLLDAVKG 515

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK---PTIFTDPAYAKSTHWNLSTSQLSSEY 234
           HV YM  A +GRG DRHL  LR  L   EK    P    +P   +S+ W +STS LS E 
Sbjct: 516 HVNYMHRAAQGRGVDRHLLALR-HLIDTEKDGAVPFFEQNPLLKRSSTWQISTSHLSHEL 574

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR 267
           F G+GWG VVPDG+GIAY +  + + FNI  LR
Sbjct: 575 FDGWGWGPVVPDGFGIAYSVKKNCIQFNIACLR 607



>gi|299745241|ref|XP_001831585.2| carnitine acetyl transferase [Coprinopsis cinerea okayama7#130]
 gi|298406497|gb|EAU90258.2| carnitine acetyl transferase [Coprinopsis cinerea okayama7#130]
          Length = 633

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 180/306 (58%), Gaps = 8/306 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV++N  AG  GEHS MDGTPT+R+ D + + + +   DHG     S + +P  L + +
Sbjct: 332 FIVYDNAYAGLLGEHSIMDGTPTARMCDNILDWLEDPAFDHGVSVTDSSV-MPTPLDWEV 390

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T     AI+KA+K   + I   D+       YGK+ IKK G SPD++ QMIIQLAY ++ 
Sbjct: 391 TPTTKEAIAKADKAAKELIETQDMS-YHLTPYGKDAIKKFGVSPDSWAQMIIQLAYKRLN 449

Query: 121 GTNK---ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINA 177
           G  K    TYE+A TRKF  GRTE  R VS +S  WVK+M+D  V    +  L   A   
Sbjct: 450 GDEKRRGGTYEAATTRKFFKGRTEAIRVVSSESDAWVKSMDDPAVSAAQRKALFDAATKV 509

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQG 237
           H+     A +G+G DRHLFGL+  L+  E+ P +FTDP +++S++W LSTS + S++F  
Sbjct: 510 HISRARAAGQGQGVDRHLFGLKKLLQPGEETPALFTDPVFSRSSYWVLSTSAIFSKHFPV 569

Query: 238 YGWGEVVPDGYGIAYMIN-NDSLNFNIVSLRLNNDVLWHYLKESATEMRQVFEYAQAKAG 296
           YGWGEVVPDG+G+AYM   ND L + + S +   +    ++KE A     +++     A 
Sbjct: 570 YGWGEVVPDGFGVAYMTGYNDRLQYTVTSRKEMPNA--QFIKEIARASEDIYKLHTDVAH 627

Query: 297 QIKAKL 302
             KAKL
Sbjct: 628 IQKAKL 633



>gi|325181464|emb|CCA15897.1| choline/Carnitine Oacyltransferase putative [Albugo laibachii Nc14]
          Length = 1826

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 158/272 (58%), Gaps = 6/272 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
             VF N KAG  GEH+ +DG P S   DF+   +  +++D G   VR  LP PQ+L F  
Sbjct: 337 LFVFRNAKAGLLGEHAMLDGMPMSVYADFIITRLHRSQIDLGRGAVRD-LPKPQKLQFYF 395

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKN-VIKKLGASPDAYVQMIIQLAYYKM 119
           +  VLS+I  A K Y   I  H + V  + G+GK+ +IK+   SPDA+VQ+ IQ+AY ++
Sbjct: 396 SPSVLSSIYFAGKLYQHLIHAHTVNVTLFHGFGKHKIIKEYSCSPDAFVQVAIQVAYRRL 455

Query: 120 YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAM--EDQKVPIEVKAELGYKAINA 177
           +G + ATYE+ QTR F HGRTE  R+ S  S  + ++M  E+       K  L   A+  
Sbjct: 456 FGKSTATYEAIQTRSFLHGRTETARSCSRQSAEFARSMAEENSTSSPAKKKSLLLDAVKG 515

Query: 178 HVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIF--TDPAYAKSTHWNLSTSQLSSEYF 235
           HV YM  A +GRG DRHL  LR  + + +     F   +P   +S+ W +STS LS E F
Sbjct: 516 HVNYMHRAAQGRGVDRHLLALRHLIDTEKDGAVPFFEQNPLLKRSSTWQISTSHLSHELF 575

Query: 236 QGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR 267
            G+GWG VVPDG+GIAY +  + + FNI  LR
Sbjct: 576 DGWGWGPVVPDGFGIAYSVKKNCIQFNIACLR 607



>gi|401624415|gb|EJS42473.1| cat2p [Saccharomyces arboricola H-6]
          Length = 670

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 184/312 (58%), Gaps = 15/312 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNVRSGLPVPQQ 55
           F+V  NG +GF  EHS MDGTPT  LN++VC  +    VD       +   ++ L  P +
Sbjct: 364 FLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLNVDEFVNKTFTSTSKAEL-KPLE 422

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           L F +T ++  AI  A+  + + I +HDLRV  Y  +GK  IK  G SPDA++Q +IQLA
Sbjct: 423 LPFIITPKINKAIESAQLQFKETIDEHDLRVWHYNKFGKTFIKNHGMSPDAFIQQVIQLA 482

Query: 116 YYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
            +K       TYE+A TRK+  GRTE  R+VS  S+ +V   ++ +V +  K +    + 
Sbjct: 483 VFKYLKHPLPTYEAASTRKYFKGRTETVRSVSTASLEFVSKWQNGEVSMAEKIQALKHSA 542

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKK-PTIFTDPAYAKSTHWNLSTSQLSSEY 234
             H  Y+  A +G+G DRH FGL+  +K ++   P +F DP +  S+ W +STSQLSSE+
Sbjct: 543 KEHSHYLKSASDGKGVDRHFFGLKNMMKPDDDHVPPLFKDPLFIYSSTWLISTSQLSSEH 602

Query: 235 FQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR----LNNDVLWHYLKESATEMRQVFEY 290
           F GYGW +V  +G+G+AYM+NND L+ N+V+      L+ + L +YL E+A E+ +  E 
Sbjct: 603 FDGYGWSQVNNNGFGLAYMLNNDWLHINVVNKPAKSGLDVNRLHYYLSEAADEIYEALE- 661

Query: 291 AQAKAGQIKAKL 302
                 +IKAKL
Sbjct: 662 ---NEKKIKAKL 670



>gi|389745727|gb|EIM86908.1| acyltransferase ChoActase/COT/CPT [Stereum hirsutum FP-91666 SS1]
          Length = 651

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 162/278 (58%), Gaps = 12/278 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVR----SGLPVPQQL 56
            IVF+N +AG  GEHS MDGTPT  L D V +++A+   DH SP       S +  P+ L
Sbjct: 347 LIVFDNAEAGIMGEHSVMDGTPTVTLCDTVLDMLADPAFDHSSPTPSGASSSSVKGPEPL 406

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            F + +EV  A+  AE+   + +    + V   + YGK  IK  G SPD++ QM++QLAY
Sbjct: 407 DFEVNAEVEKALKSAEQESLELVDGQAMNVFRTQ-YGKKAIKTFGVSPDSWAQMVVQLAY 465

Query: 117 YKMYGTN----KATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
            ++ G +      TYE+A TR+F  GRTE  R VS +S +WV++M+D  V  E +  L  
Sbjct: 466 ARLIGGSVNRQGGTYEAATTRRFLKGRTEAIRVVSSESDDWVRSMDDANVRNEERKRLFG 525

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSS 232
            A   HV+    A +  G DRH+ GL+  LK  E  P +F DP + +S++W LSTS + S
Sbjct: 526 LACKKHVELAKAAGKAEGVDRHILGLKKVLKEGEDVPELFNDPLFKRSSYWVLSTSAVFS 585

Query: 233 EYFQGYGWGEVVPDGYGIAYMINNDS---LNFNIVSLR 267
           ++F  YGWGEVVPDGYG+AYM   D    L + I S +
Sbjct: 586 KHFGPYGWGEVVPDGYGVAYMTGFDGRYYLQYTITSRK 623



>gi|366996288|ref|XP_003677907.1| hypothetical protein NCAS_0H02500 [Naumovozyma castellii CBS 4309]
 gi|342303777|emb|CCC71560.1| hypothetical protein NCAS_0H02500 [Naumovozyma castellii CBS 4309]
          Length = 664

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 167/297 (56%), Gaps = 18/297 (6%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHG-----SPNV---RSGLPV 52
           F V  NG + F  EHS MDGTPT  LN +VC  +A    +       SP+     +  P+
Sbjct: 360 FFVTGNGSSSFLAEHSKMDGTPTLFLNTYVCQQMAKLNPEQFIKGTLSPSTAFESTTKPL 419

Query: 53  PQQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMII 112
           P    F +T  + S I  A+  +   I +HDL+V  Y  YGKN IK  G SPDA++Q +I
Sbjct: 420 P----FLITPTIKSQIESAQNQFQVQINQHDLKVWHYNRYGKNFIKSHGMSPDAFIQQVI 475

Query: 113 QLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
           QLA YK  G    TYE+A TRK+  GRTE  R+VS  S  +V++ +        K  L  
Sbjct: 476 QLAIYKYLGRQLPTYEAASTRKYFKGRTEAGRSVSPASQAFVQSWDSPTKSTVEKIALLK 535

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSS 232
            +   H  YM +A  G   DRHLFGL+  L+  + KP +F DP +  S+ W +STSQLSS
Sbjct: 536 LSAKEHSNYMKDAANGMAIDRHLFGLKNMLQPEDVKPELFKDPTFNYSSTWLVSTSQLSS 595

Query: 233 EYFQGYGWGEVVPDGYGIAYMINNDSLNFNIV-----SLRLNNDVLWHYLKESATEM 284
           EYF+GYGW EV  +G G+AYM+N D L+ NIV     SL  N   + +YL E+A E+
Sbjct: 596 EYFEGYGWSEVNDNGVGLAYMLNKDWLHINIVCKPEFSL-FNVQKMHYYLSEAADEI 651



>gi|392565359|gb|EIW58536.1| carnitine acetyl transferase [Trametes versicolor FP-101664 SS1]
          Length = 635

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/272 (42%), Positives = 158/272 (58%), Gaps = 10/272 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGL-PVPQQLHFN 59
           F+VF +GKAGF GEHS MDGTPT  L D V N IA+   D  SP+  S    +PQ L +N
Sbjct: 332 FVVFADGKAGFVGEHSVMDGTPTVALCDHVINTIASP--DFASPSSASTEGALPQPLDWN 389

Query: 60  LTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKM 119
           +++E   AI+ A +     +    L ++    YGK  IK  G SPD++ QM++QLAY ++
Sbjct: 390 VSAETERAITVATEAATALVTSQTLNIVRTP-YGKAAIKAFGVSPDSWTQMVVQLAYARL 448

Query: 120 YGT-----NKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKA 174
             +        TYE+A  RKF  GRTE  R V+  S  WV++M+D       K EL   A
Sbjct: 449 LRSRGQKRQGGTYEAASVRKFLKGRTEAIRVVTSQSDAWVQSMDDASAGATRKLELFKNA 508

Query: 175 INAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEY 234
           +  H      A  G G DRHL GL++ +K  E+ P +F +P   +S++W LSTS + S++
Sbjct: 509 VKTHGASARAAGNGLGIDRHLLGLKLLVKEGEQMPEVFANPVVKRSSYWVLSTSAIFSKH 568

Query: 235 FQGYGWGEVVPDGYGIAYMIN-NDSLNFNIVS 265
           F  YGWGEVVPDG+G+AYM   +D L F I S
Sbjct: 569 FGPYGWGEVVPDGFGVAYMTGFDDYLQFTITS 600



>gi|224073488|ref|XP_002198387.1| PREDICTED: carnitine O-acetyltransferase [Taeniopygia guttata]
          Length = 627

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 174/296 (58%), Gaps = 8/296 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH+  +G P   L D V     N ++D  SP V   LP+P++L FN+
Sbjct: 330 FIVAEDGSCGLVYEHAPSEGPPIVALVDHVVKFTKNLEMDK-SPTVH--LPMPKKLRFNI 386

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N +  +   D+++L +  +GK   K    SPDA++Q+ +QLAYY+MY
Sbjct: 387 TPEIKNDIEKAKQNLNIMVEDLDIKILVFHQFGKGFPKSEKISPDAFIQLALQLAYYRMY 446

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F+ GRT+  R+ SVDS+N+V++M+      + KA+L  +A  AH +
Sbjct: 447 GRACATYESASLRMFRLGRTDTIRSTSVDSLNFVQSMDSPDKSDQEKADLLRRATQAHRE 506

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P +F D AYA + H+NLSTSQ+ ++      
Sbjct: 507 YTDMAIRGNAIDRHLLGLKLQAIEDLVSVPELFMDTAYAVAMHFNLSTSQVPAKTDCVMC 566

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSLRLNNDV----LWHYLKESATEMRQVFEYA 291
           +G VVPDGYG+ Y      +NF I +     D     + HYL+++  +MR + + A
Sbjct: 567 FGPVVPDGYGVCYNPMEQHINFAISAFNSCADTNAARMAHYLEKALLDMRSLLQDA 622



>gi|409041212|gb|EKM50698.1| hypothetical protein PHACADRAFT_264116 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 649

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 176/320 (55%), Gaps = 39/320 (12%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQ----- 55
           FIV++NGKAG  GEHS MDGTPT  L D   ++IA+   D G P   +  P P Q     
Sbjct: 326 FIVYDNGKAGLMGEHSVMDGTPTVALCDAALDMIADPNFDQGKPG--TAPPAPPQPLDWK 383

Query: 56  LHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLA 115
           LH  LT  V+SA ++A       + K+ +  +    YGK  IK+ G SPD++ QM++QLA
Sbjct: 384 LHEGLTRAVVSANARARI-----LIKNQMLKVVQTPYGKAQIKRFGVSPDSWAQMVVQLA 438

Query: 116 YYKMYGTNK-----ATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAEL 170
           Y ++   +       TYE+A TR+F  GRTE  R V+ +S  WV +M+D  V  E + EL
Sbjct: 439 YRRLLARSAKKRVGGTYEAATTRRFFKGRTEAIRVVTTESDAWVASMDDPDVSREKRKEL 498

Query: 171 GYKAINAHVKYMAEAVEGRGCDRHLFGLRM---SLKSNEK-------KP----------T 210
              A+  HV    EA   RG DRH+ GL++    L+   K        P          T
Sbjct: 499 FQAAVQKHVGLAKEAGSARGVDRHMLGLKLLNEELRKQAKGNPELQDDPEHKLHRHIVHT 558

Query: 211 IFTDPAYAKSTHWNLSTSQLSSEYFQGYGWGEVVPDGYGIAYMIN-NDSLNFNIVSLRLN 269
           +F DP Y +S++W LSTS + S++F  YGWGEVVPDG+G+AYM   +D L + I S   +
Sbjct: 559 LFDDPVYKRSSYWVLSTSAIYSKHFGPYGWGEVVPDGFGVAYMTGFDDYLQYTITSRTAS 618

Query: 270 N-DVLWHYLKESATEMRQVF 288
           +       ++++ATE+  ++
Sbjct: 619 SHRAFCQEIQKAATELYDLY 638



>gi|367001987|ref|XP_003685728.1| hypothetical protein TPHA_0E02020 [Tetrapisispora phaffii CBS 4417]
 gi|357524027|emb|CCE63294.1| hypothetical protein TPHA_0E02020 [Tetrapisispora phaffii CBS 4417]
          Length = 678

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/314 (38%), Positives = 182/314 (57%), Gaps = 15/314 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGS--PNVRSGLPVPQ---- 54
           FIV +NG +G   EHS MDGTPT  LN ++CN +  N +D  +    ++     P     
Sbjct: 366 FIVAKNGASGCLNEHSKMDGTPTLFLNSYLCNQL--NLIDSETFLKEIKESAQQPNISME 423

Query: 55  --QLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMII 112
             +L F +   + + +  A+  +D  + +HDL+V  Y  YGK+ IKK   SPDA++Q II
Sbjct: 424 TNKLQFQIEDNIKNQVVVAKTKFDSLLKEHDLKVWHYNRYGKSTIKKHKFSPDAFIQQII 483

Query: 113 QLAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGY 172
           QLA +K  G    TYE+A TRKF  GRTE  R+V+ +S  +VK   + K+    + +L  
Sbjct: 484 QLAVFKYTGKVLPTYEAASTRKFFKGRTETGRSVTSESELFVKNWNNPKLNNNERIQLLR 543

Query: 173 KAINAHVKYMAEAVEGRGCDRHLFGLR-MSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            A  AH K + E+  G+G DRH FGL+ M  +  +  P +F+D  +  S+ W +STSQLS
Sbjct: 544 NAAAAHSKNLGESANGQGIDRHFFGLKNMVDEKKDNMPELFSDKLFNYSSTWLISTSQLS 603

Query: 232 SEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQV 287
           SEYF GYGW +V   G+G+AYM+N + L+ NIV+      L+   + +YL E+A E+  +
Sbjct: 604 SEYFDGYGWSQVNDKGFGLAYMLNTNWLHINIVNKPDKANLSCARMHYYLSEAADEIMDI 663

Query: 288 FEYAQAKAGQIKAK 301
            E ++ +   +K+K
Sbjct: 664 LENSELENIALKSK 677



>gi|126297715|ref|XP_001364014.1| PREDICTED: carnitine O-acetyltransferase [Monodelphis domestica]
          Length = 626

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/300 (38%), Positives = 178/300 (59%), Gaps = 9/300 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F+V E+G  G   EH++ +G P   L D +       ++   SP +   LP+P++L FN+
Sbjct: 329 FVVAEDGSCGLVYEHAAAEGPPIVALLDHIVEFTKKPELVR-SPMI--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I KA++N +  +   DL VL +  +GKN  K    SPD ++QM +QLAYY++Y
Sbjct: 386 TPEVKSDIEKAKQNLNIMVQDLDLTVLVFHHFGKNFPKSEKMSPDGFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G + +TYESA  R F  GRT+  R+ SVDS+N+VKAM+   +  ++K EL  KA+ +H  
Sbjct: 446 GQSCSTYESASLRMFHLGRTDTIRSNSVDSLNFVKAMDSADMTEQMKVELLRKAVMSHRS 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A++G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDRAIKGEAIDRHLLGLKLQAIEELVSIPEIFMDTSYAIAMHFNLSTSQVPAKTDCVMC 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVF-EYAQAK 294
           +G VVPDGYG+ Y    + +NF I +       N   L HYL+++  ++R +  E+ +AK
Sbjct: 566 FGPVVPDGYGVCYNPMAEHINFVISAFNSCAETNAARLAHYLEKALLDLRTLLQEHPRAK 625



>gi|73967798|ref|XP_548425.2| PREDICTED: carnitine O-acetyltransferase isoform 1 [Canis lupus
           familiaris]
          Length = 626

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA+VQM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDIMVMVFHHFGKDFPKSEKLSPDAFVQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 KQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDPSVSEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL+M +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YADQAIRGEAFDRHLLGLKMQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|488543217|ref|XP_004463174.1| PREDICTED: carnitine O-acetyltransferase isoform 6 [Dasypus
           novemcinctus]
 gi|225719964|gb|ACO15820.1| carnitine acetyltransferase isoform 1 precursor (predicted)
           [Dasypus novemcinctus]
          Length = 626

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHATAEGPPIVALLDHVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKNDIEKAKQNLSIMIQDLDISVIVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D KV    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSKVSELQKVELLQKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTNRAIHGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSVTAYNSCAETNAARLVHYLEKALLDMRALLQ 619



>gi|426226125|ref|XP_004007203.1| PREDICTED: carnitine O-acetyltransferase [Ovis aries]
          Length = 623

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 326 FIVAEDGACGLIYEHAAAEGPPIVSLLDHVIEFTKRPELVR-SPMV--PLPMPKKLRFNI 382

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 383 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 442

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 443 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDPSVTEHKKVELLRKAVQAHRA 502

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 503 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 562

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIV---SLRLNNDV-LWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++    S    N V L HYL+++  +MR + +
Sbjct: 563 FGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNAVHLAHYLEKALLDMRALLQ 616



>gi|115497686|ref|NP_001069055.1| carnitine O-acetyltransferase [Bos taurus]
 gi|115304917|gb|AAI23650.1| Carnitine acetyltransferase [Bos taurus]
 gi|152941180|gb|ABS45027.1| carnitine acetyltransferase [Bos taurus]
 gi|296482039|tpg|DAA24154.1| TPA: carnitine O-acetyltransferase [Bos taurus]
          Length = 626

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGACGLIYEHAAAEGPPIVSLLDHVIEFTKRPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDPNVTEHEKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIV---SLRLNNDV-LWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++    S    N V L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNAVHLAHYLEKALLDMRALLQ 619



>gi|511874227|ref|XP_004757183.1| PREDICTED: carnitine O-acetyltransferase isoform X1 [Mustela
           putorius furo]
 gi|511963664|ref|XP_004799981.1| PREDICTED: carnitine O-acetyltransferase isoform X1 [Mustela
           putorius furo]
          Length = 626

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ VL +  +GK+  K    SPDA+VQM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDVVVLVFHHFGKDFPKSEKLSPDAFVQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 KQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDPSVSEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYGI Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|51854229|ref|NP_001004085.1| carnitine O-acetyltransferase [Rattus norvegicus]
 gi|59797483|sp|Q704S8.1|CACP_RAT RecName: Full=Carnitine O-acetyltransferase; Short=Carnitine
           acetylase; AltName: Full=Carnitine acetyltransferase;
           Short=CAT; Short=CrAT
 gi|46389567|emb|CAF06525.1| Carnitine O-acetyltransferase [Rattus norvegicus]
 gi|53733439|gb|AAH83616.1| Carnitine acetyltransferase [Rattus norvegicus]
          Length = 626

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEYTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ +L +  +GK+  K    SPDA++Q+ +QLAYY++Y
Sbjct: 386 TPEIKNDIEKAKQNISIMIQDLDIMMLVFHHFGKDFPKSQKLSPDAFIQIALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S DS+ +VK M+D KVP + + EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASTDSLAFVKGMDDPKVPEQQRVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMS 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYGI Y      +NF++ +       N   + HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQ 619



>gi|511874230|ref|XP_004757184.1| PREDICTED: carnitine O-acetyltransferase isoform X2 [Mustela
           putorius furo]
 gi|511963666|ref|XP_004799982.1| PREDICTED: carnitine O-acetyltransferase isoform X2 [Mustela
           putorius furo]
          Length = 626

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ VL +  +GK+  K    SPDA+VQM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDVVVLVFHHFGKDFPKSEKLSPDAFVQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 KQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDPSVSEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYGI Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|194225917|ref|XP_001917263.1| PREDICTED: carnitine O-acetyltransferase [Equus caballus]
          Length = 678

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 169/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 325 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 381

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   DL V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 382 TPEIKSDIEKAKQNLSIMIQDLDLTVMMFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 441

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S DS+ +VKAM+D  V  + K EL  KA+ AH  
Sbjct: 442 GQACATYESASLRMFHLGRTDTIRSASTDSLTFVKAMDDSNVAGQQKVELLRKAVQAHRA 501

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 502 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 561

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+ +  +MR + +
Sbjct: 562 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAVRLAHYLENALLDMRALLQ 615



>gi|440894367|gb|ELR46836.1| Carnitine O-acetyltransferase [Bos grunniens mutus]
          Length = 606

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 309 FIVAEDGACGLIYEHAAAEGPPIVSLLDHVIEFTKRPELVR-SPMV--PLPMPKKLRFNI 365

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 366 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 425

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 426 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDPNVTEHEKVELLRKAVQAHRA 485

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 486 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 545

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIV---SLRLNNDV-LWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++    S    N V L HYL+++  +MR + +
Sbjct: 546 FGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNAVHLAHYLEKALLDMRALLQ 599



>gi|478498562|ref|XP_004423613.1| PREDICTED: carnitine O-acetyltransferase [Ceratotherium simum
           simum]
          Length = 626

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHATAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIDKAKQNLSIMIQDLDITMMFFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+N+VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLNFVKAMDDSNVTEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVML 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAVRLAHYLEKALLDMRALLQ 619



>gi|302680360|ref|XP_003029862.1| hypothetical protein SCHCODRAFT_40188 [Schizophyllum commune H4-8]
 gi|300103552|gb|EFI94959.1| hypothetical protein SCHCODRAFT_40188, partial [Schizophyllum
           commune H4-8]
          Length = 563

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 152/258 (58%), Gaps = 8/258 (3%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIVF++G AG  GEHS MDGTPT RL D V   +     DHGSP   S  P P  L F +
Sbjct: 309 FIVFDDGYAGIMGEHSVMDGTPTVRLCDDVLAALEKTDFDHGSPA--SNAPQPTPLDFEI 366

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T    +AI++A  +    I+   L  L    YGK  IK  G SPD++ Q+++QLAY ++ 
Sbjct: 367 TPATSAAIARANADAVALISSQALTFL-RTSYGKAAIKAAGVSPDSWTQLVVQLAYARLL 425

Query: 121 ---GTNKA--TYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAI 175
              G  +A  TYE+A TR+F+ GRTE  R VS  +  WV AM    V  + + E    A+
Sbjct: 426 KRLGQQRAGGTYEAATTRRFRKGRTEAIRVVSSQADAWVAAMNMDNVGTQQRREFFIAAV 485

Query: 176 NAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYF 235
             HV+   EA  G+G DRHL GL+  ++  EK P +F DP  A+S++W LSTS + S+ F
Sbjct: 486 KKHVQRAKEAGAGQGVDRHLLGLKKVVREGEKAPELFADPVLARSSNWVLSTSAIFSKRF 545

Query: 236 QGYGWGEVVPDGYGIAYM 253
             YGWGEVVP+G+G+ YM
Sbjct: 546 DTYGWGEVVPEGFGVPYM 563



>gi|410078155|ref|XP_003956659.1| hypothetical protein KAFR_0C05330 [Kazachstania africana CBS 2517]
 gi|372463243|emb|CCF57524.1| hypothetical protein KAFR_0C05330 [Kazachstania africana CBS 2517]
          Length = 663

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 173/311 (55%), Gaps = 20/311 (6%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN-------NKVDHGSPNVRSGLPVP 53
           FIV  NG +GF  EHS MDGTP   LN+++   ++        N++   +PN    +  P
Sbjct: 360 FIVCGNGHSGFLAEHSKMDGTPNLFLNNYIMQQLSKLSPREFLNQIVM-TPN---EIYRP 415

Query: 54  QQLHFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQ 113
           + L F + + +   I  A+  +   + +HDL+V  Y+ YGKN +KK   SPDAY+Q IIQ
Sbjct: 416 ELLPFAINTSLQRDIKLAKTKFKQVMGQHDLKVWQYKRYGKNFMKKHKISPDAYIQQIIQ 475

Query: 114 LAYYKMYGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYK 173
           LA YK  G    TYE+A TR F  GRTE  R V+  S  +V+  ED  V +  K  L  +
Sbjct: 476 LAIYKYLGRQLPTYEAASTRMFFKGRTETGRVVTTASSQFVRTWEDPNVALSEKINLFKQ 535

Query: 174 AINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSE 233
           A   H  Y+ EA  G G DRH FGL+  L+  E  P +F D  +  S+ W +STSQLSSE
Sbjct: 536 ATADHSAYLKEAASGNGVDRHFFGLKNMLQDGENVP-LFDDLIFNYSSTWLVSTSQLSSE 594

Query: 234 YFQGYGWGEVVPDGYGIAYMINNDSLNFNIV-----SLRLNNDVLWHY-LKESATEMRQV 287
           +  GYGW +V   G G+AYMINND L+ NIV     SL   N++  HY L E+A E+ + 
Sbjct: 595 FLNGYGWSQVNDIGVGLAYMINNDWLHINIVCKPEFSLFDVNEL--HYILTEAADELGEA 652

Query: 288 FEYAQAKAGQI 298
            E    +  ++
Sbjct: 653 LETVHLETAKL 663



>gi|21618331|ref|NP_000746.2| carnitine O-acetyltransferase isoform 1 precursor [Homo sapiens]
 gi|119608280|gb|EAW87874.1| carnitine acetyltransferase, isoform CRA_b [Homo sapiens]
          Length = 626

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRG 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|488543209|ref|XP_004463170.1| PREDICTED: carnitine O-acetyltransferase isoform 2 [Dasypus
           novemcinctus]
          Length = 857

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 560 FIVAEDGSCGLVYEHATAEGPPIVALLDHVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 616

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 617 TPEIKNDIEKAKQNLSIMIQDLDISVIVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 676

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D KV    K EL  KA+ AH  
Sbjct: 677 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSKVSELQKVELLQKAVQAHRA 736

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 737 YTNRAIHGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 796

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 797 FGPVVPDGYGVCYNPMEAHINFSVTAYNSCAETNAARLVHYLEKALLDMRALLQ 850



>gi|471370584|ref|XP_004375804.1| PREDICTED: carnitine O-acetyltransferase isoform 1 [Trichechus
           manatus latirostris]
          Length = 626

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D   +VIA  K      +    LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPVIALVD---HVIAFTKKPEFVRSPMVPLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ +L +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITMLVFHHFGKDFPKSEKMSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSNVTDHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDLAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALIQ 619



>gi|471370586|ref|XP_004375805.1| PREDICTED: carnitine O-acetyltransferase isoform 2 [Trichechus
           manatus latirostris]
          Length = 533

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D   +VIA  K      +    LP+P++L FN+
Sbjct: 236 FIVAEDGSCGLVYEHAAAEGPPVIALVD---HVIAFTKKPEFVRSPMVPLPMPKKLRFNI 292

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ +L +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 293 TPEIKSDIEKAKQNLSIMIQDLDITMLVFHHFGKDFPKSEKMSPDAFIQMALQLAYYRIY 352

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 353 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSNVTDHQKVELLRKAVQAHRA 412

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 413 YTDLAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 472

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 473 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALIQ 526



>gi|395326643|gb|EJF59050.1| carnitine acetyl transferase [Dichomitus squalens LYAD-421 SS1]
          Length = 644

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 173/313 (55%), Gaps = 15/313 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIAN----NKVDHGSPNVRSGLPVPQQL 56
           F+V  +GKAG  GEHS MDGTPT+ + D V ++IA        +    +      +P+ L
Sbjct: 336 FVVLADGKAGLVGEHSVMDGTPTATMCDRVLDLIAAPDFATTANSSEQSTLRAKQLPEPL 395

Query: 57  HFNLTSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAY 116
            +N++ E+  AI  A +     I+   L+V+    YGK  +K  G SPD + Q+IIQLAY
Sbjct: 396 DWNVSPEIQKAIDSATEAAVALISSQTLQVVRTP-YGKAAVKAFGVSPDGWTQLIIQLAY 454

Query: 117 YKM-----YGTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELG 171
            ++     +  N  TYE+A  RKF  GRTE  R VS  S  WV +M+D       + +L 
Sbjct: 455 ARLLKAKGWKRNGGTYEAASVRKFLKGRTEAIRVVSEQSDRWVASMDDPAADARRRVQLF 514

Query: 172 YKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQLS 231
            +AI  H  Y   A    G DRHL GL++ ++  E+ P +F++P   +S++W LSTS ++
Sbjct: 515 AEAIKTHGTYARAAGNAHGVDRHLLGLKLLVREGEQVPEVFSNPVVKRSSYWVLSTSAIN 574

Query: 232 SEYFQGYGWGEVVPDGYGIAYMIN-NDSLNFNIVS-LRLNNDVLWHYLKESATEMRQVFE 289
           ++ F  YGWGEVVPDG+G+AY    +D L F + S   + ND     L+ +A   R +++
Sbjct: 575 AKNFGPYGWGEVVPDGFGVAYTTGFDDFLQFTVTSRTEMPNDEFCEELQRAA---RDIYD 631

Query: 290 YAQAKAGQIKAKL 302
              +++   KAKL
Sbjct: 632 LFASQSATQKAKL 644



>gi|29726705|pdb|1NM8|A Chain A, Structure Of Human Carnitine Acetyltransferase: Molecular
           Basis For Fatty Acyl Transfer
 gi|42543701|pdb|1S5O|A Chain A, Structural And Mutational Characterization Of L-Carnitine
           Binding To Human Carnitine Acetyltransferase
          Length = 616

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 308 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 364

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 365 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 424

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 425 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRG 484

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 485 YTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 544

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 545 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 598



>gi|410979274|ref|XP_003996010.1| PREDICTED: carnitine O-acetyltransferase [Felis catus]
          Length = 626

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 115/295 (38%), Positives = 171/295 (57%), Gaps = 8/295 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDIMVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K +L  KA+ AH  
Sbjct: 446 KQACATYESASLRMFHLGRTDTIRSASVDSLTFVKAMDDSNVSEHQKVDLLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFEY 290
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + ++
Sbjct: 566 FGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQH 620



>gi|472345615|ref|XP_004392545.1| PREDICTED: carnitine O-acetyltransferase isoform 1 [Odobenus
           rosmarus divergens]
          Length = 626

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA+VQM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDIMVMVFHHFGKDFPKAEKLSPDAFVQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 KQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDPSVSEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|383209673|ref|NP_001244292.1| carnitine O-acetyltransferase isoform 2 [Homo sapiens]
 gi|119608281|gb|EAW87875.1| carnitine acetyltransferase, isoform CRA_c [Homo sapiens]
          Length = 605

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 308 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 364

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 365 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 424

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 425 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRG 484

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 485 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 544

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 545 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 598



>gi|215274265|sp|P43155.5|CACP_HUMAN RecName: Full=Carnitine O-acetyltransferase; Short=Carnitine
           acetylase; AltName: Full=Carnitine acetyltransferase;
           Short=CAT; Short=CrAT
          Length = 626

 Score =  206 bits (523), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPLV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRG 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|390600194|gb|EIN09589.1| acyltransferase ChoActase/COT/CPT [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 612

 Score =  206 bits (523), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 155/267 (58%), Gaps = 15/267 (5%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           F++F+NG+AG  GEHS MDGTPT+R+ D   + +     +HGS       P P+ L +++
Sbjct: 334 FVIFDNGEAGIVGEHSVMDGTPTTRMCDDALDDLYRPNFNHGS--SLPSAPAPEPLDWHV 391

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYE--GYGKNVIKKLGASPDAYVQMIIQLAYYK 118
                 AI +A K   + I+    + ++Y    YGK  IK+ G SPD++ Q IIQLA+ +
Sbjct: 392 LPATQKAIDEAAKAAYELISG---QAMSYHLTPYGKAAIKRFGVSPDSWAQAIIQLAHRR 448

Query: 119 MYGT--------NKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAEL 170
           +  +        N  TYE+A  RKF  GRTE  R VS +   WV++M+D     + K  +
Sbjct: 449 LLSSSDKVPKPRNGGTYEAASVRKFHKGRTEAIRVVSSEMDAWVQSMDDAGASADEKRLM 508

Query: 171 GYKAINAHVKYMAEAVEGRGCDRHLFGLRMSLKSNEKKPTIFTDPAYAKSTHWNLSTSQL 230
              A   HV+    A  G G DRH+ GL+ SL+  E  P IF+DP YA+S++W LSTS +
Sbjct: 509 LMNAAKKHVELAKAAGNGHGIDRHMLGLKKSLREGEALPEIFSDPLYARSSYWILSTSAI 568

Query: 231 SSEYFQGYGWGEVVPDGYGIAYMINND 257
            S++F  YGWGEVVPDG+G+AYM   D
Sbjct: 569 FSKHFPTYGWGEVVPDGFGVAYMTGYD 595



>gi|472345617|ref|XP_004392546.1| PREDICTED: carnitine O-acetyltransferase isoform 2 [Odobenus
           rosmarus divergens]
          Length = 605

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 308 FIVAEDGSCGLVYEHAAAEGPPIIALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 364

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA+VQM +QLAYY++Y
Sbjct: 365 TPEIKSDIEKAKQNLSIMIQDLDIMVMVFHHFGKDFPKAEKLSPDAFVQMALQLAYYRIY 424

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
               ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 425 KQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDPSVSEHQKVELLRKAVQAHRA 484

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 485 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 544

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 545 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRALLQ 598



>gi|431898892|gb|ELK07262.1| Carnitine O-acetyltransferase [Pteropus alecto]
          Length = 743

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 169/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D   +VI   K+     +    LP+P++L FN+
Sbjct: 446 FIVAEDGSCGLVYEHAAAEGPPIITLVD---HVIEYTKLPELVRSPMVPLPMPKKLRFNI 502

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I KA++N    I   D+ +  +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 503 TPEVKSDIEKAKQNLSIMIQDLDISITVFHHFGKDFPKSEKMSPDAFIQMALQLAYYRIY 562

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VK+M+D  V    K EL  +A+ AH  
Sbjct: 563 GHACATYESASLRMFHLGRTDTIRSASMDSLTFVKSMDDSSVAEHQKVELLRRAVQAHRS 622

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ S+      
Sbjct: 623 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPSKIDCVMS 682

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 683 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLTHYLEKALLDMRALLQ 736



>gi|403298520|ref|XP_003940065.1| PREDICTED: carnitine O-acetyltransferase isoform 1 [Saimiri
           boliviensis boliviensis]
          Length = 626

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/307 (38%), Positives = 175/307 (57%), Gaps = 14/307 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIVTLLDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITMMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDSSVTEHQKVELLRKAVQAHRG 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +      
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ------ 619

Query: 296 GQIKAKL 302
           G  +AKL
Sbjct: 620 GHPRAKL 626



>gi|472584088|gb|EMS21694.1| carnitine O-acetyltransferase [Rhodosporidium toruloides NP11]
          Length = 693

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 176/313 (56%), Gaps = 13/313 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           ++V+ NG+AGF GEHS MDGTPT+RLNDF+   +  N+    S +  S  P P  L F L
Sbjct: 381 WMVYRNGEAGFVGEHSCMDGTPTARLNDFLTKRLLTNEPFPHSSSATSSTPSPSPLPFEL 440

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
            S  LS + KA + +  HI  + L  L+YE YGK  IKK+ ASPD +VQM+ Q+AYY  +
Sbjct: 441 DSTALSHVEKAHEEHRKHIEPYALHYLSYERYGKEGIKKMKASPDGWVQMLFQIAYYLTF 500

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEV--KAELGYKAINAH 178
                TYE+AQTR++Q GRTE  R ++ +S+ +VK++ D         K  L   A+  H
Sbjct: 501 KKPCGTYEAAQTRRYQLGRTETVRILTPESLAFVKSLVDSPSSSSASDKVALFRAALAQH 560

Query: 179 VKYMAEAVEGRGCDRHLFGLRM----SLKSNEKKPT-----IFTDPAYAKSTHWNLSTSQ 229
            K M  A  G G DRHLFGL+M     L   EKK       +F DP   +S  W +STSQ
Sbjct: 561 GKDMKLASAGMGIDRHLFGLKMLAATKLGEQEKKEVMEGDGLFADPLVKESGTWRMSTSQ 620

Query: 230 LSSEYFQGYGWGEVVPDGYGIAYMINNDSLNFNIVSLR-LNNDVLWHYLKESATEMRQVF 288
           +   +   YGWG VV  G G+ YMI+ +SL   +   + +  D+      ++A  +  +F
Sbjct: 621 IYIRHSPAYGWGPVVDGGLGLPYMIHPESLQLTVSCQKTVPGDLYIKNFAKAADLLMDLF 680

Query: 289 EYAQAKAGQIKAK 301
           E A+ + GQ KAK
Sbjct: 681 EQAE-RDGQGKAK 692



>gi|332230200|ref|XP_003264274.1| PREDICTED: carnitine O-acetyltransferase isoform 1 [Nomascus
           leucogenys]
          Length = 626

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLAFVKAMDDSSVMEHQKVELLRKAVQAHRG 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAVAMHFHLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 619



>gi|344271734|ref|XP_003407692.1| PREDICTED: LOW QUALITY PROTEIN: carnitine O-acetyltransferase-like
           [Loxodonta africana]
          Length = 627

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++++G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 330 FIVAEDGSCGLVYEHAAVEGPPIVALVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 386

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 387 TPEIKSDIEKAKQNLSIMIQDLDIMIVLFHHFGKDFPKSEKMSPDAFIQMALQLAYYRIY 446

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 447 GQACATYESASLRMFHLGRTDTIRSASMDSLAFVKAMDDSNVTDHQKVELLRKAVQAHRA 506

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 507 YTDLAIHGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVML 566

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 567 FGPVVPDGYGVCYNPMEGHINFSVSAYNSCAETNAARLAHYLEKALLDMRALMQ 620



>gi|403298522|ref|XP_003940066.1| PREDICTED: carnitine O-acetyltransferase isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 605

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 119/307 (38%), Positives = 175/307 (57%), Gaps = 14/307 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 308 FIVAEDGSCGLVYEHAAAEGPPIVTLLDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 364

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 365 TPEIKSDIEKAKQNLSIMIQDLDITMMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 424

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 425 GQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDSSVTEHQKVELLRKAVQAHRG 484

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 485 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 544

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +      
Sbjct: 545 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ------ 598

Query: 296 GQIKAKL 302
           G  +AKL
Sbjct: 599 GHPRAKL 605



>gi|163915141|ref|NP_001106518.1| carnitine O-acetyltransferase [Sus scrofa]
 gi|162852671|emb|CAP49176.1| carnitine acetyl transferase [Sus scrofa]
          Length = 626

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P + L D V       ++   SP +   LP+P++L FN+
Sbjct: 329 FIVAEDGACGLIYEHAAAEGPPITTLVDHVIEFTKKPELVR-SPMI--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V  +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKSDIEKAKQNLXIMIQDLDITVFVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMGDPNVTEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G+  DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDLAICGKAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMESHINFSVSAYNSCAETNAVRLAHYLEQALLDMRALLQ 619



>gi|332230202|ref|XP_003264275.1| PREDICTED: carnitine O-acetyltransferase isoform 2 [Nomascus
           leucogenys]
          Length = 605

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D+V       ++   SP V   LP+P++L FN+
Sbjct: 308 FIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVR-SPMV--PLPMPKKLRFNI 364

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ V+ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 365 TPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 424

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 425 GQACATYESASLRMFHLGRTDTIRSASMDSLAFVKAMDDSSVMEHQKVELLRKAVQAHRG 484

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 485 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAVAMHFHLSTSQVPAKTDCVMF 544

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVSL----RLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 545 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQ 598



>gi|50513719|pdb|1T7Q|A Chain A, Crystal Structure Of The F565a Mutant Of Murine Carnitine
           Acetyltransferase In Complex With Carnitine And Coa
 gi|50513720|pdb|1T7Q|B Chain B, Crystal Structure Of The F565a Mutant Of Murine Carnitine
           Acetyltransferase In Complex With Carnitine And Coa
          Length = 618

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 321 FIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEYTKKPELVR-SPMV--PLPMPKKLRFNI 377

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ +L +  +GK+  K    SPDA++Q+ +QLAYY++Y
Sbjct: 378 TPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSPDAFIQVALQLAYYRIY 437

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VK M D  VP + K EL  KA+ AH  
Sbjct: 438 GQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGMGDSTVPEQQKVELLRKAVQAHRA 497

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 498 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMA 557

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYGI Y      +NF++ +       N   + HYL+++  +MR + +
Sbjct: 558 FGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQ 611



>gi|507692079|ref|XP_004713317.1| PREDICTED: carnitine O-acetyltransferase [Echinops telfairi]
          Length = 626

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 171/294 (58%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGLVYEHAAAEGPPIVALLDHVIEFTKKPELAR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 386 TPEIKNDIEKAKQNLGIMIQDLDITMVVFHHFGKDFPKSEKMSPDAFIQMALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    KAEL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLAFVKAMDDASVVDHQKAELLRKAVQAHRT 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDLAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMC 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMEAHINFSVSAYNSCAETNAARLAHYLEKALLDMRAIMQ 619



>gi|166183814|gb|ABY84175.1| carnitine acetyltransferase isoform 1 precursor (predicted)
           [Callithrix jacchus]
          Length = 627

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/307 (38%), Positives = 175/307 (57%), Gaps = 14/307 (4%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 330 FIVAEDGSCGLVYEHAAAEGPPIVTLVDHVIEFTKKPELVR-SPMV--PLPMPKKLRFNI 386

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ S I KA++N    I   D+ ++ +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 387 TPEIKSDIEKAKQNLSIMIQDLDITMMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIY 446

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ SVDS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 447 GQACATYESASLRMFHLGRTDTIRSASVDSLAFVKAMDDSNVTEHQKVELLRKAVQAHRG 506

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H++LSTSQ+ ++      
Sbjct: 507 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMF 566

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFEYAQAKA 295
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +      
Sbjct: 567 FGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAAHLAHYLEKALLDMRALLQ------ 620

Query: 296 GQIKAKL 302
           G  +AKL
Sbjct: 621 GHPRAKL 627



>gi|432095350|gb|ELK26549.1| Carnitine O-acetyltransferase [Myotis davidii]
          Length = 623

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       +V   SP V   LP+P++L FN+
Sbjct: 326 FIVAEDGSCGLVYEHAAAEGPPIISLVDHVIEYTKKAEVVR-SPMV--PLPMPKKLRFNI 382

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ V  +  +GK+  K    SPDA++QM +QLAYY++Y
Sbjct: 383 TPEIKNDIEKAKQNLSIMIQDLDMIVTVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRVY 442

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S +S+ +VKAM+D  V    K EL  KA++AH  
Sbjct: 443 GQACATYESASLRMFHLGRTDTIRSASTESLAFVKAMDDSNVTEHQKVELLRKAVDAHRA 502

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ S+      
Sbjct: 503 YTNRAIRGEALDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPSKTDCVMF 562

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   + HYL+++  +MR++ +
Sbjct: 563 FGPVVPDGYGVCYNPMESHINFSVSAYNSCAETNAARMAHYLEKALLDMRELLQ 616



>gi|183636983|gb|ACC64540.1| carnitine acetyltransferase (predicted) [Rhinolophus ferrumequinum]
          Length = 626

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 169/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
            IV E+G  G   EH++ +G P   L D   +VI   K      +    LP+P++L FN+
Sbjct: 329 IIVAEDGSCGLVYEHAAAEGPPIVTLVD---HVIEYTKKAEPVRSPMVPLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T EV S I KA++N    I   D+ V+ +  +GK+  K    SPDA++Q+ +QLAYY++Y
Sbjct: 386 TPEVKSDIEKAKQNLGIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQIALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VKAM+D  V    K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y  +A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDQAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMS 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYG+ Y      +NF++ +       N   L HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGVCYNPMESHINFSVSAYNSCAETNAARLGHYLEKALLDMRALLQ 619



>gi|85662408|ref|NP_031786.2| carnitine O-acetyltransferase [Mus musculus]
 gi|317373469|sp|P47934.3|CACP_MOUSE RecName: Full=Carnitine O-acetyltransferase; Short=Carnitine
           acetylase; AltName: Full=Carnitine acetyltransferase;
           Short=CAT; Short=CrAT
 gi|13879380|gb|AAH06668.1| Carnitine acetyltransferase [Mus musculus]
 gi|74205126|dbj|BAE21016.1| unnamed protein product [Mus musculus]
          Length = 626

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 170/294 (57%), Gaps = 8/294 (2%)

Query: 1   FIVFENGKAGFNGEHSSMDGTPTSRLNDFVCNVIANNKVDHGSPNVRSGLPVPQQLHFNL 60
           FIV E+G  G   EH++ +G P   L D V       ++   SP V   LP+P++L FN+
Sbjct: 329 FIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEYTKKPELVR-SPMV--PLPMPKKLRFNI 385

Query: 61  TSEVLSAISKAEKNYDDHIAKHDLRVLAYEGYGKNVIKKLGASPDAYVQMIIQLAYYKMY 120
           T E+ + I KA++N    I   D+ +L +  +GK+  K    SPDA++Q+ +QLAYY++Y
Sbjct: 386 TPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSPDAFIQVALQLAYYRIY 445

Query: 121 GTNKATYESAQTRKFQHGRTEVCRTVSVDSVNWVKAMEDQKVPIEVKAELGYKAINAHVK 180
           G   ATYESA  R F  GRT+  R+ S+DS+ +VK M D  VP + K EL  KA+ AH  
Sbjct: 446 GQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGMGDSTVPEQQKVELLRKAVQAHRA 505

Query: 181 YMAEAVEGRGCDRHLFGLRM-SLKSNEKKPTIFTDPAYAKSTHWNLSTSQLSSEYFQGYG 239
           Y   A+ G   DRHL GL++ +++     P IF D +YA + H+NLSTSQ+ ++      
Sbjct: 506 YTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMF 565

Query: 240 WGEVVPDGYGIAYMINNDSLNFNIVS----LRLNNDVLWHYLKESATEMRQVFE 289
           +G VVPDGYGI Y      +NF++ +       N   + HYL+++  +MR + +
Sbjct: 566 FGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQ 619