BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10037_c0_seq1-m.14 5prime_partial 1-1206(+) 402 (+)
         (401 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|296425567|ref|XP_002842312.1| hypothetical protein [Tuber mel...   300   4e-79   Tuber melanosporum Mel28
gi|494830062|gb|EON66631.1| hypothetical protein W97_05877 [Coni...   296   5e-78   Coniosporium apollinis CBS 100218
gi|345565901|gb|EGX48849.1| hypothetical protein AOL_s00079g488 ...   293   5e-77   Arthrobotrys oligospora ATCC 24927
gi|378734167|gb|EHY60626.1| acyltransferase [Exophiala dermatiti...   290   5e-76   Exophiala dermatitidis NIH/UT8656
gi|407922691|gb|EKG15787.1| Phospholipid/glycerol acyltransferas...   281   2e-73   Macrophomina phaseolina MS6
gi|346979833|gb|EGY23285.1| 1-acyl-sn-glycerol-3-phosphate acylt...   277   4e-72   Verticillium dahliae VdLs.17
gi|452000113|gb|EMD92575.1| hypothetical protein COCHEDRAFT_1155...   275   2e-71   Bipolaris maydis C5
gi|154315248|ref|XP_001556947.1| hypothetical protein BC1G_04663...   275   2e-71   Botrytis cinerea B05.10
gi|451854203|gb|EMD67496.1| hypothetical protein COCSADRAFT_3429...   274   3e-71   Bipolaris sorokiniana ND90Pr
gi|500255333|gb|EON98727.1| putative 1-acyl-sn-glycerol-3-phosph...   274   3e-71   Phaeoacremonium minimum UCRPA7
gi|449301314|gb|EMC97325.1| hypothetical protein BAUCODRAFT_6810...   273   6e-71   Baudoinia panamericana UAMH 10762
gi|336264197|ref|XP_003346877.1| hypothetical protein SMAC_05137...   272   1e-70   Sordaria macrospora k-hell
gi|85089963|ref|XP_958192.1| hypothetical protein NCU07741 [Neur...   272   1e-70   Neurospora crassa OR74A
gi|477532153|gb|ENH83798.1| lysocardiolipin acyltransferase [Col...   272   1e-70   Colletotrichum orbiculare MAFF 240422
gi|336473431|gb|EGO61591.1| hypothetical protein NEUTE1DRAFT_590...   272   1e-70   Neurospora tetrasperma FGSC 2508
gi|511009351|gb|EPB90595.1| hypothetical protein HMPREF1544_0250...   272   1e-70   Mucor circinelloides f. circinelloides 1006PhL
gi|396499553|ref|XP_003845503.1| hypothetical protein LEMA_P0081...   272   2e-70   Leptosphaeria maculans JN3
gi|396494324|ref|XP_003844277.1| hypothetical protein LEMA_P0192...   272   2e-70   Leptosphaeria maculans JN3
gi|189211375|ref|XP_001942018.1| 1-acyl-sn-glycerol-3-phosphate ...   271   2e-70   Pyrenophora tritici-repentis Pt-1C-BFP
gi|482812425|gb|EOA89144.1| hypothetical protein SETTUDRAFT_2636...   271   2e-70   Setosphaeria turcica Et28A
gi|406867286|gb|EKD20324.1| acyltransferase [Marssonina brunnea ...   271   3e-70   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|494833070|gb|EON69148.1| hypothetical protein W97_08334 [Coni...   270   4e-70   Coniosporium apollinis CBS 100218
gi|330924931|ref|XP_003300838.1| hypothetical protein PTT_12199 ...   270   4e-70   Pyrenophora teres f. teres 0-1
gi|451853227|gb|EMD66521.1| hypothetical protein COCSADRAFT_8402...   270   5e-70   Bipolaris sorokiniana ND90Pr
gi|330916700|ref|XP_003297528.1| hypothetical protein PTT_07954 ...   269   9e-70   Pyrenophora teres f. teres 0-1
gi|169626327|ref|XP_001806564.1| hypothetical protein SNOG_16448...   269   1e-69   Parastagonospora nodorum SN15
gi|452004644|gb|EMD97100.1| hypothetical protein COCHEDRAFT_1124...   268   1e-69   Bipolaris maydis C5
gi|156037864|ref|XP_001586659.1| hypothetical protein SS1G_12646...   268   1e-69   Sclerotinia sclerotiorum 1980 UF-70
gi|310790408|gb|EFQ25941.1| acyltransferase [Glomerella graminic...   268   2e-69   Colletotrichum graminicola M1.001
gi|212536088|ref|XP_002148200.1| acyltransferase, putative [Tala...   268   2e-69   Talaromyces marneffei ATCC 18224
gi|242794826|ref|XP_002482455.1| acyltransferase, putative [Tala...   268   2e-69   Talaromyces stipitatus ATCC 10500
gi|171692517|ref|XP_001911183.1| hypothetical protein [Podospora...   268   3e-69   Podospora anserina S mat+
gi|501750384|emb|CCG84891.2| protein of unknown function [Taphri...   267   4e-69   Taphrina deformans PYCC 5710
gi|485915502|gb|EOD43129.1| putative 1-acyl-sn-glycerol-3-phosph...   267   5e-69   Neofusicoccum parvum UCRNP2
gi|380495553|emb|CCF32307.1| acyltransferase [Colletotrichum hig...   267   5e-69   Colletotrichum higginsianum
gi|512192814|gb|EPE08572.1| 1-acyl-sn-glycerol-3-phosphate acylt...   266   1e-68   Ophiostoma piceae UAMH 11346
gi|402081466|gb|EJT76611.1| 1-acyl-sn-glycerol-3-phosphate acylt...   265   1e-68   Gaeumannomyces graminis var. tritici R3-111a-1
gi|482807986|gb|EOA84919.1| hypothetical protein SETTUDRAFT_4211...   265   2e-68   Setosphaeria turcica Et28A
gi|398396926|ref|XP_003851921.1| hypothetical protein MYCGRDRAFT...   264   3e-68   Zymoseptoria tritici IPO323
gi|378729915|gb|EHY56374.1| acyltransferase [Exophiala dermatiti...   264   3e-68   Exophiala dermatitidis NIH/UT8656
gi|453083641|gb|EMF11686.1| acyltransferase-domain-containing pr...   264   4e-68   Sphaerulina musiva SO2202
gi|145253835|ref|XP_001398430.1| acyltransferase [Aspergillus ni...   263   5e-68   Aspergillus niger CBS 513.88
gi|358373302|dbj|GAA89901.1| acyltransferase [Aspergillus kawach...   263   5e-68   Aspergillus kawachii IFO 4308
gi|407919524|gb|EKG12756.1| Phospholipid/glycerol acyltransferas...   263   6e-68   Macrophomina phaseolina MS6
gi|453084565|gb|EMF12609.1| acyltransferase-domain-containing pr...   263   8e-68   Sphaerulina musiva SO2202
gi|384494203|gb|EIE84694.1| hypothetical protein RO3G_09404 [Rhi...   263   9e-68   Rhizopus delemar RA 99-880
gi|358400211|gb|EHK49542.1| acyltransferase, partial [Trichoderm...   263   1e-67   Trichoderma atroviride IMI 206040
gi|350634082|gb|EHA22446.1| hypothetical protein ASPNIDRAFT_1289...   262   1e-67   Aspergillus niger ATCC 1015
gi|452981010|gb|EME80770.1| hypothetical protein MYCFIDRAFT_3549...   262   1e-67   Cercospora fijiensis CIRAD86
gi|340516171|gb|EGR46421.1| predicted protein [Trichoderma reese...   262   2e-67   Trichoderma reesei QM6a
gi|358381861|gb|EHK19535.1| hypothetical protein TRIVIDRAFT_8093...   260   6e-67   Trichoderma virens Gv29-8
gi|225685041|gb|EEH23325.1| lysocardiolipin acyltransferase [Par...   259   9e-67   Paracoccidioides brasiliensis Pb03
gi|240277291|gb|EER40800.1| acyltransferase [Ajellomyces capsula...   259   1e-66   Histoplasma capsulatum H143
gi|225562204|gb|EEH10484.1| conserved hypothetical protein [Ajel...   259   1e-66   Histoplasma capsulatum G186AR
gi|425766562|gb|EKV05168.1| Acyltransferase, putative [Penicilli...   258   2e-66   Penicillium digitatum PHI26
gi|342885973|gb|EGU85922.1| hypothetical protein FOXB_03589 [Fus...   258   3e-66   Fusarium oxysporum Fo5176
gi|477512820|gb|ENH65349.1| hypothetical protein FOC1_g10005882 ...   258   3e-66   Fusarium oxysporum f. sp. cubense race 1
gi|239608952|gb|EEQ85939.1| acyltransferase [Ajellomyces dermati...   258   3e-66   Blastomyces dermatitidis ER-3
gi|367025329|ref|XP_003661949.1| hypothetical protein MYCTH_2301...   257   3e-66   Myceliophthora thermophila ATCC 42464
gi|408395514|gb|EKJ74694.1| hypothetical protein FPSE_05162 [Fus...   257   4e-66   Fusarium pseudograminearum CS3096
gi|302898352|ref|XP_003047831.1| predicted protein [Nectria haem...   257   4e-66   Nectria haematococca mpVI 77-13-4
gi|340905158|gb|EGS17526.1| acyltransferase-like protein [Chaeto...   256   8e-66   Chaetomium thermophilum var. thermophilum DSM 1495
gi|440639588|gb|ELR09507.1| hypothetical protein GMDG_00689 [Geo...   256   9e-66   Pseudogymnoascus destructans 20631-21
gi|452982156|gb|EME81915.1| hypothetical protein MYCFIDRAFT_4637...   255   1e-65   Cercospora fijiensis CIRAD86
gi|326481308|gb|EGE05318.1| acyltransferase [Trichophyton equinu...   255   1e-65   Trichophyton equinum CBS 127.97
gi|302404914|ref|XP_003000294.1| lysocardiolipin acyltransferase...   255   2e-65   Verticillium alfalfae VaMs.102
gi|452840801|gb|EME42739.1| hypothetical protein DOTSEDRAFT_4618...   255   2e-65   Dothistroma septosporum NZE10
gi|302505485|ref|XP_003014449.1| hypothetical protein ARB_07011 ...   254   3e-65   Arthroderma benhamiae CBS 112371
gi|295660519|ref|XP_002790816.1| conserved hypothetical protein ...   254   3e-65   
gi|449300088|gb|EMC96101.1| hypothetical protein BAUCODRAFT_3488...   254   4e-65   Baudoinia panamericana UAMH 10762
gi|452841724|gb|EME43661.1| hypothetical protein DOTSEDRAFT_7287...   254   4e-65   Dothistroma septosporum NZE10
gi|389625317|ref|XP_003710312.1| 1-acyl-sn-glycerol-3-phosphate ...   254   4e-65   Magnaporthe oryzae 70-15
gi|512206833|gb|EPE35652.1| Glycerol-3-phosphate (1)-acyltransfe...   254   5e-65   Glarea lozoyensis ATCC 20868
gi|400598370|gb|EJP66087.1| acyltransferase-like protein [Beauve...   253   5e-65   Beauveria bassiana ARSEF 2860
gi|347839532|emb|CCD54104.1| hypothetical protein BofuT4_P128040...   253   5e-65   Botrytis cinerea T4
gi|327300899|ref|XP_003235142.1| acyltransferase [Trichophyton r...   253   7e-65   Trichophyton rubrum CBS 118892
gi|119498581|ref|XP_001266048.1| acyltransferase, putative [Neos...   253   8e-65   Aspergillus fischeri NRRL 181
gi|440470863|gb|ELQ39905.1| lysocardiolipin acyltransferase [Mag...   253   8e-65   Magnaporthe oryzae Y34
gi|511010645|gb|EPB91865.1| hypothetical protein HMPREF1544_0137...   253   8e-65   Mucor circinelloides f. circinelloides 1006PhL
gi|46110379|ref|XP_382247.1| hypothetical protein FG02071.1 [Fus...   253   8e-65   
gi|119182397|ref|XP_001242333.1| hypothetical protein CIMG_06229...   252   1e-64   Coccidioides immitis RS
gi|346327490|gb|EGX97086.1| acyltransferase, putative [Cordyceps...   252   2e-64   Cordyceps militaris CM01
gi|326468699|gb|EGD92708.1| acyltransferase [Trichophyton tonsur...   252   2e-64   Trichophyton tonsurans CBS 112818
gi|320041023|gb|EFW22956.1| acyltransferase [Coccidioides posada...   251   2e-64   Coccidioides posadasii str. Silveira
gi|303319149|ref|XP_003069574.1| 1-acylglycerol-3-phosphate acyl...   251   3e-64   Coccidioides posadasii C735 delta SOWgp
gi|261189492|ref|XP_002621157.1| acyltransferase [Ajellomyces de...   251   3e-64   Blastomyces gilchristii SLH14081
gi|391863394|gb|EIT72705.1| lysophosphatidic acid acyltransferas...   251   4e-64   Aspergillus oryzae 3.042
gi|358057868|dbj|GAA96113.1| hypothetical protein E5Q_02774 [Mix...   250   5e-64   Mixia osmundae IAM 14324
gi|296808941|ref|XP_002844809.1| tetratricopeptide repeat protei...   250   5e-64   Arthroderma otae CBS 113480
gi|302655459|ref|XP_003019517.1| hypothetical protein TRV_06454 ...   250   5e-64   Trichophyton verrucosum HKI 0517
gi|317138718|ref|XP_001817095.2| acyltransferase [Aspergillus or...   249   8e-64   Aspergillus oryzae RIB40
gi|83764949|dbj|BAE55093.1| unnamed protein product [Aspergillus...   249   8e-64   Aspergillus oryzae RIB40
gi|70998644|ref|XP_754044.1| acyltransferase [Aspergillus fumiga...   249   9e-64   Aspergillus fumigatus Af293
gi|115438446|ref|XP_001218068.1| conserved hypothetical protein ...   249   9e-64   Aspergillus terreus NIH2624
gi|121712618|ref|XP_001273920.1| acyltransferase, putative [Aspe...   249   1e-63   Aspergillus clavatus NRRL 1
gi|116198439|ref|XP_001225031.1| hypothetical protein CHGG_07375...   248   3e-63   Chaetomium globosum CBS 148.51
gi|392571654|gb|EIW64826.1| hypothetical protein TRAVEDRAFT_5564...   247   4e-63   Trametes versicolor FP-101664 SS1
gi|258571674|ref|XP_002544640.1| conserved hypothetical protein ...   246   8e-63   Uncinocarpus reesii 1704
gi|315048621|ref|XP_003173685.1| hypothetical protein MGYG_09034...   246   1e-62   Microsporum gypseum CBS 118893
gi|399171962|emb|CCE27189.1| related to acetyltransferase [Clavi...   246   1e-62   Claviceps purpurea 20.1
gi|255943781|ref|XP_002562658.1| Pc20g00970 [Penicillium chrysog...   245   1e-62   Penicillium rubens Wisconsin 54-1255
gi|331223575|ref|XP_003324460.1| hypothetical protein PGTG_05266...   244   3e-62   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|471562030|gb|EMR63644.1| putative 1-acyl-sn-glycerol-3-phosph...   244   3e-62   Eutypa lata UCREL1
gi|189190578|ref|XP_001931628.1| 1-acyl-sn-glycerol-3-phosphate ...   242   1e-61   Pyrenophora tritici-repentis Pt-1C-BFP
gi|403414186|emb|CCM00886.1| predicted protein [Fibroporia radic...   241   2e-61   Fibroporia radiculosa
gi|322708516|gb|EFZ00094.1| 1-acylglycerol-3-phosphate acyltrans...   241   3e-61   
gi|388857331|emb|CCF49005.1| uncharacterized protein [Ustilago h...   240   7e-61   Ustilago hordei
gi|259482950|tpe|CBF77913.1| TPA: acyltransferase, putative (AFU...   239   9e-61   Aspergillus nidulans FGSC A4
gi|443898958|dbj|GAC76291.1| lysophosphatidic acid acyltransfera...   239   9e-61   Moesziomyces antarcticus T-34
gi|398394062|ref|XP_003850490.1| hypothetical protein MYCGRDRAFT...   239   1e-60   Zymoseptoria tritici IPO323
gi|449550777|gb|EMD41741.1| hypothetical protein CERSUDRAFT_1103...   239   1e-60   Gelatoporia subvermispora B
gi|336372024|gb|EGO00364.1| hypothetical protein SERLA73DRAFT_18...   238   3e-60   Serpula lacrymans var. lacrymans S7.3
gi|343427809|emb|CBQ71335.1| conserved hypothetical protein [Spo...   237   4e-60   Sporisorium reilianum SRZ2
gi|470319370|gb|EMR10989.1| hypothetical protein PNEG_00591 [Pne...   237   4e-60   
gi|67903702|ref|XP_682107.1| hypothetical protein AN8838.2 [Aspe...   237   4e-60   Aspergillus nidulans FGSC A4
gi|328859838|gb|EGG08946.1| hypothetical protein MELLADRAFT_7725...   236   8e-60   Melampsora larici-populina 98AG31
gi|71023953|ref|XP_762206.1| hypothetical protein UM06059.1 [Ust...   236   1e-59   
gi|322696586|gb|EFY88376.1| 1-acylglycerol-3-phosphate acyltrans...   235   2e-59   Metarhizium acridum CQMa 102
gi|302697513|ref|XP_003038435.1| hypothetical protein SCHCODRAFT...   234   2e-59   Schizophyllum commune H4-8
gi|19111984|ref|NP_595192.1| 1-acylglycerol-3-phosphate acyltran...   234   3e-59   Schizosaccharomyces pombe 972h-
gi|320588260|gb|EFX00735.1| phospholipid/glycerol acyltransferas...   234   4e-59   Grosmannia clavigera kw1407
gi|402219847|gb|EJT99919.1| acyltransferase-domain-containing pr...   230   6e-58   Dacryopinax primogenitus
gi|429859581|gb|ELA34358.1| lysocardiolipin acyltransferase [Col...   229   8e-58   Colletotrichum gloeosporioides Nara gc5
gi|409051449|gb|EKM60925.1| hypothetical protein PHACADRAFT_2471...   227   4e-57   Phanerochaete carnosa HHB-10118-sp
gi|485921595|gb|EOD47274.1| putative phospholipid glycerol acylt...   227   4e-57   Neofusicoccum parvum UCRNP2
gi|169599517|ref|XP_001793181.1| hypothetical protein SNOG_02579...   227   5e-57   Parastagonospora nodorum SN15
gi|213408573|ref|XP_002175057.1| 1-acyl-sn-glycerol-3-phosphate ...   226   8e-57   Schizosaccharomyces japonicus yFS275
gi|328771095|gb|EGF81135.1| hypothetical protein BATDEDRAFT_2387...   226   1e-56   Batrachochytrium dendrobatidis JAM81
gi|395334176|gb|EJF66552.1| hypothetical protein DICSQDRAFT_1421...   223   6e-56   Dichomitus squalens LYAD-421 SS1
gi|430813760|emb|CCJ28918.1| unnamed protein product [Pneumocyst...   223   9e-56   Pneumocystis jirovecii
gi|389742176|gb|EIM83363.1| acyltransferase-domain-containing pr...   220   5e-55   Stereum hirsutum FP-91666 SS1
gi|50290037|ref|XP_447450.1| hypothetical protein [Candida glabr...   217   6e-54   Candida glabrata CBS 138
gi|50555035|ref|XP_504926.1| YALI0F02937p [Yarrowia lipolytica] ...   214   5e-53   Yarrowia lipolytica CLIB122
gi|443917030|gb|ELU37899.1| acyltransferase [Rhizoctonia solani ...   213   8e-53   Rhizoctonia solani AG-1 IA
gi|365982399|ref|XP_003668033.1| hypothetical protein NDAI_0A063...   213   8e-53   Naumovozyma dairenensis CBS 421
gi|393244645|gb|EJD52157.1| acyltransferase-domain-containing pr...   211   3e-52   Auricularia subglabra TFB-10046 SS5
gi|299755809|ref|XP_001828902.2| hypothetical protein CC1G_03696...   211   4e-52   Coprinopsis cinerea okayama7#130
gi|444323443|ref|XP_004182362.1| hypothetical protein TBLA_0I018...   208   2e-51   Tetrapisispora blattae CBS 6284
gi|256269001|gb|EEU04343.1| Cst26p [Saccharomyces cerevisiae JAY...   207   3e-51   Saccharomyces cerevisiae JAY291
gi|6319516|ref|NP_009598.1| Cst26p [Saccharomyces cerevisiae S28...   207   3e-51   Saccharomyces cerevisiae S288c
gi|367013352|ref|XP_003681176.1| hypothetical protein TDEL_0D038...   207   3e-51   Torulaspora delbrueckii
gi|366998367|ref|XP_003683920.1| hypothetical protein TPHA_0A041...   207   4e-51   Tetrapisispora phaffii CBS 4417
gi|254577079|ref|XP_002494526.1| ZYRO0A03586p [Zygosaccharomyces...   207   4e-51   Zygosaccharomyces rouxii CBS 732
gi|366996847|ref|XP_003678186.1| hypothetical protein NCAS_0I017...   207   4e-51   Naumovozyma castellii CBS 4309
gi|151946433|gb|EDN64655.1| chromosome stability-related protein...   207   6e-51   Saccharomyces cerevisiae YJM789
gi|156844513|ref|XP_001645319.1| hypothetical protein Kpol_1037p...   206   9e-51   Vanderwaltozyma polyspora DSM 70294
gi|401840297|gb|EJT43172.1| CST26-like protein [Saccharomyces ku...   205   2e-50   Saccharomyces kudriavzevii IFO 1802
gi|365762104|gb|EHN03714.1| Cst26p [Saccharomyces cerevisiae x S...   205   2e-50   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|393213204|gb|EJC98701.1| acyltransferase-domain-containing pr...   205   2e-50   Fomitiporia mediterranea MF3/22
gi|392576346|gb|EIW69477.1| hypothetical protein TREMEDRAFT_3054...   204   5e-50   Tremella mesenterica DSM 1558
gi|384486573|gb|EIE78753.1| hypothetical protein RO3G_03458 [Rhi...   203   9e-50   Rhizopus delemar RA 99-880
gi|321249081|ref|XP_003191336.1| acyltransferase [Cryptococcus g...   202   1e-49   Cryptococcus gattii WM276
gi|323305582|gb|EGA59323.1| YDR018C-like protein [Saccharomyces ...   202   1e-49   Saccharomyces cerevisiae FostersB
gi|472584266|gb|EMS21872.1| lysocardiolipin and lysophospholipid...   202   1e-49   Rhodotorula toruloides NP11
gi|154284113|ref|XP_001542852.1| conserved hypothetical protein ...   202   2e-49   Histoplasma capsulatum NAm1
gi|323334265|gb|EGA75647.1| YDR018C-like protein [Saccharomyces ...   201   2e-49   Saccharomyces cerevisiae AWRI796
gi|45185515|ref|NP_983231.1| ACL173Cp [Ashbya gossypii ATCC 1089...   201   2e-49   Eremothecium gossypii ATCC 10895
gi|259145263|emb|CAY78527.1| EC1118_1D0_2597p [Saccharomyces cer...   201   3e-49   Saccharomyces cerevisiae EC1118
gi|207346848|gb|EDZ73216.1| YDR018Cp-like protein [Saccharomyces...   201   3e-49   Saccharomyces cerevisiae AWRI1631
gi|513033532|gb|AGO13504.1| AaceriACL173Cp [Saccharomycetaceae s...   201   3e-49   Saccharomycetaceae sp. 'Ashbya aceri'
gi|151942006|gb|EDN60362.1| conserved protein [Saccharomyces cer...   201   3e-49   Saccharomyces cerevisiae YJM789
gi|6320221|ref|NP_010301.1| putative acyltransferase [Saccharomy...   201   3e-49   Saccharomyces cerevisiae S288c
gi|323309500|gb|EGA62711.1| YDR018C-like protein [Saccharomyces ...   200   5e-49   Saccharomyces cerevisiae FostersO
gi|50303779|ref|XP_451836.1| hypothetical protein [Kluyveromyces...   199   1e-48   Kluyveromyces lactis NRRL Y-1140
gi|256273245|gb|EEU08188.1| YDR018C-like protein [Saccharomyces ...   199   1e-48   Saccharomyces cerevisiae JAY291
gi|385303300|gb|EIF47383.1| ydr018c-like protein [Dekkera bruxel...   196   8e-48   Brettanomyces bruxellensis AWRI1499
gi|58262936|ref|XP_568878.1| acyltransferase [Cryptococcus neofo...   196   8e-48   Cryptococcus neoformans var. neoformans JEC21
gi|390604162|gb|EIN13553.1| hypothetical protein PUNSTDRAFT_5691...   196   9e-48   Punctularia strigosozonata HHB-11173 SS5
gi|367006731|ref|XP_003688096.1| hypothetical protein TPHA_0M008...   195   2e-47   Tetrapisispora phaffii CBS 4417
gi|406602109|emb|CCH46296.1| putative membrane protein [Wickerha...   194   3e-47   Wickerhamomyces ciferrii
gi|401840161|gb|EJT43068.1| YDR018C-like protein [Saccharomyces ...   194   3e-47   Saccharomyces kudriavzevii IFO 1802
gi|342319202|gb|EGU11152.1| Hypothetical Protein RTG_02955 [Rhod...   194   5e-47   Rhodotorula toruloides ATCC 204091
gi|363752285|ref|XP_003646359.1| hypothetical protein Ecym_4505 ...   192   1e-46   Eremothecium cymbalariae DBVPG#7215
gi|325091792|gb|EGC45102.1| acyltransferase [Ajellomyces capsula...   192   2e-46   Histoplasma capsulatum H88
gi|409083356|gb|EKM83713.1| hypothetical protein AGABI1DRAFT_326...   190   8e-46   Agaricus bisporus var. burnettii JB137-S8
gi|426201595|gb|EKV51518.1| hypothetical protein AGABI2DRAFT_147...   189   1e-45   Agaricus bisporus var. bisporus H97
gi|392597164|gb|EIW86486.1| hypothetical protein CONPUDRAFT_4478...   187   4e-45   Coniophora puteana RWD-64-598 SS2
gi|403217686|emb|CCK72179.1| hypothetical protein KNAG_0J00970 [...   187   6e-45   Kazachstania naganishii CBS 8797
gi|156848481|ref|XP_001647122.1| hypothetical protein Kpol_1036p...   185   2e-44   Vanderwaltozyma polyspora DSM 70294
gi|255712585|ref|XP_002552575.1| KLTH0C08096p [Lachancea thermot...   185   2e-44   Lachancea thermotolerans CBS 6340
gi|254566157|ref|XP_002490189.1| Protein of unknown function, af...   185   2e-44   Komagataella phaffii GS115
gi|323338336|gb|EGA79564.1| YDR018C-like protein [Saccharomyces ...   184   3e-44   Saccharomyces cerevisiae Vin13
gi|448533912|ref|XP_003870724.1| hypothetical protein CORT_0F037...   183   9e-44   Candida orthopsilosis Co 90-125
gi|353235835|emb|CCA67841.1| related to acetyltransferase [Pirif...   182   1e-43   Serendipita indica DSM 11827
gi|328769671|gb|EGF79714.1| hypothetical protein BATDEDRAFT_3185...   181   4e-43   Batrachochytrium dendrobatidis JAM81
gi|354543138|emb|CCE39856.1| hypothetical protein CPAR2_602750 [...   181   4e-43   Candida parapsilosis
gi|150865478|ref|XP_001384714.2| hypothetical protein PICST_8373...   180   8e-43   Scheffersomyces stipitis CBS 6054
gi|448098457|ref|XP_004198931.1| Piso0_002326 [Millerozyma farin...   177   4e-42   Millerozyma farinosa CBS 7064
gi|58262934|ref|XP_568877.1| acyltransferase [Cryptococcus neofo...   176   8e-42   Cryptococcus neoformans var. neoformans JEC21
gi|366988425|ref|XP_003673979.1| hypothetical protein NCAS_0A104...   176   1e-41   Naumovozyma castellii CBS 4309
gi|255727202|ref|XP_002548527.1| hypothetical protein CTRG_02824...   176   1e-41   Candida tropicalis MYA-3404
gi|241956392|ref|XP_002420916.1| uncharacterized acyltransferase...   174   3e-41   Candida dubliniensis CD36
gi|472580710|gb|EMS18488.1| lysophosphatidic acid acyltransferas...   174   3e-41   Rhodotorula toruloides NP11
gi|448102358|ref|XP_004199782.1| Piso0_002326 [Millerozyma farin...   174   5e-41   Millerozyma farinosa CBS 7064
gi|505756761|gb|EOR00902.1| hypothetical protein J056_004714 [Wa...   174   6e-41   Wallemia ichthyophaga EXF-994
gi|410077219|ref|XP_003956191.1| hypothetical protein KAFR_0C006...   172   1e-40   Kazachstania africana CBS 2517
gi|459366322|gb|EMG45703.1| hypothetical protein G210_4088, part...   172   2e-40   Candida maltosa Xu316
gi|344300018|gb|EGW30358.1| hypothetical protein SPAPADRAFT_6321...   171   5e-40   Spathaspora passalidarum NRRL Y-27907
gi|149236065|ref|XP_001523910.1| conserved hypothetical protein ...   170   7e-40   Lodderomyces elongisporus NRRL YB-4239
gi|388492986|gb|AFK34559.1| unknown [Medicago truncatula] >gi|38...   166   8e-39   Medicago truncatula
gi|502125937|ref|XP_004499122.1| PREDICTED: LOW QUALITY PROTEIN:...   166   9e-39   
gi|359807379|ref|NP_001241383.1| uncharacterized protein LOC1008...   166   9e-39   Glycine max [soybeans]
gi|195998323|ref|XP_002109030.1| hypothetical protein TRIADDRAFT...   165   2e-38   Trichoplax adhaerens
gi|294658704|ref|XP_002770829.1| DEHA2F15664p [Debaryomyces hans...   165   2e-38   Debaryomyces hansenii CBS767
gi|359475266|ref|XP_003631627.1| PREDICTED: probable 1-acyl-sn-g...   165   2e-38   Vitis vinifera
gi|388522193|gb|AFK49158.1| unknown [Lotus japonicus]                 165   3e-38   Lotus japonicus
gi|356564243|ref|XP_003550365.1| PREDICTED: probable 1-acyl-sn-g...   164   3e-38   
gi|224105447|ref|XP_002313814.1| predicted protein [Populus tric...   164   3e-38   Populus trichocarpa [western balsam poplar]
gi|259490769|ref|NP_001159241.1| hypothetical protein [Zea mays]...   163   7e-38   Zea mays [maize]
gi|242058907|ref|XP_002458599.1| hypothetical protein SORBIDRAFT...   163   7e-38   Sorghum bicolor [broomcorn]
gi|68483565|ref|XP_714343.1| potential acyltransferase [Candida ...   162   1e-37   Candida albicans SC5314
gi|260939890|ref|XP_002614245.1| hypothetical protein CLUG_05731...   160   4e-37   Clavispora lusitaniae ATCC 42720
gi|255556121|ref|XP_002519095.1| lysophosphatidic acid acyltrans...   160   5e-37   
gi|460385052|ref|XP_004238219.1| PREDICTED: probable 1-acyl-sn-g...   160   5e-37   Solanum lycopersicum
gi|405118533|gb|AFR93307.1| acyltransferase [Cryptococcus neofor...   160   6e-37   
gi|460370196|ref|XP_004230940.1| PREDICTED: probable 1-acyl-sn-g...   159   9e-37   Solanum lycopersicum
gi|344229672|gb|EGV61557.1| hypothetical protein CANTEDRAFT_1150...   159   1e-36   Candida tenuis ATCC 10573
gi|449461156|ref|XP_004148308.1| PREDICTED: probable 1-acyl-sn-g...   159   1e-36   Cucumis sativus [cucumbers]
gi|449518791|ref|XP_004166419.1| PREDICTED: LOW QUALITY PROTEIN:...   159   1e-36   
gi|356545295|ref|XP_003541079.1| PREDICTED: probable 1-acyl-sn-g...   159   1e-36   Glycine max [soybeans]
gi|68484125|ref|XP_714065.1| potential acyltransferase [Candida ...   159   1e-36   Candida albicans SC5314
gi|183211900|gb|ACC59200.1| 1-acyl-sn-glycerol-3-phosphate acylt...   159   1e-36   Ricinus communis
gi|502149143|ref|XP_004507408.1| PREDICTED: probable 1-acyl-sn-g...   159   2e-36   
gi|367038263|ref|XP_003649512.1| hypothetical protein THITE_2108...   158   3e-36   Thielavia terrestris NRRL 8126
gi|502149138|ref|XP_004507406.1| PREDICTED: probable 1-acyl-sn-g...   158   3e-36   Cicer arietinum [garbanzo]
gi|470106525|ref|XP_004289619.1| PREDICTED: probable 1-acyl-sn-g...   157   4e-36   Fragaria vesca subsp. vesca
gi|53791688|dbj|BAD53283.1| putative acyl-CoA:1-acylglycerol-3-p...   157   4e-36   Oryza sativa Japonica Group [Japonica rice]
gi|302767976|ref|XP_002967408.1| hypothetical protein SELMODRAFT...   157   4e-36   Selaginella moellendorffii
gi|126303648|ref|XP_001380699.1| PREDICTED: lysocardiolipin acyl...   157   6e-36   Monodelphis domestica
gi|18410753|ref|NP_565098.1| lysophosphatidyl acyltransferase 4 ...   157   6e-36   Arabidopsis thaliana [mouse-ear cress]
gi|482569221|gb|EOA33409.1| hypothetical protein CARUB_v10020475...   157   6e-36   Capsella rubella
gi|149633443|ref|XP_001510123.1| PREDICTED: lysocardiolipin acyl...   157   7e-36   Ornithorhynchus anatinus [duck-billed platypus]
gi|395507084|ref|XP_003757858.1| PREDICTED: lysocardiolipin acyl...   157   7e-36   Sarcophilus harrisii
gi|462424422|gb|EMJ28685.1| hypothetical protein PRUPE_ppa006921...   156   8e-36   Prunus persica
gi|115440337|ref|NP_001044448.1| Os01g0782500 [Oryza sativa Japo...   156   8e-36   
gi|356538815|ref|XP_003537896.1| PREDICTED: probable 1-acyl-sn-g...   156   8e-36   
gi|483510224|gb|EOA99563.1| Lysocardiolipin acyltransferase, par...   156   9e-36   Anas platyrhynchos [duck]
gi|302753762|ref|XP_002960305.1| hypothetical protein SELMODRAFT...   156   9e-36   Selaginella moellendorffii
gi|297834800|ref|XP_002885282.1| hypothetical protein ARALYDRAFT...   156   9e-36   Arabidopsis lyrata subsp. lyrata
gi|508706661|gb|EOX98557.1| Lysophosphatidyl acyltransferase 5 [...   156   1e-35   Theobroma cacao [chocolate]
gi|224063587|ref|XP_002301215.1| predicted protein [Populus tric...   156   1e-35   Populus trichocarpa [western balsam poplar]
gi|297839375|ref|XP_002887569.1| hypothetical protein ARALYDRAFT...   155   2e-35   Arabidopsis lyrata subsp. lyrata
gi|507958676|ref|XP_004686379.1| PREDICTED: lysocardiolipin acyl...   155   2e-35   Condylura cristata
gi|482566635|gb|EOA30824.1| hypothetical protein CARUB_v10013968...   155   2e-35   Capsella rubella
gi|462396456|gb|EMJ02255.1| hypothetical protein PRUPE_ppa007197...   155   2e-35   Prunus persica
gi|15230215|ref|NP_188515.1| lysophosphatidyl acyltransferase 5 ...   155   2e-35   Arabidopsis thaliana [mouse-ear cress]
gi|462396455|gb|EMJ02254.1| hypothetical protein PRUPE_ppa007197...   155   2e-35   Prunus persica
gi|498933271|ref|XP_004540399.1| PREDICTED: lysocardiolipin acyl...   155   3e-35   Maylandia zebra
gi|145332637|ref|NP_001078184.1| lysophosphatidyl acyltransferas...   155   3e-35   Arabidopsis thaliana [mouse-ear cress]
gi|5882722|gb|AAD55275.1|AC008263_6 Contains similarity to gb|Z9...   154   3e-35   Arabidopsis thaliana [mouse-ear cress]
gi|12323905|gb|AAG51931.1|AC013258_25 putative acyl-CoA:1-acylgl...   154   4e-35   Arabidopsis thaliana [mouse-ear cress]
gi|224137242|ref|XP_002327077.1| predicted protein [Populus tric...   154   4e-35   
gi|148908399|gb|ABR17313.1| unknown [Picea sitchensis]                154   5e-35   Picea sitchensis
gi|449268010|gb|EMC78890.1| Lysocardiolipin acyltransferase 1 [C...   154   5e-35   Columba livia [carrier pigeon]
gi|326914893|ref|XP_003203757.1| PREDICTED: lysocardiolipin acyl...   154   6e-35   
gi|242088397|ref|XP_002440031.1| hypothetical protein SORBIDRAFT...   154   6e-35   Sorghum bicolor [broomcorn]
gi|183211898|gb|ACC59199.1| 1-acyl-sn-glycerol-3-phosphate acylt...   153   8e-35   Ricinus communis
gi|348510701|ref|XP_003442883.1| PREDICTED: lysocardiolipin acyl...   153   9e-35   
gi|47086103|ref|NP_998435.1| lysocardiolipin acyltransferase 1 [...   153   9e-35   Danio rerio [leopard danio]
gi|508722781|gb|EOY14678.1| Lysophosphatidyl acyltransferase 4 [...   153   1e-34   Theobroma cacao [chocolate]
gi|66825969|ref|XP_646339.1| hypothetical protein DDB_G0269848 [...   152   1e-34   Dictyostelium discoideum AX4
gi|507629392|ref|XP_004627437.1| PREDICTED: lysocardiolipin acyl...   152   1e-34   Octodon degus
gi|449470013|ref|XP_004152713.1| PREDICTED: probable 1-acyl-sn-g...   152   2e-34   Cucumis sativus [cucumbers]
gi|71895655|ref|NP_001026210.1| lysocardiolipin acyltransferase ...   152   2e-34   Gallus gallus [bantam]
gi|507541137|ref|XP_004654571.1| PREDICTED: lysocardiolipin acyl...   152   2e-34   Jaculus jaculus
gi|344280262|ref|XP_003411904.1| PREDICTED: lysocardiolipin acyl...   152   2e-34   
gi|47229964|emb|CAG10378.1| unnamed protein product [Tetraodon n...   152   2e-34   Tetraodon nigroviridis
gi|397513807|ref|XP_003827199.1| PREDICTED: lysocardiolipin acyl...   151   3e-34   
gi|301105020|ref|XP_002901594.1| lysocardiolipin acyltransferase...   151   3e-34   Phytophthora infestans T30-4
gi|470114039|ref|XP_004293226.1| PREDICTED: probable 1-acyl-sn-g...   151   3e-34   
gi|348574558|ref|XP_003473057.1| PREDICTED: lysocardiolipin acyl...   151   3e-34   
gi|397513805|ref|XP_003827198.1| PREDICTED: lysocardiolipin acyl...   151   4e-34   Pan paniscus [bonobo]
gi|213982709|ref|NP_001135517.1| lysocardiolipin acyltransferase...   151   4e-34   Xenopus tropicalis [western clawed frog]
gi|194384698|dbj|BAG59509.1| unnamed protein product [Homo sapiens]   150   5e-34   Homo sapiens [man]
gi|42558246|ref|NP_872357.2| lysocardiolipin acyltransferase 1 i...   150   6e-34   Homo sapiens [man]
gi|426335171|ref|XP_004029106.1| PREDICTED: lysocardiolipin acyl...   150   6e-34   Gorilla gorilla gorilla [lowland gorilla]
gi|327262593|ref|XP_003216108.1| PREDICTED: lysocardiolipin acyl...   150   7e-34   Anolis carolinensis [Carolina anole]
gi|114576846|ref|XP_001163327.1| PREDICTED: lysocardiolipin acyl...   150   7e-34   Pan troglodytes
gi|471379826|ref|XP_004377710.1| PREDICTED: lysocardiolipin acyl...   150   7e-34   Trichechus manatus latirostris
gi|488518341|ref|XP_004451125.1| PREDICTED: lysocardiolipin acyl...   150   7e-34   
gi|432936724|ref|XP_004082248.1| PREDICTED: lysocardiolipin acyl...   150   7e-34   
gi|50659059|ref|NP_001002257.1| lysocardiolipin acyltransferase ...   150   8e-34   
gi|114576850|ref|XP_515384.2| PREDICTED: lysocardiolipin acyltra...   150   8e-34   
gi|426335169|ref|XP_004029105.1| PREDICTED: lysocardiolipin acyl...   150   8e-34   
gi|301784977|ref|XP_002927903.1| PREDICTED: lysocardiolipin acyl...   150   8e-34   
gi|432096768|gb|ELK27346.1| Lysocardiolipin acyltransferase 1 [M...   150   8e-34   
gi|402890481|ref|XP_003908515.1| PREDICTED: lysocardiolipin acyl...   150   9e-34   
gi|332227133|ref|XP_003262745.1| PREDICTED: lysocardiolipin acyl...   150   9e-34   
gi|218664497|ref|NP_001136317.1| lysocardiolipin acyltransferase...   150   9e-34   
gi|488518337|ref|XP_004451123.1| PREDICTED: lysocardiolipin acyl...   150   9e-34   
gi|390474603|ref|XP_002757931.2| PREDICTED: LOW QUALITY PROTEIN:...   149   1e-33   
gi|194380120|dbj|BAG63827.1| unnamed protein product [Homo sapiens]   149   1e-33   
gi|281344874|gb|EFB20458.1| hypothetical protein PANDA_017747 [A...   149   1e-33   
gi|488518335|ref|XP_004451122.1| PREDICTED: lysocardiolipin acyl...   149   1e-33   
gi|115464749|ref|NP_001055974.1| Os05g0502200 [Oryza sativa Japo...   149   1e-33   
gi|472380457|ref|XP_004409631.1| PREDICTED: lysocardiolipin acyl...   149   1e-33   
gi|109102558|ref|XP_001104425.1| PREDICTED: lysocardiolipin acyl...   149   1e-33   
gi|338714368|ref|XP_001500525.2| PREDICTED: lysocardiolipin acyl...   149   2e-33   
gi|351712964|gb|EHB15883.1| Lysocardiolipin acyltransferase 1, p...   149   2e-33   
gi|512924298|ref|XP_004905184.1| PREDICTED: lysocardiolipin acyl...   149   2e-33   
gi|298713115|emb|CBJ33474.1| Lysocardiolipin acyltransferase [Ec...   149   2e-33   
gi|218197054|gb|EEC79481.1| hypothetical protein OsI_20519 [Oryz...   149   2e-33   
gi|255538548|ref|XP_002510339.1| lysophosphatidic acid acyltrans...   148   2e-33   
gi|354468320|ref|XP_003496614.1| PREDICTED: lysocardiolipin acyl...   148   2e-33   
gi|119903770|ref|XP_599164.3| PREDICTED: lysocardiolipin acyltra...   148   2e-33   
gi|505853250|ref|XP_004620058.1| PREDICTED: lysocardiolipin acyl...   148   3e-33   
gi|73980699|ref|XP_540138.2| PREDICTED: lysocardiolipin acyltran...   148   3e-33   
gi|124486722|ref|NP_001074540.1| lysocardiolipin acyltransferase...   148   3e-33   
gi|507683302|ref|XP_004711159.1| PREDICTED: lysocardiolipin acyl...   148   3e-33   
gi|392340925|ref|XP_001060474.3| PREDICTED: lysocardiolipin acyl...   148   3e-33   
gi|410955526|ref|XP_003984402.1| PREDICTED: lysocardiolipin acyl...   148   3e-33   
gi|395828802|ref|XP_003787553.1| PREDICTED: lysocardiolipin acyl...   148   3e-33   
gi|431911957|gb|ELK14101.1| Lysocardiolipin acyltransferase 1, p...   147   4e-33   
gi|440907823|gb|ELR57920.1| Lysocardiolipin acyltransferase 1, p...   147   4e-33   
gi|226531962|ref|NP_001151948.1| 1-acyl-sn-glycerol-3-phosphate ...   147   4e-33   
gi|194707926|gb|ACF88047.1| unknown [Zea mays] >gi|413945927|gb|...   147   4e-33   
gi|459173712|ref|XP_002119716.2| PREDICTED: lysocardiolipin acyl...   147   4e-33   
gi|291226007|ref|XP_002732992.1| PREDICTED: ACyLtransferase-like...   147   5e-33   
gi|149050687|gb|EDM02860.1| similar to lysocardiolipin acyltrans...   147   6e-33   
gi|156382764|ref|XP_001632722.1| predicted protein [Nematostella...   147   7e-33   
gi|504140639|ref|XP_004582767.1| PREDICTED: lysocardiolipin acyl...   147   8e-33   
gi|466000251|ref|XP_004268230.1| PREDICTED: lysocardiolipin acyl...   146   9e-33   
gi|478487676|ref|XP_004418230.1| PREDICTED: lysocardiolipin acyl...   146   1e-32   
gi|511917344|ref|XP_004777948.1| PREDICTED: lysocardiolipin acyl...   145   2e-32   
gi|365982307|ref|XP_003667987.1| hypothetical protein NDAI_0A058...   145   2e-32   
gi|511917346|ref|XP_004777949.1| PREDICTED: lysocardiolipin acyl...   145   2e-32   
gi|348684750|gb|EGZ24565.1| hypothetical protein PHYSODRAFT_5396...   145   2e-32   
gi|357133090|ref|XP_003568161.1| PREDICTED: probable 1-acyl-sn-g...   145   2e-32   
gi|426223368|ref|XP_004005847.1| PREDICTED: lysocardiolipin acyl...   145   2e-32   
gi|74190619|dbj|BAE25946.1| unnamed protein product [Mus musculus]    145   3e-32   
gi|326432219|gb|EGD77789.1| hypothetical protein PTSG_08879 [Sal...   144   3e-32   
gi|410898629|ref|XP_003962800.1| PREDICTED: lysocardiolipin acyl...   144   4e-32   
gi|291386977|ref|XP_002709981.1| PREDICTED: lysocardiolipin acyl...   144   5e-32   
gi|302142438|emb|CBI19641.3| unnamed protein product [Vitis vini...   144   6e-32   
gi|301118637|ref|XP_002907046.1| 1-acyl-sn-glycerol-3-phosphate ...   143   7e-32   
gi|359492660|ref|XP_002281838.2| PREDICTED: probable 1-acyl-sn-g...   143   8e-32   
gi|330792835|ref|XP_003284492.1| hypothetical protein DICPUDRAFT...   143   9e-32   
gi|340375993|ref|XP_003386518.1| PREDICTED: hypothetical protein...   143   1e-31   
gi|147769916|emb|CAN72146.1| hypothetical protein VITISV_010094 ...   142   1e-31   
gi|168026942|ref|XP_001765990.1| predicted protein [Physcomitrel...   142   1e-31   
gi|365767099|gb|EHN08587.1| Cst26p [Saccharomyces cerevisiae x S...   142   2e-31   
gi|260830483|ref|XP_002610190.1| hypothetical protein BRAFLDRAFT...   141   4e-31   
gi|348689402|gb|EGZ29216.1| hypothetical protein PHYSODRAFT_4733...   140   5e-31   
gi|470468663|ref|XP_004341922.1| acyltransferase domain containi...   139   1e-30   
gi|308504039|ref|XP_003114203.1| CRE-BUS-18 protein [Caenorhabdi...   139   1e-30   
gi|323306090|gb|EGA59824.1| Cst26p [Saccharomyces cerevisiae Fos...   139   2e-30   
gi|475516436|gb|EMT05984.1| Putative 1-acyl-sn-glycerol-3-phosph...   139   2e-30   
gi|328350587|emb|CCA36987.1| hypothetical protein PP7435_Chr1-08...   139   2e-30   
gi|345485203|ref|XP_001603121.2| PREDICTED: lysocardiolipin acyl...   139   2e-30   
gi|281209895|gb|EFA84063.1| hypothetical protein PPL_03136 [Poly...   138   3e-30   
gi|508785391|gb|EOY32647.1| Lysophosphatidyl acyltransferase 2, ...   138   3e-30   
gi|388492890|gb|AFK34511.1| unknown [Medicago truncatula]             138   3e-30   
gi|147863949|emb|CAN83214.1| hypothetical protein VITISV_038716 ...   137   6e-30   
gi|323310212|gb|EGA63404.1| Cst26p [Saccharomyces cerevisiae Fos...   137   8e-30   
gi|298713600|emb|CBJ27128.1| acyltransferase [Ectocarpus silicul...   136   9e-30   
gi|508785390|gb|EOY32646.1| Lysophosphatidyl acyltransferase 2, ...   136   1e-29   
gi|156368619|ref|XP_001627790.1| predicted protein [Nematostella...   136   1e-29   
gi|390343392|ref|XP_003725866.1| PREDICTED: lysocardiolipin acyl...   135   2e-29   
gi|225441750|ref|XP_002283340.1| PREDICTED: 1-acyl-sn-glycerol-3...   135   2e-29   
gi|124378835|gb|ABN09946.1| lysophosphatidyl acyltransferase [Cr...   135   2e-29   
gi|502165660|ref|XP_004513649.1| PREDICTED: 1-acyl-sn-glycerol-3...   135   3e-29   
gi|115534668|ref|NP_505971.2| Protein BUS-18 [Caenorhabditis ele...   134   3e-29   
gi|406699253|gb|EKD02460.1| acyltransferase [Trichosporon asahii...   134   4e-29   
gi|73620927|sp|Q6IWY1.1|LPAT2_BRAOL RecName: Full=1-acyl-sn-glyc...   134   4e-29   
gi|224139852|ref|XP_002323308.1| predicted protein [Populus tric...   134   4e-29   
gi|341904399|gb|EGT60232.1| CBN-ACL-10 protein [Caenorhabditis b...   134   4e-29   
gi|83287830|sp|Q9XFW4.1|LPAT2_BRANA RecName: Full=1-acyl-sn-glyc...   134   5e-29   
gi|1067138|emb|CAA88620.1| 1-acyl-sn-glycerol-3-phosphate acyltr...   134   5e-29   
gi|449437617|ref|XP_004136588.1| PREDICTED: 1-acyl-sn-glycerol-3...   134   5e-29   
gi|449517427|ref|XP_004165747.1| PREDICTED: 1-acyl-sn-glycerol-3...   134   6e-29   
gi|168471722|gb|ABM92334.2| 1-acylglycerol-3-phosphate acyltrans...   134   6e-29   
gi|356504815|ref|XP_003521190.1| PREDICTED: 1-acyl-sn-glycerol-3...   133   7e-29   
gi|388582450|gb|EIM22755.1| hypothetical protein WALSEDRAFT_3191...   133   7e-29   
gi|313225138|emb|CBY20931.1| unnamed protein product [Oikopleura...   133   8e-29   
gi|470143826|ref|XP_004307568.1| PREDICTED: 1-acyl-sn-glycerol-3...   133   8e-29   
gi|297817090|ref|XP_002876428.1| hypothetical protein ARALYDRAFT...   133   8e-29   
gi|18410774|ref|NP_567052.1| lysophosphatidyl acyltransferase 2 ...   133   8e-29   
gi|289472609|gb|ADC97478.1| lysophosphatidic acid acyltransferas...   133   8e-29   
gi|115313423|gb|AAI24533.1| Zgc:154071 [Danio rerio] >gi|1828889...   133   9e-29   
gi|482562051|gb|EOA26242.1| hypothetical protein CARUB_v10017420...   133   9e-29   
gi|390353412|ref|XP_003728105.1| PREDICTED: lysocardiolipin acyl...   133   1e-28   
gi|401888043|gb|EJT52011.1| acyltransferase [Trichosporon asahii...   133   1e-28   
gi|414144874|ref|NP_001070213.2| 1-acyl-sn-glycerol-3-phosphate ...   133   1e-28   
gi|289472611|gb|ADC97479.1| lysophosphatidic acid acyltransferas...   133   1e-28   
gi|294460437|gb|ADE75797.1| unknown [Picea sitchensis]                132   2e-28   
gi|356504817|ref|XP_003521191.1| PREDICTED: 1-acyl-sn-glycerol-3...   132   2e-28   
gi|511003442|gb|EPB84845.1| hypothetical protein HMPREF1544_0841...   132   2e-28   
gi|405953775|gb|EKC21370.1| 1-acyl-sn-glycerol-3-phosphate acylt...   132   2e-28   
gi|196006035|ref|XP_002112884.1| hypothetical protein TRIADDRAFT...   132   2e-28   
gi|508785394|gb|EOY32650.1| Lysophosphatidyl acyltransferase 3 [...   132   2e-28   
gi|326437037|gb|EGD82607.1| hypothetical protein PTSG_03262 [Sal...   131   3e-28   
gi|21536701|gb|AAM61033.1| 1-acylcerol-3-phosphate acyltransfera...   130   5e-28   
gi|224087056|ref|XP_002308046.1| predicted protein [Populus tric...   130   8e-28   
gi|502108944|ref|XP_004493527.1| PREDICTED: 1-acyl-sn-glycerol-3...   130   1e-27   
gi|82568693|dbj|BAE48660.1| 1-acyl-sn-glycerol-3-phosphate acylt...   130   1e-27   
gi|242014933|ref|XP_002428133.1| 1-acylglycerol-3-phosphate acyl...   130   1e-27   
gi|356572050|ref|XP_003554183.1| PREDICTED: 1-acyl-sn-glycerol-3...   129   1e-27   
gi|58332234|ref|NP_001011265.1| 1-acylglycerol-3-phosphate O-acy...   129   1e-27   
gi|460407518|ref|XP_004249199.1| PREDICTED: 1-acyl-sn-glycerol-3...   129   1e-27   
gi|462397675|gb|EMJ03343.1| hypothetical protein PRUPE_ppa007002...   129   2e-27   
gi|301770567|ref|XP_002920701.1| PREDICTED: 1-acyl-sn-glycerol-3...   129   2e-27   
gi|470605036|ref|XP_004313699.1| PREDICTED: 1-acyl-sn-glycerol-3...   129   2e-27   
gi|198414563|ref|XP_002129599.1| PREDICTED: lysocardiolipin acyl...   129   2e-27   
gi|405952233|gb|EKC20070.1| Lysocardiolipin acyltransferase 1 [C...   128   2e-27   
gi|348670383|gb|EGZ10205.1| hypothetical protein PHYSODRAFT_5224...   128   2e-27   
gi|466053816|ref|XP_004278917.1| PREDICTED: 1-acyl-sn-glycerol-3...   128   3e-27   
gi|388504400|gb|AFK40266.1| unknown [Medicago truncatula]             128   3e-27   
gi|512865092|ref|XP_004890843.1| PREDICTED: 1-acyl-sn-glycerol-3...   128   3e-27   
gi|507541133|ref|XP_004654569.1| PREDICTED: 1-acyl-sn-glycerol-3...   128   3e-27   
gi|449268670|gb|EMC79519.1| 1-acyl-sn-glycerol-3-phosphate acylt...   128   3e-27   
gi|357509775|ref|XP_003625176.1| 1-acyl-sn-glycerol-3-phosphate ...   128   3e-27   
gi|73946218|ref|XP_855143.1| PREDICTED: 1-acyl-sn-glycerol-3-pho...   128   3e-27   
gi|262036919|dbj|BAI47595.1| 1-acylglycerol-3-phosphate O-acyltr...   128   3e-27   
gi|255571568|ref|XP_002526730.1| lysophosphatidic acid acyltrans...   128   4e-27   
gi|6635840|gb|AAF20003.1|AF213937_1 1-acyl-sn-glycerol-3-phospha...   128   4e-27   
gi|356498539|ref|XP_003518108.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   4e-27   
gi|258523310|gb|ACV73676.1| lysophosphatidic acid acyltransferas...   127   5e-27   
gi|148222474|ref|NP_001085041.1| 1-acylglycerol-3-phosphate O-ac...   127   5e-27   
gi|471406210|ref|XP_004384856.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   6e-27   
gi|255636898|gb|ACU18782.1| unknown [Glycine max]                     127   6e-27   
gi|466053821|ref|XP_004278918.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   6e-27   
gi|462410440|gb|EMJ15774.1| hypothetical protein PRUPE_ppa019921...   127   6e-27   
gi|406897269|gb|EKD41275.1| hypothetical protein ACD_73C00783G00...   127   7e-27   
gi|410960329|ref|XP_003986745.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   7e-27   
gi|357155998|ref|XP_003577308.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   8e-27   
gi|66805933|ref|XP_636688.1| hypothetical protein DDB_G0288523 [...   127   8e-27   
gi|478532909|ref|XP_004440600.1| PREDICTED: 1-acyl-sn-glycerol-3...   127   8e-27   
gi|219521976|ref|NP_001137169.1| 1-acyl-sn-glycerol-3-phosphate ...   127   8e-27   
gi|255544850|ref|XP_002513486.1| 1-acylglycerol-3-phosphate acyl...   127   9e-27   
gi|470247188|ref|XP_004357305.1| Putative acetyltransferase prot...   126   9e-27   
gi|149743988|ref|XP_001500501.1| PREDICTED: 1-acyl-sn-glycerol-3...   126   9e-27   
gi|328783171|ref|XP_001123248.2| PREDICTED: lysocardiolipin acyl...   126   1e-26   
gi|224106167|ref|XP_002314068.1| predicted protein [Populus tric...   126   1e-26   
gi|356534633|ref|XP_003535857.1| PREDICTED: 1-acyl-sn-glycerol-3...   126   1e-26   
gi|344294761|ref|XP_003419084.1| PREDICTED: 1-acyl-sn-glycerol-3...   126   1e-26   
gi|392882406|gb|AFM90035.1| 1-acyl-sn-glycerol-3-phosphate acylt...   126   1e-26   
gi|392879768|gb|AFM88716.1| 1-acyl-sn-glycerol-3-phosphate acylt...   126   1e-26   
gi|301781044|ref|XP_002925922.1| PREDICTED: 1-acyl-sn-glycerol-3...   126   1e-26   
gi|223948039|gb|ACN28103.1| unknown [Zea mays] >gi|413920337|gb|...   126   1e-26   
gi|226494556|ref|NP_001148618.1| 1-acyl-sn-glycerol-3-phosphate ...   126   1e-26   
gi|507693176|ref|XP_004642561.1| PREDICTED: 1-acyl-sn-glycerol-3...   125   2e-26   
gi|326913385|ref|XP_003203019.1| PREDICTED: 1-acyl-sn-glycerol-3...   125   2e-26   
gi|511902772|ref|XP_004770894.1| PREDICTED: 1-acyl-sn-glycerol-3...   125   2e-26   
gi|108864611|gb|ABA94922.2| 1-acyl-sn-glycerol-3-phosphate acylt...   125   2e-26   
gi|218189173|gb|EEC71600.1| hypothetical protein OsI_03992 [Oryz...   125   2e-26   
gi|222616293|gb|EEE52425.1| hypothetical protein OsJ_34550 [Oryz...   125   2e-26   
gi|330843440|ref|XP_003293662.1| hypothetical protein DICPUDRAFT...   125   2e-26   
gi|471206907|ref|XP_004260206.1| 1-acylglycerol-3-phosphate acyl...   125   2e-26   
gi|255544852|ref|XP_002513487.1| lysophosphatidic acid acyltrans...   125   2e-26   
gi|340715457|ref|XP_003396229.1| PREDICTED: lysocardiolipin acyl...   125   3e-26   
gi|374671171|gb|AEZ56251.1| plastid 1-acylglycerol-phosphate acy...   125   3e-26   
gi|332019425|gb|EGI59909.1| Lysocardiolipin acyltransferase 1 [A...   125   3e-26   
gi|56118272|ref|NP_001008119.1| 1-acylglycerol-3-phosphate O-acy...   125   3e-26   
gi|350414494|ref|XP_003490335.1| PREDICTED: lysocardiolipin acyl...   125   3e-26   
gi|242071805|ref|XP_002451179.1| hypothetical protein SORBIDRAFT...   125   3e-26   
gi|162462974|ref|NP_001105919.1| 1-acyl-sn-glycerol-3-phosphate ...   124   3e-26   
gi|465967676|gb|EMP31479.1| 1-acyl-sn-glycerol-3-phosphate acylt...   124   3e-26   
gi|405976264|gb|EKC40777.1| 1-acyl-sn-glycerol-3-phosphate acylt...   124   3e-26   
gi|357151980|ref|XP_003575968.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   4e-26   
gi|118083886|ref|XP_416756.2| PREDICTED: 1-acyl-sn-glycerol-3-ph...   124   4e-26   
gi|460378153|ref|XP_004234840.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   4e-26   
gi|431904578|gb|ELK09960.1| 1-acyl-sn-glycerol-3-phosphate acylt...   124   4e-26   
gi|502081771|ref|XP_004486963.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   4e-26   
gi|383851044|ref|XP_003701063.1| PREDICTED: lysocardiolipin acyl...   124   4e-26   
gi|483521434|gb|EOB06492.1| 1-acyl-sn-glycerol-3-phosphate acylt...   124   5e-26   
gi|296082658|emb|CBI21663.3| unnamed protein product [Vitis vini...   124   5e-26   
gi|402868686|ref|XP_003898424.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   5e-26   
gi|15223789|ref|NP_175537.1| 1-acyl-sn-glycerol-3-phosphate acyl...   124   6e-26   
gi|147906755|ref|NP_001087659.1| 1-acylglycerol-3-phosphate O-ac...   124   6e-26   
gi|426235029|ref|XP_004011493.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   7e-26   
gi|426235027|ref|XP_004011492.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   7e-26   
gi|197098452|ref|NP_001126417.1| 1-acyl-sn-glycerol-3-phosphate ...   124   7e-26   
gi|397499069|ref|XP_003820287.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   7e-26   
gi|145692847|gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [...   124   7e-26   
gi|9910392|ref|NP_064518.1| 1-acyl-sn-glycerol-3-phosphate acylt...   124   7e-26   
gi|225438273|ref|XP_002268451.1| PREDICTED: 1-acyl-sn-glycerol-3...   124   7e-26   
gi|157138549|ref|XP_001664249.1| 1-acylglycerol-3-phosphate acyl...   124   7e-26   
gi|413920338|gb|AFW60270.1| hypothetical protein ZEAMMB73_783506...   124   7e-26   
gi|470308185|ref|XP_004363771.1| lysocardiolipin acyltransferase...   123   8e-26   
gi|344295151|ref|XP_003419277.1| PREDICTED: 1-acyl-sn-glycerol-3...   123   8e-26   
gi|308321664|gb|ADO27983.1| 1-acyl-sn-glycerol-3-phosphate acylt...   123   9e-26   
gi|410955951|ref|XP_004001690.1| PREDICTED: LOW QUALITY PROTEIN:...   123   9e-26   
gi|312151298|gb|ADQ32161.1| 1-acylglycerol-3-phosphate O-acyltra...   123   9e-26   
gi|307167259|gb|EFN60942.1| Lysocardiolipin acyltransferase [Cam...   123   9e-26   
gi|268557172|ref|XP_002636575.1| C. briggsae CBR-ACL-10 protein ...   123   1e-25   
gi|156122740|gb|ABU50327.1| 1-acyl-sn-glycerol-3-phosphate acylt...   123   1e-25   
gi|432109781|gb|ELK33833.1| 1-acyl-sn-glycerol-3-phosphate acylt...   123   1e-25   
gi|327261341|ref|XP_003215489.1| PREDICTED: 1-acyl-sn-glycerol-3...   123   1e-25   
gi|242085684|ref|XP_002443267.1| hypothetical protein SORBIDRAFT...   123   1e-25   
gi|449442533|ref|XP_004139036.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   1e-25   
gi|325192890|emb|CCA27281.1| lysocardiolipin acyltransferase put...   122   1e-25   
gi|507558976|ref|XP_004663222.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   2e-25   
gi|218186088|gb|EEC68515.1| hypothetical protein OsI_36790 [Oryz...   122   2e-25   
gi|224042585|ref|XP_002189743.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   2e-25   
gi|403284998|ref|XP_003933831.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   2e-25   
gi|62751456|ref|NP_001015537.1| 1-acyl-sn-glycerol-3-phosphate a...   122   2e-25   
gi|326490461|dbj|BAJ84894.1| predicted protein [Hordeum vulgare ...   122   2e-25   
gi|296199577|ref|XP_002747213.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   2e-25   
gi|47087391|ref|NP_998590.1| 1-acyl-sn-glycerol-3-phosphate acyl...   122   2e-25   
gi|326915644|ref|XP_003204124.1| PREDICTED: 1-acyl-sn-glycerol-3...   122   2e-25   


>gi|296425567|ref|XP_002842312.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638575|emb|CAZ86503.1| unnamed protein product [Tuber melanosporum]
          Length = 436

 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 225/349 (64%), Gaps = 6/349 (1%)

Query: 27  LEIIKMPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYI 86
           + I + PA G  +   L QWL R   F ++F G    L+ +Q L LLL+PF    Y +YI
Sbjct: 1   MPIEQHPA-GRARYGGLRQWL-RICSFTIYFGGCMLVLHLTQILGLLLYPFDRPLYYAYI 58

Query: 87  KHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQI 146
             T+  FG+L+  I Q+++P+   +T DKS +  LK++  G ++E + P+R++LIANHQ+
Sbjct: 59  AKTKANFGVLVTTITQWWSPTVVRVTGDKSVRHQLKRT-PGGRLECEFPDRMVLIANHQL 117

Query: 147 YADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKT 206
           Y+DWLY+W   Y A  HG   IILK+SLK++P+ G GMQFF +IFL R W  DK  F   
Sbjct: 118 YSDWLYLWWIAYTARMHGFFYIILKESLKYVPVIGPGMQFFGFIFLARKWEQDKPRFVHR 177

Query: 207 LSTLATSK--EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAG 264
           LS LA     EP+WLL+FPEGT +SD  R TS KYA+K+ + D +H++LPRSTGL FC  
Sbjct: 178 LSKLAAGGGVEPMWLLMFPEGTNLSDNGRKTSSKYAEKISVEDLKHLMLPRSTGLRFCLE 237

Query: 265 SLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-ED 323
           +L KSV++VYD T+  EGV RG+F ++ +TL   YFEG+ P+++++H R++A+S +P  D
Sbjct: 238 NLGKSVEWVYDCTVAYEGVPRGKFGQDFFTLNSTYFEGRPPKSVNMHWRRFAVSSIPVSD 297

Query: 324 EDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQ 372
             +F  WL  RW EKD L+E +   GRF   E  +     +++V  +++
Sbjct: 298 VAEFDAWLTLRWREKDDLLEYYLENGRFPEDEDEKQGNGNIHAVKSVSE 346



>gi|494830062|gb|EON66631.1| hypothetical protein W97_05877 [Coniosporium apollinis CBS 100218]
          Length = 467

 Score =  296 bits (759), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 209/320 (65%), Gaps = 12/320 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           VR  +F ++F      +   Q L   L+     +Y +++  T++ FG+L+  + Q+++P+
Sbjct: 89  VRMVLFGLYFLVSCICMFLGQLLGTPLYLLQKDWYYAWMAFTKQHFGLLITTMTQWWSPT 148

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              I+ D++ +G L+Q+ +G ++E D PERLILI+NHQIY DWLY+W   Y    HG + 
Sbjct: 149 LVRISGDETVRGQLRQTADG-RLECDFPERLILISNHQIYTDWLYLWWIAYTDRMHGHVY 207

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLKW+PI GWGMQFF ++FL RNWA DK  F   L  L TS           +P+
Sbjct: 208 IILKESLKWIPILGWGMQFFSFVFLSRNWAKDKPRFQHRLRKLNTSHHGPLSGSQPLDPM 267

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R +SKK+ADK  + D  HVLLPRSTGL FC   + ++VD+VYD T
Sbjct: 268 WLLIFPEGTNLSKNGRASSKKWADKNNIPDLRHVLLPRSTGLLFCLQEMRRTVDWVYDCT 327

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQRWI 336
           +  EGV RG F ++I+T+R  YF+G+ P+++++H R++AI+ MP D+ K F EW+ QRW+
Sbjct: 328 LSYEGVPRGLFGQDIFTIRSTYFQGRPPKSVNMHWRRFAIASMPLDDPKAFEEWVHQRWV 387

Query: 337 EKDALMEEFYTKGRFTGYES 356
           EKD L+E F   GRF   E 
Sbjct: 388 EKDELIEYFLQHGRFPADEG 407



>gi|345565901|gb|EGX48849.1| hypothetical protein AOL_s00079g488 [Arthrobotrys oligospora ATCC
           24927]
          Length = 431

 Score =  293 bits (751), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 209/313 (66%), Gaps = 8/313 (2%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           VR  +F+++F+  S A+  +QF+   L+ ++  ++ +YI  T++ FG  +    Q++ P+
Sbjct: 19  VRLILFILYFSAGSIAIVATQFIGAPLYFYNKDWFYTYISLTKQSFGTFVTTGTQWWTPT 78

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              I+ DKS +G ++ + +G  +E D PER++ IANHQ+Y+DWLY+W   Y A  HGA+ 
Sbjct: 79  TIRISGDKSVRGQIRITDDGL-LECDFPERMVFIANHQLYSDWLYIWWIAYAARMHGAVY 137

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT------SKEPLWLLI 221
           IILK+SLKW+PI GWGMQ + +IFL RNWA D+  F   L  +A        + P+WLLI
Sbjct: 138 IILKESLKWVPIVGWGMQMYGFIFLARNWAKDQQRFKHRLEKIAAKDRKPQDRPPMWLLI 197

Query: 222 FPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIE 281
           FPEGT +    R++SKK+ADK+GL + +HVLLPR TGL +C   L +SV++VYD T+  E
Sbjct: 198 FPEGTNMCPNARVSSKKFADKMGLRNPDHVLLPRVTGLQYCLQQLDESVEWVYDCTMAYE 257

Query: 282 GVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDA 340
           G+ R ++ ++I+TLR  Y +G+ P++++LH R++ ISE+P  D  +F +W+R RW EKD 
Sbjct: 258 GIPRDKYGQDIFTLRAQYLQGRPPKSVNLHFRRFRISEIPYNDTKEFEQWMRDRWTEKDE 317

Query: 341 LMEEFYTKGRFTG 353
           +ME +   GR  G
Sbjct: 318 MMETYMQTGRLPG 330



>gi|378734167|gb|EHY60626.1| acyltransferase [Exophiala dermatitidis NIH/UT8656]
          Length = 847

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 217/361 (60%), Gaps = 16/361 (4%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R      +F   + A+N SQFL   L+  +  +Y ++I  T++ FG+L + + Q FAP+ 
Sbjct: 38  RALALSTYFLSGALAINLSQFLGAPLYLVNQDWYNAWIAFTKQSFGLLTMTLTQTFAPTK 97

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKI 168
            +I+ D S +G L QS  G  + L+ PERL+LIANHQIY DWLY+W   Y    HG + I
Sbjct: 98  VIISGDASVRGQLLQSTEGDLI-LNFPERLVLIANHQIYTDWLYLWWIAYCNGMHGRLYI 156

Query: 169 ILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVV 228
           ILK+SLK +P+ GWGMQF Q+IFLKR W  DK   +  L  L    +P+WLL+FPEGT +
Sbjct: 157 ILKESLKKIPVLGWGMQFNQFIFLKRKWEQDKPNMASALQRLNRPTDPMWLLLFPEGTNL 216

Query: 229 SDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQF 288
           +  TR  S  +A K  + D +HVLLPRSTGLHFC   L  +VDYVYD TI  EGV RG +
Sbjct: 217 AASTRAKSAAWAAKNNIPDMKHVLLPRSTGLHFCLEELKGTVDYVYDCTIAYEGVPRGAY 276

Query: 289 PEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYT 347
            ++I+TL+  Y EG+ P+++ +H R++AI ++P  +E  F  WL  RW EKD LME++  
Sbjct: 277 AQDIFTLKAGYLEGRPPKSVSMHWRRFAIKDIPLHNEKAFELWLIARWREKDLLMEQYLQ 336

Query: 348 KGRF------TGYESPRT--------VPMKLNSVFELTQIWYFIVPLVPIMWYFSNYLLN 393
            G F      T Y+S +         VP++ +  +E  QI+  +  L  +++ F   L  
Sbjct: 337 TGSFPADKGATKYKSGKVLRGCGHMEVPIRASHWYEFLQIFAPMGILAMVLYIFYGDLPQ 396

Query: 394 R 394
           R
Sbjct: 397 R 397



>gi|407922691|gb|EKG15787.1| Phospholipid/glycerol acyltransferase [Macrophomina phaseolina MS6]
          Length = 441

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 210/323 (65%), Gaps = 13/323 (4%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F ++F G    +N SQFL   L+ FS  +Y +++  T++ FG+L+  + Q+++P+
Sbjct: 51  LRMFLFGLYFFGSCVCINMSQFLGAPLYFFSIDWYYAWMALTKQHFGLLITTMTQWWSPT 110

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ D+S +G L+Q+ +G ++E D P+R++LIANHQIY DWLY+W   Y +  HG + 
Sbjct: 111 VVRVSGDESVRGQLRQTEDG-RLECDFPDRMVLIANHQIYTDWLYLWWIAYTSRMHGHLY 169

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLKW+P+ G GMQFF +IFL R WATDK  F   L  L              +P+
Sbjct: 170 IILKESLKWIPLIGTGMQFFSFIFLSRKWATDKPRFQHRLQKLNARHKGPMSGQNDLDPM 229

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R  S ++A K G  D  H LLPRSTGL+FC   L ++ ++VYD T
Sbjct: 230 WLLIFPEGTNLSQNGRDASARWAKKSGQDDLRHALLPRSTGLYFCLQELKETTEWVYDCT 289

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV RGQ+ ++++TL   YF+G+ PR+++LH R++A+ ++P   + +F +W+ QRW 
Sbjct: 290 MAYEGVPRGQYGQDLFTLYSTYFQGRPPRSVNLHWRRFAVKDVPMSSQAEFEQWILQRWR 349

Query: 337 EKDALMEEFYTKGRFTGY-ESPR 358
           EKD L+E +   GRF    E+PR
Sbjct: 350 EKDDLLETYLQTGRFPADPEAPR 372



>gi|346979833|gb|EGY23285.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Verticillium
           dahliae VdLs.17]
          Length = 411

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/338 (42%), Positives = 205/338 (60%), Gaps = 20/338 (5%)

Query: 31  KMPALGEPQSQ----NLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYI 86
           K P L  P  +     L+Q +VR   +  +F     A+  +QFL   L+      Y +Y+
Sbjct: 27  KTPELAHPAGRAKHGTLMQ-IVRGFTWAAYFVCCCVAIGTTQFLGAPLYYIRRDLYYAYM 85

Query: 87  KHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQI 146
             T++ F +L   + Q++ P+   I+ D S    ++Q  +G  VE D PERL+L+ANHQI
Sbjct: 86  ALTKQSFALLTTTMTQWWGPTKIRISGDASVAHQMRQQPDGM-VEFDFPERLVLVANHQI 144

Query: 147 YADWLYVWCFTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPF 203
           Y DWLY+W   Y AN    HG I IILK+SLKW+P  GWGM F+ +IF+ R  ATD+   
Sbjct: 145 YTDWLYLWWIGY-ANTPRMHGHIYIILKESLKWIPFIGWGMMFYGFIFMSRKMATDRPRL 203

Query: 204 SKTLSTLATSKE---------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLP 254
           +  L  L T++          P+WLL+FPEGT ++   R  S  +A+K GL D EHVLLP
Sbjct: 204 AHRLGQLKTTQRAPDGTSFLSPMWLLLFPEGTNLALNGRTKSAAWAEKTGLRDGEHVLLP 263

Query: 255 RSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRK 314
           RSTG++FC   L  +VDYVYD T+  EG+ RG+F ++ +TL   YF+G+ PR+++ H R+
Sbjct: 264 RSTGMYFCLKELGDTVDYVYDCTVAYEGIPRGKFGQDYFTLSSTYFQGRPPRSVNFHWRR 323

Query: 315 YAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + +SE+P E  D F  WLR RW EKDALME++ + GRF
Sbjct: 324 FKVSEIPLETADAFELWLRARWYEKDALMEQYLSTGRF 361



>gi|452000113|gb|EMD92575.1| hypothetical protein COCHEDRAFT_1155540 [Bipolaris maydis C5]
 gi|477591198|gb|ENI08271.1| hypothetical protein COCC4DRAFT_58130 [Bipolaris maydis ATCC 48331]
          Length = 425

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 207/315 (65%), Gaps = 12/315 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F  +FAG   A+  +Q+    L+ +S + + +++  +++ FGI++  +   +AP 
Sbjct: 44  LRMFLFAAYFAGSIMAIAITQYFGCPLYLYSKNLFYAWMAMSKQHFGIVITTMTYCWAPV 103

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ DKS +G LK++ +G ++E D PERL+LI+NHQIY DW+Y+W   Y A+ HG + 
Sbjct: 104 TMRVSGDKSMRGQLKKTKDG-RLESDFPERLVLISNHQIYTDWVYLWWVAYTASMHGHLY 162

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++P+ GWGM+ + +IFL R W+TDK  F   L  L TS           +P+
Sbjct: 163 IILKESLKYIPVIGWGMRLYGFIFLSRKWSTDKERFQHRLKKLTTSHSGPLSGSQELDPM 222

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R +S+K+A+K  + D  H +LPRSTGL FC   L  SV+Y+YD T
Sbjct: 223 WLLIFPEGTNLSVNGRASSRKWAEKNKIDDLRHAMLPRSTGLLFCLKELKGSVEYLYDCT 282

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++I+TLR  YF+G+ P+++++H R+YA +++P  DE +F++WL  RW 
Sbjct: 283 VAYEGVPVGQYGQDIFTLRGTYFQGRSPKSVNMHWRRYATADIPVHDEKEFSDWLLLRWR 342

Query: 337 EKDALMEEFYTKGRF 351
           EKD L++ F    RF
Sbjct: 343 EKDDLLQYFVENNRF 357



>gi|154315248|ref|XP_001556947.1| hypothetical protein BC1G_04663 [Botryotinia fuckeliana B05.10]
 gi|472243482|gb|EMR88137.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 protein
           [Botryotinia fuckeliana BcDW1]
          Length = 419

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 139/325 (42%), Positives = 206/325 (63%), Gaps = 11/325 (3%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           GE +  ++ Q + R   F  +F    + +  +Q + + L+  + + Y +++  T++ FG+
Sbjct: 39  GEVKHGSVAQ-IGRLLSFATYFWACCSTIQATQLIGVPLYWINRNIYYAWMALTKQSFGL 97

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW- 154
           L+  + Q+++P+   I+ D S  G L+++ +G + E D PERLI+IANHQ+Y DWLY+W 
Sbjct: 98  LITTMTQWWSPTVVRISGDASVAGQLRKTADG-RAECDFPERLIMIANHQLYTDWLYLWW 156

Query: 155 -CFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL--- 210
             +T     HG I II KDSLKW+PI GWGMQFF +IF+ R    D+   +     L   
Sbjct: 157 VAYTNQPQTHGYIYIIAKDSLKWVPIIGWGMQFFNFIFMSRKMEKDRPVMAHRFKQLQEK 216

Query: 211 ---ATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLH 267
              A+  +P+WLL+FPEGT  SD  R  S K+A K+G+ D EH LLPRSTG  FC   L 
Sbjct: 217 RPGASELDPMWLLLFPEGTNASDNRREASAKWAAKIGVKDMEHTLLPRSTGSFFCLNELK 276

Query: 268 KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDE-DK 326
           K+VDYVYD T+  EGV RG+F ++ +TL   Y EG+ P++++L  R++ I+++P D  +K
Sbjct: 277 KTVDYVYDCTMAYEGVPRGKFGQDYFTLTSSYIEGRPPKSVNLFWRRFKIADIPLDNAEK 336

Query: 327 FTEWLRQRWIEKDALMEEFYTKGRF 351
           F  WLR+RW EKDALME++ T GRF
Sbjct: 337 FEVWLRERWYEKDALMEQYMTTGRF 361



>gi|451854203|gb|EMD67496.1| hypothetical protein COCSADRAFT_34293 [Bipolaris sorokiniana
           ND90Pr]
          Length = 435

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 220/352 (62%), Gaps = 19/352 (5%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F  +FAG   A+  +Q+    L+ +S + + +++  +++ FGI++  +  ++AP 
Sbjct: 54  LRMFLFAAYFAGSIMAIAITQYFGCPLYLYSKNLFYAWMAMSKQHFGIVVTTMTYWWAPV 113

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ DKS +G L+++ +G ++E + PERL+LI+NHQIY DW+Y+W   Y A+ HG + 
Sbjct: 114 TMRVSGDKSMRGQLRKTKDG-RLESEFPERLVLISNHQIYTDWVYLWWVAYTASMHGHLY 172

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++P+ GWGM+ + +IFL R W+TDK  F   L  L TS           +P+
Sbjct: 173 IILKESLKYIPVIGWGMRLYGFIFLSRKWSTDKERFQHRLKRLTTSHSGPLSGSQELDPM 232

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R  SKK+A+K  + D  H LLPRSTGL FC   L  SV+Y+YD T
Sbjct: 233 WLLIFPEGTNLSSNGRAASKKWAEKNKIDDLRHALLPRSTGLLFCLKELKGSVEYLYDCT 292

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++++TLR  YF+G+ P+++++H R+YA +++P  DE +F++WL  RW 
Sbjct: 293 VAYEGVPVGQYGQDLFTLRGTYFQGRSPKSVNMHWRRYATADIPVHDEKEFSDWLLLRWR 352

Query: 337 EKDALMEEFYTKGRFTG--YESPRTVPMKLNSVFELTQIWYFIVPLVPIMWY 386
           EKD L++ F    RF     E+P      ++S   L    +    + P+ WY
Sbjct: 353 EKDDLLQYFVENNRFPADDGETP-----NVDSGEPLKGAGWIETDVRPVKWY 399



>gi|500255333|gb|EON98727.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 protein
           [Togninia minima UCRPA7]
          Length = 424

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 199/317 (62%), Gaps = 13/317 (4%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L+R   F  +F G    +  +Q+L   L+  +   Y +Y+  T++ FG+++  + +++ P
Sbjct: 50  LLRQLTFATYFIGSCVTIAVTQYLGAPLYWINRDLYYAYMALTKQSFGLVITTMTKWWGP 109

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA--HG 164
           +   I+ D S    ++Q+ +G +VE D P+R+++IANHQIY DWLY+W   Y  N   HG
Sbjct: 110 TTIRISGDASVADQIRQTADG-RVEFDFPQRMVMIANHQIYTDWLYLWWVGYANNPQMHG 168

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------E 215
            I IILK+SLKW+P+ G GM F+ +IF+ R  A D+   +  L  L              
Sbjct: 169 YIYIILKESLKWIPVMGPGMMFYGFIFMSRKMAVDQPRMAHRLGKLKMQHTAPDGRKYLN 228

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WLL+FPEGT +S+  R  S K+A+K GL D EHVLLPRSTG++FC   L  +VDYVYD
Sbjct: 229 PMWLLLFPEGTNLSNNGRAKSAKWAEKTGLKDPEHVLLPRSTGMYFCLNELKGTVDYVYD 288

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            T+  EG+ RG F EE++TL   YF GQ P++++ + R++ ++++P E+ +KF  WLR R
Sbjct: 289 CTVAYEGIPRGGFGEELFTLSGTYFRGQPPKSVNFYWRRFRVADIPLENSEKFELWLRDR 348

Query: 335 WIEKDALMEEFYTKGRF 351
           W EKD LMEE+ + GRF
Sbjct: 349 WYEKDRLMEEYMSTGRF 365



>gi|449301314|gb|EMC97325.1| hypothetical protein BAUCODRAFT_68107 [Baudoinia compniacensis UAMH
           10762]
          Length = 405

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 212/337 (62%), Gaps = 19/337 (5%)

Query: 34  ALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCF 93
            LG P+    +  L RT  F ++F G    ++FSQ L   L+  +  Y+ +Y+  T+  F
Sbjct: 11  TLGGPKHGPAMATL-RTVGFFIYFLGSCLFIHFSQLLGAPLYFCNKDYFYAYMAWTKEFF 69

Query: 94  GILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYV 153
           G+L+  + Q+++P+   ++ DKS  G++KQ  +G  + + + ER++L+ANHQIY DWLY+
Sbjct: 70  GLLVTTMTQWWSPTVIRLSGDKSMSGLIKQHKDGM-LRMKLGERVVLMANHQIYTDWLYM 128

Query: 154 WCFTYLANA--HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLA 211
           W   Y  +   HG I IILK+SLKW PI G  MQF+ +IF+ R W+ D+      L  L+
Sbjct: 129 WWIGYTNSPPMHGHIYIILKESLKWAPIIGPAMQFYGFIFMARKWSKDQERMRYRLRKLS 188

Query: 212 TSK--------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
           TSK              +P+WLLIFPEGT VS  TR  SKKY++K+G+ D +H LLPRST
Sbjct: 189 TSKHSGPKSGALKGASLDPMWLLIFPEGTNVSANTRNGSKKYSEKMGIPDMKHQLLPRST 248

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           GL FC      +V+Y+YD TIG EG+  G + ++++TLR +YF+G+ P+++++H R++ I
Sbjct: 249 GLQFCLQECADTVEYLYDCTIGYEGIPHGLYGQDVFTLRSVYFQGRPPKSVNMHWRRFKI 308

Query: 318 SEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTG 353
           +++P  D D  ++W+  RW EKD L+E FY  G+F G
Sbjct: 309 ADLPVNDHDAMSQWVLDRWREKDELLEHFYQNGKFPG 345



>gi|336264197|ref|XP_003346877.1| hypothetical protein SMAC_05137 [Sordaria macrospora k-hell]
 gi|380090348|emb|CCC11924.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 428

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/340 (41%), Positives = 212/340 (62%), Gaps = 20/340 (5%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G+ +   L+Q ++R     +FF   S  +  +QFL   L+  +   Y +Y+  T++ FG+
Sbjct: 48  GKEKHNRLIQ-ILRGVSLAIFFTACSVGIVATQFLGAPLYWINRDLYYTYMALTKQSFGL 106

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
            +  + Q++ P+   I+ D S  G +K++ +G +VE + PER+++IANHQIY DWLY+W 
Sbjct: 107 TITTMTQWWGPTTIRISGDGSVAGQIKKTPDG-RVEFNFPERMVMIANHQIYTDWLYLWW 165

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y ANA   HG + IILK+SLK+LPI G GM F+ +IF+ R    D+   +  L  L T
Sbjct: 166 VGY-ANAPRMHGYLYIILKESLKYLPIVGQGMMFYGFIFMSRKMNVDQPRLAYRLGKLKT 224

Query: 213 SK--------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAG 264
                      P+WLL+FPEGT  +   R  SKK+ADK+G+ D EHVLLPRSTG++FC  
Sbjct: 225 KHTHNGRQYLNPMWLLLFPEGTNCTQNGRNKSKKWADKIGIKDTEHVLLPRSTGIYFCLK 284

Query: 265 SLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-ED 323
            L  +V+YVYD T+  EGV RG + ++ +TL   Y  GQ P++++ + R++A+ ++P E+
Sbjct: 285 ELKGTVEYVYDCTVAYEGVPRGMYGDQFFTLSSTYLRGQPPKSVNFYWRRFAVDDIPLEN 344

Query: 324 EDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMK 363
           +D+F  WLR+RW EKDALME++ T GRF     P + P K
Sbjct: 345 QDEFDVWLRERWYEKDALMEQYLTTGRF-----PPSPPTK 379



>gi|85089963|ref|XP_958192.1| hypothetical protein NCU07741 [Neurospora crassa OR74A]
 gi|28919527|gb|EAA28956.1| hypothetical protein NCU07741 [Neurospora crassa OR74A]
          Length = 428

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 208/328 (63%), Gaps = 15/328 (4%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G+ +   L+Q ++R     +FF   S  +  +QFL   L+  +   Y +Y+  T+  FG+
Sbjct: 48  GKEKHNRLIQ-ILRGVSLAIFFTACSVGIVATQFLGAPLYWINRDLYYTYMALTKESFGL 106

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
            +  + Q++ P+   I+ D S  G +K++ +G +VE + PER+++IANHQIY DWLY+W 
Sbjct: 107 TITTMTQWWGPTTIRISGDGSVAGQIKKTPDG-RVEFNFPERMVMIANHQIYTDWLYLWW 165

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y ANA   HG + IILK+SLK+LPI G GM F+ +IF+ R  + D+   +  L  L T
Sbjct: 166 VGY-ANAPRMHGYLYIILKESLKYLPIVGQGMMFYGFIFMARKMSVDQQRLAYRLGKLKT 224

Query: 213 SK--------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAG 264
                      P+WLL+FPEGT  +   R  SKK+ADK+G+ D EHVLLPRSTG++FC  
Sbjct: 225 KHTHDGKQYLNPMWLLLFPEGTNCTQNGRDKSKKWADKMGIKDTEHVLLPRSTGMYFCLK 284

Query: 265 SLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-ED 323
            L  +VDYVYD T+  EGV RG + ++ +TL   Y  GQ P++++ + R++A+ ++P E+
Sbjct: 285 ELKGTVDYVYDCTVAYEGVPRGMYGDQFFTLSSTYLRGQPPKSVNFYWRRFAVDDIPLEN 344

Query: 324 EDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +++F  WLR+RW EKDALME++ T GRF
Sbjct: 345 QEEFDVWLRERWYEKDALMEQYLTTGRF 372



>gi|477532153|gb|ENH83798.1| lysocardiolipin acyltransferase [Colletotrichum orbiculare MAFF
           240422]
          Length = 409

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 215/364 (59%), Gaps = 20/364 (5%)

Query: 29  IIKMPALGEPQSQNLVQW---LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSY 85
           +++ P+   P  +    W   ++R  +F ++FA  +A++  SQ +   L+  +   Y +Y
Sbjct: 22  LVRKPSDSHPAGRRKHNWFISVIRGVLFAIYFASCTASIFISQVIGGWLYWVNRDIYYAY 81

Query: 86  IKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQ 145
           +  T++ F I   A+   + P+   ++ D S  G ++Q  NG  VE   PERL+LIANHQ
Sbjct: 82  MALTKQSFAITTTAMTHLWGPTTIRMSGDASVAGQIQQGPNGM-VEFKFPERLVLIANHQ 140

Query: 146 IYADWLYVWCFTYLANA--HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPF 203
           IY DWLY+W   Y  N   HG   IILK+SLK++P+ GWGM F+ +IF+ R  +TD+   
Sbjct: 141 IYTDWLYLWWVAYANNPGMHGHFYIILKESLKYIPLVGWGMMFYGFIFMSRKMSTDQPRL 200

Query: 204 SKTLSTLATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLP 254
           +  L  L             E +WLL+FPEGT +S   R  S  +A+K G+ D EHVLLP
Sbjct: 201 AHRLRKLKKQHTGPDGKQFLEAMWLLLFPEGTNLSGNGRRKSAAWAEKTGIKDPEHVLLP 260

Query: 255 RSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRK 314
           RSTG+ FC   L  +++YVYD T+  EGV RG+F E+ +TL   YF+G+ P++++ H R+
Sbjct: 261 RSTGMFFCLKELQGTLEYVYDCTVAYEGVPRGKFGEQYFTLSSTYFQGRPPKSVNFHWRR 320

Query: 315 YAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPR----TVPMKLNSVFE 369
           + +++MP  D+ +F  W+R+RW EKDA MEE+ + GRF   +  +       ++LN   E
Sbjct: 321 FRVADMPLHDQKEFDAWVRERWYEKDAFMEEYVSTGRFPPSKDLKGGYIETQVRLNRWME 380

Query: 370 LTQI 373
           LTQ+
Sbjct: 381 LTQV 384



>gi|336473431|gb|EGO61591.1| hypothetical protein NEUTE1DRAFT_59004 [Neurospora tetrasperma FGSC
           2508]
 gi|350293280|gb|EGZ74365.1| acyltransferase-domain-containing protein [Neurospora tetrasperma
           FGSC 2509]
          Length = 428

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 208/328 (63%), Gaps = 15/328 (4%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G+ +   L+Q ++R     +FF   S  +  +QFL   L+  +   Y +Y+  T+  FG+
Sbjct: 48  GKEKHNRLIQ-ILRGVSLAIFFTACSVGIVATQFLGAPLYWINRDLYYTYMALTKESFGL 106

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
            +  + Q++ P+   I+ D S  G +K++ +G +VE + PER+++IANHQIY DWLY+W 
Sbjct: 107 TITTMTQWWGPTTIRISGDGSVAGQIKKTPDG-RVEFNFPERMVMIANHQIYTDWLYLWW 165

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y ANA   HG + IILK+SLK+LPI G GM F+ +IF+ R  + D+   +  L  L T
Sbjct: 166 VGY-ANAPRMHGYLYIILKESLKYLPIVGQGMMFYGFIFMARKMSVDQQRLAYRLGKLKT 224

Query: 213 SK--------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAG 264
                      P+WLL+FPEGT  +   R  SKK+ADK+G+ D EHVLLPRSTG++FC  
Sbjct: 225 KHTHDGKQYLNPMWLLLFPEGTNCTQNGRDKSKKWADKMGIKDTEHVLLPRSTGMYFCLK 284

Query: 265 SLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-ED 323
            L  +VDYVYD T+  EGV RG + ++ +TL   Y  GQ P++++ + R++A+ ++P E+
Sbjct: 285 ELKGTVDYVYDCTVAYEGVPRGMYGDQFFTLSSTYLRGQPPKSVNFYWRRFAVDDIPLEN 344

Query: 324 EDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +++F  WLR+RW EKDALME++ T GRF
Sbjct: 345 QEEFDVWLRERWYEKDALMEQYLTTGRF 372



>gi|511009351|gb|EPB90595.1| hypothetical protein HMPREF1544_02505 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 316

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 194/297 (65%), Gaps = 14/297 (4%)

Query: 97  LVAINQFFAPSNFVITVDKSA---KGVLKQSWNGAKVE-LDMPERLILIANHQIYADWLY 152
           LVA+ Q+FAP+N V+T D+S    + ++++     KV     PER+I+ +NHQIYADW+Y
Sbjct: 8   LVALIQWFAPANLVMTFDQSCGSMQDIIQKDTKTGKVNGFIFPERIIVTSNHQIYADWVY 67

Query: 153 VWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
           +WC  YLA AHG +KIILK SLK LPI+G GM+FF +IFL+R  A DK      L     
Sbjct: 68  IWCIAYLAKAHGVLKIILKSSLKNLPIYGQGMRFFDFIFLQRKLAMDKDNIISNLERSKK 127

Query: 213 SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDY 272
             + LWL++FPEGTVVS  TR  SK++A+   + D+ + LLPRSTGL  C  +L  S+DY
Sbjct: 128 GDQSLWLVLFPEGTVVSPSTRKRSKEFAEMNDMHDNRYTLLPRSTGLRLCTTTLADSIDY 187

Query: 273 VYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWL 331
           +YD TIG  G++    PE++YT++ ++F   YP+ +H+++R++ +  +P ++E +F +W 
Sbjct: 188 IYDFTIGYSGIKPNDIPEQVYTIQSVFFFNFYPKQVHVYVRRFRVDSIPTKNEAEFNQWN 247

Query: 332 RQRWIEKDALMEEFYTKGRFTG------YESPRT--VPMKL-NSVFELTQIWYFIVP 379
            +RW EKD LM+ FY  G F G       +  R   VP++L NSV +L QIW FI+P
Sbjct: 248 LERWKEKDELMDHFYKHGAFPGNPTVADTDDSRVIDVPIRLNNSVLDLAQIWVFILP 304



>gi|396499553|ref|XP_003845503.1| hypothetical protein LEMA_P008110.1 [Leptosphaeria maculans JN3]
 gi|312222084|emb|CBY02024.1| hypothetical protein LEMA_P008110.1 [Leptosphaeria maculans JN3]
          Length = 734

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 196/317 (61%), Gaps = 3/317 (0%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G P+   L Q      +   F +G   A++ SQFL   L      +Y  Y+ +T+ CF I
Sbjct: 55  GPPRYGELTQAERAFTLASTFLSG-VLAISASQFLGAPLKLIDPQFYDGYMAYTKECFAI 113

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q++AP+   ++ D S  G L +  +G+ +E    +R+IL+ANHQ+Y DWLY+W 
Sbjct: 114 LVTCLTQWWAPTVVRVSGDSSMVGQLIKKADGS-LECKFADRMILMANHQLYTDWLYLWW 172

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y    HG I IILK+SLK +PI GWG QF+ +IFL R W  D+  F + L  L    +
Sbjct: 173 IAYTNKMHGFIYIILKESLKNVPIIGWGAQFYNFIFLSRKWEEDQRTFKRHLEKLNKPND 232

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR  SKK+ADK GL D +H LLPRSTGL FC   L  + D++YD
Sbjct: 233 PMWLIIFPEGTNLSASTRANSKKWADKNGLQDMKHQLLPRSTGLKFCLNELKDTTDWLYD 292

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            TI  EGV  GQF ++I+TLR  +FEG+ P+++++H R++ + E+P E+   F  WLR R
Sbjct: 293 CTIAYEGVPDGQFGQDIFTLRSSFFEGRPPKSVNMHWRRFHLDEIPYENTKAFEVWLRNR 352

Query: 335 WIEKDALMEEFYTKGRF 351
           W EKD ++E F+   RF
Sbjct: 353 WREKDYMLEYFHRNNRF 369



>gi|396494324|ref|XP_003844277.1| hypothetical protein LEMA_P019280.1 [Leptosphaeria maculans JN3]
 gi|312220857|emb|CBY00798.1| hypothetical protein LEMA_P019280.1 [Leptosphaeria maculans JN3]
          Length = 451

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 207/320 (64%), Gaps = 12/320 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R A+F ++F+    A++ +Q++   L+ +S   + +++  T++ FGI+   +  ++AP+
Sbjct: 68  IRMALFALYFSSSILAISVTQYIGAPLYLYSKDLFYAWMAMTKQHFGIVSATMTYWWAPT 127

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              I+ D S +G ++++ +G ++E D PER++LI+NHQIY DW+Y+W   Y A+ HG + 
Sbjct: 128 TVRISGDASVRGQMRKTADG-RLECDFPERIVLISNHQIYTDWVYLWWMAYTADMHGHLY 186

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+S+K++PI G GM  + +IFL R WATDK  F   L  L+TS           +P+
Sbjct: 187 IILKESIKYIPIIGTGMMLYGFIFLSRKWATDKERFQYRLKKLSTSHAGPLSGTPGLDPM 246

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R+ SKK+ADK G+ D  H LLPRSTGL FC   L  +V+Y+YD T
Sbjct: 247 WLLIFPEGTNLSTNGRVASKKWADKNGIPDLRHALLPRSTGLSFCLQELKDTVEYMYDCT 306

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++I+TLR  YF+G+ P +++LH+R++ I+++P  DE  F  WL  R+ 
Sbjct: 307 LAYEGVPAGQYGQDIFTLRGTYFQGRSPASVNLHLRRFRIADIPLHDETVFAAWLLARFR 366

Query: 337 EKDALMEEFYTKGRFTGYES 356
           EKD L++ F    RF   E 
Sbjct: 367 EKDDLLQYFVDHQRFPADEG 386



>gi|189211375|ref|XP_001942018.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187978111|gb|EDU44737.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 709

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 200/317 (63%), Gaps = 3/317 (0%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G P+   L Q      +   F +G   A++ SQFL   L      +Y +Y+ +T+ CF I
Sbjct: 67  GPPRFGELTQAERAFTLASTFLSG-VLAISASQFLGAPLKLIDPQFYDAYMAYTKECFAI 125

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q++AP+   ++ D S  G L +  +G+ +  +  +R++L+ANHQ+Y DWLY+W 
Sbjct: 126 LITCLTQWWAPTVVRVSGDSSMVGQLIKRKDGS-LRCNFSDRMVLMANHQLYTDWLYLWW 184

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y  N HG I IILK+SLK +PI GWG QF+ +IFL R W  D+  F K LS L    +
Sbjct: 185 IAYTNNMHGFIYIILKESLKNIPIIGWGAQFYNFIFLSRKWEEDQRTFKKHLSKLNKKGD 244

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR  SK++ADK GL D +H LLPRSTGL FC   L ++ D++YD
Sbjct: 245 PMWLIIFPEGTNLSPTTRERSKQWADKNGLQDMKHQLLPRSTGLRFCLNELKETTDWLYD 304

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            TI  EG+  GQF ++I+TLR  +FEG+ P+++++H R++ IS++P E+   F  WLR R
Sbjct: 305 CTIAYEGIPPGQFGQDIFTLRSSFFEGRPPKSVNMHWRRFRISDIPYENTHAFEVWLRNR 364

Query: 335 WIEKDALMEEFYTKGRF 351
           W EKD ++E F    RF
Sbjct: 365 WREKDYMLEYFSRHTRF 381



>gi|482812425|gb|EOA89144.1| hypothetical protein SETTUDRAFT_26363 [Setosphaeria turcica Et28A]
          Length = 433

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/320 (39%), Positives = 210/320 (65%), Gaps = 12/320 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F ++F     A+  +Q+  L L+ +S + + +++  +++ FGI+L  +  ++AP+
Sbjct: 54  IRMCLFALYFNSSIVAIAMTQYAGLPLYFYSKNLFYAWMAVSKQHFGIVLTTMTSWWAPA 113

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ D+S +G L+++ +G ++E D PER++L++NHQIY DW+Y+W  +Y A+ HG + 
Sbjct: 114 TMRVSGDESVRGQLRKTRDG-RLECDFPERIVLVSNHQIYTDWVYLWWISYTASMHGHLY 172

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++P+ GW M  + +IFL R WATDK  F   L  L +S           +P+
Sbjct: 173 IILKESLKYIPVVGWAMALYGFIFLSRKWATDKERFQHRLERLNSSHSGPLSGSKGLDPM 232

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R+ S+K+A+K  + D  H LLPRSTGL FC   L  +VDY+YD T
Sbjct: 233 WLLIFPEGTNLSHNGRVASQKWAEKNQMEDLRHALLPRSTGLLFCLQQLKDTVDYLYDCT 292

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++++TLR  YF+G+ P++++++ R++A++++P  DE +F++WL  RW 
Sbjct: 293 VAYEGVPVGQYGQDLFTLRGTYFQGRPPKSVNMYWRRFAVADIPIHDEKEFSDWLLARWR 352

Query: 337 EKDALMEEFYTKGRFTGYES 356
           EKD L++ F    RF   E 
Sbjct: 353 EKDDLLQHFVEHQRFPADEG 372



>gi|406867286|gb|EKD20324.1| acyltransferase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 424

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 211/339 (62%), Gaps = 25/339 (7%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           GE +   LVQ ++R  V V +F      +  +Q L   L+  +  +Y +Y+  T++ FGI
Sbjct: 36  GEIKHHGLVQ-ILRLLVAVFYFFSSCCTIVATQLLGAPLYWINRDFYYAYMALTKQSFGI 94

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW- 154
            +  +  ++AP+   I+ D S  G LK++ +G +VE   PER+++IANHQIY+DWLY+W 
Sbjct: 95  FVTTLTSWWAPTVVRISGDASVAGQLKRTADG-RVECHFPERIVMIANHQIYSDWLYLWW 153

Query: 155 -CFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK------------- 200
             +T     HG I IILK+SLK +PI GWGM+F+ ++F+ R  +TD+             
Sbjct: 154 IAYTNRPRLHGHIYIILKESLKHVPIIGWGMRFYGFVFMSRKMSTDQPRLAYRLQKLKGR 213

Query: 201 --GPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTG 258
             GP S T     +  +P+WLL+FPEGT  SD  R  S  +A K G+ D EHVLLPRSTG
Sbjct: 214 HAGPLSGT-----SGLDPMWLLLFPEGTNASDNGRAKSAAWAKKQGIKDMEHVLLPRSTG 268

Query: 259 LHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
             FC   L  +VDYVYD T+  EGV RG+F ++++TLR +Y +G+ P +++++ R++AI 
Sbjct: 269 SFFCLNELKGTVDYVYDCTLAYEGVPRGEFGQDLFTLRSMYLQGRPPPSVNMYWRRFAIE 328

Query: 319 EMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYES 356
           +MP +D D+F  W+R+RW EKD+ +E++ + GRF G  S
Sbjct: 329 DMPLDDPDRFELWMRERWYEKDSFIEQYLSSGRFPGDPS 367



>gi|494833070|gb|EON69148.1| hypothetical protein W97_08334 [Coniosporium apollinis CBS 100218]
          Length = 686

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 198/330 (60%), Gaps = 8/330 (2%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G PQ   L Q     +      +G + A+  +Q +   L   +  YY  Y+  T++ F +
Sbjct: 32  GPPQHGQLSQAERAFSAGSSLLSG-AMAITATQVMGAPLKLINEEYYNHYMAFTKQAFAV 90

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  I  +++P+   ++ D S +G L Q   G  +    P R++L+ANHQ+Y DWLY+W 
Sbjct: 91  LITTITNWWSPTIVRVSADASMRGQLSQDEKG-DLRCHFPHRIVLMANHQLYTDWLYLWW 149

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y    HG I IILK+S+K +PIFGW  QF+ +IFL R W  DK  F + L  L   ++
Sbjct: 150 IAYTNGMHGYIYIILKESIKNIPIFGWSAQFYNFIFLSRKWEKDKSRFKEHLDKLNKPRD 209

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WLLIFPEGT +S  TR  SK++A+K GL D +H LLPRSTGLHFC   L  + D++YD
Sbjct: 210 PMWLLIFPEGTNLSKSTRERSKEWAEKNGLEDMKHQLLPRSTGLHFCLEELKGTTDWLYD 269

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            TI  EGV  GQF ++I+TLR  +FEG+ P+++++H R++ I+++P E+   F  WLR R
Sbjct: 270 CTIAYEGVPEGQFGQDIFTLRSSFFEGRPPKSVNMHWRRFKIADIPLENPKAFEVWLRNR 329

Query: 335 WIEKDALMEEFYTKGRFTGYE-----SPRT 359
           W EKD ++E +   GRF   E      PRT
Sbjct: 330 WREKDYMLEFYARTGRFPAEEFWKVQGPRT 359



>gi|330924931|ref|XP_003300838.1| hypothetical protein PTT_12199 [Pyrenophora teres f. teres 0-1]
 gi|311324821|gb|EFQ91063.1| hypothetical protein PTT_12199 [Pyrenophora teres f. teres 0-1]
          Length = 427

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 209/315 (66%), Gaps = 12/315 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F V+FA    A+  SQ++ L L+ +S   + +++  T++ FG +++ +  ++AP 
Sbjct: 48  LRMYLFGVYFAISIVAIAISQYIGLPLYFYSTDLFYAWMAMTKQHFGSVVMTMTYWWAPV 107

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ D+S +G L++S +G K+E D PERL+L+ANHQ+Y DW+Y+W   Y A+ HG + 
Sbjct: 108 TMRVSGDESVRGQLRKSKDG-KLECDFPERLVLVANHQLYTDWVYIWWTCYTASMHGHLY 166

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++P+ GWGM+ F +IFL R W+TDK  F   L  L+TS           +P+
Sbjct: 167 IILKESLKYIPVLGWGMKLFGFIFLSRKWSTDKERFQHRLRKLSTSHSGPLSGSKGLDPM 226

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R +S+K+A K  + D  H LLPRSTGL FC   L  S+ ++YD T
Sbjct: 227 WLLIFPEGTNLSTNGRESSQKWAAKNNMPDLRHALLPRSTGLSFCLQELQGSIGHLYDCT 286

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++++TLR  YF+G+ P++++++ R+YAI+E+P  +E +F++WL  RW 
Sbjct: 287 VAYEGVPVGQYGQDLFTLRGTYFQGRPPKSVNMYWRRYAIAEIPLHNEKEFSDWLLARWR 346

Query: 337 EKDALMEEFYTKGRF 351
           EKD L++ F    RF
Sbjct: 347 EKDDLLQYFVENQRF 361



>gi|451853227|gb|EMD66521.1| hypothetical protein COCSADRAFT_84029 [Bipolaris sorokiniana
           ND90Pr]
          Length = 700

 Score =  270 bits (690), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 134/321 (41%), Positives = 200/321 (62%), Gaps = 3/321 (0%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G P+   L Q      +   F +G   A++ SQFL   L      +Y  Y+ +T+ CF I
Sbjct: 67  GPPRYGELTQAERAFTLASTFLSG-VLAISASQFLGAPLKLIDPQFYDGYMAYTKECFAI 125

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q++AP+   ++ D +  G L +  +G+ ++ +  +R++L+ANHQ+Y DWLY+W 
Sbjct: 126 LITCLTQWWAPTVVRVSGDSTMVGQLIKRKDGS-LQCNFADRMVLMANHQLYTDWLYLWW 184

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y  N HG I IILK+SLK +PI GWG QF+ +IFL R W  D+  F + LS L    +
Sbjct: 185 IAYTNNMHGFIYIILKESLKNIPIIGWGAQFYNFIFLSRKWEEDERTFKRHLSKLNKKGD 244

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR  SKK+ADK GL D +H LLPRSTGL FC   L  + D++YD
Sbjct: 245 PMWLIIFPEGTNLSPTTREKSKKWADKNGLQDMKHQLLPRSTGLKFCLNELKDTTDWLYD 304

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            TI  EG+  GQ+ ++I+TLR  +FEG+ P+++++H R++ ++++P E+   F  WLR R
Sbjct: 305 CTIAYEGIPPGQYGQDIFTLRSSFFEGRPPKSVNMHWRRFRLADIPYENTHAFEVWLRNR 364

Query: 335 WIEKDALMEEFYTKGRFTGYE 355
           W EKD ++E F    RF   +
Sbjct: 365 WREKDYMLEYFNRNNRFPAED 385



>gi|330916700|ref|XP_003297528.1| hypothetical protein PTT_07954 [Pyrenophora teres f. teres 0-1]
 gi|311329765|gb|EFQ94388.1| hypothetical protein PTT_07954 [Pyrenophora teres f. teres 0-1]
          Length = 711

 Score =  269 bits (688), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 189/287 (65%), Gaps = 2/287 (0%)

Query: 66  FSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSW 125
            +QFL   L      +Y +Y+ +T+ CF IL+  + Q++AP+   ++ D S  G L +  
Sbjct: 92  LAQFLGAPLKLIDPQFYDAYMAYTKECFAILITCLTQWWAPTVVRVSGDSSMVGQLIKRK 151

Query: 126 NGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQ 185
           +G+ ++ +  +R++L+ANHQ+Y DWLY+W   Y  N HG I IILK+SLK +PI GWG Q
Sbjct: 152 DGS-LQCNFSDRMVLMANHQLYTDWLYLWWIAYTNNMHGFIYIILKESLKNIPIIGWGAQ 210

Query: 186 FFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGL 245
           F+ +IFL R W  D+  F K LS L    +P+WL+IFPEGT +S  TR  SK++ADK GL
Sbjct: 211 FYNFIFLSRKWEEDQRTFKKHLSKLNKKGDPMWLIIFPEGTNLSPTTRERSKQWADKNGL 270

Query: 246 VDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYP 305
            D +H LLPRSTGL FC   L ++ D++YD TI  EG+  GQF ++I+TLR  +FEG+ P
Sbjct: 271 QDMKHQLLPRSTGLRFCLNELKETTDWLYDCTIAYEGIPPGQFGQDIFTLRSSFFEGRPP 330

Query: 306 RNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +++++H R++ IS++P E+   F  WLR RW EKD ++E F    RF
Sbjct: 331 KSVNMHWRRFRISDIPCENTHAFEVWLRNRWREKDYMLEYFSRHTRF 377



>gi|169626327|ref|XP_001806564.1| hypothetical protein SNOG_16448 [Phaeosphaeria nodorum SN15]
 gi|111055026|gb|EAT76146.1| hypothetical protein SNOG_16448 [Phaeosphaeria nodorum SN15]
          Length = 426

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 211/323 (65%), Gaps = 12/323 (3%)

Query: 45  QWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFF 104
           Q  +R  +F V+F G   A+  +QF+   L+ +S   + +++  +++ FGI+   +  ++
Sbjct: 45  QQALRMFLFAVYFNGSILAIAVTQFIGAPLYFYSKDLFYAWMAMSKQHFGIVSTTMTYWW 104

Query: 105 APSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           AP    I+ D+S +G ++++ +G ++E D PER++ ++NHQIY DW+Y+W   Y ++ HG
Sbjct: 105 APVKIRISGDESVRGQMRKTEDG-RLECDFPERIVYVSNHQIYTDWVYLWWIAYTSSMHG 163

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------- 214
            + IILK+S+K++PI G GM F+ ++FL R WATDK  F   L  L+TS           
Sbjct: 164 HLYIILKESIKYIPILGTGMMFYGFVFLSRKWATDKERFRYRLKKLSTSHSGPLSGSKGL 223

Query: 215 EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVY 274
           +P+WLL+FPEGT +S   R  SKK+ADK  + D  H LLPRSTGLHFC   L+ +V+++Y
Sbjct: 224 DPMWLLLFPEGTNLSKNGRAASKKWADKNDMPDLRHALLPRSTGLHFCLQELNDTVEWMY 283

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQ 333
           D T+  EGV  GQ+ ++++TLR  YF+G+ P+++++H+R++ I+++P +DE +F++WL  
Sbjct: 284 DCTLAYEGVPVGQYGQDLFTLRGTYFQGRPPKSVNIHLRRFRIADIPLDDEKEFSDWLLA 343

Query: 334 RWIEKDALMEEFYTKGRFTGYES 356
           RW EKD +++ +    RF   E 
Sbjct: 344 RWREKDDMLQYYVENNRFPADEG 366



>gi|452004644|gb|EMD97100.1| hypothetical protein COCHEDRAFT_1124173 [Bipolaris maydis C5]
 gi|477587352|gb|ENI04434.1| hypothetical protein COCC4DRAFT_198164 [Bipolaris maydis ATCC
           48331]
          Length = 708

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 205/338 (60%), Gaps = 3/338 (0%)

Query: 19  LFNGRLIVLEIIKMPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFS 78
           L  G  I  + +     G P+   L Q      +   F +G   A++ SQFL   L    
Sbjct: 50  LGAGLRISKDNVDAHPAGPPRYGELTQAERAFTLASTFLSG-VLAISASQFLGAPLKLID 108

Query: 79  HSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERL 138
             +Y  Y+ +T+ CF IL+  + Q++AP+   ++ D +  G L +  +G+ ++ +  +R+
Sbjct: 109 PQFYDGYMAYTKECFAILITCLTQWWAPTVVRVSGDSTMVGQLIKRKDGS-LQCNFADRM 167

Query: 139 ILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWAT 198
           +L+ANHQ+Y DWLY+W   Y  N HG I IILK+SLK +PI GWG QF+ +IFL R W  
Sbjct: 168 VLMANHQLYTDWLYLWWIAYTNNMHGFIYIILKESLKNIPIIGWGAQFYNFIFLSRKWEE 227

Query: 199 DKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTG 258
           D+  F K LS L    +P+WL+IFPEGT +S  TR  SKK+A+K GL D +H LLPRSTG
Sbjct: 228 DERTFKKHLSKLNKKGDPMWLIIFPEGTNLSPTTREKSKKWAEKNGLQDMKHQLLPRSTG 287

Query: 259 LHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
           L FC   L  + D++YD TI  EG+  GQ+ ++I+TLR  +FEG+ P+++++H R++ ++
Sbjct: 288 LKFCLNELKDTTDWLYDCTIAYEGIPPGQYGQDIFTLRSSFFEGRPPKSVNMHWRRFRLA 347

Query: 319 EMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYE 355
           ++P E+   F  WLR RW EKD ++E F    RF   +
Sbjct: 348 DIPYENTHAFEVWLRNRWREKDYMLEYFNRNNRFPAED 385



>gi|156037864|ref|XP_001586659.1| hypothetical protein SS1G_12646 [Sclerotinia sclerotiorum 1980]
 gi|154698054|gb|EDN97792.1| hypothetical protein SS1G_12646 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 417

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 141/355 (39%), Positives = 213/355 (60%), Gaps = 19/355 (5%)

Query: 31  KMPALGEPQS----QNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYI 86
           K  A+G+  S       V  + R   F  +F    + +  +Q + + L+  +   Y S++
Sbjct: 27  KEKAIGDHPSGEVRHGFVAQVCRLLSFATYFWAACSTIQATQLIGIPLYWINRDIYYSWM 86

Query: 87  KHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQI 146
             T++ FG+++  + Q+++P+   I+ D S  G L+++ +G + E   PERLILIANHQ+
Sbjct: 87  ALTKQSFGLVITTMTQWWSPTVVRISGDASVAGQLRKTADG-RAECHFPERLILIANHQL 145

Query: 147 YADWLYVW--CFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFS 204
           Y DWLY+W   +T     HG I II K+SLKW+PI GWGMQF+ +IF+ R    D+   +
Sbjct: 146 YTDWLYLWWVAYTNQPQTHGYIYIIAKNSLKWVPIIGWGMQFYNFIFMSRKMEKDRPVMA 205

Query: 205 KTLSTLATSK------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTG 258
                L   +      +P+WLL+FPEGT  SD  R  S ++A+K+G+ D EHVLLPRSTG
Sbjct: 206 HRFKQLQEKRPGALELDPMWLLLFPEGTNASDNRREASARWAEKIGVKDMEHVLLPRSTG 265

Query: 259 LHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
           L F    L K+VDYVYD T+  EGV RG+F ++ +TL   Y EG+ P++++L+ R++ I+
Sbjct: 266 LFFSLNELKKTVDYVYDCTMAYEGVPRGKFGQDYFTLTSSYIEGRPPKSVNLYWRRFKIA 325

Query: 319 EMPEDE-DKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQ 372
           ++P D  +KF  WLR+RW EKDALME++   GRF     P  V  K  ++ E  +
Sbjct: 326 DIPLDNAEKFEVWLRERWYEKDALMEQYMVTGRF-----PPNVTSKEGTIEEFIE 375



>gi|310790408|gb|EFQ25941.1| acyltransferase [Glomerella graminicola M1.001]
          Length = 410

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/367 (40%), Positives = 223/367 (60%), Gaps = 21/367 (5%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G P+    +Q L R   F ++FA    A+  +Q L   L+  +   + +Y+  T++ FG+
Sbjct: 34  GRPKHSFAMQ-LFRGLTFGLYFAACCLAIITTQILGSPLYFVNREIFYAYMALTKQSFGL 92

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
            + A+   ++ +   I+ DKS  G +K++ +G +V+ + PERLILIANHQIY DWLY+W 
Sbjct: 93  TITAMTHMWSNTTIRISGDKSMDGQIKKTPDG-RVQFNFPERLILIANHQIYTDWLYLWW 151

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y ANA   HG I IILK+SLK++P  G GM F+ +IF+ R  ATD+   +  ++ L T
Sbjct: 152 VAY-ANAPSMHGHIYIILKESLKYIPGVGIGMMFYGFIFMSRKMATDQPRLAHRINKLKT 210

Query: 213 SK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCA 263
                      +P+WLL+FPEGT +S   R  S  +ADK+GL D EHVLLPRSTG  FC 
Sbjct: 211 RHAGPGGREYLDPMWLLLFPEGTNLSTNGRRKSAAWADKMGLRDPEHVLLPRSTGTFFCL 270

Query: 264 GSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED 323
             L  S++Y+YD T+  EG+ RG+F ++ +TL   YF+G+ PR+++ H R++ ++++P D
Sbjct: 271 NELKDSLEYIYDCTVAYEGIPRGKFGDDYFTLTSTYFQGRPPRSVNFHWRRFRLADIPLD 330

Query: 324 EDK-FTEWLRQRWIEKDALMEEFYTKGRFTGYESPR----TVPMKLNSVFELTQIWYFIV 378
           + K F  WLR+RW EKDA+ME + + GRF              ++L S FELTQI + +V
Sbjct: 331 DAKAFDAWLRERWYEKDAIMETYVSTGRFPASADIEGGHVETEVRLRSWFELTQI-FVVV 389

Query: 379 PLVPIMW 385
               I+W
Sbjct: 390 GTAGIIW 396



>gi|212536088|ref|XP_002148200.1| acyltransferase, putative [Talaromyces marneffei ATCC 18224]
 gi|210070599|gb|EEA24689.1| acyltransferase, putative [Talaromyces marneffei ATCC 18224]
          Length = 410

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/338 (39%), Positives = 209/338 (61%), Gaps = 21/338 (6%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+ +   +F G    +  +Q +   L+  + +YY +Y+  T++CFGIL+V I Q+ AP
Sbjct: 41  ILRSLLLATWFNGCCVCIFMTQLIGAPLYFVNKNYYYAYMAMTKQCFGILIVTITQWGAP 100

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S KG ++   NG  ++ + P+RL+ +ANHQ+Y DWLY+W  +Y +  HG I
Sbjct: 101 TVVRVSGDESVKGQIQLGANGL-LKTNFPDRLVFVANHQVYTDWLYLWWVSYTSRMHGHI 159

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT----------SKEP 216
            IILK+SLK +P+ G GM F+ +IF+ R W  DK      L  L +          S +P
Sbjct: 160 YIILKESLKRIPVIGQGMMFYGFIFMARKWEADKPRLEHRLQKLKSRHTGPMSGSQSLDP 219

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S KY +KVG+   +H +LPRSTGL FC   L  +VD+VYD 
Sbjct: 220 MWLLIFPEGTNLSINTKNISNKYGEKVGIAPLKHTILPRSTGLLFCLQQLRGTVDWVYDC 279

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQRW 335
           T+G EG  +G +P+  +TLR  Y +G+ P++++++ R++A+ E+P D+ K F +WL +RW
Sbjct: 280 TVGYEGPPKGIYPDRYFTLRSTYGQGRPPKSVNMYWRRWALEEIPLDDPKDFEQWLLERW 339

Query: 336 IEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
            EKDAL+++F+  GRF         P  L+S  E   I
Sbjct: 340 REKDALLDQFFETGRF---------PTSLDSSIETQNI 368



>gi|242794826|ref|XP_002482455.1| acyltransferase, putative [Talaromyces stipitatus ATCC 10500]
 gi|218719043|gb|EED18463.1| acyltransferase, putative [Talaromyces stipitatus ATCC 10500]
          Length = 410

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/336 (39%), Positives = 206/336 (61%), Gaps = 21/336 (6%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R+ + + +F      +  +Q +   L+  +  YY +Y+  T++CFGIL++ I Q+ AP+ 
Sbjct: 43  RSLLLITWFNCCCVCIVATQLIGAPLYLVNKDYYYAYMAMTKQCFGILMITITQWGAPTV 102

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKI 168
             ++ D S  G ++ + NG  ++ + P+RL+ IANHQ+Y DW Y+W   Y +  HG I I
Sbjct: 103 VRVSGDDSVNGQIQMTANGL-LKTNFPDRLVFIANHQVYTDWTYLWWVGYTSRMHGHIYI 161

Query: 169 ILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT----------SKEPLW 218
           ILK+SLK+LP+ G GM F+ +IF+ R W  DK      L  L T          S +P+W
Sbjct: 162 ILKESLKYLPVLGQGMMFYGFIFMARKWEADKPRLEHRLQKLKTRHSGPMSGPQSLDPMW 221

Query: 219 LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTI 278
           LLIFPEGT +S  T+  S +Y +K+G+   +H++LPRSTGL FC   L  +VDYVYD T+
Sbjct: 222 LLIFPEGTNLSINTKNVSNRYGEKMGIEPLKHMILPRSTGLLFCLQQLRGTVDYVYDCTV 281

Query: 279 GIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQRWIE 337
           G EG  +G +P+  YTLR IY +G+ P++++++ R+++++E+P D+ K F +WL +RW E
Sbjct: 282 GYEGPPKGVYPDRFYTLRSIYGQGRPPKSVNMYWRRWSLAEIPLDDPKAFEQWLLERWRE 341

Query: 338 KDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
           KDAL+++F+  GRF         P  L S  E   I
Sbjct: 342 KDALLDQFFETGRF---------PTSLGSSIETQHI 368



>gi|171692517|ref|XP_001911183.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946207|emb|CAP73008.1| unnamed protein product [Podospora anserina S mat+]
          Length = 401

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 215/351 (61%), Gaps = 18/351 (5%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G+ +   LVQ+L   + FV F AG   A++ +Q +   L+   H  Y SY+  T++ FG+
Sbjct: 19  GKEKHGKLVQFLRGFSFFVYFMAG-CIAIHLAQLIGSPLYYVDHDIYYSYMALTKQSFGL 77

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+     ++ P+   I+ D S    +K++ +G +VE   PER+++IANHQIY DWLY+W 
Sbjct: 78  LITTSTNWWGPTTIRISGDASVADQIKKTKDG-RVEFSFPERMVMIANHQIYTDWLYLWW 136

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y AN+   HG + IILK+SLK++PI G GM F+ +IF+ R  A D+   +  L  L T
Sbjct: 137 IGY-ANSPQMHGYVYIILKESLKYIPIAGLGMVFYGFIFMSRKMAVDQPRLAHRLGKLKT 195

Query: 213 SK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCA 263
                       P+WLL+FPEGT  S   R  S ++A+K+G+ D EH+LLPRSTG  FC 
Sbjct: 196 YNTTPDGTKYLNPMWLLLFPEGTNASQNGRNKSARWAEKIGVKDPEHMLLPRSTGSFFCL 255

Query: 264 GSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED 323
             L  +V+YVYD T+  EGV RG+F E+++TL   YF GQ P++++L+ R++ I+++P D
Sbjct: 256 NELKGTVEYVYDCTVAYEGVPRGKFGEQLFTLSGTYFRGQPPKSVNLYWRRFRIADIPLD 315

Query: 324 E-DKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
             ++F  WLR+RW EKDALME++ + GRF    SP T   K    F  T++
Sbjct: 316 SAEQFDVWLRERWYEKDALMEQYISTGRFPA--SPPTAANKNQEGFLETEV 364



>gi|501750384|emb|CCG84891.2| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 423

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/337 (40%), Positives = 205/337 (60%), Gaps = 3/337 (0%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
            R  +FV +F      +  +Q + L L+ +S ++Y ++I  T++ FG++ V I Q+FAP+
Sbjct: 15  ARLVLFVCYFNCVCCIIQINQLIGLPLYYYSKAWYYAWIARTKQQFGMVCVTITQWFAPT 74

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
             V++ D S   +LK    G ++E    ER++LI+NHQIYADWL++W   Y +  HGA  
Sbjct: 75  TVVVSGDDSTARLLKSGAYG-RIETGFDERMVLISNHQIYADWLFMWWAAYTSRMHGAFY 133

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE-PLWLLIFPEGT 226
           IILKDSLKW+PI G  MQ F +IF+ RNW  DK    + L+ L T K+ P+WLL++PEGT
Sbjct: 134 IILKDSLKWIPIIGTAMQLFGFIFMARNWEKDKPAMERRLTQLRTDKDWPMWLLLYPEGT 193

Query: 227 VVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRG 286
            +S  T   ++ YA K      +  LLPRSTGL FC  +L ++VDY+YD TI  E +   
Sbjct: 194 NLSPTTIEKARAYAKKTDGPLLQRTLLPRSTGLRFCLDNLKETVDYLYDCTIAYEPIGET 253

Query: 287 QFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFY 346
            F  + YTLR ++ EG+ P+ +H+H R++A  ++P  E +F +WL +R++EKD ++  FY
Sbjct: 254 IFAAQKYTLRSLFLEGKPPKRVHMHWRRFATKDIPMGEKEFEKWLYERFVEKDEMLINFY 313

Query: 347 TKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPLVPI 383
             G F   +S  T  + L  + E+  +W   V L+ I
Sbjct: 314 KVGHFENTKSIETA-IGLRHLSEIADLWTPTVGLLLI 349



>gi|485915502|gb|EOD43129.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 protein
           [Neofusicoccum parvum UCRNP2]
          Length = 436

 Score =  267 bits (682), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 203/315 (64%), Gaps = 17/315 (5%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F V+F G    +N +Q++   L+ +S  +Y +++  T++ FG+L+  + Q+++P+
Sbjct: 51  LRMFLFGVYFMGSCVCINLTQYIGAPLYFYSRDWYYAWMAVTKQHFGLLITTMTQWWSPT 110

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ D+S +G L+Q+ +G ++E D P+R++LIANHQIY DWLY+W   Y +  HG + 
Sbjct: 111 VVRVSGDESVRGQLRQTEDG-RLECDFPDRMVLIANHQIYTDWLYLWWIAYTSRMHGHLY 169

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++PI G GMQFF +IFL R WATDK  F   L  L              +P+
Sbjct: 170 IILKESLKYIPIMGIGMQFFSFIFLSRKWATDKPRFQHRLQKLNARHKGPMSGDHDLDPM 229

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R +S ++A+K G  D  H LLPRSTGL FC   L  + ++VYD T
Sbjct: 230 WLLIFPEGTNLSSNGRDSSARWAEKSGQSDLRHALLPRSTGLFFCLQELKGTTEWVYDCT 289

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +      RGQ+ ++++TL+  YFEG+ PR+++LH R++A+ ++P   +  F +W+ QRW 
Sbjct: 290 MA-----RGQYGQDLFTLKSTYFEGRPPRSVNLHWRRFAVKDIPLSSQTDFEQWVLQRWR 344

Query: 337 EKDALMEEFYTKGRF 351
           EKD L+E +   GRF
Sbjct: 345 EKDDLLEFYLQTGRF 359



>gi|380495553|emb|CCF32307.1| acyltransferase [Colletotrichum higginsianum]
          Length = 410

 Score =  267 bits (682), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 221/356 (62%), Gaps = 20/356 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L+R   F ++FA    A+  +Q L + L+ ++   + +Y+  T++ FG+ + A+   ++ 
Sbjct: 44  LLRGLTFGLYFAACCLAIITTQMLGIPLYFYNREMFYAYMALTKQSFGLTITAMTHMWSN 103

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA---H 163
           S   I+ DKS  G ++++ +G +VE + PERL+L+ANHQIY DWLY+W   Y ANA   H
Sbjct: 104 STIRISGDKSMNGQIRKTPDG-RVEFNFPERLVLVANHQIYTDWLYLWWVAY-ANAPSMH 161

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFS------KTLSTLATSKE-- 215
           G I IILK+SLK++P  G GM F+ +IF+ R  ATD+   +      KT    A  KE  
Sbjct: 162 GHIYIILKESLKYIPGVGIGMMFYGFIFMSRKMATDQPRLAHRIDKLKTRHVAANGKEYL 221

Query: 216 -PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVY 274
            P+WLL+FPEGT +S   R  S  +A K+GL D EHVLLPRSTG  FC   L  S++Y+Y
Sbjct: 222 NPMWLLLFPEGTNLSTNGRRKSAAWAAKMGLKDPEHVLLPRSTGTLFCLRELKDSLEYIY 281

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQ 333
           D T+  EGV RG+F ++ ++L   YF+G+ PR+++ H R++ ++++P D+ K F  WLR+
Sbjct: 282 DCTVAYEGVPRGKFGDQYFSLISTYFQGRPPRSVNFHWRRFRLADIPLDDAKAFDAWLRE 341

Query: 334 RWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWYFIVPLVPIMW 385
           RW EKDALMEE+ + GRF       +      ++L + FEL QI + +V    I+W
Sbjct: 342 RWYEKDALMEEYLSTGRFPASPDIESGHLETEVRLKNWFELGQI-FVVVGTAGIIW 396



>gi|512192814|gb|EPE08572.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Ophiostoma piceae
           UAMH 11346]
          Length = 417

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 199/317 (62%), Gaps = 13/317 (4%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+  F +FF      +  +Q + + L+ F+   +  Y+  T++ FGI++  +  ++ P
Sbjct: 50  ILRSVSFGLFFFTTVMTIQLTQIVGMPLYFFNRELFYDYVALTKQSFGIIITTMTYWWGP 109

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYL--ANAHG 164
           +   I+ D+S  G +K++ +G + E   PER+++IANHQIY DWLY+W   Y    N HG
Sbjct: 110 TTIRISGDESVAGQIKKTKDG-RAEFSFPERMVMIANHQIYTDWLYLWWVGYANSPNTHG 168

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------E 215
            I IILK+SLK++P+ G GM F+ +IF+ R  A D+   +  L  L+ +           
Sbjct: 169 YIYIILKESLKYIPVIGTGMMFYGFIFMSRKMAVDQPRMAHRLRKLSEAHTDPSGKTYYN 228

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WLL+FPEGT +SD  R  S  +ADK+G  D EH+LLPRSTG++FC   L  SV+YVYD
Sbjct: 229 PMWLLLFPEGTNLSDNGRAKSAAWADKMGYKDPEHMLLPRSTGMYFCLSELQGSVEYVYD 288

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            T+  EGV RG + E+ ++L   YFEG+ P++++ H R++ +SE+P E  + F +WLR R
Sbjct: 289 CTVAYEGVPRGGYGEDCFSLSGTYFEGRAPKSVNFHWRRFKVSEIPLESAEVFDKWLRDR 348

Query: 335 WIEKDALMEEFYTKGRF 351
           W EKDA+ME++ + GR 
Sbjct: 349 WYEKDAMMEQYMSTGRL 365



>gi|402081466|gb|EJT76611.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Gaeumannomyces
           graminis var. tritici R3-111a-1]
          Length = 428

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 206/340 (60%), Gaps = 19/340 (5%)

Query: 39  QSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLV 98
           Q     + + R   F ++FA     +  +QF+   L+  S  +Y +Y+  T++ FGI + 
Sbjct: 37  QKYGRARQMFRQVTFGLYFAACVLGIATAQFIGAPLYWISRDWYYAYMAVTKQYFGITIT 96

Query: 99  AINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTY 158
            + +++ P+   ++ D S  G + Q+ +G +VE   P+RL+LIANHQIY DWLY+W   Y
Sbjct: 97  TMTKWWGPTIIRVSGDASVAGQITQAKDG-RVEFGFPKRLVLIANHQIYTDWLYLWWVAY 155

Query: 159 LAN--AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT---- 212
             +   HG I IILK+SLK++PI G GM F+ +IF+ R  A D+   +  L  L      
Sbjct: 156 ANDPQTHGWIYIILKESLKYIPIMGTGMMFYGFIFMSRKMAVDQPRMAHRLQKLKVKSTD 215

Query: 213 ------SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                 S  P+WLL+FPEGT  SD  RI S ++ADK+G+ D  H+LLPRSTG++FC   L
Sbjct: 216 PNTDQRSLNPMWLLLFPEGTNASDKGRIKSAQWADKMGIKDPRHLLLPRSTGMYFCLSEL 275

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             +VDYVYD T+  EG+ RG++ EE +TL   YF+G+ P++++ + R++ +SE+P    +
Sbjct: 276 KGTVDYVYDCTVAYEGIPRGRYGEEFFTLSSTYFQGRPPKSVNFYWRRFPVSEIPLATPE 335

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRF-----TGYESPRTV 360
           +F  WLR+RW EKD LME++Y  GRF     +G+  P  V
Sbjct: 336 EFEVWLRERWYEKDELMEQYYATGRFPPLGSSGFLGPDAV 375



>gi|482807986|gb|EOA84919.1| hypothetical protein SETTUDRAFT_42115 [Setosphaeria turcica Et28A]
          Length = 732

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/321 (41%), Positives = 198/321 (61%), Gaps = 3/321 (0%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G P+   L Q      +   F +G   A++ SQFL   L      +Y  Y+ +T+ CF I
Sbjct: 73  GPPRYGELTQAERAFTLASTFLSG-VLAISASQFLGAPLKLIDPQFYDGYMAYTKECFAI 131

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q++AP+   ++ D +  G L +  +G+ ++ +  +R++L+ANHQ+Y DWLY+W 
Sbjct: 132 LITCLTQWWAPTVVRVSGDSTMVGQLIKRKDGS-LQCNFADRMVLMANHQLYTDWLYLWW 190

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y  N HG I IILK+SLK +PI GWG QF+ +IFL R W  D+  F K LS L    +
Sbjct: 191 IAYTNNMHGFIYIILKESLKNIPIIGWGAQFYNFIFLSRKWEEDQRTFKKHLSKLNKKGD 250

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR  SK +A K GL D +H LLPRSTGL FC   L  + D++YD
Sbjct: 251 PMWLIIFPEGTNLSPTTREKSKAWAQKNGLQDMKHQLLPRSTGLKFCLNELKDTTDWLYD 310

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQR 334
            TI  EG+  GQ+ ++I+TLR  +FEG+ P+++++H R++ ++++P E+   F  WLR R
Sbjct: 311 CTIAYEGIPPGQYGQDIFTLRSSFFEGRPPKSVNMHWRRFRLADIPYENTHAFEVWLRNR 370

Query: 335 WIEKDALMEEFYTKGRFTGYE 355
           W EKD ++E F    RF   +
Sbjct: 371 WREKDYMLEYFSRNNRFPAED 391



>gi|398396926|ref|XP_003851921.1| hypothetical protein MYCGRDRAFT_72903, partial [Zymoseptoria
           tritici IPO323]
 gi|339471801|gb|EGP86897.1| hypothetical protein MYCGRDRAFT_72903 [Zymoseptoria tritici IPO323]
          Length = 346

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/290 (43%), Positives = 190/290 (65%), Gaps = 2/290 (0%)

Query: 63  ALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLK 122
           A++ SQF+   L      +Y++Y+  T+  F +L+  I Q++AP+   ++ D+S K  + 
Sbjct: 54  AISASQFIGAPLKLVDVKFYEAYMAWTKESFAVLVTTITQWWAPTVVRVSGDESMKDQIF 113

Query: 123 QSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGW 182
           Q  +G  ++ + P RL+L+ NHQ+Y DWLY+W   Y  N HG + IILK+SLK +PI GW
Sbjct: 114 QMDDGT-LKCNFPHRLVLMGNHQLYTDWLYLWWIAYTNNTHGRVYIILKESLKKVPIIGW 172

Query: 183 GMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADK 242
           GMQF+ +IFL RNW  D+  F   L  L    +P+WLLIFPEGT +S+ TR  S K+A+K
Sbjct: 173 GMQFYNFIFLSRNWEQDRYKFKHHLDQLKDPDDPMWLLIFPEGTNLSESTREKSAKWAEK 232

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
            G+ D +H LLPRSTGL FC   L  S +++YD TI  EGV +G + ++I+TL+   FEG
Sbjct: 233 TGVSDMKHQLLPRSTGLQFCLQELRASTNWLYDCTIAYEGVPKGMYGQDIFTLKSSLFEG 292

Query: 303 QYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + P++++++ R+Y I+++P ED + F+ WL  RW EKD L+E +Y  G F
Sbjct: 293 RPPKSVNMYWRRYKIADVPYEDSEAFSRWLLNRWREKDYLLEYYYKFGSF 342



>gi|378729915|gb|EHY56374.1| acyltransferase [Exophiala dermatitidis NIH/UT8656]
          Length = 420

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 209/358 (58%), Gaps = 24/358 (6%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R  + + +F   +  +N +QFL   L+ ++  YY +Y+  T++ FGIL +A  ++FAP
Sbjct: 47  ILRALLLLDWFNCGAVCINVTQFLGAPLYWWNKDYYYAYMALTKQSFGILGIAGTRWFAP 106

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DK  +G  +++  G  +E   PERL+ IANHQ+Y +WLY+W   Y +  HG I
Sbjct: 107 TKVRVSWDKDLRGQFRKTTAGT-LETTFPERLVYIANHQVYTEWLYLWWIAYTSRMHGHI 165

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R WA DK      L  L T            +P
Sbjct: 166 FIILKESLKYVPILGPGMMFYGFIFMARKWAADKPRLQHRLEKLKTRHSGPMSGSAGLDP 225

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S ++A+K G+ D  HVLLPRSTGL FC   L  +VD+VYD 
Sbjct: 226 MWLLIFPEGTNLSRNTKKVSSRWAEKQGIPDTRHVLLPRSTGLFFCLQQLQGTVDWVYDC 285

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           TI  EG  +G F  E +T+R  Y +G+ P+ +++H R++A++ +P  D  +F +WL +RW
Sbjct: 286 TIAYEGTPKGGFAPEYFTIRSTYLQGRPPKCVNMHWRRFAMASIPLNDAKEFEKWLLERW 345

Query: 336 IEKDALMEEFYTKGRFTGYESPRTVP------------MKLNSVFELTQIWYFIVPLV 381
            EKD L+E +Y  G F G E                  M LN+  E+ QI+  +  L 
Sbjct: 346 REKDDLLERWYETGYFPGDEEAANASRGISKGGYIETEMTLNNWMEIGQIFVVLATLA 403



>gi|453083641|gb|EMF11686.1| acyltransferase-domain-containing protein [Mycosphaerella populorum
           SO2202]
          Length = 425

 Score =  264 bits (674), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 132/331 (39%), Positives = 205/331 (61%), Gaps = 19/331 (5%)

Query: 38  PQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILL 97
           P         +R   F ++F      ++ +Q ++L L+  S  +++ +I  T+  FG+L+
Sbjct: 36  PLKHGAAMQALRITGFAIYFFLCCCGIHAAQMMALPLFFISKDWFRPWIAMTKAFFGLLI 95

Query: 98  VAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFT 157
             + Q+++P+   ++ DKS  G+L+Q  +G  ++ D   R++LI NHQ+Y DWLY+W   
Sbjct: 96  TTMTQWWSPTVVRVSGDKSVAGLLRQDASGM-LQTDFGNRMVLITNHQLYTDWLYLWWTA 154

Query: 158 YLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK 214
           Y ANA   HG + IILKDSLKW+P  G GMQ F +IF+ R WATD+      L  L T +
Sbjct: 155 Y-ANAIPMHGHVYIILKDSLKWIPALGPGMQLFGFIFMSRKWATDQDRMRYRLQKLRTRR 213

Query: 215 -------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHF 261
                        +P+WL+IFPEGT +S  TR  SKK+A++ G+ D  H +LPRSTGL F
Sbjct: 214 SPPMAGQTGEAQLDPMWLMIFPEGTNLSANTRARSKKFAEQSGIEDMRHQVLPRSTGLQF 273

Query: 262 CAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP 321
           C   L  +V+Y+YD+TIG EGV  G++  EI+TLR +YF+G+ P+++++H R++ +SE+P
Sbjct: 274 CLQELQGTVEYLYDVTIGYEGVPAGRYGAEIFTLRSVYFQGRTPKSVNMHWRRFKVSELP 333

Query: 322 -EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +D+D   +W+  RW EKD L++ F   G+F
Sbjct: 334 LDDKDAMHKWVMDRWREKDELLDVFMKTGKF 364



>gi|145253835|ref|XP_001398430.1| acyltransferase [Aspergillus niger CBS 513.88]
 gi|134084005|emb|CAK43076.1| unnamed protein product [Aspergillus niger]
          Length = 417

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 204/327 (62%), Gaps = 13/327 (3%)

Query: 37  EPQ-SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           EP+    +   L+R+ +   +F     A+  +Q +   L+  +  +Y SY+ +T++ FG+
Sbjct: 32  EPRLKHGIAMQLLRSLLLATWFNCCCVAILATQVIGSPLYVINKDWYYSYMAYTKQSFGL 91

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           ++ A+ Q+  P+   ++ D+S +G +  + +G +++   PER++LIANHQ+Y DW+Y+W 
Sbjct: 92  VITALTQWGCPTFVRVSGDRSVRGQVHVAEDG-RLKTQFPERMVLIANHQVYTDWIYLWW 150

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK- 214
             Y    HG I IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T   
Sbjct: 151 VAYTNTMHGRIFIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHT 210

Query: 215 ---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
                    +P+WLLIFPEGT +S  TR  S +YA K GL   +H LLPRSTGL FC   
Sbjct: 211 GSQSGSPQYDPMWLLIFPEGTNLSINTRRRSAEYAAKQGLSPLKHELLPRSTGLFFCLQQ 270

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +V++VYD T+  EG  +G  P++ +TLR  Y +G+ P ++++H R++A+SE+P +D+
Sbjct: 271 LRGTVEWVYDCTVAYEGPPKGSLPDKYFTLRSTYLQGRPPTSVNMHWRRFAVSEIPLDDQ 330

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +F  WLR+RWIEKD L+EE+Y  GRF
Sbjct: 331 QEFDSWLRERWIEKDQLLEEYYETGRF 357



>gi|358373302|dbj|GAA89901.1| acyltransferase [Aspergillus kawachii IFO 4308]
          Length = 417

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 203/327 (62%), Gaps = 13/327 (3%)

Query: 37  EPQ-SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           EP+    +   L+R+ +   +F     A+  +Q +   L+  +  +Y SY+ +T++ FG+
Sbjct: 32  EPRLKHGIAMQLLRSLLLATWFNCCCVAILATQVIGSPLYVINKDWYYSYMAYTKQSFGL 91

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           ++ A+ Q+  P+   ++ DKS +G +  + +G +++   PERL+LIANHQ+Y DW+Y+W 
Sbjct: 92  VITALTQWGCPTFVRVSGDKSVRGQVHVAEDG-RLKTQFPERLVLIANHQVYTDWIYLWW 150

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK- 214
             Y    HG I IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T   
Sbjct: 151 VAYTNTMHGRIFIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHT 210

Query: 215 ---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
                    +P+WLLIFPEGT +S  TR  S +YA K GL   +H L+PRSTGL FC   
Sbjct: 211 GSQSGSPQYDPMWLLIFPEGTNLSINTRRRSAEYAAKQGLSPLKHELIPRSTGLFFCLQQ 270

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +V++VYD T+  EG  RG  P++ +TLR  Y +G+ P ++++H R++A+SE+P +D+
Sbjct: 271 LRGTVEWVYDCTVAYEGPPRGSLPDKYFTLRSTYLQGRPPTSVNMHWRRFAVSEIPLDDQ 330

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +F  WLR+RW EKD L+EE+Y  GRF
Sbjct: 331 HEFDSWLRERWTEKDQLLEEYYETGRF 357



>gi|407919524|gb|EKG12756.1| Phospholipid/glycerol acyltransferase [Macrophomina phaseolina MS6]
          Length = 780

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 205/339 (60%), Gaps = 8/339 (2%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G PQ     Q     ++   F +G   A+N +QF+ L        +Y  YI  T++ F +
Sbjct: 35  GPPQHGGFGQAERGVSIASTFLSG-ILAINAAQFIGLPFKMIDPQFYNDYIAFTKQSFAV 93

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q+++P+   ++ D S  G L    +G+ +E   PERL+L+ANHQ+Y DWLY+W 
Sbjct: 94  LVTTLTQWWSPTEVRVSGDPSIPGQLLLKPDGS-LECRFPERLVLMANHQLYTDWLYLWW 152

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y     G + IILK+S+K +P+ GWG QF+ +IFL RNW  DK  F + L  L+  K+
Sbjct: 153 AAYTNKMAGHVYIILKESIKHIPLIGWGSQFYNFIFLARNWEKDKPRFQEHLQQLSNPKD 212

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR +S+++A+K G+ D  H LLPRSTGL FC  +L  S +++YD
Sbjct: 213 PVWLIIFPEGTNLSAATRESSRRWAEKNGIKDMRHQLLPRSTGLKFCLENLQGSTEWLYD 272

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQR 334
            TI  EGV  GQ+ ++IYTL+  +FEG+ P+++++H R++ ISE+P   DK F  WLR R
Sbjct: 273 CTIAYEGVPHGQYGQDIYTLQSSFFEGRPPKSVNMHWRRFRISEIPLHSDKAFEVWLRNR 332

Query: 335 WIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
           W EKD  ++ +     F     P   P K +S  E+ +I
Sbjct: 333 WKEKDHYLDYYQRHSAF-----PAADPWKASSPAEMQRI 366



>gi|453084565|gb|EMF12609.1| acyltransferase-domain-containing protein, partial [Mycosphaerella
           populorum SO2202]
          Length = 344

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 189/290 (65%), Gaps = 2/290 (0%)

Query: 63  ALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLK 122
           A++ SQF+   L      +Y++Y+  T+  F +L+  I Q++AP+   ++ D + KG L 
Sbjct: 52  AISASQFIGAPLKLIDAQFYEAYMAWTKESFAVLMTTITQWWAPTVVRVSGDATMKGQLF 111

Query: 123 QSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGW 182
           Q  +G  ++ + P RL+L+ NHQ+Y DWLY W   Y    HG I IILK+SLK +PI GW
Sbjct: 112 QMDDGT-LKCNFPHRLVLMGNHQLYTDWLYFWWIAYTNKMHGRIYIILKESLKHIPIIGW 170

Query: 183 GMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADK 242
           GMQF+ +IFL R W  D+  F + L  L   K+P+WLLIFPEGT +S+VTR  S K+A+K
Sbjct: 171 GMQFYNFIFLSRKWEQDRYSFKRHLDHLKNPKDPMWLLIFPEGTNLSEVTRQKSAKWAEK 230

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
            G+ D +H LLPR+ GL FC   L  + +++YD TI  EGV  G + ++IYTL+   FEG
Sbjct: 231 TGVPDMKHQLLPRAIGLQFCLKELRATTNWLYDCTIAYEGVPNGMYGQDIYTLKSSLFEG 290

Query: 303 QYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + P++++++ R++ I+++P ED++ F+ WL  RW EKD +++ +Y  G F
Sbjct: 291 RPPKSVNMYFRRFKIADIPYEDDEAFSRWLINRWREKDYMLDYYYKFGNF 340



>gi|384494203|gb|EIE84694.1| hypothetical protein RO3G_09404 [Rhizopus delemar RA 99-880]
          Length = 295

 Score =  263 bits (671), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 187/294 (63%), Gaps = 17/294 (5%)

Query: 91  RCFGILLVAINQFFAPSNFVITVDKSA---KGVLKQSWNGAKVELDMPERLILIANHQIY 147
           R +   L+AI ++FAP+ F+++ D++    + +L+   +   + L+ PER+I IANHQIY
Sbjct: 2   RTWSQSLIAIVEYFAPTQFILSFDENCGPVEDILQLDDSKNVIGLNFPERMIAIANHQIY 61

Query: 148 ADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTL 207
           ADW+Y+WC  +LA+ H AIKIILK SL++LPI+G  ++F            DK      L
Sbjct: 62  ADWIYIWCLAHLADKHDAIKIILKKSLEYLPIYGTKLEF------------DKDNIINNL 109

Query: 208 STLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLH 267
                +K P+WL++FPEGTV+S+ TR  SK YA+++ + D+ + LLPRSTGL  C   L 
Sbjct: 110 QRSKKNKLPMWLVLFPEGTVISESTRKKSKDYAERMNMQDNRYTLLPRSTGLRLCTTVLK 169

Query: 268 KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKF 327
            +V+Y+YD TIG  G+     PEE++T++ I+F  +YP+ +H+HIRKY I  +P++   F
Sbjct: 170 DNVEYIYDFTIGYSGITSTDIPEEVHTIQSIFFFNRYPKQVHVHIRKYRIDSIPDESKLF 229

Query: 328 TEWLRQRWIEKDALMEEFYTKGRFTGYE-SPRTVPMKL-NSVFELTQIWYFIVP 379
            +W+  RW EKD LM  FY    F   + +   VP+KL NS+ EL QIW F+VP
Sbjct: 230 DQWVLARWKEKDELMTRFYETNSFVTKDVATINVPIKLKNSILELAQIWIFLVP 283



>gi|358400211|gb|EHK49542.1| acyltransferase, partial [Trichoderma atroviride IMI 206040]
          Length = 418

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/356 (37%), Positives = 210/356 (58%), Gaps = 18/356 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R   F ++F      +  +Q L   L+  +  +Y  Y+  T+R F I  + + Q + P
Sbjct: 51  ILRGLAFTIYFLTCCVTIVITQVLGCWLYFVNRDFYYDYMSMTKRLFAITTILMTQIWGP 110

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYL--ANAHG 164
           +   I+ D++  G +  +  G  V+ + PER+++IANHQIY DWLY+W   Y+   +AHG
Sbjct: 111 TTIRISGDETVAGEILPT-EGGGVQFNFPERMVMIANHQIYTDWLYLWWCGYVNRPSAHG 169

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE--------- 215
            I IILK+SL+++PI GWGM+F+ +IF+ R  A D+   +  L  L  +K          
Sbjct: 170 HIYIILKESLQYIPIVGWGMKFYGFIFMSRKMAKDQPRLAYRLGKLKQTKTDPNGKTYRV 229

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WLL+FPEGT +S   R  S  +ADK G  D EH+LLPRSTG  FC   L  +VDYVYD
Sbjct: 230 PMWLLLFPEGTNISGNGRRKSASWADKNGWKDPEHMLLPRSTGSFFCLNELRGTVDYVYD 289

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDE-DKFTEWLRQR 334
            T+  EG+ RG++ E+I+TL   YF+G+ P++++   RK+ +S++P D  D+F  WLR  
Sbjct: 290 CTVAYEGIDRGKYGEDIFTLGSTYFQGRSPKSVNFFWRKFKMSDIPLDNADEFDLWLRNE 349

Query: 335 WIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWYFIVPLVPIMWY 386
           W +KDALME++ T GRF      +       ++  + FE+ Q+ + IV +  + W+
Sbjct: 350 WYKKDALMEQYLTTGRFPAMAGSKVDFVETKVRAKNPFEILQV-FTIVGIAGLCWH 404



>gi|350634082|gb|EHA22446.1| hypothetical protein ASPNIDRAFT_128938 [Aspergillus niger ATCC
           1015]
          Length = 1457

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 204/327 (62%), Gaps = 13/327 (3%)

Query: 37  EPQ-SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           EP+    +   L+R+ +   +F     A+  +Q +   L+  +  +Y SY+ +T++ FG+
Sbjct: 32  EPRLKHGIAMQLLRSLLLATWFNCCCVAILATQVIGSPLYVINKDWYYSYMAYTKQSFGL 91

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           ++ A+ Q+  P+   ++ D+S +G +  + +G +++   PER++LIANHQ+Y DW+Y+W 
Sbjct: 92  VITALTQWGCPTFVRVSGDRSVRGQVHVAEDG-RLKTQFPERMVLIANHQVYTDWIYLWW 150

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK- 214
             Y    HG I IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T   
Sbjct: 151 VAYTNTMHGRIFIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHT 210

Query: 215 ---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
                    +P+WLLIFPEGT +S  TR  S +YA K GL   +H LLPRSTGL FC   
Sbjct: 211 GSQSGSPQYDPMWLLIFPEGTNLSINTRRRSAEYAAKQGLSPLKHELLPRSTGLFFCLQQ 270

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +V++VYD T+  EG  +G  P++ +TLR  Y +G+ P ++++H R++A+SE+P +D+
Sbjct: 271 LRGTVEWVYDCTVAYEGPPKGSLPDKYFTLRSTYLQGRPPTSVNMHWRRFAVSEIPLDDQ 330

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +F  WLR+RWIEKD L+EE+Y  GRF
Sbjct: 331 QEFDSWLRERWIEKDQLLEEYYETGRF 357



>gi|452981010|gb|EME80770.1| hypothetical protein MYCFIDRAFT_35494, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 342

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 187/290 (64%), Gaps = 2/290 (0%)

Query: 63  ALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLK 122
           A++ SQF+   L      +Y++Y+  T+  F +L+  I Q++AP+   ++ D S KG L 
Sbjct: 53  AISASQFIGAPLKLIDSKFYEAYMAWTKESFAVLMTTITQWWAPTVVRVSGDDSMKGQLF 112

Query: 123 QSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGW 182
           Q  +G  +  + P RLI++ NHQ+Y DWLY+W   Y    HG I IILK+SLK +PI GW
Sbjct: 113 QMDDG-DLRCNFPHRLIMMGNHQLYTDWLYLWWIAYTNKMHGRIYIILKESLKQVPIIGW 171

Query: 183 GMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADK 242
           GMQF+ +IFL R W  D+  F K L  L   ++P+WLLIFPEGT +S VTR  S  ++ K
Sbjct: 172 GMQFYNFIFLSRKWEQDRYRFKKHLDHLKNPQDPMWLLIFPEGTNLSAVTREKSASWSKK 231

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
            G+ D +H LLPR+TGL FC   +  S +++YD TI  EGV +G + ++I+TL+   FEG
Sbjct: 232 TGIPDMKHQLLPRTTGLQFCLQEMRPSTNWLYDCTIAYEGVPKGLYGQDIFTLKSSLFEG 291

Query: 303 QYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + P+++++  R++ ISE+P +D+++F  WL  RW EKD ++E FY  G F
Sbjct: 292 RPPKSVNMFFRRFKISEIPYQDDEQFQSWLVNRWREKDYMLEHFYKFGSF 341



>gi|340516171|gb|EGR46421.1| predicted protein [Trichoderma reesei QM6a]
          Length = 421

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 149/386 (38%), Positives = 217/386 (56%), Gaps = 27/386 (6%)

Query: 33  PALGEPQSQNL----VQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKH 88
           PA   P  +      VQ L   A+ V FF      +  SQ L   L+  +   Y  Y+  
Sbjct: 34  PADAHPSGKRAHGRAVQVLRGLALGVYFFT-CCVTIVISQVLGSWLYFVNRDLYYDYMSM 92

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           T+R F +    + Q + P+   I+ D+S  G ++ + +G  V+   PERL++IANHQIY 
Sbjct: 93  TKRWFAVTTTFVTQVWGPTTIRISGDESVAGEIRPTEDGG-VQFSFPERLVMIANHQIYT 151

Query: 149 DWLYVWCFTYLAN--AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKT 206
           DWLY+W   Y+    AHG I IILK SL+++PI GWGM+F+ +IF+ R  ATD+   +  
Sbjct: 152 DWLYLWWVGYVNKPAAHGHIYIILKQSLQYIPIIGWGMKFYGFIFMSRKMATDQPRMAYR 211

Query: 207 LSTLATSKE---------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
           L  L  +K          P+WLL+FPEGT +S   R  S  +A+K G  D EHVLLPRST
Sbjct: 212 LGKLKQTKTDPSGKQYRVPMWLLLFPEGTNISGNGRRKSAAWAEKNGWKDPEHVLLPRST 271

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           G  FC   L  +VDYVYD T+  EGV RG++ E I+TL   YF+G+ P++++ + RK+ +
Sbjct: 272 GSFFCLNELKGTVDYVYDCTVAYEGVERGKYGENIFTLSSTYFQGRSPKSVNFYWRKFKL 331

Query: 318 SEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQ 372
           S++P +D  KF  WLR+ W +KDALME++ T GRF      +       ++  S  E+ Q
Sbjct: 332 SDIPLDDAGKFDVWLREEWYKKDALMEQYLTTGRFPAMAGSKVDFIETKVRTKSPLEVLQ 391

Query: 373 IWYFIVPLVPIMWY----FSNYLLNR 394
           + + IV +  ++W     F   + NR
Sbjct: 392 V-FTIVGITGLVWRNVQKFGGVVANR 416



>gi|358381861|gb|EHK19535.1| hypothetical protein TRIVIDRAFT_80938 [Trichoderma virens Gv29-8]
          Length = 401

 Score =  260 bits (664), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 218/386 (56%), Gaps = 30/386 (7%)

Query: 27  LEIIKMPALGEPQSQNL-----------VQWLVRTAVFVVFFAGQSAALNFSQFLSLLLW 75
           + + + P  G   SQ++           VQ ++R     V+F      +  SQ L   L+
Sbjct: 1   MGLNEAPGKGSANSQDVHPSGKRPHGRAVQ-ILRGLALAVYFLTCCVTIVVSQLLGCWLY 59

Query: 76  PFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMP 135
             +   Y  Y+  T+R F I++  + Q + P+   I+ D+S  G ++    G  V+ + P
Sbjct: 60  FVNREIYYDYMSMTKRWFAIVVTWMTQIWGPTTIRISGDESVAGEIRPM-EGGGVQFNFP 118

Query: 136 ERLILIANHQIYADWLYVWCFTYL--ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLK 193
           ERL++IANHQIY DWLY+W   Y+  A+AHG I IILK SL+++PI GWGM F+ +IF+ 
Sbjct: 119 ERLVMIANHQIYTDWLYLWWVGYVNRASAHGHIFIILKQSLQYIPIIGWGMTFYSFIFMS 178

Query: 194 RNWATDKGPFSKTLSTLATSKE---------PLWLLIFPEGTVVSDVTRITSKKYADKVG 244
           R  ATD+   +  L  L  ++          P+WLL+FPEGT +S   R  S  +A+K G
Sbjct: 179 RKMATDQPRLAYRLGKLKQTRTDPSGKQYRIPMWLLLFPEGTNISGNGRRKSASWAEKKG 238

Query: 245 LVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQY 304
             D EHVLLPRSTG  FC   L  +V+YVYD T+  EGV RG++ E I+TL   Y +G+ 
Sbjct: 239 WKDPEHVLLPRSTGSFFCLNELRGTVEYVYDCTVAYEGVGRGKYGENIFTLSSTYLQGRP 298

Query: 305 PRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT---- 359
           P++++ + R++ +S++P +D D+F  WLR  W +KDALME++ T GRF      +     
Sbjct: 299 PKSVNFYWRRFKLSDIPLDDADEFDAWLRAEWYKKDALMEQYLTTGRFPAMAGSKVDFIE 358

Query: 360 VPMKLNSVFELTQIWYFIVPLVPIMW 385
             ++  S  E+ QI +  V +  ++W
Sbjct: 359 TKVQTKSPLEILQI-FSAVGIAGLVW 383



>gi|225685041|gb|EEH23325.1| lysocardiolipin acyltransferase [Paracoccidioides brasiliensis
           Pb03]
 gi|226294354|gb|EEH49774.1| lysocardiolipin acyltransferase [Paracoccidioides brasiliensis
           Pb18]
          Length = 421

 Score =  259 bits (662), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/331 (38%), Positives = 198/331 (59%), Gaps = 17/331 (5%)

Query: 42  NLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAIN 101
           NL   ++R+ + + +F      +  +Q +   L+  +  Y+  Y+  T+R FGI + A+ 
Sbjct: 26  NLTIQILRSLILITWFNCCCLCIVITQLIGAPLFFINRHYFNKYMAMTKRSFGIAITALT 85

Query: 102 QFFAPSNFVITVDKSAKGVLK-----QSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           ++  P+   ++ DKS +G         +  GAK++   P+R+++IANHQ+Y DWLY+W F
Sbjct: 86  EWGCPTPIRVSGDKSVQGQFGLTRGGSASGGAKLKTYFPDRIVMIANHQVYTDWLYLWWF 145

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE- 215
           +Y A  HG I IILK+SLK++P+ G GM F+ +IF+ R WA DK      L  L T  E 
Sbjct: 146 SYTAQMHGHIYIILKESLKYIPVIGQGMMFYGFIFMARKWAADKPRLQHRLEKLKTYHES 205

Query: 216 ----------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
                     P+WLLIFPEGT +S  T+  S  Y +K G+    H +LPRSTGL FC   
Sbjct: 206 CSRPGLRILDPMWLLIFPEGTNLSRNTKRISDGYGEKHGIPPLRHQILPRSTGLFFCLQQ 265

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +VD+VYD T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++ ISE+P +D+
Sbjct: 266 LKGTVDWVYDCTVGYEGPPKGSYPDAFFTIRSTYLQGRPPKVVNFYWRRFPISEIPLDDQ 325

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRFTGYE 355
           ++F  W+ QRW EKD L+E+FY  GRF   E
Sbjct: 326 NEFEGWILQRWREKDDLLEQFYETGRFPPCE 356



>gi|240277291|gb|EER40800.1| acyltransferase [Ajellomyces capsulatus H143]
          Length = 405

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 196/320 (61%), Gaps = 12/320 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+   + +F      +  +Q     L+  +  Y+ +Y+  T+R FGI + A+ ++F P
Sbjct: 26  ILRSLALLAWFNCCCVCIVATQLAGAPLYFINRQYFNAYMAMTKRSFGIAITALTEWFCP 85

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DKS +G    + +G K++ + PER++LIANHQ+Y DWLY+W F+Y +  HG I
Sbjct: 86  TPIRVSGDKSVQGQFFITKDG-KLKTNFPERMVLIANHQVYTDWLYLWWFSYTSQMHGHI 144

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P+ G GM F+ +IF+ R W  DK      L  L T+           +P
Sbjct: 145 YIILKESLKYIPLIGQGMMFYGFIFMARKWIADKPRLQHRLEKLKTAHGGPRPGSLLLDP 204

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+    H +LPRSTGL FC   L  +VD+VYD 
Sbjct: 205 MWLLIFPEGTNLSRNTKRISDGYGAKQGIPPLRHQILPRSTGLFFCLQQLKGTVDWVYDC 264

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++A+SE+P +D+ +F  W+ +RW
Sbjct: 265 TVGYEGPPKGSYPDAYFTIRSTYLQGRPPKVVNFYWRRFAVSEIPLDDQKEFDAWVHKRW 324

Query: 336 IEKDALMEEFYTKGRFTGYE 355
           IEKD L+E FY  GRF   E
Sbjct: 325 IEKDELLERFYETGRFPPCE 344



>gi|225562204|gb|EEH10484.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 405

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 196/320 (61%), Gaps = 12/320 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+   + +F      +  +Q     L+  +  Y+ +Y+  T+R FGI + A+ ++F P
Sbjct: 26  ILRSLALLAWFNCCCVCIVATQLAGAPLYFINRQYFNAYMAMTKRSFGIAITALTEWFCP 85

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DKS +G    + +G K++ + PER++LIANHQ+Y DWLY+W F+Y +  HG I
Sbjct: 86  TPIRVSGDKSVQGQFFITKDG-KLKTNFPERMVLIANHQVYTDWLYLWWFSYTSQMHGHI 144

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P+ G GM F+ +IF+ R W  DK      L  L T+           +P
Sbjct: 145 YIILKESLKYIPLIGQGMMFYGFIFMARKWIADKPRLQHRLEKLKTAHGGPRPGSLLLDP 204

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+    H +LPRSTGL FC   L  +VD+VYD 
Sbjct: 205 MWLLIFPEGTNLSRNTKRISDGYGAKQGIPPLRHQILPRSTGLFFCLQQLKGTVDWVYDC 264

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++A+SE+P +D+ +F  W+ +RW
Sbjct: 265 TVGYEGPPKGSYPDAYFTIRSTYLQGRPPKVVNFYWRRFAVSEIPLDDQKEFDAWVHKRW 324

Query: 336 IEKDALMEEFYTKGRFTGYE 355
           IEKD L+E FY  GRF   E
Sbjct: 325 IEKDDLLERFYETGRFPPCE 344



>gi|425766562|gb|EKV05168.1| Acyltransferase, putative [Penicillium digitatum PHI26]
 gi|425781715|gb|EKV19662.1| Acyltransferase, putative [Penicillium digitatum Pd1]
          Length = 415

 Score =  258 bits (660), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 206/337 (61%), Gaps = 13/337 (3%)

Query: 27  LEIIKMPALGEPQ-SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSY 85
           L+ +    L EP+    +   ++R+ + + +      A+  +Q +   L+  + +YY SY
Sbjct: 20  LQKLSTEPLSEPRLKHGIPMQILRSLLLITWVDCCILAICVTQLIGAPLYLINRNYYYSY 79

Query: 86  IKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQ 145
           + +T++CFG++L A+ Q+ +P+ F ++ D S +G +  S +G  +E   PERL++I+NHQ
Sbjct: 80  MAYTKQCFGLVLGAVTQWSSPTLFRVSGDASVRGQIHLSKDGL-LETRFPERLVMISNHQ 138

Query: 146 IYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSK 205
           +Y DW+Y+W   Y    HG I IILK+SLK++P+ G GM F+ +IF+ R W +DK     
Sbjct: 139 VYTDWVYLWWVAYTNQMHGRIFIILKESLKYIPLVGTGMMFYGFIFMARKWTSDKPRLQH 198

Query: 206 TLSTLAT----------SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
            L  L T            +P+WLLIFPEGT +S  T+  S  +  K GL   +H++LPR
Sbjct: 199 RLEKLKTVYTGSNSARPQYDPMWLLIFPEGTNLSINTKRRSDIWGTKQGLPSFKHMILPR 258

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           STGL FC   L  +VD+VYD T+  EG  +G +P++ +TLR  Y +G+ P ++++H R++
Sbjct: 259 STGLFFCLQQLRGTVDWVYDCTMAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRF 318

Query: 316 AISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +SE+P +D+ +F  WL  RW EKD LM+E++  GRF
Sbjct: 319 QVSEIPLDDQKEFENWLTARWAEKDQLMDEYFETGRF 355



>gi|342885973|gb|EGU85922.1| hypothetical protein FOXB_03589 [Fusarium oxysporum Fo5176]
 gi|475668401|gb|EMT66188.1| hypothetical protein FOC4_g10006578 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 420

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 219/370 (59%), Gaps = 30/370 (8%)

Query: 39  QSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLV 98
           +S   +  +VR ++F ++F      +  +Q +   L+  +  +Y +Y+  T++ F +   
Sbjct: 45  ESYGTLMQIVRGSLFALYFNTCCMIIFLTQLVGAPLYFVNRDWYYAYMAMTKQSFCLTTT 104

Query: 99  AINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTY 158
           ++ Q + P+   I+ D+S  G +K   +G  V+ + PERL++IANHQIY DWLY+W   Y
Sbjct: 105 SMTQIWGPTTIRISGDESVAGQIKLRPDGG-VQFEFPERLVMIANHQIYTDWLYLWWIAY 163

Query: 159 LANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK- 214
            AN+   HG I IILK+SLK +P+ GWGM+F+ +IF+ R  A+D+   +  L+ L   K 
Sbjct: 164 -ANSPSMHGHIYIILKESLKHIPLIGWGMRFYGFIFMSRKMASDQPRLAYRLNKLKQRKV 222

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLL+FPEGT +S+  R  S  +A K  L D +HV+LPRSTG+ FC   L
Sbjct: 223 DPNGKSYMDPMWLLLFPEGTNLSNNGRRKSAGWAAKNDLKDPDHVMLPRSTGMFFCLNEL 282

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             S+DYVYD T+  EG+ RG F EE + L   YF+G+ P++++ H R++ +S+MP  D+ 
Sbjct: 283 KGSIDYVYDCTVAYEGIPRGGFGEEYFGLVSTYFQGRAPKSVNFHWRRFKVSDMPLHDQK 342

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSV---------FELTQIWYF 376
            F  WLR+ W +KDALMEE+ T GRF     PR    K++ +         +E+ QI + 
Sbjct: 343 AFELWLREEWYKKDALMEEYLTTGRF-----PRMAGSKIDYIETEVKTRKPWEILQI-FA 396

Query: 377 IVPLVPIMWY 386
           +V    ++W+
Sbjct: 397 VVGTAALIWH 406



>gi|477512820|gb|ENH65349.1| hypothetical protein FOC1_g10005882 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 420

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 219/370 (59%), Gaps = 30/370 (8%)

Query: 39  QSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLV 98
           +S   +  +VR ++F ++F      +  +Q +   L+  +  +Y +Y+  T++ F +   
Sbjct: 45  ESYGTLMQIVRGSLFALYFNTCCMIIFLTQLVGAPLYFVNRDWYYAYMAMTKQSFCLTTT 104

Query: 99  AINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTY 158
           ++ Q + P+   I+ D+S  G +K   +G  V+ + PERL++IANHQIY DWLY+W   Y
Sbjct: 105 SMTQIWGPTTIRISGDESVAGQIKLRPDGG-VQFEFPERLVMIANHQIYTDWLYLWWIAY 163

Query: 159 LANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK- 214
            AN+   HG I IILK+SLK +P+ GWGM+F+ +IF+ R  A+D+   +  L+ L   K 
Sbjct: 164 -ANSPSMHGHIYIILKESLKHIPLIGWGMRFYGFIFMSRKMASDQPRLAYRLNKLKQRKV 222

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLL+FPEGT +S+  R  S  +A K  L D +HV+LPRSTG+ FC   L
Sbjct: 223 DPNGKSYMDPMWLLLFPEGTNLSNNGRRKSAGWAAKNDLKDPDHVMLPRSTGMFFCLNEL 282

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             S+DYVYD T+  EG+ RG F EE + L   YF+G+ P++++ H R++ +S+MP  D+ 
Sbjct: 283 KGSIDYVYDCTVAYEGIPRGGFGEEYFGLVSTYFQGRAPKSVNFHWRRFKVSDMPLHDQK 342

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSV---------FELTQIWYF 376
            F  WLR+ W +KDALMEE+ T GRF     PR    K++ +         +E+ QI + 
Sbjct: 343 AFELWLREEWYKKDALMEEYLTTGRF-----PRMAGSKIDYIETEVKTRKPWEILQI-FA 396

Query: 377 IVPLVPIMWY 386
           +V    ++W+
Sbjct: 397 VVGAAALIWH 406



>gi|239608952|gb|EEQ85939.1| acyltransferase [Ajellomyces dermatitidis ER-3]
 gi|327354031|gb|EGE82888.1| acyltransferase [Ajellomyces dermatitidis ATCC 18188]
          Length = 408

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 194/320 (60%), Gaps = 12/320 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+   + +F      +  +Q +   L+  +  Y+ SY+  T+R FGI + A+ ++  P
Sbjct: 26  ILRSLALLTWFNCCCVCIVATQLVGAPLYFINRQYFNSYMAMTKRSFGIAITALTEWGCP 85

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DKS +G    + +G  VE   PER++LIANHQ+Y DWLY+W F+Y +  HG I
Sbjct: 86  TPIRVSGDKSVQGQFSLTKDG-NVETSFPERMVLIANHQVYTDWLYLWWFSYTSQMHGHI 144

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE----------P 216
            IILK+SLK++P+ G GM F+ +IF+ R W +DK      L  L T  E          P
Sbjct: 145 YIILKESLKYIPLIGQGMMFYGFIFMARKWISDKPRLQHRLEKLKTVHEEGRSGSRVLDP 204

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+    H +LPRSTGL FC   L  ++D+VYD 
Sbjct: 205 MWLLIFPEGTNLSRNTKRISDAYGAKQGIPPLRHQILPRSTGLFFCLQQLKGTIDWVYDC 264

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++A++E+P +D+ +F  W+ +RW
Sbjct: 265 TVGYEGPPKGSYPDAYFTIRSTYLKGRPPKVVNFYWRRFAVAEIPLDDQKEFEAWIHERW 324

Query: 336 IEKDALMEEFYTKGRFTGYE 355
           +EKD L+E FY  GRF   E
Sbjct: 325 LEKDDLLERFYETGRFPPCE 344



>gi|367025329|ref|XP_003661949.1| hypothetical protein MYCTH_2301905 [Myceliophthora thermophila ATCC
           42464]
 gi|347009217|gb|AEO56704.1| hypothetical protein MYCTH_2301905 [Myceliophthora thermophila ATCC
           42464]
          Length = 334

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/276 (46%), Positives = 186/276 (67%), Gaps = 15/276 (5%)

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           T+R FG+L+  +  ++ P+   I+ D S    ++++ +G  VE   PER+I+IANHQIY 
Sbjct: 4   TKRSFGLLITTMTHWWGPTTIRISGDASVADQIRKTEDGL-VEFSFPERMIMIANHQIYT 62

Query: 149 DWLYVWCFTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSK 205
           DWLY+W   Y ANA   HG++ IILK+SLK++PI G GM F+ +IFL R  A D+   + 
Sbjct: 63  DWLYLWWVGY-ANAPKTHGSLFIILKESLKYIPIVGPGMMFYGFIFLSRKMAVDQPRMAY 121

Query: 206 TLSTLATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
            L  L T+          +P+WLL+FPEGT  S+ +R  S K+A K+G+ D EHVLLPRS
Sbjct: 122 RLRKLKTTHTAPDGKKYLDPMWLLLFPEGTNASENSRSKSAKWAAKIGVKDPEHVLLPRS 181

Query: 257 TGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYA 316
           TG+++C   L  +VDYVYD T+  EGV RGQF E+I+TL   Y +GQ P++++ + R++ 
Sbjct: 182 TGIYYCLSELKGTVDYVYDCTVAYEGVPRGQFGEKIFTLGGTYIKGQTPKSVNFYWRRFR 241

Query: 317 ISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           I++MP E ++KF  WLR+RW EKDALME++ + GRF
Sbjct: 242 IADMPLESQEKFEAWLRERWYEKDALMEQYISTGRF 277



>gi|408395514|gb|EKJ74694.1| hypothetical protein FPSE_05162 [Fusarium pseudograminearum CS3096]
          Length = 420

 Score =  257 bits (657), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 214/357 (59%), Gaps = 20/357 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR + F  +F      +  +Q + L L+  +  +Y +YI  T+  FG+ +  + Q + P
Sbjct: 53  IVRGSCFAFYFNSCIVIIFLTQLIGLPLYFVNRDWYYAYIAMTKGFFGLTITLMTQIWGP 112

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA---H 163
           +   ++ D+S  G +K   +G  V+ + PERL+LIANHQIY DWLY+W   Y AN+   H
Sbjct: 113 TTIRVSGDESVAGQIKLRSDGG-VQFEFPERLVLIANHQIYTDWLYLWWIAY-ANSPSMH 170

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK--------- 214
           G I IILK+SLK +PI G GMQ + +IF+ R  A+D+   +  L+ L   K         
Sbjct: 171 GHIYIILKESLKRIPIVGLGMQLYGFIFMSRKMASDQPRMAYRLNKLKQPKVDPNGKSYM 230

Query: 215 EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVY 274
           +P+WLL+FPEGT +S+  R  S  +A K+ L D EHVLLPRSTG+ FC   L  S+DYVY
Sbjct: 231 DPMWLLLFPEGTNLSNNGRRKSAGWAAKMDLKDPEHVLLPRSTGMFFCLNELKGSLDYVY 290

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQ 333
           D T+  EG+ RG F E+ + L   YF+G+ P++++ H R++ +S++P D+ K F  WLR+
Sbjct: 291 DCTVAYEGIPRGGFGEQYFGLVSTYFQGRPPKSVNFHWRRFRLSDVPLDDQKAFDLWLRE 350

Query: 334 RWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWYFIVPLVPIMWY 386
            W +KDALMEE+ T GRF   E  +       +K    +E+ Q+ + ++  V ++W+
Sbjct: 351 EWYKKDALMEEYMTTGRFPRMEGGKVDYIETEVKTRQPWEILQL-FAVIGTVGLIWH 406



>gi|302898352|ref|XP_003047831.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256728762|gb|EEU42118.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 415

 Score =  257 bits (657), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 137/352 (38%), Positives = 213/352 (60%), Gaps = 25/352 (7%)

Query: 33  PALGEPQSQ----NLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKH 88
           P +  P  +     L+Q ++R A+F  +F      ++ +QF+   L+ F+  +Y +Y+  
Sbjct: 31  PKVAHPSGREGYGTLMQ-ILRGALFSFYFMTCCIIIHITQFIGAPLYFFNRDWYYAYMAM 89

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           T+R F +    + Q + P+   I+ D+S  G +K   +G  V+ + PERL+LIANHQIY 
Sbjct: 90  TKRSFCLTTTVMTQIWGPTTIRISGDESVAGQIKLRPDGG-VQFEFPERLVLIANHQIYT 148

Query: 149 DWLYVWCFTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSK 205
           DWLY+W   Y AN+   HG I IILK+SLK +P+ GWGM F+ +IF+ R  ATD+   + 
Sbjct: 149 DWLYLWWVGY-ANSPGMHGHIYIILKESLKMIPLIGWGMMFYGFIFMSRKMATDQPRLAY 207

Query: 206 TLSTLATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
            LS L   K         +P+WLL+FPEGT +S   R  S  +A K  L D +HV+LPRS
Sbjct: 208 RLSKLKQRKVDPNGKSYMDPMWLLLFPEGTNLSRNGRRKSAGWAAKNDLKDPDHVMLPRS 267

Query: 257 TGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYA 316
           TG+ FC   L  ++DYVYD T+  EG+ R  + EE++ L   YF+G+ P++++ H R++ 
Sbjct: 268 TGMFFCLNELKGTMDYVYDCTVAYEGIPRDGYGEELFGLSSTYFQGRPPKSVNFHWRRFR 327

Query: 317 ISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSV 367
           ++++P +D+ +F  WLR++W +KDALME++ T GRF     PR    K++ +
Sbjct: 328 MADIPLDDQKEFDLWLREQWYQKDALMEQYMTTGRF-----PRMAGSKVDYI 374



>gi|340905158|gb|EGS17526.1| acyltransferase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 416

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 205/329 (62%), Gaps = 16/329 (4%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G  +   LVQ ++R     V+F   +  ++ +Q +   L+  +   Y +Y+  T+R FG+
Sbjct: 34  GRRKHGTLVQ-IIRGVSVTVYFVVCATTIHATQLIGSPLYWINRDLYYAYMSLTKRSFGL 92

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  +  ++  +   I+ D S    ++++ +G  VE   PER+I+IANHQIY DWLY+W 
Sbjct: 93  LITTMTHWWGATTIRISGDASVADQIRKTEDGL-VEFSFPERIIMIANHQIYTDWLYLWW 151

Query: 156 FTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
             Y AN+   HG + IILK+SLK++PI G GM F+ +IF+ R  ATD+   +  L  L T
Sbjct: 152 VGY-ANSPKMHGFLYIILKESLKYIPIIGPGMMFYGFIFMSRKMATDQPRLAHRLGKLRT 210

Query: 213 SK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCA 263
                      +P+WLL+FPEGT  S   R  S ++A+K+G+ D EHVLLPRSTG ++C 
Sbjct: 211 PHATPDGRKYLDPMWLLLFPEGTNSSKNGRQKSARWAEKIGVKDPEHVLLPRSTGTYYCL 270

Query: 264 GSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-E 322
             L  +VDY+YD T+  EGV RG+F EEI+T+   Y  GQ P++++ + R++ I+++P  
Sbjct: 271 QELKGTVDYIYDCTVAYEGVPRGRFGEEIFTIGGTYLRGQPPKSVNFYWRRFRIADIPLA 330

Query: 323 DEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++++F  WLR+RW EKDALME++ T GRF
Sbjct: 331 NQEEFDMWLRERWYEKDALMEQYLTTGRF 359



>gi|440639588|gb|ELR09507.1| hypothetical protein GMDG_00689 [Geomyces destructans 20631-21]
          Length = 423

 Score =  256 bits (654), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 200/313 (63%), Gaps = 10/313 (3%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F+ +F   +  +  S+F+ + L+     +Y   I   +  FG  +  + ++++P+
Sbjct: 46  IRFVLFMTYFWSCACTIALSEFVGIPLYWIKREWYYKNIALAKEAFGTTITCMTKWWSPT 105

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAH--GA 165
              I+ D+S +G L+Q  +G ++E + PER++LIANHQ+Y+DW+Y+W   Y       G 
Sbjct: 106 VIRISGDESVRGQLRQLPDG-RLECNFPERIVLIANHQLYSDWIYLWWIGYANRPRMSGH 164

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATS------KEPLWL 219
           + IILK+++K++P+ G GM  F +IF+ R W+ DK   +  L  L T         P+WL
Sbjct: 165 VYIILKETIKYIPLLGQGMVLFNFIFMSRKWSKDKARMAYRLGKLKTPIPGTKLLRPMWL 224

Query: 220 LIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIG 279
           ++FPEGT +SD  RI S K+A K GL D +H +LPRSTG  FC   L  +VDYVYD T+ 
Sbjct: 225 MLFPEGTNLSDNGRINSAKWAAKQGLQDLQHQMLPRSTGSFFCLNELKGTVDYVYDCTLA 284

Query: 280 IEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEK 338
            EG+ RGQF ++ +TLR  YFEG+ P++++++ R++A+S++P +D ++F  W+R+ WIEK
Sbjct: 285 YEGIARGQFGQDYFTLRSSYFEGRPPKSVNMYWRRFALSDIPLDDAEEFDVWIRECWIEK 344

Query: 339 DALMEEFYTKGRF 351
           DA +EE+ + GRF
Sbjct: 345 DAFLEEYVSTGRF 357



>gi|452982156|gb|EME81915.1| hypothetical protein MYCFIDRAFT_46377 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 397

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 202/333 (60%), Gaps = 18/333 (5%)

Query: 35  LGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFG 94
           LGE +    +Q L+R   F ++F G     + +Q + + L+  +  ++ +     ++ F 
Sbjct: 6   LGEAKHGAAMQ-LLRIVGFGIYFFGSCFFAHGAQIMGVPLYFINKDWFYASQALAKQFFA 64

Query: 95  ILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW 154
           +++  + Q ++P+   I+ DKS  G L+Q  +G  +EL+  +R +++ANHQIY DWLY+W
Sbjct: 65  LIITTMTQLWSPTVVRISGDKSVAGQLRQDASGL-LELNFEDRAVIMANHQIYTDWLYLW 123

Query: 155 CFTYLANA--HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
              Y  +   HG I IILKDSLKW+P+ G  MQ + +IF+ R W+TD+      L  L T
Sbjct: 124 WIAYTNSQPMHGHIYIILKDSLKWVPLIGPAMQLYGFIFMARKWSTDQQRMRYRLQKLNT 183

Query: 213 SK-------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGL 259
                          +P+WLLIFPEGT +S  TR  S+K+A+K G  D +H +LPRSTGL
Sbjct: 184 RHSGPMSGQHGAAQLDPMWLLIFPEGTNLSANTRKQSQKFAEKSGQADLKHQVLPRSTGL 243

Query: 260 HFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISE 319
            FC   L  +VDYVYD TIG EGV    +  E++TLR +YF+G+ P+++++H R+Y + +
Sbjct: 244 QFCLQELRDTVDYVYDCTIGYEGVPPSGYASELFTLRSVYFQGRPPKSVNMHWRRYRVKD 303

Query: 320 MP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           MP +D+DKF EW+  RW EKD L+E F   GRF
Sbjct: 304 MPLDDKDKFHEWVLARWREKDELLETFIKTGRF 336



>gi|326481308|gb|EGE05318.1| acyltransferase [Trichophyton equinum CBS 127.97]
          Length = 411

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 201/341 (58%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP    ++  LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 24  EPADYGILVQLVRSFLIVAWFCCCCTCIVVAQVVGLPLYVIKKEYFNAWIALTKESFGLA 83

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  ++ + PERL+LIANHQ+Y DWLY+W  
Sbjct: 84  ITALTEWGAPTPVRISGDRSVLGQVTLTSNGG-IKTNFPERLVLIANHQVYTDWLYLWWV 142

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+  +  
Sbjct: 143 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSIKRGQ 202

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y +K G+   +H L PRSTGL+FC   L
Sbjct: 203 SSSGNPLFDPMWLLIFPEGTNLSLHTKQVSDAYGEKKGIPPLKHELHPRSTGLYFCLQQL 262

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             SV YVYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A +++P E ++
Sbjct: 263 RGSVQYVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFNDIPLESQE 322

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL +RW EKD L++ F   G+F  +E+   V M LNS
Sbjct: 323 EFEAWLFERWAEKDELLDTFIETGKFPPFENSDLVEMDLNS 363



>gi|302404914|ref|XP_003000294.1| lysocardiolipin acyltransferase [Verticillium albo-atrum VaMs.102]
 gi|261360951|gb|EEY23379.1| lysocardiolipin acyltransferase [Verticillium albo-atrum VaMs.102]
          Length = 327

 Score =  255 bits (652), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 177/276 (64%), Gaps = 15/276 (5%)

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           T++ F +L   + Q++ P+   I+ D S    ++Q  +G  VE D PERL+L+ANHQIY 
Sbjct: 4   TKQSFALLTTTMTQWWGPTKIRISGDASVAHQMRQQPDGM-VEFDFPERLVLVANHQIYT 62

Query: 149 DWLYVWCFTYLANA---HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSK 205
           DWLY+W   Y AN    HG I IILK+SLKW+P  GWGM F+ +IF+ R  ATD+   + 
Sbjct: 63  DWLYLWWIGY-ANTPRMHGHIYIILKESLKWIPFIGWGMMFYGFIFMSRKMATDQPRLAH 121

Query: 206 TLSTLATSKE---------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
            L  L   +          P+WLL+FPEGT ++   R  S  +A K GL D EHVLLPRS
Sbjct: 122 RLGQLKKRQRAPDGTSFLSPMWLLLFPEGTNLALNGRTKSAAWAKKTGLKDGEHVLLPRS 181

Query: 257 TGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYA 316
           TG++FC   L  +VDYVYD T+  EG+ RG+F ++ +TL   YF+G+ P++++ H R++ 
Sbjct: 182 TGMYFCLKELGDTVDYVYDCTVAYEGIPRGKFGQDYFTLSSTYFQGRPPKSVNFHWRRFK 241

Query: 317 ISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +SE+P ED + F  WLR RW EKDALME++ + GRF
Sbjct: 242 VSEIPLEDAEAFELWLRARWYEKDALMEQYLSTGRF 277



>gi|452840801|gb|EME42739.1| hypothetical protein DOTSEDRAFT_46184 [Dothistroma septosporum
           NZE10]
          Length = 676

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 185/290 (63%), Gaps = 2/290 (0%)

Query: 63  ALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLK 122
           A++ SQF+   L      +Y +Y+  T+  F +L+  I Q++AP+   ++ D S KG L 
Sbjct: 56  AISASQFIGAPLKLIDPKFYNAYMAWTKESFAVLMTTITQWWAPTVVRVSGDDSMKGQLF 115

Query: 123 QSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGW 182
              +G  ++ + P RL+L+ NHQ+Y DWLY+W   Y    HG I IILK+SLK LPI GW
Sbjct: 116 VMDDGT-LKCNFPHRLVLMGNHQLYTDWLYLWWTAYTNKMHGRIYIILKESLKNLPIIGW 174

Query: 183 GMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADK 242
           G QF+ +IFL R W  D+  F K L  L    +P+WLLIFPEGT +S  TR  S ++A+K
Sbjct: 175 GCQFYNFIFLSRKWEQDRYSFKKHLDHLKNPLDPMWLLIFPEGTNLSATTREKSARWAEK 234

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
            G+ D  H LLPRSTGL FC   L  + +++YD TI  EGV  G + ++I+TL+  + EG
Sbjct: 235 TGIPDMRHQLLPRSTGLQFCLKELRPTTNWLYDCTIAYEGVPAGMYGQDIFTLKSSFLEG 294

Query: 303 QYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + P++++++ R++ ISE+P ED+++F+ WL  RW EKD ++E +Y  G F
Sbjct: 295 RPPKSVNMYWRRFKISEIPYEDDEQFSRWLLNRWREKDYILEYYYKFGNF 344



>gi|302505485|ref|XP_003014449.1| hypothetical protein ARB_07011 [Arthroderma benhamiae CBS 112371]
 gi|291178270|gb|EFE34060.1| hypothetical protein ARB_07011 [Arthroderma benhamiae CBS 112371]
          Length = 411

 Score =  254 bits (650), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 200/341 (58%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP +  ++  LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 24  EPANYGILVQLVRSFLIVAWFCCCCTCIVVAQVVGLPLYVIKKEYFNAWIALTKESFGLA 83

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  +  + PERL+LIANHQ+Y DWLY+W  
Sbjct: 84  ITALTEWSAPTPVRISGDRSVLGQVTLTSNGG-IRTNFPERLVLIANHQVYTDWLYLWWV 142

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+  +  
Sbjct: 143 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSIKRGK 202

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y +K G+   +H L PRSTGL+FC   L
Sbjct: 203 SSSGKPKFDPMWLLIFPEGTNLSLHTKQVSDAYGEKKGIAPLKHELHPRSTGLYFCLQQL 262

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             SV+YVYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A  ++P E ++
Sbjct: 263 RGSVEYVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFDDIPLESQE 322

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL +RW EKD L++ F   G+F  +E+   V M  NS
Sbjct: 323 EFEAWLFERWAEKDELLDTFIETGKFPPFENSDLVEMDPNS 363



>gi|295660519|ref|XP_002790816.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281369|gb|EEH36935.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 1683

 Score =  254 bits (650), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/327 (39%), Positives = 197/327 (60%), Gaps = 17/327 (5%)

Query: 42  NLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAIN 101
           NL   ++R+ + + +F      +  +Q +   L+  +  Y+  Y+  T+R FGI + A+ 
Sbjct: 26  NLAIQILRSLILMTWFNCCCLCIIITQLIGAPLFFINRHYFNKYMAMTKRSFGIAITALT 85

Query: 102 QFFAPSNFVITVDKSAKGVLK-----QSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           ++  P+   ++ DKS +G         +  GAK++   P+R+++IANHQ+Y DWLY+W F
Sbjct: 86  EWGCPTPIRVSGDKSVQGQFGLTRGGSASGGAKLKTYFPDRIVMIANHQVYTDWLYLWWF 145

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE- 215
           +Y A  HG I IILK+SLK++P+ G GM F+ +IF+ R WA DK      L  L T  E 
Sbjct: 146 SYTAQMHGHIYIILKESLKYIPLIGQGMMFYGFIFMARKWAADKPRLQHRLEKLKTYHES 205

Query: 216 ----------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
                     P+WLLIFPEGT +S  T+  S  Y +K G+    H +LPRSTGL FC   
Sbjct: 206 CSRPGLRILDPMWLLIFPEGTNLSRNTKRISDGYGEKHGIPPLRHQILPRSTGLFFCLQQ 265

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +VD+VYD T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++ ISE+P +D+
Sbjct: 266 LKGTVDWVYDCTVGYEGPPKGSYPDAFFTIRSTYIQGRPPKVVNFYWRRFPISEIPLDDQ 325

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++F  W+ QRW EKD L+E+FY  GRF
Sbjct: 326 NEFEGWILQRWREKDDLLEQFYETGRF 352



>gi|449300088|gb|EMC96101.1| hypothetical protein BAUCODRAFT_34884 [Baudoinia compniacensis UAMH
           10762]
          Length = 682

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/285 (43%), Positives = 184/285 (64%), Gaps = 2/285 (0%)

Query: 63  ALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLK 122
           A++ SQF+   L       Y  Y+  T+  F +L+  I Q++AP+   ++ D S KG L 
Sbjct: 52  AISASQFIGAPLKLVDPKAYDGYMAWTKESFAVLMTTITQWWAPTVVRVSGDDSMKGQLF 111

Query: 123 QSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGW 182
           Q  +G  ++ + P R++L+ANHQ+Y DWLY+W   Y    HG I IILK+S+K LPIFGW
Sbjct: 112 QMDDGT-LKCNFPHRMVLMANHQLYTDWLYLWWIAYTNKMHGRIYIILKESMKQLPIFGW 170

Query: 183 GMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADK 242
           G QF+ +IFL R W TD+  F   LS L   ++P+WLLIFPEGT +S VTR  S  +A K
Sbjct: 171 GAQFYNFIFLSRKWETDRWRFKSALSHLKNPEDPMWLLIFPEGTNLSAVTREKSAAWAKK 230

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
            G+ D ++ LLPR+TGL F    L  S +++YD T+  EGV +G++ ++I+TLR  +FEG
Sbjct: 231 SGIPDMKNQLLPRTTGLQFILQELKHSTNWLYDCTVAYEGVPKGEYGQDIFTLRSSFFEG 290

Query: 303 QYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQRWIEKDALMEEFY 346
           + P+++++  R+Y IS++P D D+ F  WL  RW EKD ++E +Y
Sbjct: 291 RPPKSVNMFWRRYRISDIPLDNDQAFGRWLMNRWREKDYILEYYY 335



>gi|452841724|gb|EME43661.1| hypothetical protein DOTSEDRAFT_72876 [Dothistroma septosporum
           NZE10]
          Length = 430

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 209/364 (57%), Gaps = 18/364 (4%)

Query: 35  LGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFG 94
           LG P+    +Q L R   F ++F      ++ +Q L + L+  +  ++ +++  T++ FG
Sbjct: 33  LGAPKHGGGMQAL-RIVAFGLYFTISCLFMHGAQLLGIPLYWINRDWFYAWMAMTKQFFG 91

Query: 95  ILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW 154
           I +  +  +++P+   ++ DKS  G+LKQ  +G  V L+  +R +L+ANHQ+Y DWLY+W
Sbjct: 92  IFITTMTNWWSPTVVRVSGDKSVAGLLKQDASGM-VSLEFGDRAVLMANHQLYTDWLYLW 150

Query: 155 --CFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
              +T     HG + IILKDSLKW+P+ G  MQ F +IF+ R WA D+      L  L +
Sbjct: 151 WSAYTNTLPMHGHLYIILKDSLKWVPLIGPAMQLFGFIFMSRKWANDQERMRYRLQKLNS 210

Query: 213 SK-------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGL 259
                          +P+WL+IFPEGT +S  TR  S KYA K GL D +H +LPRSTGL
Sbjct: 211 RHSGPMSGQSGKAQLDPMWLMIFPEGTNLSRNTREQSAKYAAKAGLQDMKHQILPRSTGL 270

Query: 260 HFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISE 319
            FC   L  +V+Y+YD TI  EG+ +G +  E++TLR +YF+G+ P+++++H R+Y I +
Sbjct: 271 QFCLQELRDTVEYLYDCTIAYEGIPQGSYGSELFTLRSVYFQGRPPKSVNMHWRRYRIKD 330

Query: 320 MP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIV 378
           +P  D DK  +W+  RW EKD LM+ F   G+F   +S   +       F+   I   + 
Sbjct: 331 LPLNDHDKMYDWVMARWREKDELMDAFIKTGKFPADKSAVEIEGGPTDSFKTPYINTEVQ 390

Query: 379 PLVP 382
           P  P
Sbjct: 391 PRSP 394



>gi|389625317|ref|XP_003710312.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Magnaporthe
           oryzae 70-15]
 gi|351649841|gb|EHA57700.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Magnaporthe
           oryzae 70-15]
          Length = 432

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 200/320 (62%), Gaps = 17/320 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R   FV +FA     +  +Q +   L+ ++  +Y S++  T+  FGI +  + +++ P
Sbjct: 60  ILRRLAFVSYFAICVCTILMTQVIGAPLYWYNRDWYYSWMSMTKAHFGITITTMTKWWGP 119

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA---H 163
           +   I+ D S  G ++Q  +G  VE   PERL++IANHQ+Y DWLY+W   Y AN+   H
Sbjct: 120 TIIRISGDDSMDGQIRQKPDGT-VEFAFPERLVMIANHQLYTDWLYLWWVAY-ANSPQMH 177

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK--------- 214
           G I IILK+SLK++P+ G GM F+ +IF+ R  A DK   +  L  L TS          
Sbjct: 178 GWIYIILKESLKYIPVIGTGMMFYGFIFMSRKMAVDKPRLAHRLQKLKTSSADPSASAGR 237

Query: 215 --EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDY 272
              P+WLL+FPEGT  S   +I S K+A+K+G+ + +H+LLPRSTG+HF    L  +V+Y
Sbjct: 238 SLNPMWLLLFPEGTNASANGQIKSGKWAEKIGVKNPQHMLLPRSTGMHFILSELKGTVEY 297

Query: 273 VYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDE-DKFTEWL 331
           +YD T+  EG+ RG F E+ +TL   YFEG+ P++++ H R++ ++++P D  + F EW+
Sbjct: 298 LYDCTVAYEGIPRGDFGEQYFTLSSTYFEGRPPKSVNFHWRRFRVADIPLDTPEAFDEWM 357

Query: 332 RQRWIEKDALMEEFYTKGRF 351
           R+RW EKD LM+++ T GRF
Sbjct: 358 RERWYEKDDLMDKYLTNGRF 377



>gi|512206833|gb|EPE35652.1| Glycerol-3-phosphate (1)-acyltransferase [Glarea lozoyensis ATCC
           20868]
          Length = 417

 Score =  254 bits (648), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/318 (41%), Positives = 200/318 (62%), Gaps = 16/318 (5%)

Query: 52  VFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVI 111
           VF  FF   S  +  +QFL + L+  S  +Y +Y+  T+  FGI +  +  ++AP+   I
Sbjct: 52  VFYFFFTCLSIVI--TQFLGVPLYWISRDWYYAYMSLTKESFGIAVTTLTHWWAPTVVRI 109

Query: 112 TVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW--CFTYLANAHGAIKII 169
           + D S  G L Q+ +G +VE   P+RLI+IANHQIY DWLY+W   +T   + HG I II
Sbjct: 110 SGDASVAGELLQTGDG-RVECRFPDRLIMIANHQIYTDWLYLWWAAYTNQPHMHGHIYII 168

Query: 170 LKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL----------ATSKEPLWL 219
           LK SLK +PI GWGM+F+ +IF+ R   TD+   +  ++ L              +P+WL
Sbjct: 169 LKQSLKHIPIVGWGMRFYGFIFMSRKMETDRPRLAHRMNVLKQVHSGPMSGTPGLDPMWL 228

Query: 220 LIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIG 279
           L+FPEGT  +  T   S ++++K  + + E+ LLPR TGL+FC   L  +VD++YD TI 
Sbjct: 229 LLFPEGTNFTRNTAKISARFSEKANIPNVENALLPRGTGLYFCLKELEGTVDFIYDCTIA 288

Query: 280 IEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEK 338
            EGV++G F +E+YTLR IY +G+ P ++++H RK+AI+++P E++  F +WL+ +W EK
Sbjct: 289 YEGVKKGHFGDELYTLRSIYLQGRPPPSVNMHWRKFAIAKIPLENQVLFDKWLQDQWHEK 348

Query: 339 DALMEEFYTKGRFTGYES 356
           DAL+E +   GRF G E+
Sbjct: 349 DALLETYLNTGRFPGEEA 366



>gi|400598370|gb|EJP66087.1| acyltransferase-like protein [Beauveria bassiana ARSEF 2860]
          Length = 415

 Score =  253 bits (647), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 206/362 (56%), Gaps = 18/362 (4%)

Query: 40  SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVA 99
              +V   +R   F V+F      +  +Q +   L+  +   + +Y+  T+R F ++++ 
Sbjct: 41  GHGVVVKFLRGLAFAVYFWSCCFVIAITQLVGAPLYFVNKDMFYAYMAMTKRSFALVIIV 100

Query: 100 INQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYL 159
           + + +  +   ++ D+S  G +K   +G  V+ D PER+++IANHQIY DWLY+W   Y 
Sbjct: 101 MTRIWGRTTIRVSGDESVAGQIKTMPDGT-VQFDFPERMVMIANHQIYTDWLYLWWVGYA 159

Query: 160 ANA--HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK--- 214
                HG I IILKDSL+W+PI G GM FF +IF+ R  ATD+   +  L  L   K   
Sbjct: 160 NRVAMHGHIYIILKDSLRWIPIMGTGMMFFGFIFMSRKMATDRPRLAHRLQKLCQLKTAP 219

Query: 215 ------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHK 268
                 +P+WLL+FPEGT +S   R  S  +A K  L D EHV+LPRSTG  FC   L  
Sbjct: 220 NGNKYYDPMWLLLFPEGTNLSSNGRRKSSNWAAKNDLKDPEHVMLPRSTGTFFCLNELKG 279

Query: 269 SVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-F 327
           SV+YVYD T+  EG++RGQ+ EE +TL   YF G+ P++++ H R++ + ++P D+ K F
Sbjct: 280 SVEYVYDCTVAYEGIKRGQYGEEFFTLSGTYFAGRPPKSVNFHWRRFRLDDIPLDDPKEF 339

Query: 328 TEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWYFIVPLVPI 383
             WLR  W +KD LME +  +GRF       T      ++  S FE+ QI + +V ++ +
Sbjct: 340 EVWLRNEWYKKDELMEIYLKEGRFPSITDSTTPYVETEVRTRSPFEIFQI-FSVVGIIWL 398

Query: 384 MW 385
           MW
Sbjct: 399 MW 400



>gi|347839532|emb|CCD54104.1| hypothetical protein BofuT4_P128040.1 [Botryotinia fuckeliana T4]
          Length = 318

 Score =  253 bits (647), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 173/261 (66%), Gaps = 10/261 (3%)

Query: 100 INQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW--CFT 157
           + Q+++P+   I+ D S  G L+++ +G + E D PERLI+IANHQ+Y DWLY+W   +T
Sbjct: 1   MTQWWSPTVVRISGDASVAGQLRKTADG-RAECDFPERLIMIANHQLYTDWLYLWWVAYT 59

Query: 158 YLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL------A 211
                HG I II KDSLKW+PI GWGMQFF +IF+ R    D+   +     L      A
Sbjct: 60  NQPQTHGYIYIIAKDSLKWVPIIGWGMQFFNFIFMSRKMEKDRPVMAHRFKQLQEKRPGA 119

Query: 212 TSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD 271
           +  +P+WLL+FPEGT  SD  R  S K+A K+G+ D EH LLPRSTG  FC   L K+VD
Sbjct: 120 SELDPMWLLLFPEGTNASDNRREASAKWAAKIGVKDMEHTLLPRSTGSFFCLNELKKTVD 179

Query: 272 YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDE-DKFTEW 330
           YVYD T+  EGV RG+F ++ +TL   Y EG+ P++++L  R++ I+++P D  +KF  W
Sbjct: 180 YVYDCTMAYEGVPRGKFGQDYFTLTSSYIEGRPPKSVNLFWRRFKIADIPLDNAEKFEVW 239

Query: 331 LRQRWIEKDALMEEFYTKGRF 351
           LR+RW EKDALME++ T GRF
Sbjct: 240 LRERWYEKDALMEQYMTTGRF 260



>gi|327300899|ref|XP_003235142.1| acyltransferase [Trichophyton rubrum CBS 118892]
 gi|326462494|gb|EGD87947.1| acyltransferase [Trichophyton rubrum CBS 118892]
          Length = 419

 Score =  253 bits (646), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 200/341 (58%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP +  ++  LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 32  EPANYGILVQLVRSFLIVAWFCCCCTCIVVAQVVGLPLYVIKKEYFNTWIALTKESFGLA 91

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  ++ + PERL+LIANHQ+Y DWLY+W  
Sbjct: 92  ITALTEWSAPTPVRISGDRSVLGQVTLTSNGG-IKTNFPERLVLIANHQVYTDWLYLWWV 150

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+  +  
Sbjct: 151 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSIKRGQ 210

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y +K G+   +H L PRSTGL+FC   L
Sbjct: 211 SASGNPLFDPMWLLIFPEGTNLSLHTKQVSDAYGEKKGIPPLKHELHPRSTGLYFCLQQL 270

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             SV YVYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A  ++P E ++
Sbjct: 271 RGSVQYVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFDDIPLESQE 330

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL +RW EKD L++ F   G+F  +E+   V M  NS
Sbjct: 331 EFEAWLFERWAEKDELLDTFIETGKFPPFENSDLVEMDPNS 371



>gi|119498581|ref|XP_001266048.1| acyltransferase, putative [Neosartorya fischeri NRRL 181]
 gi|119414212|gb|EAW24151.1| acyltransferase, putative [Neosartorya fischeri NRRL 181]
          Length = 418

 Score =  253 bits (646), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 196/316 (62%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L+R+ +   +F      +  +Q +   L+  +  YY SY+  T++ FG+++ A+ Q+  P
Sbjct: 42  LLRSLLLATWFNCCCIIIFATQLIGSPLYFINKDYYYSYMALTKQSFGLVITALTQWGCP 101

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S +G +    +G +++ + PERL+LIANHQ+Y DW+Y W   Y    HG I
Sbjct: 102 TYVRVSGDESVRGQIHLCKDG-RLKTEFPERLVLIANHQVYTDWIYFWWIAYTNQMHGRI 160

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T +          +P
Sbjct: 161 FIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQRSGSKSESPQYDP 220

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S +Y  K GL   +H LLPRSTGL FC   L  +VD+VYD 
Sbjct: 221 MWLLIFPEGTNLSPNTKRRSDEYGRKQGLPPLKHELLPRSTGLLFCLQQLKGTVDWVYDC 280

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+  EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P +D+ +F  WLR RW
Sbjct: 281 TVAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAMSDIPLDDQKEFDNWLRARW 340

Query: 336 IEKDALMEEFYTKGRF 351
            EKD L++EF+  GRF
Sbjct: 341 TEKDELLDEFFETGRF 356



>gi|440470863|gb|ELQ39905.1| lysocardiolipin acyltransferase [Magnaporthe oryzae Y34]
 gi|440486868|gb|ELQ66695.1| lysocardiolipin acyltransferase [Magnaporthe oryzae P131]
          Length = 441

 Score =  253 bits (646), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 200/320 (62%), Gaps = 17/320 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R   FV +FA     +  +Q +   L+ ++  +Y S++  T+  FGI +  + +++ P
Sbjct: 60  ILRRLAFVSYFAICVCTILMTQVIGAPLYWYNRDWYYSWMSMTKAHFGITITTMTKWWGP 119

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA---H 163
           +   I+ D S  G ++Q  +G  VE   PERL++IANHQ+Y DWLY+W   Y AN+   H
Sbjct: 120 TIIRISGDDSMDGQIRQKPDGT-VEFAFPERLVMIANHQLYTDWLYLWWVAY-ANSPQMH 177

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK--------- 214
           G I IILK+SLK++P+ G GM F+ +IF+ R  A DK   +  L  L TS          
Sbjct: 178 GWIYIILKESLKYIPVIGTGMMFYGFIFMSRKMAVDKPRLAHRLQKLKTSSADPSASAGR 237

Query: 215 --EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDY 272
              P+WLL+FPEGT  S   +I S K+A+K+G+ + +H+LLPRSTG+HF    L  +V+Y
Sbjct: 238 SLNPMWLLLFPEGTNASANGQIKSGKWAEKIGVKNPQHMLLPRSTGMHFILSELKGTVEY 297

Query: 273 VYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED-EDKFTEWL 331
           +YD T+  EG+ RG F E+ +TL   YFEG+ P++++ H R++ ++++P D  + F EW+
Sbjct: 298 LYDCTVAYEGIPRGDFGEQYFTLSSTYFEGRPPKSVNFHWRRFRVADIPLDTPEAFDEWM 357

Query: 332 RQRWIEKDALMEEFYTKGRF 351
           R+RW EKD LM+++ T GRF
Sbjct: 358 RERWYEKDDLMDKYLTNGRF 377



>gi|511010645|gb|EPB91865.1| hypothetical protein HMPREF1544_01374 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 326

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 189/308 (61%), Gaps = 24/308 (7%)

Query: 102 QFFAPSNFVITVDKSA-------------KGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           + FAP   +IT D S              + +L ++  G    +  PERLI+I+NHQIYA
Sbjct: 2   RLFAPGELIITFDDSITNDMDDDNNNEALEELLTRNMKGQVTGISFPERLIMISNHQIYA 61

Query: 149 DWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLS 208
           DW+YVW   YL  AHGA+KI+LK SL  +PI+G GM+FF++IFLKR    DK      L 
Sbjct: 62  DWIYVWFLAYLGKAHGALKIMLKHSLSQVPIYGMGMKFFEFIFLKRKLEHDKDNIVNNLE 121

Query: 209 TLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHK 268
                  PLWL++FPEGTV+SD TR  SK++A K+ + D++  LLPR+TGL  C  +L  
Sbjct: 122 IAKKRGRPLWLVLFPEGTVISDNTRQKSKEFAAKLHMDDYKFTLLPRTTGLMLCKETLGD 181

Query: 269 SVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKFT 328
           SV+++YDLT+G  G+  GQ PE++ T+++I+ EG  P  IH+H+R+Y ++++P D + FT
Sbjct: 182 SVEWLYDLTVGYPGIEPGQNPEDVMTMKRIFCEGNGPHEIHIHMRRYRLADLPTDTESFT 241

Query: 329 EWLRQRWIEKDALMEEFYTKGRF---TGYESPR-------TVPMKL-NSVFELTQIWYFI 377
            WL  RW EKD  +  F   G+F   + +++ R        +P++L N++ E    W ++
Sbjct: 242 HWLLDRWTEKDKRLVYFNEHGKFPEESDFDNERIYNGRTVKIPIQLQNTLRECYGYWLYL 301

Query: 378 VPLVPIMW 385
           +  +PI++
Sbjct: 302 LIYIPIIY 309



>gi|46110379|ref|XP_382247.1| hypothetical protein FG02071.1 [Fusarium graminearum PH-1]
          Length = 420

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 213/357 (59%), Gaps = 20/357 (5%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR + F ++F      +  +Q + L L+  +  +Y +Y+  T+  FG+ +  + Q + P
Sbjct: 53  IVRGSCFALYFNTCIVIIFLTQLIGLPLYFVNRDWYYAYVAMTKGFFGLTITLMTQIWGP 112

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA---H 163
           +   ++ D+S  G +K   +G  V+ + PERL+LIANHQIY DWLY+W   Y AN+   H
Sbjct: 113 TTIRVSGDESVAGQIKLRSDGG-VQFEFPERLVLIANHQIYTDWLYLWWIAY-ANSPSMH 170

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK--------- 214
           G I IILK+SL+ +PI G GMQ + +IF+ R  A+D+   +  L+ L   K         
Sbjct: 171 GHIYIILKESLRRIPIVGLGMQIYGFIFMSRKMASDQPRMAYRLNKLKQPKVDPNGKSYM 230

Query: 215 EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVY 274
            P+WLL+FPEGT +S+  R  S  +A K+ L D EHVLLPRSTG+ FC   L  S+DYVY
Sbjct: 231 NPMWLLLFPEGTNLSNNGRRKSAGWAAKMDLKDPEHVLLPRSTGMFFCLNELKGSLDYVY 290

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQ 333
           D T+  EG+ RG F E+ + L   YF+G+ P++++ H R++ +S++P D+ K F  WLR+
Sbjct: 291 DCTVAYEGIPRGGFGEQYFGLVSTYFQGRPPKSVNFHWRRFRLSDIPLDDQKAFDLWLRE 350

Query: 334 RWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWYFIVPLVPIMWY 386
            W +K+ALMEE+ T GRF   E  +       +K    +E+ Q+ + +V    ++W+
Sbjct: 351 EWYKKNALMEEYMTTGRFPRMEGGKVDYIETEVKTRQPWEILQL-FTVVGTAALIWH 406



>gi|119182397|ref|XP_001242333.1| hypothetical protein CIMG_06229 [Coccidioides immitis RS]
 gi|392865228|gb|EAS31006.2| acyltransferase [Coccidioides immitis RS]
          Length = 422

 Score =  252 bits (643), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 191/324 (58%), Gaps = 12/324 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR+ + V +F     ++  +Q + L L+  +  ++ SY+  T+R FGI + A+ Q+ +P
Sbjct: 45  IVRSLLIVTWFNCCCISIVATQAIGLPLYLVNKRWFYSYMAMTKRFFGITITALTQWSSP 104

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   I+ D S +G      N   V    PERL+LIANHQ+Y DWLY+W  +Y +N HG I
Sbjct: 105 TPVRISGDSSMQGQFSLR-NDGTVVTKFPERLVLIANHQVYTDWLYLWWVSYTSNMHGYI 163

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P  G GM  + +IF+ R W  DK      L  L TS           +P
Sbjct: 164 YIILKESLKYIPFIGQGMMLYGFIFMARKWIEDKPRLQHRLQKLKTSHGKSPDGLPVFDP 223

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLI+PEGT +S  T+  S  Y +K G+   +H LLPRSTGL FC   L  +VDYVYD 
Sbjct: 224 MWLLIYPEGTNLSRNTKRRSDAYCEKQGIAPRKHTLLPRSTGLFFCLQKLRGTVDYVYDC 283

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G + E  +TLR  Y  G+ P+ ++ + R++AI ++P  D+ +F +W+ +RW
Sbjct: 284 TVGYEGPPKGSYAESYFTLRSTYLRGRPPKAVNFYWRRFAILDIPLNDQKEFEDWIYKRW 343

Query: 336 IEKDALMEEFYTKGRFTGYESPRT 359
            EKD L+E F   GRF  +E   T
Sbjct: 344 GEKDQLLERFAETGRFPPFEPETT 367



>gi|346327490|gb|EGX97086.1| acyltransferase, putative [Cordyceps militaris CM01]
          Length = 414

 Score =  252 bits (643), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 208/354 (58%), Gaps = 18/354 (5%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           VR   F V+F   +  +  +Q +   L+  +   + +++  T++ F +++  + + +  +
Sbjct: 48  VRGLAFAVYFWSCTLVIGVTQLIGAPLYFVNRDMFYAWMAMTKQQFALVITVMTRIWGRT 107

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA--HGA 165
              ++ D+S  G +K   +G  V+ D PER++LIANHQIY DWLY+W   Y      HG 
Sbjct: 108 IIRVSGDESVAGQIKTMSDGT-VQFDFPERMVLIANHQIYTDWLYLWWVGYANRVAMHGH 166

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------EP 216
           I IILKDSL+W+PI G GM FF +IF+ R  ATD+   +  L  L   K         +P
Sbjct: 167 IYIILKDSLRWIPIMGTGMMFFGFIFMSRKMATDRPRIAHRLQKLRELKTDPNGKSYYDP 226

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLL+FPEGT +S   R  S  +A K  L D EHV+LPRSTG  FC   L  SV+YVYD 
Sbjct: 227 MWLLLFPEGTNLSSNGRRKSSSWAAKNDLKDPEHVMLPRSTGTFFCLNELKGSVEYVYDC 286

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQRW 335
           T+  EG++RG++ EE +TL   YF G+ P++++ H R++ ++++P D+ K F EWLR  W
Sbjct: 287 TVAYEGIKRGEYGEEFFTLSGTYFAGRPPKSVNFHWRRFRLADIPLDDPKEFEEWLRNEW 346

Query: 336 IEKDALMEEFYTKGRF---TGYESPRT-VPMKLNSVFELTQIWYFIVPLVPIMW 385
            +KD L+E +  +GRF    G  +P     +K  S FE+ QI + ++ +V +MW
Sbjct: 347 YKKDELIEVYLKEGRFPPLPGSSTPYVETEVKTKSPFEILQI-FAVLGIVALMW 399



>gi|326468699|gb|EGD92708.1| acyltransferase [Trichophyton tonsurans CBS 112818]
          Length = 419

 Score =  252 bits (643), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 200/341 (58%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP    ++  LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 32  EPADYGILVQLVRSFLIVAWFCCCCTCIVVAQVVGLPLYVIKKEYFNAWIALTKESFGLA 91

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  ++ + PERL+LIANHQ+Y DWLY+W  
Sbjct: 92  ITALTEWGAPTPVRISGDRSVLGQVTLTSNGG-IKTNFPERLVLIANHQVYTDWLYLWWV 150

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+  +  
Sbjct: 151 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSIKRGQ 210

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y +K G+   +H L PRSTGL+FC   L
Sbjct: 211 SSSGNPLFDPMWLLIFPEGTNLSLHTKQVSDAYGEKKGIPPLKHELHPRSTGLYFCLQQL 270

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             SV YVYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A +++P E ++
Sbjct: 271 RGSVQYVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFNDIPLESQE 330

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL + W EKD L++ F   G+F  +E+   V M LNS
Sbjct: 331 EFEAWLFELWAEKDELLDTFIETGKFPPFENSDLVEMDLNS 371



>gi|320041023|gb|EFW22956.1| acyltransferase [Coccidioides posadasii str. Silveira]
          Length = 422

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 191/324 (58%), Gaps = 12/324 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR+ + V +F     ++  +Q + L L+  +  ++ SY+  T+R FGI + A+ Q+ +P
Sbjct: 45  IVRSLLIVTWFNCCCISIVATQAIGLPLYLVNERWFYSYMAMTKRFFGITITALTQWSSP 104

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   I+ D S +G      N   V    PERL+LIANHQ+Y DWLY+W  +Y +N HG I
Sbjct: 105 TPVRISGDSSMQGQFSL-LNDGTVVTKFPERLVLIANHQVYTDWLYLWWVSYTSNMHGYI 163

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P  G GM  + +IF+ R W  DK      L  L TS           +P
Sbjct: 164 YIILKESLKYIPFIGQGMMLYGFIFMARKWIEDKPRLQHRLQKLKTSHGKSPDGLPVFDP 223

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLI+PEGT +S  T+  S  Y +K G+   +H LLPRSTGL FC   L  +VDYVYD 
Sbjct: 224 MWLLIYPEGTNLSRNTKRRSDAYCEKQGIAPRKHTLLPRSTGLFFCLQKLRGTVDYVYDC 283

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G + E  +TLR  Y  G+ P+ ++ + R++AI ++P  D+ +F +W+ +RW
Sbjct: 284 TVGYEGPPKGSYAESYFTLRSTYLRGRPPKAVNFYWRRFAILDIPLNDQKEFEDWIYKRW 343

Query: 336 IEKDALMEEFYTKGRFTGYESPRT 359
            EKD L+E F   GRF  +E   T
Sbjct: 344 GEKDQLLERFAETGRFPPFEPGTT 367



>gi|303319149|ref|XP_003069574.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240109260|gb|EER27429.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 422

 Score =  251 bits (641), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 191/324 (58%), Gaps = 12/324 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR+ + V +F     ++  +Q + L L+  +  ++ SY+  T+R FGI + A+ Q+ +P
Sbjct: 45  IVRSLLIVTWFNCCCISIVATQAIGLPLYLVNKRWFYSYMAMTKRFFGITITALTQWSSP 104

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   I+ D S +G      N   V    PERL+LIANHQ+Y DWLY+W  +Y +N HG I
Sbjct: 105 TPVRISGDSSMQGQFSL-LNDGTVVTKFPERLVLIANHQVYTDWLYLWWVSYTSNMHGYI 163

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P  G GM  + +IF+ R W  DK      L  L TS           +P
Sbjct: 164 YIILKESLKYIPFIGQGMMLYGFIFMARKWIEDKPRLQHRLQKLKTSHGKSPDGLPVFDP 223

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLI+PEGT +S  T+  S  Y +K G+   +H LLPRSTGL FC   L  +VDYVYD 
Sbjct: 224 MWLLIYPEGTNLSRNTKRRSDAYCEKQGIAPRKHTLLPRSTGLFFCLQKLRGTVDYVYDC 283

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G + E  +TLR  Y  G+ P+ ++ + R++AI ++P  D+ +F +W+ +RW
Sbjct: 284 TVGYEGPPKGSYAESYFTLRSTYLRGRPPKAVNFYWRRFAILDIPLNDQKEFEDWIYKRW 343

Query: 336 IEKDALMEEFYTKGRFTGYESPRT 359
            EKD L+E F   GRF  +E   T
Sbjct: 344 GEKDQLLERFAETGRFPPFEPGTT 367



>gi|261189492|ref|XP_002621157.1| acyltransferase [Ajellomyces dermatitidis SLH14081]
 gi|239591734|gb|EEQ74315.1| acyltransferase [Ajellomyces dermatitidis SLH14081]
          Length = 408

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 191/320 (59%), Gaps = 12/320 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+   + +F      +  +Q +   L+     Y+ SY+  T+R FGI + A+ ++  P
Sbjct: 26  ILRSLALLTWFNCCCVCIVATQLVGAPLYFIHRQYFNSYMAMTKRSFGIAITALTEWGCP 85

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DKS +G    + +G  VE   PER++LIANHQ+Y DWLY+W F+Y +  HG I
Sbjct: 86  TPIRVSGDKSVQGQFSLTKDG-NVETSFPERMVLIANHQVYTDWLYLWWFSYTSQMHGHI 144

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE----------P 216
            IILK+SLK++P+ G GM F+ +IF+ R W +DK      L  L T  E          P
Sbjct: 145 YIILKESLKYIPLIGQGMMFYGFIFMARKWISDKPRLQHRLEKLKTVHEEGRSGSRVLDP 204

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+    H +LPRSTGL FC   L  ++ +VYD 
Sbjct: 205 MWLLIFPEGTNLSRNTKRISDAYGAKQGIPPLRHQILPRSTGLFFCLQQLKGTIYWVYDC 264

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++A++ +P +D+ +F  W+ +RW
Sbjct: 265 TVGYEGPPKGSYPDAYFTIRSTYLKGRPPKVVNFYWRRFAVAAIPLDDQKEFEAWIHERW 324

Query: 336 IEKDALMEEFYTKGRFTGYE 355
           +EKD L+E FY  GRF   E
Sbjct: 325 LEKDDLLERFYETGRFPPCE 344



>gi|391863394|gb|EIT72705.1| lysophosphatidic acid acyltransferase LPAAT [Aspergillus oryzae
           3.042]
          Length = 420

 Score =  251 bits (640), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 194/314 (61%), Gaps = 12/314 (3%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R+ +   +F      +  +Q L   L+  S  YY +Y+ +T++ FG+++ A+ Q+  P+ 
Sbjct: 48  RSLLLATWFNCCCVVILVTQVLGAPLYLISKDYYYAYMAYTKQSFGLVITALTQWGCPTF 107

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKI 168
             ++ DKS +G +  + +G +++ + PERL+LIANHQ+Y DW+Y+W   Y    HG I I
Sbjct: 108 VRVSGDKSVQGQIHLTEDG-RLKTEFPERLVLIANHQVYTDWIYLWWVAYTNIMHGRIFI 166

Query: 169 ILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPLW 218
           ILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P+W
Sbjct: 167 ILKESLKYIPIVGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTRHSGSKSESSEYDPMW 226

Query: 219 LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTI 278
           LLIFPEGT +S  T+  S +Y  K G    +H +LPRSTGL FC   L  +VD+VYD T+
Sbjct: 227 LLIFPEGTNLSINTKRRSDEYGQKQGFPPLKHEVLPRSTGLFFCLQQLRGTVDWVYDCTV 286

Query: 279 GIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIE 337
             EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P  D+ +F  WLR RW E
Sbjct: 287 AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAVSDIPLNDQKEFDAWLRARWTE 346

Query: 338 KDALMEEFYTKGRF 351
           KD L++E++  GRF
Sbjct: 347 KDQLLDEYFETGRF 360



>gi|358057868|dbj|GAA96113.1| hypothetical protein E5Q_02774 [Mixia osmundae IAM 14324]
          Length = 425

 Score =  250 bits (639), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 144/381 (37%), Positives = 207/381 (54%), Gaps = 37/381 (9%)

Query: 48  VRTAVFVVFFAGQSAALNFS-QFLSLLLWPFS---HSYYQSYIKHTQRCFGILLVAINQF 103
            R  +F  FFA     L+   Q L    W F    H +++S I HT+  F  LL+ I+Q 
Sbjct: 43  ARFLLFNGFFASTLILLHVGFQILPSPFWFFGSTQHIFWRS-ILHTKTMFAQLLIYISQT 101

Query: 104 FAPSNFVITV---DKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLA 160
           F P+  ++T    D     ++K+   G  + L +PER I++ANHQ+Y DW Y+W   Y A
Sbjct: 102 FGPTKIILTSEGKDLDLSAIVKRDAKGKVIHLTLPERSIILANHQVYCDWSYIWNLLYFA 161

Query: 161 NAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT----SKEP 216
             H AI IILK SLKW+PI G  MQ FQ+IFL R+W  D+    + +  +A     S EP
Sbjct: 162 ELHNAIVIILKKSLKWIPIVGPAMQMFQFIFLSRSWDADQSVLKRQIGKMAAKAQESSEP 221

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YVY 274
           L LLIFPEG +VS ++R  SKKYADK G+ D +H +LPRSTGL FC  +L K V    V 
Sbjct: 222 LSLLIFPEGNLVSQLSRPISKKYADKSGIADMKHQILPRSTGLLFCLRALAKEVPSLSVI 281

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEM-------------P 321
           D+TIG EG+  G + ++ Y+L+ I+  GQ P  +H+H+R +  SE+             P
Sbjct: 282 DITIGYEGIPEGDYGQDYYSLQSIFGAGQSPPAVHMHVRTFKASELPLGHDLTEADHATP 341

Query: 322 EDEDKFTEWLRQRWIEKDALMEEFYTKGRF----------TGYESPRTVPMKLNSVFELT 371
           E+   F +W+R RW EKD L+  FY KG F          T    P ++P++  +  +  
Sbjct: 342 EERKIFDDWVRSRWQEKDHLLGRFYAKGSFIEGKRGVSKVTEAYGPISIPIEAKTSKDTN 401

Query: 372 QIWYFIVPLVPIMWYFSNYLL 392
            +    +P   ++   + YL+
Sbjct: 402 ILLGSCIPGAIMIAALTKYLI 422



>gi|296808941|ref|XP_002844809.1| tetratricopeptide repeat protein 1 [Arthroderma otae CBS 113480]
 gi|238844292|gb|EEQ33954.1| tetratricopeptide repeat protein 1 [Arthroderma otae CBS 113480]
          Length = 1628

 Score =  250 bits (638), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 202/344 (58%), Gaps = 15/344 (4%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP +  ++  L+R+ + V +F+     +  +Q + L L+     Y+ +Y+  T+  FG+ 
Sbjct: 32  EPPNYGILAQLIRSFLIVAWFSCCCVCIVVAQVVGLPLYLVKREYFNAYVATTKESFGLA 91

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  ++   P+RL+LIANHQ+Y DWLY+W  
Sbjct: 92  ITALTEWSAPTPVRISGDRSVLGQVTLTSNGG-IQTRFPDRLVLIANHQVYTDWLYLWWV 150

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      L +L   +  
Sbjct: 151 TYTNQMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLKSLCVRRGD 210

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y  K  +   +H LLPRSTGL+FC   L
Sbjct: 211 STPGSPVFDPMWLLIFPEGTNLSIHTKEVSDNYGRKNAIPPFKHELLPRSTGLYFCLQQL 270

Query: 267 HKSVDYVYDLTIGIEG---VRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED 323
             +VDYVYD T+G EG    R+G +P+  +T+R  Y + + PR ++ + R++A++++P D
Sbjct: 271 KGTVDYVYDCTMGYEGPPSCRKGSYPDSYFTIRSTYLKCRPPRVVNFYWRRFALADIPLD 330

Query: 324 -EDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
            ++ F  WL +RW EKDAL++ F   G+F  +E    V M  NS
Sbjct: 331 KQEDFEAWLFERWAEKDALLDAFIETGKFPPFEDADLVEMDPNS 374



>gi|302655459|ref|XP_003019517.1| hypothetical protein TRV_06454 [Trichophyton verrucosum HKI 0517]
 gi|291183247|gb|EFE38872.1| hypothetical protein TRV_06454 [Trichophyton verrucosum HKI 0517]
          Length = 411

 Score =  250 bits (638), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/341 (37%), Positives = 199/341 (58%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP +  ++  LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 24  EPANYGILVQLVRSFLIVAWFCCCCTCIVVAQVVGLPLYVIKKEYFNAWIALTKESFGLA 83

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  +  + PERL+LIANHQ+Y DWLY+W  
Sbjct: 84  ITALTEWSAPTPVRISGDRSVLGQVTLTSNGG-IRTNFPERLVLIANHQVYTDWLYLWWV 142

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+     
Sbjct: 143 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSIKHGK 202

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y +K  +   +H L PRSTGL+FC   L
Sbjct: 203 TSSGKPKFDPMWLLIFPEGTNLSLHTKQVSDAYGEKKDIPPLKHELHPRSTGLYFCLQQL 262

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             SV+YVYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A  ++P E+++
Sbjct: 263 RGSVEYVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFDDIPLENQE 322

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL +RW EKD L++ F   G+F  +E+   V M  NS
Sbjct: 323 EFEAWLFERWAEKDELLDTFIETGKFPPFENSDLVEMDPNS 363



>gi|317138718|ref|XP_001817095.2| acyltransferase [Aspergillus oryzae RIB40]
          Length = 413

 Score =  249 bits (637), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/314 (38%), Positives = 194/314 (61%), Gaps = 12/314 (3%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R+ +   +F      +  +Q L   L+  S  YY +Y+ +T++ FG+++ A+ Q+  P+ 
Sbjct: 48  RSLLLATWFNCCCVVILVTQVLGAPLYLISKDYYYAYMAYTKQSFGLVITALTQWGCPTF 107

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKI 168
             ++ DKS +G +  + +G +++ + PERL+LIANHQ+Y DW+Y+W   Y    HG I I
Sbjct: 108 VRVSGDKSVQGQIHLTEDG-RLKTEFPERLVLIANHQVYTDWIYLWWVAYTNIMHGRIFI 166

Query: 169 ILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPLW 218
           ILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P+W
Sbjct: 167 ILKESLKYIPIVGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTRHSGSKSESSEYDPMW 226

Query: 219 LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTI 278
           LLIFPEGT +S  T+  S +Y  K G    +H +LPRSTGL FC   +  +VD+VYD T+
Sbjct: 227 LLIFPEGTNLSINTKRRSDEYGQKQGFPPLKHEVLPRSTGLFFCLQHMRGTVDWVYDCTV 286

Query: 279 GIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIE 337
             EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P  D+ +F  WLR RW E
Sbjct: 287 AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAVSDIPLNDQKEFDAWLRARWTE 346

Query: 338 KDALMEEFYTKGRF 351
           KD L++E++  GRF
Sbjct: 347 KDQLLDEYFETGRF 360



>gi|83764949|dbj|BAE55093.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 420

 Score =  249 bits (637), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/314 (38%), Positives = 194/314 (61%), Gaps = 12/314 (3%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R+ +   +F      +  +Q L   L+  S  YY +Y+ +T++ FG+++ A+ Q+  P+ 
Sbjct: 48  RSLLLATWFNCCCVVILVTQVLGAPLYLISKDYYYAYMAYTKQSFGLVITALTQWGCPTF 107

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKI 168
             ++ DKS +G +  + +G +++ + PERL+LIANHQ+Y DW+Y+W   Y    HG I I
Sbjct: 108 VRVSGDKSVQGQIHLTEDG-RLKTEFPERLVLIANHQVYTDWIYLWWVAYTNIMHGRIFI 166

Query: 169 ILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPLW 218
           ILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P+W
Sbjct: 167 ILKESLKYIPIVGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTRHSGSKSESSEYDPMW 226

Query: 219 LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTI 278
           LLIFPEGT +S  T+  S +Y  K G    +H +LPRSTGL FC   +  +VD+VYD T+
Sbjct: 227 LLIFPEGTNLSINTKRRSDEYGQKQGFPPLKHEVLPRSTGLFFCLQHMRGTVDWVYDCTV 286

Query: 279 GIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIE 337
             EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P  D+ +F  WLR RW E
Sbjct: 287 AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAVSDIPLNDQKEFDAWLRARWTE 346

Query: 338 KDALMEEFYTKGRF 351
           KD L++E++  GRF
Sbjct: 347 KDQLLDEYFETGRF 360



>gi|70998644|ref|XP_754044.1| acyltransferase [Aspergillus fumigatus Af293]
 gi|66851680|gb|EAL92006.1| acyltransferase, putative [Aspergillus fumigatus Af293]
 gi|159126222|gb|EDP51338.1| acyltransferase, putative [Aspergillus fumigatus A1163]
          Length = 418

 Score =  249 bits (637), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 195/316 (61%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L+R+ +   +F      +  +Q +   L+  +  YY SY+  T++ FG+++ A+ ++  P
Sbjct: 42  LLRSLLLATWFNCCCIIIFTTQLIGSPLYFINKDYYYSYMALTKQSFGLVITALTEWGCP 101

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S +G +    +G +++   PERL+LIANHQ+Y DW+Y+W   Y    HG I
Sbjct: 102 TYVRVSGDESVRGQIHLCKDG-RLKTQFPERLVLIANHQVYTDWIYLWWIAYTNQMHGRI 160

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P
Sbjct: 161 FIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQTSGSESESPQYDP 220

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S +Y  K GL   +H LLPRSTGL FC   L  +VD+VYD 
Sbjct: 221 MWLLIFPEGTNLSPNTKRRSDEYGRKQGLPPLKHELLPRSTGLLFCLQQLKGTVDWVYDC 280

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           ++  EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P +D+ +F  WLR RW
Sbjct: 281 SVAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAMSDIPLDDQKEFDSWLRARW 340

Query: 336 IEKDALMEEFYTKGRF 351
            EKD L++EF+  GRF
Sbjct: 341 TEKDELLDEFFETGRF 356



>gi|115438446|ref|XP_001218068.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114188883|gb|EAU30583.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 1635

 Score =  249 bits (636), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 129/349 (36%), Positives = 209/349 (59%), Gaps = 22/349 (6%)

Query: 37  EPQ-SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           EP+    +   L+R+ +   +F      +  +Q +   L+  + SYY +Y+ +T++ FG+
Sbjct: 32  EPRLKHGIAMQLLRSLILATWFNCCCVIILATQLVGSPLYFVNKSYYYNYMAYTKQSFGL 91

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           ++ A+ Q+  P+   ++ DKS +G +  S +G +++   PERL++IANHQ+Y DW+Y+W 
Sbjct: 92  VITALTQWGCPTYVRVSGDKSVRGQVHLSKDG-RLKTQFPERLVMIANHQVYTDWIYLWW 150

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT--- 212
             Y  + HG I IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T   
Sbjct: 151 VAYTNSMHGRIFIILKESLKYIPIIGQGMMFYGFIFMARKWLSDKPRLQHRLEKLKTRLS 210

Query: 213 -SK------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
            SK      +P+WLLIFPEGT +S  T+  S +Y  K G    +H +LPRSTGL FC   
Sbjct: 211 GSKSGSPEYDPMWLLIFPEGTNLSINTKRRSDEYGTKQGFPPLKHEILPRSTGLFFCLQQ 270

Query: 266 LHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDE 324
           L  +VD+VYD T+  EG  +G +P++ +TLR  Y +G+ P +++++ R++A++++P +D+
Sbjct: 271 LKGTVDWVYDCTVAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFAVADIPLDDQ 330

Query: 325 DKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
             F  WLR RW EKD L++E++  GRF         P +L    E  ++
Sbjct: 331 KDFDAWLRARWTEKDQLLDEYFETGRF---------PTELTGTIETGEV 370



>gi|121712618|ref|XP_001273920.1| acyltransferase, putative [Aspergillus clavatus NRRL 1]
 gi|119402073|gb|EAW12494.1| acyltransferase, putative [Aspergillus clavatus NRRL 1]
          Length = 419

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 197/316 (62%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L+R+ +   +F      +  +Q +   L+  +  YY SY+  T++ FG+++ A+ Q+  P
Sbjct: 43  LLRSLLLATWFNCCCIIILATQLIGSPLYFINKDYYYSYMALTKQSFGLVITALTQWGCP 102

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S +G +  S +G +++   PERL+L+ANHQ+Y DW+Y+W   Y    HG I
Sbjct: 103 TYVRVSGDESVRGQIHLSKDG-RLKTQFPERLVLVANHQVYTDWIYLWWVAYTNTMHGRI 161

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT----------SKEP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P
Sbjct: 162 FIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTKLSGSNSGTSEYDP 221

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S ++  K GL   +H +LPRSTGL FC   L  +VD+VYD 
Sbjct: 222 MWLLIFPEGTNLSLNTKRRSDEFGAKQGLPALKHEILPRSTGLLFCLQQLKGTVDWVYDC 281

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+  EG  +G +P++ +TLR  Y +G+ P +++++ R++A+S++P +D+++F  WLR RW
Sbjct: 282 TVAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMYWRRFALSDIPLDDQNEFDAWLRARW 341

Query: 336 IEKDALMEEFYTKGRF 351
            EKD L++E++  GRF
Sbjct: 342 TEKDVLLDEYFETGRF 357



>gi|116198439|ref|XP_001225031.1| hypothetical protein CHGG_07375 [Chaetomium globosum CBS 148.51]
 gi|88178654|gb|EAQ86122.1| hypothetical protein CHGG_07375 [Chaetomium globosum CBS 148.51]
          Length = 359

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 189/297 (63%), Gaps = 15/297 (5%)

Query: 68  QFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNG 127
           Q +   L+  +   Y +Y+  T++ FG+L+  +  ++ P+   I+ D S    ++++ +G
Sbjct: 8   QLIGAPLYWINRQLYYAYMSLTKQSFGLLITTMTHWWGPTTIRISGDASVADQIRKTDDG 67

Query: 128 AKVELDMPERLILIANHQIYADWLYVWCFTYLANA---HGAIKIILKDSLKWLPIFGWGM 184
             VE   PER+++IANHQIY DWLY+W   Y ANA   HG++ IILK+SLK++PI G GM
Sbjct: 68  L-VEFSFPERMVMIANHQIYTDWLYLWWVGY-ANAPKMHGSLFIILKESLKYIPIVGPGM 125

Query: 185 QFFQYIFLKRNWATDKGPFSKTLSTLATSK---------EPLWLLIFPEGTVVSDVTRIT 235
            F+ +IF+ R  A D+   +  L  L TS          +P+WLL+FPEGT  S   +  
Sbjct: 126 MFYGFIFMSRKMAVDQPRLAHRLQKLKTSHTAPDGKKYLDPMWLLLFPEGTNASQNGKNK 185

Query: 236 SKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTL 295
           S K+A K+G+ D EH+LLPRSTG +FC   L  +VDY+YD T+  EGV RG+F E I+TL
Sbjct: 186 SAKWAAKIGVKDPEHMLLPRSTGTYFCLNELKGTVDYIYDCTVAYEGVPRGKFGERIFTL 245

Query: 296 RKIYFEGQYPRNIHLHIRKYAISEMPEDE-DKFTEWLRQRWIEKDALMEEFYTKGRF 351
              Y +GQ P++++ + R++ I ++P D  ++F  WLR+RW EKDALME++ + GRF
Sbjct: 246 AGTYVKGQTPKSVNFYWRRFLIDDIPLDTPEEFDIWLRERWYEKDALMEQYVSTGRF 302



>gi|392571654|gb|EIW64826.1| hypothetical protein TRAVEDRAFT_55649 [Trametes versicolor
           FP-101664 SS1]
          Length = 422

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 146/385 (37%), Positives = 214/385 (55%), Gaps = 56/385 (14%)

Query: 51  AVFVVFFAGQSAALNFSQF---LSLLLWPF--SHSYYQSYIKHTQRCFGILLVAINQFFA 105
           A+ V  FAG  A +N SQF   L L L P   +   Y   I++T+  FG LLV ++Q+FA
Sbjct: 31  ALLVFMFAG--AMINGSQFAILLPLRLVPVRVARKLYYEGIRYTKGAFGALLVLMSQWFA 88

Query: 106 PSNFVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           P+  V++ +   KG         ++++  +G  V L++P++ +LIANHQ+YADW+Y W  
Sbjct: 89  PTKLVLSFETEGKGRFTPEEIETLVQRDQHGTIVGLNLPQKTVLIANHQVYADWIYAWAL 148

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE- 215
           TY    H  + I+LK SLKW+P+ GWGMQFF +IFL R+WA+D+   +++LS LA   E 
Sbjct: 149 TYYMGTHKDVFIVLKKSLKWVPVLGWGMQFFNFIFLARSWASDRLQLTQSLSWLAHRAEK 208

Query: 216 ---PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD- 271
              PL  +++PEGT+VS  TR  SKKYADK+G+ D  H LLPRSTGLH+   SL   +  
Sbjct: 209 EDSPLTFILYPEGTLVSKDTRPISKKYADKLGIPDMTHTLLPRSTGLHYSLRSLAPRIQS 268

Query: 272 -YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS------------ 318
             + D+T+   G+   ++ ++ YTLR ++ +G  P  +HLHIRK+ ++            
Sbjct: 269 LQLLDITMAYPGIPPLRYGQDYYTLRSLFCDGVPPPAVHLHIRKFDVNREVPIGDVSASN 328

Query: 319 ----------------EMPEDE-DKFTEWLRQRWIEKDALMEEFYTKGRF-----TGYES 356
                           ++PE E + F  WLR  W EKD LM  F   G       +G   
Sbjct: 329 PNALPSGGAGTSAVEVDIPEAEREAFELWLRDLWREKDRLMGRFLDTGSLDAPSASGKPV 388

Query: 357 PRTVPMKLNSVFELTQIWYFIVPLV 381
             TVP++L   +E+   + F VP V
Sbjct: 389 EITVPLRLKHGYEVLDAFCFFVPAV 413



>gi|258571674|ref|XP_002544640.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237904910|gb|EEP79311.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 423

 Score =  246 bits (628), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 192/321 (59%), Gaps = 12/321 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+ + + +F     ++  +Q + L L+  +  ++ SY+  T+R FGI + A+ ++ +P
Sbjct: 46  IIRSLLILAWFNCCCFSIVVTQAVGLPLYLINKRWFYSYMAMTKRSFGITITALTEWCSP 105

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   I+ D S +G      +G +V    PERL+LIANHQ+Y DWLY+W  TY  + HG I
Sbjct: 106 TPVRISGDSSVQGQFSLLKDG-RVATKFPERLVLIANHQVYTDWLYLWWVTYTNDMHGYI 164

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P  G GM  + +IF+ R W  DK      L  L T            +P
Sbjct: 165 YIILKESLKYIPFIGQGMMLYGFIFMARKWIEDKPRLQHRLQKLKTKHGVSPEGLPLFDP 224

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+   +H+LLPRSTGL FC   L  +VDYVYD 
Sbjct: 225 MWLLIFPEGTNLSRNTKDRSDAYCQKQGIAPSKHILLPRSTGLFFCLQQLRGTVDYVYDC 284

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           TIG EG  +  + E  +T+R  Y  G+ P++++ + R+++IS++P  D+ +F +W+ +RW
Sbjct: 285 TIGYEGQPKDSYAEAHFTIRSTYLRGRPPKSVNFYWRRFSISDIPLTDQKEFEDWIYKRW 344

Query: 336 IEKDALMEEFYTKGRFTGYES 356
            EKD L+++F   GRF  +E 
Sbjct: 345 EEKDRLLDQFIETGRFPPFED 365



>gi|315048621|ref|XP_003173685.1| hypothetical protein MGYG_09034 [Arthroderma gypseum CBS 118893]
 gi|311341652|gb|EFR00855.1| hypothetical protein MGYG_09034 [Arthroderma gypseum CBS 118893]
          Length = 418

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 197/341 (57%), Gaps = 12/341 (3%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           EP +  L   LVR+ + V +F      +  +Q + L L+     Y+ ++I  T+  FG+ 
Sbjct: 32  EPANYGLFVQLVRSFLIVAWFCCCCTCIIVAQVVGLPLYVIKKEYFNAWIALTKESFGLA 91

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           + A+ ++ AP+   I+ D+S  G +  + NG  ++ + P+RL+LIANHQ+Y DWLY+W  
Sbjct: 92  ITALTEWSAPTPVRISGDRSVLGQVTLTSNGG-IKTNFPDRLVLIANHQVYTDWLYLWWV 150

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-- 214
           TY    HG I IILK+SLK++P+ G GM  + +IF+ R W  DK      LS L+  +  
Sbjct: 151 TYTNKMHGHIYIILKESLKYIPLVGQGMTLYGFIFMARKWMADKPRLQHRLSKLSVKRAE 210

Query: 215 --------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
                   +P+WLLIFPEGT +S  T+  S  Y  K G+   +H L PRSTGL FC   L
Sbjct: 211 SSSGNPLFDPMWLLIFPEGTNLSLHTKDVSDAYGKKKGIPPLKHELHPRSTGLFFCLQQL 270

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
             +V +VYD T+  EG  +G FP+  +T+R  Y + + PR ++ + R++A  ++P E+++
Sbjct: 271 RGTVGHVYDCTMAYEGPPKGSFPDSYFTIRSTYLKCRPPRVVNFYWRRFAFEDIPLENQE 330

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNS 366
           +F  WL +RW EKD L++ F   G+F  +E    V M  N+
Sbjct: 331 EFEAWLFERWAEKDQLLDTFIETGKFPPFEDADLVEMDPNN 371



>gi|399171962|emb|CCE27189.1| related to acetyltransferase [Claviceps purpurea 20.1]
          Length = 329

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 195/320 (60%), Gaps = 18/320 (5%)

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYA 148
           T+R F + + ++   F P+   I+ D+S KG +  +  G  VE   PER+++IANHQIY 
Sbjct: 2   TKRSFSLTITSMTHIFGPTTIRISGDESVKGQILPA-TGGGVEFKFPERMVMIANHQIYT 60

Query: 149 DWLYVWCFTYLANA--HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKT 206
           DW+Y+W   Y  N   HG I IILK+SLK++P+ G GM F+ +IFL R  ATD+   +  
Sbjct: 61  DWIYLWWVGYANNPGMHGHIYIILKESLKYIPVIGTGMMFYGFIFLSRKMATDQPRLAHR 120

Query: 207 LSTLATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
           L+ L   K         +P+WLL+FPEGT +S+  R+ S  +A K  L D EHV+LPRST
Sbjct: 121 LNKLKQKKVDPRGNTYLDPMWLLLFPEGTNLSNNGRMKSAAWAAKNSLRDPEHVMLPRST 180

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           G +FC   L  SV+YVYD T+  EGV RG++ EEI+ L   YFEG+ P++++L+ R++ +
Sbjct: 181 GTYFCLNELKDSVEYVYDCTVAYEGVPRGKYGEEIFGLCSTYFEGRPPKSVNLYWRRFKV 240

Query: 318 SEMPEDEDK-FTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQ 372
           +++P D+ K F  WLR +W +KDALME++   GRF      +       ++    +E+ Q
Sbjct: 241 ADIPLDDPKEFELWLRDQWYKKDALMEQYLNTGRFPPLSGDKVDYVETEVRTRYPWEILQ 300

Query: 373 IWYFIVPLVPIMWYFSNYLL 392
           I + +V +  ++W+    LL
Sbjct: 301 I-FSVVGICGLLWHNVRRLL 319



>gi|255943781|ref|XP_002562658.1| Pc20g00970 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587393|emb|CAP85426.1| Pc20g00970 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 415

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 200/316 (63%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+ + + +      A+  +Q +   L+  +  YY SY+ +T++CFG++L ++ Q+ +P
Sbjct: 41  ILRSLLLITWADCCIMAICVTQLIGCPLYLINRYYYYSYMAYTKQCFGLVLGSVTQWSSP 100

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           + F ++ D S +G +  S +G  +E   PERL++I+NHQ+Y DW+Y+W   Y    HG I
Sbjct: 101 TLFRVSGDASVRGQIHLSKDGL-LETRFPERLVMISNHQVYTDWVYLWWVAYTNQMHGRI 159

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T+           +P
Sbjct: 160 FIILKESLKYIPIVGTGMMFYGFIFMARKWMSDKPRLQHRLDKLKTAYTGSNSARPQYDP 219

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  + +K GL   +HV+LPRSTGL FC   L  +VD+VYD 
Sbjct: 220 MWLLIFPEGTNLSINTKRRSDIWGEKQGLPSFKHVILPRSTGLFFCLQQLRGTVDWVYDC 279

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+  EG  +G +P++ +TLR  Y +G+ P ++++H R++ +S++P +D+ +F EW+  RW
Sbjct: 280 TMAYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRFQVSKIPLDDQKEFEEWMTARW 339

Query: 336 IEKDALMEEFYTKGRF 351
            EKD LM++++  GRF
Sbjct: 340 AEKDQLMDQYFETGRF 355



>gi|331223575|ref|XP_003324460.1| hypothetical protein PGTG_05266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309303450|gb|EFP80041.1| hypothetical protein PGTG_05266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 447

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 203/378 (53%), Gaps = 68/378 (17%)

Query: 39  QSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPF---SHSYYQSYIKHTQRC--- 92
             QN  + ++R+  F  FF   +  L+ +Q   LL++PF   S S +  +++    C   
Sbjct: 12  NEQNHKKPILRSIKFNSFFFSSAIFLHLTQ---LLVFPFVILSDSTFTRHLRLKYNCLAR 68

Query: 93  --FGILLVAINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYA 148
             F I+L+ I Q FAP+N V+T D S     V+++  NG  + +D+P   I++ANHQIYA
Sbjct: 69  KTFAIILILITQIFAPTNLVLTSDHSIDLNQVVRRDKNGNIIAIDLPSHSIIMANHQIYA 128

Query: 149 DWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLS 208
           DWLYVW   YLA+ H A+ IILK SLKW+P+ G  MQ F +IFL R+WATDK   +  L 
Sbjct: 129 DWLYVWSLAYLADIHSALIIILKASLKWVPLVGPAMQMFSFIFLNRSWATDKKDLTIQLD 188

Query: 209 TLA--------TSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLH 260
            LA        +S   + LLIFPEGT+VS +TR  SKKYA+K G+ D +H LLPRSTG  
Sbjct: 189 QLADQTYNPTMSSLNKIGLLIFPEGTLVSPLTRPASKKYAEKCGVDDLKHCLLPRSTGSL 248

Query: 261 FCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
           FC  +L + +    + DLTIG  GV      ++ YTL+ I+  G+ P  +H+HI+   +S
Sbjct: 249 FCMRALSQKIPDLKLIDLTIGYSGVPADGHGQDYYTLQSIFGYGRPPPKVHIHIKVIPVS 308

Query: 319 EM---------------------------------------------PEDEDKFTEWLRQ 333
           E+                                             PE+ D+F  WLR 
Sbjct: 309 EIPIGHVAPRPSTPNPISVSIPTNDLPVTIDEKKTTPKELSSMNDPSPEEVDRFDSWLRG 368

Query: 334 RWIEKDALMEEFYTKGRF 351
            W+EKD L+++FY  GRF
Sbjct: 369 LWVEKDMLLDQFYAHGRF 386



>gi|471562030|gb|EMR63644.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 protein
           [Eutypa lata UCREL1]
          Length = 417

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 196/316 (62%), Gaps = 13/316 (4%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R   F ++F      ++ +Q L   L+     +Y +Y+   +  FG+L   +  ++AP+
Sbjct: 51  LRALTFGLYFFIGCLTVHLTQLLGSPLYFIDQEHYYAYMSLCKASFGLLTTTMTYWWAPT 110

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVW--CFTYLANAHGA 165
              I+ D S    L  + +G +VE + P+RL++IANHQIY DW+Y+W   +T L   HG 
Sbjct: 111 VIRISGDASVADQLSLTPDG-RVECNFPDRLVMIANHQIYTDWIYLWWVGYTNLRQMHGH 169

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------EP 216
           I IILK+S+K++P+ G G  F  +IF+ R  + D+   +  L  L TS           P
Sbjct: 170 IYIILKESIKYIPVIGLGCVFHGFIFMSRKMSVDQPRLAHRLRKLKTSYTNPEGKSYLSP 229

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLL+FPEGT +S   ++ S  +A+K+GL + EH++LPRSTG++FC   L  +VDY+YD 
Sbjct: 230 MWLLLFPEGTNISGNGKVKSAAWAEKMGLKNPEHMMLPRSTGMYFCLNELKGTVDYIYDC 289

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+  EGV RG+F E+ + L   YF+G+ P++++ + R++AI+++P ++ D+F  WLR++W
Sbjct: 290 TVAYEGVPRGRFGEDYFGLSSTYFQGRPPKSVNFYWRRFAIADIPLDNNDEFDLWLREKW 349

Query: 336 IEKDALMEEFYTKGRF 351
            EKDALME++   GRF
Sbjct: 350 YEKDALMEQYMCTGRF 365



>gi|189190578|ref|XP_001931628.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187973234|gb|EDU40733.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 420

 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 202/315 (64%), Gaps = 19/315 (6%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R  +F V+FA    A+  +Q++ L L+ +S   + +++  +++ FG +++ +  ++AP 
Sbjct: 48  LRMYLFGVYFAISIIAIAITQYIGLPLYFYSRDLFYAWMAMSKQHFGSVVMTMTYWWAPV 107

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              ++ D+S +G L++S +G K+E D PERL+       Y DW+Y+W   Y A+ HG + 
Sbjct: 108 TMRVSGDESVRGQLRKSKDG-KLECDFPERLL-------YTDWVYIWWTCYTASMHGHLY 159

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EPL 217
           IILK+SLK++P+ GWGM+ F +IFL R W+TDK  F   L  L+TS           +P+
Sbjct: 160 IILKESLKYIPVLGWGMKLFGFIFLSRKWSTDKERFQHRLRKLSTSHSGPLSGSKGLDPM 219

Query: 218 WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLT 277
           WLLIFPEGT +S   R +S+++A K  + D  H LLPRSTGL FC   L  S+ ++YD T
Sbjct: 220 WLLIFPEGTNLSTNGRESSQRWAAKNNMPDLRHALLPRSTGLSFCLQELKGSIGHLYDCT 279

Query: 278 IGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWI 336
           +  EGV  GQ+ ++++TLR  YF+G+ P++++++ R++AI+++P  DE +F++WL  RW 
Sbjct: 280 VAYEGVPVGQYGQDLFTLRGTYFQGRPPKSVNMYWRRFAIADIPLHDEKEFSDWLLARWR 339

Query: 337 EKDALMEEFYTKGRF 351
           EKD L++ F    RF
Sbjct: 340 EKDDLLQYFVEHQRF 354



>gi|403414186|emb|CCM00886.1| predicted protein [Fibroporia radiculosa]
          Length = 420

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/381 (37%), Positives = 208/381 (54%), Gaps = 50/381 (13%)

Query: 51  AVFVVFFAGQSAALNFSQFLSLL---LWPFS--HSYYQSYIKHTQRCFGILLVAINQFFA 105
           A+F+V F      +N SQF+ LL   L+PF+   + Y   I+ ++  FG L+V ++Q FA
Sbjct: 31  ALFLVVFLFACVVINASQFVFLLPLKLFPFAWADAVYFEGIRCSKGAFGALIVLMSQLFA 90

Query: 106 PSNFVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           P+  +IT +K  +G         ++++   G  V L +P+R +LIANHQ+YADW Y W  
Sbjct: 91  PTKLMITFEKEGQGRLTDEEIDALVERGKGGRVVGLHLPQRAVLIANHQVYADWWYDWSL 150

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE- 215
            Y    H  + I+LKDSLKW+PI GWGMQ F+++FLKR+WA+D+   S +LS L    E 
Sbjct: 151 AYFMGTHKDVYIVLKDSLKWIPIIGWGMQLFKFVFLKRSWASDRLHLSNSLSWLGRQAEK 210

Query: 216 ---PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD- 271
              PL  +++PEGT+VS  TR  SKK+ADK+G+ D  H LLPRSTGLH+   SL   V  
Sbjct: 211 RDVPLMFILYPEGTLVSKDTRPLSKKFADKMGIPDMMHTLLPRSTGLHYSLRSLSPRVPT 270

Query: 272 -YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS------------ 318
             + D+T+   G+    + +  YTLR I+ +G  P  IH+HIR + ++            
Sbjct: 271 LRLIDITMAYPGIPPFGYGQSYYTLRSIFLDGVPPPTIHMHIRCFDVAREVPIGDLSASN 330

Query: 319 ----------------EMPEDE-DKFTEWLRQRWIEKDALMEEFYTKGRFTGY-ESPRTV 360
                           E+PE E D+F  WLR  W EKD L+ ++   G F G  E    V
Sbjct: 331 PNALPTSSPGEHTLEVEIPEAERDRFDLWLRNLWREKDRLLSQYLDTGSFVGTKELQLNV 390

Query: 361 PMKLNSVFELTQIWYFIVPLV 381
           P+ L    +L       +P+V
Sbjct: 391 PLILRRRRDLFDALGLFMPVV 411



>gi|322708516|gb|EFZ00094.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Metarhizium
           anisopliae ARSEF 23]
          Length = 429

 Score =  241 bits (614), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/371 (35%), Positives = 212/371 (57%), Gaps = 26/371 (7%)

Query: 40  SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVA 99
              L   ++R   F V+F     A+  +Q +   L+  +  ++ +Y+  T++ F + +  
Sbjct: 44  GHGLGMQILRGITFTVYFTFCCFAIVITQTIGAPLYFINREWFYAYMAMTKQSFALTITV 103

Query: 100 INQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQ--------IYADWL 151
           +   + P+   I+ D+S  G +  +  G  VE   PER+++IANHQ        IY DWL
Sbjct: 104 MTHIWGPALVRISGDESVAGQILAT-PGGGVEFKFPERMVMIANHQGLTPVAAQIYTDWL 162

Query: 152 YVWCFTYL--ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLST 209
           Y+W   Y      HG I IILK+SLK++P  G GM F+ +I++ R  ATD+   +  L+ 
Sbjct: 163 YLWWVGYANRPGMHGHIYIILKESLKYIPFIGTGMMFYGFIYMSRKMATDQPRLAYRLNK 222

Query: 210 LATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLH 260
           L   K         +P+WLL+FPEGT +S   R  S ++A+K GL D +HV+LPRSTG+ 
Sbjct: 223 LKQKKIDPSGRAYFDPMWLLLFPEGTNLSRNGRKKSSQWAEKNGLKDPDHVMLPRSTGIF 282

Query: 261 FCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEM 320
           FC   L  +VDYVYD T+  EG+ RG++ EEI+ L   YF+G+ P++++L+ R++ ++++
Sbjct: 283 FCLNELKDTVDYVYDCTVAYEGIPRGKYGEEIFGLASTYFQGRPPKSVNLYWRRFRLADI 342

Query: 321 P-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKLNSVFELTQIWY 375
           P  D+ +F  WLR +W +KDALMEE+  KGRF      +T      +K    +E+ QI +
Sbjct: 343 PLNDQKEFDIWLRDQWYKKDALMEEYLKKGRFPALTRGKTEYVETEVKTRHPWEILQI-F 401

Query: 376 FIVPLVPIMWY 386
            +V    ++W+
Sbjct: 402 TVVGTAGLLWH 412



>gi|388857331|emb|CCF49005.1| uncharacterized protein [Ustilago hordei]
          Length = 470

 Score =  240 bits (612), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 199/365 (54%), Gaps = 57/365 (15%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLS--LLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFA 105
           ++T +  + F     +++  Q LS  L L P +   + S I +T+  F   L+ I+QFF 
Sbjct: 48  IQTILLAIIFNFCIISIHLFQLLSWPLSLHPTTRPIFHSSIGYTKLAFARALLLISQFFG 107

Query: 106 PSNFVITVDKSAKGVL-------KQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTY 158
           P+  VI++     G L       +    G     D+P R I ++NHQ+Y DWLY+WCF Y
Sbjct: 108 PTQLVISIGDGRGGYLDPEPFVHRDKQTGRITCFDLPSRAIWMSNHQVYTDWLYLWCFAY 167

Query: 159 LANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---- 214
            A    +I IILK SLKW+P  GWGMQF+++IFLKRNWA+D+   +K LS +A++     
Sbjct: 168 YAGLADSILIILKHSLKWIPFVGWGMQFYRFIFLKRNWASDQAQLAKQLSQVASTNHTTR 227

Query: 215 -------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLH 267
                  + L LLIFPEGT+VS+ TR  S K+A+K+G+ D ++VLLPRSTGL FC  +L 
Sbjct: 228 ESKANTAKKLLLLIFPEGTLVSNNTRPISAKFAEKMGIKDLDNVLLPRSTGLFFCLTTLA 287

Query: 268 KSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR------------ 313
           K +D  ++ DLTIG  GV    F ++ YTLR I+ +G  P  IH+H+             
Sbjct: 288 KEMDDLWLVDLTIGYPGVPPAGFGQDYYTLRSIFMQGVPPPAIHIHLTLTRITNAVENDT 347

Query: 314 ----------KYAISEMP-------------EDEDKFTEWLRQRWIEKDALMEEFYTKGR 350
                       A +++P             E+ ++F EWLR+RW +KD  M  FY  G 
Sbjct: 348 CSNPISLAQVSTANTDVPPLGKNERPAESGGEERNQFEEWLRRRWTKKDLEMHNFYKDGD 407

Query: 351 FTGYE 355
           F G +
Sbjct: 408 FVGGQ 412



>gi|259482950|tpe|CBF77913.1| TPA: acyltransferase, putative (AFU_orthologue; AFUA_5G05880)
           [Aspergillus nidulans FGSC A4]
          Length = 396

 Score =  239 bits (611), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 195/316 (61%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+ +   +F      +  +Q +   L+  +  YY +++  T+R FG+++ ++ ++  P
Sbjct: 37  VLRSLLLATWFNCCCVVILMTQLIGCPLYIINKHYYYAWMASTKRSFGLVITSLTEWGCP 96

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S +G ++ + +G +++   PERL++I+NHQ+Y DW+Y+W   Y    HG I
Sbjct: 97  TYVRVSGDESIRGQVRIADDG-RLKTTFPERLVMISNHQVYTDWIYLWWIAYSNMMHGHI 155

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P
Sbjct: 156 FIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHIGSDSGAPKYDP 215

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G    +H +LPRSTGL FC   L  +V++VYD 
Sbjct: 216 MWLLIFPEGTNLSINTKRRSDAYGAKNGFPPLKHQVLPRSTGLFFCLQQLRGTVEWVYDC 275

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G + ++ +TLR  Y +G+ P +++++ R++A+S++P +D+ +F  WLR RW
Sbjct: 276 TVGYEGPPKGSYADKYFTLRSTYVQGRPPTSVNMYWRRFAVSDIPLDDQQEFDAWLRARW 335

Query: 336 IEKDALMEEFYTKGRF 351
            EKD L++E++  GRF
Sbjct: 336 TEKDELLDEYFETGRF 351



>gi|443898958|dbj|GAC76291.1| lysophosphatidic acid acyltransferase LPAAT and related
           acyltransferases [Pseudozyma antarctica T-34]
          Length = 461

 Score =  239 bits (611), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 195/369 (52%), Gaps = 60/369 (16%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLS--LLLWPFSHSYYQSYIKHTQRCFGILLVAINQFF 104
           LV+T +F + F     + +F Q LS  L L P +   Y+S+I +++  F   L+ I+QFF
Sbjct: 36  LVQTILFALVFNFCIVSAHFFQLLSWPLSLHPRTRPIYRSHIAYSKLAFSRALLVISQFF 95

Query: 105 APSNFVITVDKSAKG-------VLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFT 157
             +  VI++     G       V +    G  V  D+P R + ++NHQ+Y DWLY+WC  
Sbjct: 96  GRTQLVISIGDGKGGYIDPEPFVHRDKRTGRVVSFDLPSRSVWMSNHQVYTDWLYLWCLA 155

Query: 158 YLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT----- 212
           Y A+   +I IILKDSLKW+P  GWGMQF+++IFLKRNWA+D+   +K L  +A+     
Sbjct: 156 YYADLADSILIILKDSLKWIPFIGWGMQFYRFIFLKRNWASDQAQLAKQLGQVASENHNA 215

Query: 213 ---------SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCA 263
                    + + L LLIFPEGT+VS  TR  S K+A+K+G+ D E+VLLPRSTGL FC 
Sbjct: 216 PGEESSATGTAKKLLLLIFPEGTLVSGNTRPVSAKFAEKMGIKDLENVLLPRSTGLFFCL 275

Query: 264 GSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH---------I 312
            +L K +D  ++ D TIG  GV    + ++ YTLR I+ +G  P  IHLH         +
Sbjct: 276 RTLAKQMDDLWLVDFTIGYPGVPPAGYGQDYYTLRSIFMQGVPPPAIHLHFTLTRITDPV 335

Query: 313 RKYAISEMPEDED--------------------------KFTEWLRQRWIEKDALMEEFY 346
                S  P   D                           F  WLR RW EKD LM  FY
Sbjct: 336 AGDTSSNAPSVADVATAQTDTPPLGANDAPAESSDAERTAFESWLRARWTEKDQLMHRFY 395

Query: 347 TKGRFTGYE 355
            +G F G +
Sbjct: 396 AQGDFVGGD 404



>gi|398394062|ref|XP_003850490.1| hypothetical protein MYCGRDRAFT_74465 [Zymoseptoria tritici IPO323]
 gi|339470368|gb|EGP85466.1| hypothetical protein MYCGRDRAFT_74465 [Zymoseptoria tritici IPO323]
          Length = 418

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/331 (39%), Positives = 196/331 (59%), Gaps = 18/331 (5%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           +P+   L+Q L R   F ++F G    ++ +Q L L L+ ++  ++ ++I  T++ FGIL
Sbjct: 28  KPRHGPLMQSL-RIVGFGIYFFGTGIFIHLAQLLGLPLYFYNQDWFYAWIALTKQFFGIL 86

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           +  + Q+++P+   I+ DKS  G+L Q  +G  + +D  +R++L+ANHQIY DWLY+W  
Sbjct: 87  ITTMTQWWSPTLIRISGDKSMAGLLHQDASGL-LTVDFGDRVVLMANHQIYTDWLYLWWI 145

Query: 157 TYLAN--AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL---- 210
            Y  +   HG I IILK SLKW+P+ G  MQ + +IF+ R WATD+      L  L    
Sbjct: 146 AYTNSLPMHGHIYIILKASLKWVPLIGPAMQLYGFIFMARKWATDQETMRYRLQKLNSRH 205

Query: 211 ------ATSK---EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHF 261
                 ++SK   +P+WL+IFPEGT +S  T   S KYA+K      +H LLPR TGL F
Sbjct: 206 SQPLTSSSSKPQLDPMWLMIFPEGTNLSANTYGISTKYAEKTSTAMTKHCLLPRHTGLQF 265

Query: 262 CAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP 321
           C   L  +V YVYD TI  EG     F  E + LR +YFEG  P+++++H R++A+  +P
Sbjct: 266 CLQELRSTVPYVYDCTIAYEGTPPSGFAAERFGLRSVYFEGLPPKSVNMHWRRFAMDTIP 325

Query: 322 -EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +DE +   W   RW EKD L+E F  KG+F
Sbjct: 326 LDDEKEMAAWTLARWREKDELLEVFKQKGKF 356



>gi|449550777|gb|EMD41741.1| hypothetical protein CERSUDRAFT_110317 [Ceriporiopsis subvermispora
           B]
          Length = 415

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 191/342 (55%), Gaps = 44/342 (12%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKG---------VLKQSWNGAKVEL 132
           Y + I++++  FG L++   Q FAP+  V++ +K  +G         ++++  +G  V L
Sbjct: 63  YYAGIRYSEGAFGTLMMLACQLFAPTTLVVSFEKHGEGKFTEEEVARIVERDGSGKVVNL 122

Query: 133 DMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFL 192
            +P++ +LIANHQ+YADW Y WC TY    +  + I+LK SLKW+PI GWGMQFF + FL
Sbjct: 123 HLPQKTVLIANHQMYADWWYAWCLTYYMQTYKDVHIVLKKSLKWVPILGWGMQFFNFTFL 182

Query: 193 KRNWATDKGPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDH 248
            R+WA+DK   + +LS LA   E    PL  +++PEGT+VS  TR  SKKYADK+G+ D 
Sbjct: 183 ARSWASDKLHLASSLSWLARRAEKEDTPLTFILYPEGTLVSRDTRPISKKYADKLGIPDM 242

Query: 249 EHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPR 306
            H LLPRSTGLH+   +L        + D+T+   G+    + ++ YTLR I+F+G  P 
Sbjct: 243 LHTLLPRSTGLHYSLRALAPRTPSLQMIDITMAYPGIPPFGYGQDYYTLRSIFFDGISPP 302

Query: 307 NIHLHIRKYAI-SEMP----------------------------EDEDKFTEWLRQRWIE 337
            +++HIR++ +  E+P                            E+ D F  WLR RW E
Sbjct: 303 EVYMHIRRFDVMREVPIGDISSSKPDNTPNGDSSKPSVEVDIPNEERDTFEVWLRDRWRE 362

Query: 338 KDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIVP 379
           KDALM ++   G F   +    +P+KL    E+   + F +P
Sbjct: 363 KDALMSKYMDGGSFVEAQEQVKIPLKLKQKREILNAFCFFIP 404



>gi|336372024|gb|EGO00364.1| hypothetical protein SERLA73DRAFT_180941 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384778|gb|EGO25926.1| hypothetical protein SERLADRAFT_466772 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 417

 Score =  238 bits (606), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 208/381 (54%), Gaps = 46/381 (12%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQF-----LSLLLWPFSHSYYQSYIKHTQRCFGILLVAIN 101
           ++  A+F++ F      +N  QF     L L  +P+S + Y   I++T+  F  L++ +N
Sbjct: 23  ILNAALFLIVFISGCVMVNGFQFVFLLPLRLFPFPWSRTLYDEGIRYTKEAFATLMILMN 82

Query: 102 QFFAPSNFVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLY 152
           Q+FAP+   +T +   +G         ++K+   G  V L +P + ++IANHQ+Y DW Y
Sbjct: 83  QWFAPTRLSVTFETQGQGRFTEEEVERIVKRDAAGKVVSLRLPAKSVIIANHQVYCDWWY 142

Query: 153 VWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
           VWC TY A  H  + I+LK SLKW+PI GWGMQF+ +IFL R+WA+D+   S  LS L  
Sbjct: 143 VWCLTYFAGTHKDVFIVLKRSLKWVPILGWGMQFYNFIFLARSWASDRLHLSSQLSKLGK 202

Query: 213 SKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHK 268
             +    PL  +++PEGT+VS  TR  SK+YADK+G  D  +VLLPRSTGLH+   SL  
Sbjct: 203 QAQQQDKPLTFILYPEGTLVSRDTRPISKRYADKLGTPDLLNVLLPRSTGLHYSLRSLTP 262

Query: 269 SVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS-------- 318
            +    + D+TI   GV    + +  YTLR I+ +   P  IH+H+R + ++        
Sbjct: 263 RIPSLRMLDITIIYPGVPPMGYGQSYYTLRSIFLDRTPPPVIHMHLRMFDVARDVPIGDI 322

Query: 319 ----------------EMPEDED-KFTEWLRQRWIEKDALMEEFYTKGRF-TGYESPRTV 360
                           + PE E  +F  WLR+ W EKD  + +F++   F +G ++P  +
Sbjct: 323 STTNPDAIPNSGAVEVDFPEHEKVEFDLWLRKLWTEKDEFITKFHSTPSFPSGTKAPVDI 382

Query: 361 PMKLNSVFELTQIWYFIVPLV 381
           P++L  ++E+   +    P V
Sbjct: 383 PLELRHIWEILDAFCCFGPAV 403



>gi|343427809|emb|CBQ71335.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 472

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/385 (36%), Positives = 198/385 (51%), Gaps = 65/385 (16%)

Query: 32  MPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLS--LLLWPFSHSYYQSYIKHT 89
           +P    P  Q  +Q    +  F + F     + +  Q LS  L L+P +   Y  +I ++
Sbjct: 34  VPISSRPPKQTYLQ----SIAFALVFNFCIISAHLFQLLSWPLSLFPATRPIYHDHIAYS 89

Query: 90  QRCFGILLVAINQFFAPSNFVITVDKSAKGVL-------KQSWNGAKVELDMPERLILIA 142
           +  F  LL+ I+QFF P+  VI++     G L       +    G    LD+P R + ++
Sbjct: 90  KLAFSRLLLLISQFFGPTQLVISIGDGQGGFLDPEPFVHRDKQTGRIRSLDLPSRAVWMS 149

Query: 143 NHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGP 202
           NHQ+Y DWLY+WC  Y A+   +I IILK SLKW+P  GWGMQF+++IFL RNWA+D+  
Sbjct: 150 NHQVYVDWLYLWCLAYYADLADSILIILKKSLKWIPFVGWGMQFYRFIFLARNWASDQAQ 209

Query: 203 FSKTLSTLATSK---------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVD 247
            +K L  +A+                 + L LLIFPEGT+VS  TR  S K+A K G+ D
Sbjct: 210 LAKQLGQVASQNHAESSAATASSTNTAKKLLLLIFPEGTLVSSQTRPISAKFAQKTGIKD 269

Query: 248 HEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYP 305
            E+VLLPRSTGL FC  +L K +D  ++ D TIG  GV    + ++ YTLR I+ +G  P
Sbjct: 270 LENVLLPRSTGLFFCLRTLAKEMDDLWLVDFTIGYPGVPPAGYGQDFYTLRSIFMQGIPP 329

Query: 306 RNIHLHI---------------RKYAISEMP--------------------EDEDKFTEW 330
             IH+H+                  +++++P                    E+   F  W
Sbjct: 330 SAIHIHLTMTRITPPVAGDTSSNAPSVAQIPTASIDTPPLGANVKPAESSEEERTAFEAW 389

Query: 331 LRQRWIEKDALMEEFYTKGRFTGYE 355
           LR+RW +KDA M  FYT G F G E
Sbjct: 390 LRRRWTDKDAQMHRFYTHGDFVGGE 414



>gi|470319370|gb|EMR10989.1| hypothetical protein PNEG_00591 [Pneumocystis murina B123]
          Length = 762

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/334 (38%), Positives = 197/334 (58%), Gaps = 7/334 (2%)

Query: 43  LVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQ 102
           L QW  R  VF+ F    S A+   Q L+   + +  ++Y  YI+ T++  G++ +AI +
Sbjct: 13  LCQWSGRILVFIGFIC-VSIAIAILQLLATFFYKYKQNWYYKYIRRTKKHAGVICMAIAK 71

Query: 103 FFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA 162
              PS  ++  DK      ++  N  K E++   R I I+NHQIY DW Y+W   YL   
Sbjct: 72  LLIPSYAILYGDKIILSHFEKDLN-KKEEIEESNRFIFISNHQIYIDWFYIWWIAYLKKI 130

Query: 163 HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLA-TSKEPLWLLI 221
              I I+LKDSLK +PI G  M+ F +IFL R+W  D   F+     L+ ++ + + LL+
Sbjct: 131 DNGIYIVLKDSLKRIPIIG--MKTFGFIFLSRSWQEDHLRFNNHFRNLSLSANQSMLLLL 188

Query: 222 FPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIE 281
           +PEGT +S  T+  S  Y  K  L   ++VLLPR  GL+FC  +LHK+  Y+YD TIG E
Sbjct: 189 YPEGTNISLHTKHQSLAYVKKNDLPILDYVLLPRIKGLYFCLKNLHKTTKYLYDCTIGYE 248

Query: 282 GVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDA 340
           GV    + ++IYTL+ I F+GQ+P+N+H+H+R+++I  +P ++ED+F  WL   WIEKD 
Sbjct: 249 GVTHNTYAQDIYTLKSILFDGQFPKNVHIHLRRFSIDTVPLDNEDQFKNWLYNLWIEKDK 308

Query: 341 LMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIW 374
           LM +F   G F G  + +   ++L+S+ E+  +W
Sbjct: 309 LMHQFINHGYFPGDFTLKR-KIQLDSILEILSLW 341



>gi|67903702|ref|XP_682107.1| hypothetical protein AN8838.2 [Aspergillus nidulans FGSC A4]
 gi|40740936|gb|EAA60126.1| hypothetical protein AN8838.2 [Aspergillus nidulans FGSC A4]
          Length = 1467

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 195/316 (61%), Gaps = 12/316 (3%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+ +   +F      +  +Q +   L+  +  YY +++  T+R FG+++ ++ ++  P
Sbjct: 37  VLRSLLLATWFNCCCVVILMTQLIGCPLYIINKHYYYAWMASTKRSFGLVITSLTEWGCP 96

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D+S +G ++ + +G +++   PERL++I+NHQ+Y DW+Y+W   Y    HG I
Sbjct: 97  TYVRVSGDESIRGQVRIADDG-RLKTTFPERLVMISNHQVYTDWIYLWWIAYSNMMHGHI 155

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++PI G GM F+ +IF+ R W +DK      L  L T            +P
Sbjct: 156 FIILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHIGSDSGAPKYDP 215

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G    +H +LPRSTGL FC   L  +V++VYD 
Sbjct: 216 MWLLIFPEGTNLSINTKRRSDAYGAKNGFPPLKHQVLPRSTGLFFCLQQLRGTVEWVYDC 275

Query: 277 TIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRW 335
           T+G EG  +G + ++ +TLR  Y +G+ P +++++ R++A+S++P +D+ +F  WLR RW
Sbjct: 276 TVGYEGPPKGSYADKYFTLRSTYVQGRPPTSVNMYWRRFAVSDIPLDDQQEFDAWLRARW 335

Query: 336 IEKDALMEEFYTKGRF 351
            EKD L++E++  GRF
Sbjct: 336 TEKDELLDEYFETGRF 351



>gi|328859838|gb|EGG08946.1| hypothetical protein MELLADRAFT_77256 [Melampsora larici-populina
           98AG31]
          Length = 440

 Score =  236 bits (602), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 176/306 (57%), Gaps = 43/306 (14%)

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQI 146
            ++ FGI+LV   Q F P+  VITVD     + ++K+  +G  + LD+P+R + +ANHQI
Sbjct: 70  AKQVFGIVLVVATQIFGPTKLVITVDDGIDLRQMVKRDKSGRVISLDLPKRSVTMANHQI 129

Query: 147 YADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKT 206
           YADWLY+WC  YLA  HG+I IILK SLKW+PI G  MQ F +IFL R+WA+DK    + 
Sbjct: 130 YADWLYIWCLAYLAEIHGSIIIILKASLKWVPIIGPAMQLFSFIFLNRSWASDKSSLIEH 189

Query: 207 LSTLA-----TSK-------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLP 254
           L+T+A     TSK       E L LLIFPEGT+VS +TR  S+KYA+K G  D +H LLP
Sbjct: 190 LTTMAKQTSSTSKLKPNQAFESLTLLIFPEGTLVSPLTRPISQKYAEKTGFTDLKHCLLP 249

Query: 255 RSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHI 312
           RSTG  FC  +L +S+    + DLTIG  G+      ++ YTL+ I+  G  P  +H+H+
Sbjct: 250 RSTGTLFCIRALSRSIPDLQLIDLTIGYPGIPAYGNGQDFYTLQSIFGYGHSPPQVHIHL 309

Query: 313 RKYAISEMP---------------------------EDEDKFTEWLRQRWIEKDALMEEF 345
           R   IS +P                            +  +F +WLR++W  KD ++E F
Sbjct: 310 RLIPISSIPIGTSHLNPSSTSSSSSTPATEIIDPSPSETIEFDKWLREQWRMKDEMLERF 369

Query: 346 YTKGRF 351
           Y  G  
Sbjct: 370 YKTGEM 375



>gi|71023953|ref|XP_762206.1| hypothetical protein UM06059.1 [Ustilago maydis 521]
 gi|46101710|gb|EAK86943.1| hypothetical protein UM06059.1 [Ustilago maydis 521]
          Length = 467

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 198/383 (51%), Gaps = 63/383 (16%)

Query: 32  MPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLS--LLLWPFSHSYYQSYIKHT 89
           +P    P  Q  +Q    T +F + F     +++  Q LS  L L P +   Y S+I +T
Sbjct: 31  IPISSRPPKQTYLQ----TTLFALVFNICIISVHLFQLLSWPLSLHPATKPIYHSHIAYT 86

Query: 90  QRCFGILLVAINQFFAPSNFVITVDKSAKGVL-------KQSWNGAKVELDMPERLILIA 142
           +  F  +L+ I+QFF PS  +I++     G L       +    G  V +D+P R I ++
Sbjct: 87  KLAFARILLIISQFFGPSQLIISIGDGKGGYLDPETFVHRNKQTGKIVSIDLPSRSIWMS 146

Query: 143 NHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGP 202
           NHQ+Y DWLY+WC  Y A+   +I IILK SLKW+P  GWGMQF+++IFL RNWA+D+  
Sbjct: 147 NHQVYTDWLYLWCLAYYADLADSILIILKKSLKWIPFIGWGMQFYRFIFLARNWASDQAQ 206

Query: 203 FSKTLSTLATSKE-------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHE 249
            +K L  +A+  +              L LLIFPEGT+VS  TR  S K+A+K+G+ D E
Sbjct: 207 LAKQLGEVASQNQNDAFSSASTDTAKKLLLLIFPEGTLVSSQTRPVSAKFAEKMGIKDME 266

Query: 250 HVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRN 307
           ++LLPRSTGL FC  +L K +   ++ D ++G  GV      ++ YTLR I+ +G  P  
Sbjct: 267 NLLLPRSTGLFFCLRTLAKEMHDLWLVDFSVGYPGVPPAGHGQDFYTLRSIFMQGVPPPA 326

Query: 308 IHLHI---------------RKYAISEMP--------------------EDEDKFTEWLR 332
           IH+H+                  A++++                     E+   F  WLR
Sbjct: 327 IHVHLTMTRITKPVAGDTSSNAVAVAQLATADIDAPPLGANIKPAESSEEERSAFETWLR 386

Query: 333 QRWIEKDALMEEFYTKGRFTGYE 355
           QRW  KDA M  FYT G F   E
Sbjct: 387 QRWTNKDAEMHRFYTDGDFVQGE 409



>gi|322696586|gb|EFY88376.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Metarhizium
           acridum CQMa 102]
          Length = 446

 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/381 (33%), Positives = 211/381 (55%), Gaps = 43/381 (11%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R   F  +F     A+  +QF+   L+  +  ++ +Y+  T++ F + +  +   + P
Sbjct: 51  ILRGIAFTAYFTFCCFAIVITQFIGAPLYFINREWFYAYMAMTKQSFALTITVMTHIWGP 110

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQ--------------------- 145
           +   I+ D+S  G +  +  G  VE   PER+++IANHQ                     
Sbjct: 111 ATVRISGDESVAGQILAT-PGGGVEFKFPERMVMIANHQVSLHVMMVSPGEIAARWELTA 169

Query: 146 ----IYADWLYVWCFTYL--ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD 199
               IY DWLY+W   Y      HG I IILK+SLK++P  G GM F+ +I++ R  ATD
Sbjct: 170 GAAQIYTDWLYLWWVGYANRPGMHGHIYIILKESLKYIPFIGTGMMFYGFIYMSRKMATD 229

Query: 200 KGPFSKTLSTLATSK---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEH 250
           +   +  L+ L   K         +P+WLL+FPEGT +S   R  S ++A+K GL D +H
Sbjct: 230 QPRLAYRLNKLKKKKIDPSGKAYFDPMWLLLFPEGTNLSRNGREKSFQWAEKNGLKDPDH 289

Query: 251 VLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHL 310
           V+LPRSTG+ FC   L  +V+YVYD T+  EG+ RG++ EEI+ L   YF+G+ P++++L
Sbjct: 290 VMLPRSTGIFFCLNELKDTVEYVYDCTVAYEGIPRGKYGEEIFGLASTYFQGRPPKSVNL 349

Query: 311 HIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKLN 365
           + R++ +++MP  D+ +F  WLR +W +KDALMEE+  +GRF      +T      ++  
Sbjct: 350 YWRRFRVADMPLNDQKEFDTWLRDQWYKKDALMEEYLREGRFPALTGGKTEYVETEVRTK 409

Query: 366 SVFELTQIWYFIVPLVPIMWY 386
             +E+ QI + +V    ++W+
Sbjct: 410 HPWEILQI-FTVVGTAGLLWH 429



>gi|302697513|ref|XP_003038435.1| hypothetical protein SCHCODRAFT_84053 [Schizophyllum commune H4-8]
 gi|300112132|gb|EFJ03533.1| hypothetical protein SCHCODRAFT_84053 [Schizophyllum commune H4-8]
          Length = 458

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 143/401 (35%), Positives = 205/401 (51%), Gaps = 72/401 (17%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSY---------------YQSYIKHTQRC 92
           VR A F + F      +N +QF  LL  P   +Y               Y+  +++T+  
Sbjct: 49  VRAAAFFLIFNFGCLMVNGAQFAFLL--PLRIAYGVLGVFGLGKRLERAYKDGVRYTKGG 106

Query: 93  FGILLVAINQFFAPSNFVITVDKSAKG------VLKQSWNGAKVELDMPERLILIANHQI 146
           FG LLV + Q+FAPS   +T +K   G      V+++   G    LD+P+R +LI NHQ+
Sbjct: 107 FGCLLVLMCQWFAPSTIRVTFEKEGMGWFTDLDVVRRDEQGNIDYLDLPQRFVLIGNHQV 166

Query: 147 YADWLYVWCFTYLANAHGAIK---IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPF 203
           Y DW Y+WC TY     G  K   I LK+SLKWLP+ GWGMQFF +IFL R+WA D+   
Sbjct: 167 YLDWWYMWCLTYFIGPKGVHKNVYITLKNSLKWLPVVGWGMQFFSFIFLARSWAADRAQL 226

Query: 204 SKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGL 259
           + +LS L    E    PL  +++PEGT+VSD TR  SKKYADK+G+ D  H LLPRSTGL
Sbjct: 227 ASSLSRLGMEAEEEDNPLAFILYPEGTLVSDQTRPISKKYADKLGITDMSHTLLPRSTGL 286

Query: 260 HFCAGSLHKSVDY--VYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           H+   SL   +    + D+TI   G+    + ++ YT+R ++ +G YP  IH+H+R + +
Sbjct: 287 HYSLRSLAPRIPNLKLLDVTIVYPGIPPMGYGQDYYTMRSVFLDGVYPPLIHMHMRMFDV 346

Query: 318 S-------------------------------EMPEDEDK-FTEWLRQRWIEKDALMEEF 345
           +                               ++PE E   F  WLR+ W EKD  +E F
Sbjct: 347 ATEVPIGDLSATRANVVPPSGNPGKGKSTVEVDIPEAEKAVFDAWLRRLWTEKDTTIESF 406

Query: 346 YTKGRFTGYESPRTVP-------MKLNSVFELTQIWYFIVP 379
           +  G  TG+ S    P       ++L    E    + F++P
Sbjct: 407 HKNGA-TGHASEGKGPDVGVDLQLRLKRAREYLDAFCFLLP 446



>gi|19111984|ref|NP_595192.1| 1-acylglycerol-3-phosphate acyltransferase (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|74627007|sp|O94361.1|YHOE_SCHPO RecName: Full=Uncharacterized acyltransferase C428.14
 gi|3947878|emb|CAA22289.1| 1-acylglycerol-3-phosphate acyltransferase (predicted)
           [Schizosaccharomyces pombe]
          Length = 350

 Score =  234 bits (598), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 119/325 (36%), Positives = 185/325 (56%), Gaps = 8/325 (2%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           +R   F++  A  S  +  S+ +   L+  +   Y  YI  T+   GIL  A+ Q F+P+
Sbjct: 7   IRKYSFILCLAVGSVTIYTSEVIGTPLYFVNKELYNKYIAFTKSFAGILFTALVQLFSPT 66

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
              +T D   + +     NG  +E    ER I+IANHQ+Y+DW+YVW  +Y A  HG + 
Sbjct: 67  PVTLTYDPELRNLFYLDRNGC-LETIAAERNIVIANHQLYSDWMYVWWLSYTAKQHGHVY 125

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTV 227
           I+LK+SLKWLP+ GWGMQ F++IFL R W  D    S+    +   ++ + L++FPEGT 
Sbjct: 126 IMLKNSLKWLPVIGWGMQLFRFIFLSRKWDKDYETMSRHFKFIRNVRDSVSLILFPEGTN 185

Query: 228 VSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQ 287
           + + T   S+ YADK+G+   +H++LPR  GL +    L  S+ Y+YD T         +
Sbjct: 186 LVESTYQRSRVYADKIGVKMPKHLMLPRVRGLFYSISQLRDSMTYLYDYTFYFSDPSPKK 245

Query: 288 FPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYT 347
           +  + ++L K++FEG   + +H+H+R++ ISE+P +ED+FT+WL QRW EKD L++    
Sbjct: 246 YAADAFSLPKLFFEGVPIKRLHIHVRRFPISEIPTEEDQFTDWLYQRWYEKDKLIDTLLE 305

Query: 348 KGRFTGYESPRTVPMKLNSVFELTQ 372
            G F G       P KL++   L  
Sbjct: 306 TGNFPG-------PKKLHTTVRLKH 323



>gi|320588260|gb|EFX00735.1| phospholipid/glycerol acyltransferase [Grosmannia clavigera kw1407]
          Length = 398

 Score =  234 bits (596), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 209/378 (55%), Gaps = 37/378 (9%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G  +   ++Q L   ++ + FF      +  +Q +   L+  +   +  Y+  T++ FG+
Sbjct: 42  GREKHGRVIQILRGVSLIMFFFT-----IQITQCIGAPLYLINRRLFYDYMAVTKQSFGL 96

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           ++  +  ++ P+   I+ D S  G +K S +  +VE + PERL+LIANHQIY DWLY+W 
Sbjct: 97  VITTMTYWWGPTTIRISGDASVAGQIK-SLSDGRVEFNFPERLVLIANHQIYTDWLYLWW 155

Query: 156 FTYL--ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATS 213
             Y     +HG+I IILK+SLK++PI G GM F+ +IF+ R  A D+   +  L  L   
Sbjct: 156 VGYANKPRSHGSIYIILKESLKYIPIIGPGMMFYGFIFMSRKMAIDRPRMAHRLQKLRAE 215

Query: 214 K---------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAG 264
                     +P+WLL+FPEGT  S+  R+ S K+A+K G+ D EHVLLPRSTG+++C  
Sbjct: 216 HLDPSGNVYYDPMWLLLFPEGTNSSNNGRVKSAKWAEKTGIKDTEHVLLPRSTGMYYCLS 275

Query: 265 SLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDE 324
            L  SVDYVYD T+  EGV+RG+F E+ +TL   Y +GQ P++++ + R++ +  +P D 
Sbjct: 276 ELKGSVDYVYDCTVAYEGVKRGEFGEQHFTLAGTYLQGQPPKSVNFYWRRFRVDNIPLDN 335

Query: 325 DK-FTEWLRQRWI--EKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPLV 381
            + F  WLR+R     KD    E   + R+T               FE+ Q+  F VP  
Sbjct: 336 AELFDTWLRERCAADSKDGPYIETAVRTRYT---------------FEIAQM--FAVPTT 378

Query: 382 PIMWYFSNYLLNRKFTSS 399
            +M      +  R+F++ 
Sbjct: 379 LLMLCNIGIIYWRRFSAG 396



>gi|402219847|gb|EJT99919.1| acyltransferase-domain-containing protein [Dacryopinax sp. DJM-731
           SS1]
          Length = 318

 Score =  230 bits (586), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 120/324 (37%), Positives = 185/324 (57%), Gaps = 30/324 (9%)

Query: 98  VAINQFFAPSNFVITVDKSAK--GVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           + + Q+FAP   VIT D+      +  ++  G  VEL +P++ + IANHQ Y DW+Y+WC
Sbjct: 1   MCVIQWFAPVELVITADEGMNLDAICVRNDKGEVVELRLPQKFVCIANHQCYLDWMYLWC 60

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLA---- 211
             Y A+AH  I IIL D  KW+P+ GWGMQF+++IF+ R+WA D+   ++ L  L     
Sbjct: 61  ALYFAHAHQHIYIILMDRFKWIPVLGWGMQFYRFIFITRSWAADRVYLARKLLELGKHAI 120

Query: 212 TSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD 271
            + +P  LLI+PEGT+VSD TR  S++Y++K G+ D  ++LLPRSTGL F   +L  S+ 
Sbjct: 121 KAAQPFVLLIYPEGTLVSDETRAKSRQYSEKAGIADMVNMLLPRSTGLLFSLRTLAPSIP 180

Query: 272 --YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-------- 321
              V D T+G  G+    + ++ YTLR ++F G  P  +HLHIR +   ++P        
Sbjct: 181 NLAVVDFTVGYAGIPPAGYGQDFYTLRSVFFNGISPPTLHLHIRMWQAKDLPLGDMSDSA 240

Query: 322 --------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
                   E++D F  WL  RW EKD  M+ FY  G F+  +   T  +++ + + + Q 
Sbjct: 241 TRGAEASQEEKDMFDRWLLDRWREKDRWMDGFYKTGEFSNSQGRYTRTLEVKNPWAIAQA 300

Query: 374 WYFIVPLVPIMWYFSNYLLNRKFT 397
           + + VP++      + +LL R F 
Sbjct: 301 FSYGVPVI------TGWLLYRTFA 318



>gi|429859581|gb|ELA34358.1| lysocardiolipin acyltransferase [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 402

 Score =  229 bits (585), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 201/373 (53%), Gaps = 47/373 (12%)

Query: 21  NGRLIVLEIIKMPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHS 80
           N  L+   +   PA G  +   L+Q ++R   F V+FA   A++  +Q +   L+  +  
Sbjct: 40  NAGLLRKPVDAHPA-GRIKHNKLMQ-ILRGVSFAVYFAACCASIFITQLMGCGLYLVNRE 97

Query: 81  YYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLIL 140
            Y +Y+  T++ F +   A+   + P+   I+ D S                        
Sbjct: 98  LYYAYMALTKQSFALTTTAMTHIWGPTKIRISGDAS------------------------ 133

Query: 141 IANHQIYADWLYVWCFTYL--ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWAT 198
                IY DWLY+W   Y      HG I IILK+SLK++P+ GWGM F+ +IF+ R  +T
Sbjct: 134 -----IYTDWLYLWWVAYANEPGMHGHIYIILKESLKYIPLVGWGMMFYGFIFMSRKMST 188

Query: 199 DKGPFSKTLSTLATS---------KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHE 249
           D+   +  L  L            ++P+WLL+FPEGT +S   R  S  +A++ GL D E
Sbjct: 189 DQPRLAHRLGKLKMEHTTPSGKKHRDPMWLLLFPEGTNLSGNGRRKSAAWAEQTGLKDPE 248

Query: 250 HVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIH 309
           H+LLPRSTG++FC   L  ++DYVYD T+  EGV RG++ E  +TL   YF+G+ P++++
Sbjct: 249 HLLLPRSTGMYFCLKELKGTLDYVYDCTVAYEGVPRGKYGESYFTLASTYFQGRPPKSVN 308

Query: 310 LHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT----VPMKL 364
            H R++ +++MP  D+ +F  W+R+RW EKDALMEE+   GRF   E  +       ++L
Sbjct: 309 FHWRRFRVADMPLHDQKEFDAWVRERWYEKDALMEEYLVNGRFPPSEDNKKGYIETEVRL 368

Query: 365 NSVFELTQIWYFI 377
              +EL+Q++  +
Sbjct: 369 KHWWELSQVFVVV 381



>gi|409051449|gb|EKM60925.1| hypothetical protein PHACADRAFT_247149 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 418

 Score =  227 bits (579), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 124/359 (34%), Positives = 196/359 (54%), Gaps = 48/359 (13%)

Query: 78  SHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQ---------SWNGA 128
           +  +Y   I++++   G LLV + Q FAP++ V++ +++  G   +           +G 
Sbjct: 59  AQKWYDEGIRYSKGACGTLLVLVTQLFAPASLVVSFERNGPGAFSREELDRLVVRDGSGR 118

Query: 129 KVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQ 188
              L +P + + IANHQ+YADW YVWC TY A ++  + I+LK SLKWLPI GWGMQ + 
Sbjct: 119 VTALQLPPKAVWIANHQMYADWWYVWCLTYFAGSYKDVFIVLKKSLKWLPIIGWGMQLYN 178

Query: 189 YIFLKRNWATDKGPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVG 244
           +IFL R+WA+D+   +K+LS L+   E    PL  +++PEGT+VS  TR  SKKYADK+G
Sbjct: 179 FIFLSRSWASDRLHLAKSLSWLSAQAEKRDTPLTFVLYPEGTLVSKHTRPLSKKYADKMG 238

Query: 245 LVDHEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
             D+ ++LLPRSTGL +   +L   +    + D+T+   G+    + +  YTLR I+ +G
Sbjct: 239 FPDNRNMLLPRSTGLQYSLRALSPRIRSLQLIDVTVAYPGIPPLGYGQSYYTLRSIFMDG 298

Query: 303 QYPRNIHLHIRKYAIS------------------------------EMPEDE-DKFTEWL 331
             P  +H+H+RK+ +S                              ++P+DE DKF +WL
Sbjct: 299 VPPPQVHMHVRKFDVSRDVPIGDLSKVNPSKLPNVSGGPMKESAETDVPQDEKDKFDKWL 358

Query: 332 RQRWIEKDALMEEFYTKGRFTGYESPRT-VPMKLNSVFELTQIWYFIVPLVPIMWYFSN 389
           R+ W  KD  ++ +   G F    S R  +P+ +    E+   + F +P + + W FS 
Sbjct: 359 RELWTAKDHDVDRYLDCGSFVNDPSLRVEIPIAIRRKREILDAFCFFIPAL-LGWIFSR 416



>gi|485921595|gb|EOD47274.1| putative phospholipid glycerol acyltransferase protein
           [Neofusicoccum parvum UCRNP2]
          Length = 472

 Score =  227 bits (579), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 187/339 (55%), Gaps = 42/339 (12%)

Query: 36  GEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGI 95
           G PQ     Q     ++   F +G   A+N +QF+ L        +Y  YI  T++ F +
Sbjct: 33  GPPQHGEFGQAERGVSIASTFLSG-ILAINAAQFIGLPFKMIDPKFYNDYIAFTKQSFAV 91

Query: 96  LLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
           L+  + Q+++P+                     KV L              Y DWLY+W 
Sbjct: 92  LVTTLTQWWSPT---------------------KVHL--------------YTDWLYLWW 116

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
             Y     G + IILK+S+K +P+ GWG QF+ +IFL RNW  DK  F + L  L+  K+
Sbjct: 117 VAYTNKMAGHVYIILKESIKNIPLIGWGSQFYNFIFLARNWEKDKPRFQEHLQQLSNPKD 176

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYD 275
           P+WL+IFPEGT +S  TR +S+++A+K G+ D  H LLPRSTGL FC  +L  + +++YD
Sbjct: 177 PMWLIIFPEGTNLSKSTRESSRRWAEKNGIQDMRHQLLPRSTGLKFCLENLKHTTEWLYD 236

Query: 276 LTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDK-FTEWLRQR 334
            TI  EGV  GQ+ ++IYTL+  +FEG+ P+++++H R++ IS +P   DK F  WLR R
Sbjct: 237 CTIAYEGVPLGQYGQDIYTLQSSFFEGRPPKSVNMHWRRFRISSIPLHSDKAFEVWLRNR 296

Query: 335 WIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
           W EKD  ++ +  KG F     P T P K +S  E+ +I
Sbjct: 297 WKEKDHYLDYYLRKGAF-----PSTEPWKASSPAEIAKI 330



>gi|169599517|ref|XP_001793181.1| hypothetical protein SNOG_02579 [Phaeosphaeria nodorum SN15]
 gi|160705259|gb|EAT89310.2| hypothetical protein SNOG_02579 [Phaeosphaeria nodorum SN15]
          Length = 798

 Score =  227 bits (578), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 109/234 (46%), Positives = 156/234 (66%), Gaps = 2/234 (0%)

Query: 119 GVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLP 178
           G + +  +G+ ++ D  ER++L+ANHQ+Y DWLY+W   Y  + HG I IILK+SL+ +P
Sbjct: 3   GQMTKKKDGS-LQCDFAERMVLMANHQLYTDWLYLWWIAYTNSMHGFIYIILKESLRNIP 61

Query: 179 IFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKK 238
           I GW  QF+ +IFL RNW  D+  F K L  L    +P+WL+IFPEGT +S  TR  SKK
Sbjct: 62  IIGWSAQFYNFIFLARNWEEDQRTFKKHLGKLNKPNDPMWLIIFPEGTNLSATTREKSKK 121

Query: 239 YADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKI 298
           +A+K  L D +H LLPRSTGL FC   L  + +++YD TI  EGV  GQF ++I+TLR  
Sbjct: 122 WAEKNNLQDMKHQLLPRSTGLRFCLNELKDTTEWLYDCTIAYEGVPPGQFGQDIFTLRST 181

Query: 299 YFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +FEG+ P+++++H R++ +S +P ++   F  WLR RW EKD ++E F    RF
Sbjct: 182 FFEGRPPKSVNMHWRRFHLSTIPLQNTAAFEVWLRNRWREKDYMLEYFARNTRF 235



>gi|213408573|ref|XP_002175057.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase delta
           [Schizosaccharomyces japonicus yFS275]
 gi|212003104|gb|EEB08764.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase delta
           [Schizosaccharomyces japonicus yFS275]
          Length = 387

 Score =  226 bits (576), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 112/334 (33%), Positives = 188/334 (56%), Gaps = 7/334 (2%)

Query: 45  QWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFF 104
           +WLV T +F       +  +  +Q L L L  F  + ++ YI  T++  G+L  ++ + F
Sbjct: 10  KWLVLTYMFTA-----TICVFVTQILGLPLLLFGKNVFRKYISITKKLCGVLFASMTELF 64

Query: 105 APSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           +P+   +  D+  +        G  +E  +P R ++IANHQ+Y+DW+Y+W   Y +N HG
Sbjct: 65  SPTPVTVYYDEELRNQFFLDRTGC-LESIVPPRTVVIANHQLYSDWVYLWWMAYTSNNHG 123

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPE 224
            I I+LKDSLKW+PI GWGMQF+++IFL R W  D+    +    +   K P  L++FPE
Sbjct: 124 NIFIMLKDSLKWVPILGWGMQFYRFIFLSRTWQKDQKTMRQRFDKIRDPKLPATLIMFPE 183

Query: 225 GTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVR 284
           GT + + T   S  YA K+G+   +H++LPR  GL F    L  ++ Y+YD TI  E + 
Sbjct: 184 GTNLVENTYNRSANYAKKIGVPCPKHLMLPRVRGLFFTLQQLRDTMTYLYDYTICFEDIA 243

Query: 285 RGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEE 344
             ++  + + L  ++F+      +H+++R++ I ++P DE  FT+WL  RW+EKD L++E
Sbjct: 244 PCKYAADKFPLSALFFDSVRIDRVHMYVRRFRIEDIPTDEALFTDWLYTRWLEKDKLVDE 303

Query: 345 FYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIV 378
           F    RF     P +  ++L    E+  ++  ++
Sbjct: 304 FTKTKRFPC-SKPLSTTIRLKRKLEILPVYTVVI 336



>gi|328771095|gb|EGF81135.1| hypothetical protein BATDEDRAFT_23875 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 340

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 179/316 (56%), Gaps = 37/316 (11%)

Query: 59  GQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAK 118
           G S A+N  Q LS  L   S   Y++ ++  Q  FG L++ +  F+AP + ++T D    
Sbjct: 22  GCSIAINCRQVLSAPLLLLSRHRYRTEMRKCQGLFGSLILYVTFFYAPLDIILTGDHDG- 80

Query: 119 GVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLP 178
                        L   + ++++ANHQIY DW Y+W   +  NAH  +KI+LK SL++LP
Sbjct: 81  -------------LTSEKSVVIMANHQIYTDWWYIWIICWFRNAHCNLKIMLKASLRFLP 127

Query: 179 IFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKK 238
           I GWGM FF+++F+ R W+ DK      L+     K P+WLLIFPEGTV++D TR  S+ 
Sbjct: 128 ILGWGMTFFEFLFMARKWSKDKPTLQFNLTRAKNDKLPIWLLIFPEGTVITDDTRSKSQA 187

Query: 239 YADKVGLVDH-EHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRK 297
           YA K  + D+ ++VL+PRSTGL+     L   V+Y+YD TIG  G+     P ++Y   K
Sbjct: 188 YAKKADISDNPDNVLIPRSTGLYNSLLLLQPDVEYLYDFTIGYSGLAEHDCPYDMYPTTK 247

Query: 298 IYFEGQYPRNIHLHIRK--------YAISEMPEDEDK--------------FTEWLRQRW 335
           ++FEG+ P+ IH+H+ K        +AI+E  E E K              F+ WLR+R+
Sbjct: 248 VFFEGRGPKQIHVHVDKFKIVTLPGFAIAEGAESETKAVEGNPMDGDTNPEFSLWLRKRF 307

Query: 336 IEKDALMEEFYTKGRF 351
           +EKD L+ +FY  G F
Sbjct: 308 LEKDQLLRQFYKHGSF 323



>gi|395334176|gb|EJF66552.1| hypothetical protein DICSQDRAFT_142143 [Dichomitus squalens
           LYAD-421 SS1]
          Length = 419

 Score =  223 bits (569), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 217/412 (52%), Gaps = 63/412 (15%)

Query: 28  EIIKMPALGEPQS--QNLVQWLVRTAVFV---VFFAGQSAALNFSQFLSLLLWPFSHS-- 80
           E+  +P L  P+   +     L+ +AV++   +   G   A+     L L L PF  +  
Sbjct: 3   ELYTIPILSRPRRTWKQTAHALLSSAVYLFGCIMIHGPQLAI----LLPLRLVPFRRARK 58

Query: 81  -YYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKG---------VLKQSWNGAKV 130
            YY+   ++T+  FG LLV ++Q+FAP+  V++ +   +G         +++++ +G  +
Sbjct: 59  LYYEG-ARYTKGAFGALLVLMSQWFAPTILVLSFETEGQGKFTPEEIEGLVERNSDGRVI 117

Query: 131 ELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYI 190
            L++P++ +LIANHQ+YADW Y W  TY    +  + I+LK SLKW+PI GWGMQF+ +I
Sbjct: 118 ALNLPKKSVLIANHQVYADWWYAWTLTYFMGTYKDVYIVLKRSLKWVPILGWGMQFYNFI 177

Query: 191 FLKRNWATDKGPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLV 246
           FL R+WA+D+   S+ LS LA   E    P   +++PEGT+VS  TR  SKKYADK+G+ 
Sbjct: 178 FLARSWASDRLQLSQGLSWLARRAEKEDWPFTFILYPEGTLVSKDTRPISKKYADKLGIP 237

Query: 247 DHEHVLLPRSTGLHFCAGSLHKSVDY--VYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQY 304
           D  + LLPRSTGLH+   SL   +    + D+T+   G+    + +  YTLR I+ +   
Sbjct: 238 DMTNTLLPRSTGLHYSLRSLAPRIPSLELIDITMAYPGIPYLGYGQSYYTLRSIFCDRVP 297

Query: 305 PRNIHLHIRKYAIS----------------------------EMPEDE-DKFTEWLRQRW 335
           P  +H+HIRK+ +                             E+P  E + F  WLR  W
Sbjct: 298 PPAVHMHIRKFNVRRDIPIGNVPVANPDVLPQGSSRVASVEVEIPRAEAEAFELWLRDLW 357

Query: 336 IEKDALMEEFYTKGRFTGYESPR------TVPMKLNSVFELTQIWYFIVPLV 381
            EKD L+  F+  G  +     +      TVP++L   +E+   + F +P +
Sbjct: 358 REKDRLLNRFFETGYLSAAAESKSGPATVTVPVQLRHTYEILDAFCFFIPAI 409



>gi|430813760|emb|CCJ28918.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 321

 Score =  223 bits (567), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 181/306 (59%), Gaps = 3/306 (0%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
            R+A+F+ F       +   Q L   L+ +  ++Y ++++ T+R  GI  + + Q+  PS
Sbjct: 14  ARSAIFLGFIC-ICIGITILQLLGKPLYFWKQNWYHTFMRRTKRQTGIACIMLLQWLMPS 72

Query: 108 NFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
           + V++ DK      ++  N  + ++ M  R ILI NHQI  DWLY+W   Y+   H  I 
Sbjct: 73  DIVLSGDKKILSDFEELPN-LQEDIQMYNRFILIVNHQISTDWLYIWWIAYIKKIHDGIY 131

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTV 227
           IILKDSL+ +P+ GWGM+ F +IFL R+W+ D       L  L+   E + LL++PEGT 
Sbjct: 132 IILKDSLRKIPVIGWGMKTFGFIFLSRSWSKDYHKLKNHLEHLSLQNESMLLLLYPEGTN 191

Query: 228 VSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQ 287
            S  T+  S  YA K  L   ++VLLPR  GL+ C   L+KS  Y+Y+ TIG +GV   +
Sbjct: 192 FSSNTKPQSLIYAKKKNLPMLDYVLLPRIKGLYLCLMHLNKSTKYLYNCTIGYQGVMYNE 251

Query: 288 FPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFY 346
           + ++I+T + I    ++P N+H+H +K  I+++P ++E+KF  WL + WIEKD LM +F+
Sbjct: 252 YAQDIFTFKSIIMNLKFPENVHIHFQKIDINKIPLDNEEKFKNWLYELWIEKDKLMHQFF 311

Query: 347 TKGRFT 352
            +G F+
Sbjct: 312 NQGYFS 317



>gi|389742176|gb|EIM83363.1| acyltransferase-domain-containing protein [Stereum hirsutum
           FP-91666 SS1]
          Length = 350

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 180/329 (54%), Gaps = 51/329 (15%)

Query: 102 QFFAPSNFVIT---------VDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLY 152
           Q+FAPS  V+T          D   +G++ ++  G  V+L++P + +LIANHQ+YADW+Y
Sbjct: 7   QWFAPSKLVVTFEREGPGAFTDDEVEGLVVKNTKGRVVKLNLPHKSVLIANHQVYADWMY 66

Query: 153 VWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT 212
            WC TY A  H  + I+LK SLKW+PI GWGMQFF +IFL R+WA+D+    K L+T+  
Sbjct: 67  AWCLTYFAGTHRDVYIVLKKSLKWVPILGWGMQFFNFIFLARSWASDRHYLVKELATIGR 126

Query: 213 SKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHK 268
             E    PL  +++PEGT+VS  TR  SKKYADK+G+ D  H LLPRSTGL +   +L  
Sbjct: 127 QAEQTDIPLTFILYPEGTLVSKDTRPISKKYADKIGIPDMVHTLLPRSTGLLYSLRALSP 186

Query: 269 SVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI--------- 317
            +    + D+T+   G+    + +  YTLR I+++   P  +H+HIR++ +         
Sbjct: 187 RIPSLQLIDITVAYPGIPPMGYGQAYYTLRSIFWDRVPPPAVHMHIRRFDVARDVPIGDV 246

Query: 318 -----------------------SEMPE-DEDKFTEWLRQRWIEKDALMEEFYTKGRFTG 353
                                  +++PE ++DKF  WLR+ W+EKD +M  +   G  + 
Sbjct: 247 SKTSPTSLPTTPSNGSAKSTALEADVPEVEKDKFDLWLRELWLEKDKVMSRYLETGSMSP 306

Query: 354 Y---ESPRTVPMKLNSVFELTQIWYFIVP 379
               E    +P+KL    E    + F VP
Sbjct: 307 SLENEPEVVIPVKLRHNRETLGAFMFFVP 335



>gi|50290037|ref|XP_447450.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526760|emb|CAG60387.1| unnamed protein product [Candida glabrata]
          Length = 397

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 184/338 (54%), Gaps = 45/338 (13%)

Query: 50  TAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNF 109
           +   V+     +A L FSQ  + L    +H Y      +T++ F +LL +I +  AP   
Sbjct: 26  SCCVVLLVIQVTAKLRFSQNKTRL----THVY-----NYTKKQFIVLLTSILRIVAPCEI 76

Query: 110 VITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIK 167
            +T D  +  KG   Q  +  ++  ++ ER I I+NHQIY DW+++W   Y  +  G + 
Sbjct: 77  RVTTDNGSIPKGTFYQDSSSGRLRANLLERSITISNHQIYTDWVFLWWLAYAGDKAGNVF 136

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLA---------------- 211
           I+LK SL+ +P+ G+GM+ F +IF+ R WA D+   S  LS +                 
Sbjct: 137 IMLKKSLRKIPVLGYGMENFNFIFMNRKWAYDRVNMSNHLSAIEADSLGCGPISGNKPVK 196

Query: 212 --TSKEPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLP 254
             +  E +W               L++FPEGT +S  TR  ++ YA+K+G V + HVLLP
Sbjct: 197 VNSDGEEVWDMKSSAQRNIKWPYNLILFPEGTNLSAHTRKVNEAYAEKIGRVPYRHVLLP 256

Query: 255 RSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRK 314
           R+TGL FC   L  SVD VYD TIG  G+   ++ ++ Y+L+ I+F G+YP+ + +H+R 
Sbjct: 257 RATGLRFCLQKLRNSVDVVYDTTIGYSGILSTEYGQDAYSLKNIFFRGKYPKLVDIHVRS 316

Query: 315 YAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           + +S++P +DE  F EWL + W EKD +ME FY  G F
Sbjct: 317 FKLSDIPIDDEIDFIEWLFKVWEEKDKMMEYFYEHGTF 354



>gi|50555035|ref|XP_504926.1| YALI0F02937p [Yarrowia lipolytica]
 gi|49650796|emb|CAG77731.1| YALI0F02937p [Yarrowia lipolytica CLIB122]
          Length = 409

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 189/336 (56%), Gaps = 6/336 (1%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R  + V +F     ++  +Q++   L   S   +  ++++T++ F ++++ + Q    
Sbjct: 60  VLRGVIAVFYFLCACLSIVLTQWIGYPLKYQSKMAWVVWVEYTKQQFIVVMLCLVQALTS 119

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ D++ KGV     NG  +     ER I+IANHQ+Y DW+Y+W F   +   G I
Sbjct: 120 TEMRVSGDETMKGVFSVDGNGY-LSSRFEERAIVIANHQLYTDWIYLWWFALTSGFGGCI 178

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGT 226
            I+LK SL+ +PI G GM  + +IFL R WA D+    +    L   + P+WL +FPEGT
Sbjct: 179 YILLKKSLRSIPILGSGMANYNFIFLSRKWADDEQNMKEHFQGLNKLQAPVWLTMFPEGT 238

Query: 227 VVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRG 286
             S      S K+A K+G+   +HVLLPR+TGL F   +L ++VDY+YD T+  EGV RG
Sbjct: 239 NTSHNGTNNSNKFAAKIGVKPMKHVLLPRTTGLRFAIENLAQTVDYLYDCTLAYEGVGRG 298

Query: 287 QFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEF 345
           ++ ++ YTL  ++  GQ P  +  H  K+ I E+P +DE KF +WL   W +KD +M+ F
Sbjct: 299 EYGQDFYTLGNVFLRGQGPVYVKAHWTKFVIKEIPYKDEKKFEKWLYDLWYDKDQMMDNF 358

Query: 346 YTKGRF--TGYESPRTVPMKLNSVFELTQIWYFIVP 379
              G+F     ES +   ++L    +  Q+  F++P
Sbjct: 359 IETGKFFPDNEESEKIAKLQLAHPLQGLQV--FVIP 392



>gi|443917030|gb|ELU37899.1| acyltransferase [Rhizoctonia solani AG-1 IA]
          Length = 404

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 119/273 (43%), Positives = 168/273 (61%), Gaps = 21/273 (7%)

Query: 100 INQFFAPSNFVITVD--KSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFT 157
           + Q+FAP++ ++T +     + V+ +   G   EL +P +++++ NHQIYADW Y+WC  
Sbjct: 1   MCQWFAPTSLIVTYEGGNGIEDVVVRDEGGRVTELKLPPQVVMMPNHQIYADWWYLWCLA 60

Query: 158 YLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATS---- 213
           Y   AH  + IILKDSLKW+PI GWGMQFF++IFL R+WA DK   +  L+ LA +    
Sbjct: 61  YSMRAHADVLIILKDSLKWIPIVGWGMQFFRFIFLARSWAHDKQRLTSHLTRLARTAAGG 120

Query: 214 KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL--HKSVD 271
           + P  LL+FPEGT+VS  TR  S KYA K G+ D +H+LLPRSTGL FC   L  H    
Sbjct: 121 QLPFLLLLFPEGTLVSPNTRPLSAKYAAKTGIQDMQHILLPRSTGLLFCLRVLSPHMPSL 180

Query: 272 YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISE-----MPEDEDK 326
            + D+TI   G+ RG + +  YTLR I+ +G  P  +H+H+R Y ++      +P  E++
Sbjct: 181 KLLDVTIAYPGIPRGGYGQAYYTLRSIFMQGVPPPRVHVHLRLYDVARDVPIGVPRGEEE 240

Query: 327 --------FTEWLRQRWIEKDALMEEFYTKGRF 351
                   F +WL  RW EKD LME+  T+GRF
Sbjct: 241 ANETERAAFDQWLLARWKEKDNLMEQQLTEGRF 273



>gi|365982399|ref|XP_003668033.1| hypothetical protein NDAI_0A06360 [Naumovozyma dairenensis CBS 421]
 gi|343766799|emb|CCD22790.1| hypothetical protein NDAI_0A06360 [Naumovozyma dairenensis CBS 421]
          Length = 383

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 192/369 (52%), Gaps = 26/369 (7%)

Query: 52  VFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVI 111
           + VV F      L   Q  +L++ P +    Q  + +T+R F ++L  I    APS   I
Sbjct: 21  ISVVIFLEGVICLLLLQIFTLMITPTNPQRRQHLLDYTKRLFIVILATILAIVAPSGVRI 80

Query: 112 TVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKII 169
           T DK    +G + +     ++   +    I I NHQIY DW+++W   Y +N  G + I+
Sbjct: 81  TRDKKTITEGTVYKDVKKGRICSILQNHSISICNHQIYTDWIFLWWLAYTSNLGGNVYIM 140

Query: 170 LKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL----------------ATS 213
           LK SL+ +P+ G+GM+ F +IF+ R W  DK    + L  L                   
Sbjct: 141 LKKSLENIPLLGFGMKNFDFIFMSRKWINDKLTLERQLGALNEKSTRLDNPNEQDLKKVH 200

Query: 214 KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYV 273
            EP  L++FPEGTV+S  TR  S  Y  K+G      VLLP  TGL F   +L  ++D +
Sbjct: 201 DEPYNLILFPEGTVLSPTTRSKSLSYGQKIGREPFSTVLLPHETGLRFSLQNLQSTLDIL 260

Query: 274 YDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLR 332
           YD+TIG  GVR+ ++ E +Y L+ I+ EG YP+ + +HIR + I ++P  DE KF++WL 
Sbjct: 261 YDVTIGYSGVRQDEYGENVYGLKSIFLEGHYPKMVDIHIRAFNIEDIPFHDETKFSKWLY 320

Query: 333 QRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPLVPIMWYFSNYLL 392
           + W EK+ L+ ++Y +G F   +   T    +   F+++   +F V + PI+      +L
Sbjct: 321 KVWEEKNKLLNDYYKQGSF---DLDPTNTDSVTDSFKISSYEFFGVLICPIL----TLIL 373

Query: 393 NRKFTSSFI 401
             KF + FI
Sbjct: 374 LVKFIAGFI 382



>gi|393244645|gb|EJD52157.1| acyltransferase-domain-containing protein [Auricularia delicata
           TFB-10046 SS5]
          Length = 435

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 179/308 (58%), Gaps = 28/308 (9%)

Query: 77  FSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKS---AKGVLKQSWNGAKVELD 133
           F+   +   ++ ++ C+  LL+   Q+F+P+   ++++      + VL  +  G  V L+
Sbjct: 66  FASHVHDEIVRWSKGCYSALLLLTTQWFSPTEITVSMEGDNLKPEEVLVYNKKGRLVALN 125

Query: 134 MP-ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFL 192
           +P  R++++ANHQIY+DW++VW   Y  N H  + I+LK SLKW+P+ GWGMQ F+++FL
Sbjct: 126 LPTNRVVVMANHQIYSDWIFVWHLLYFCNLHMDVYIVLKKSLKWVPVVGWGMQVFRFLFL 185

Query: 193 KRNWATDKGPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDH 248
            R+WA DK   ++ L+ +    E    PL L+++PEGT+VS  TR  SKKYADK+G+ D 
Sbjct: 186 ARSWAHDKEYLARKLADIGKLAEQKDQPLALVLYPEGTLVSKDTRPISKKYADKMGISDG 245

Query: 249 EHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPR 306
            + LLPRSTG+ +   SL   V   +V D+T+   G+ R  + +  YTLR + F G  P 
Sbjct: 246 RYTLLPRSTGMQYALRSLSPRVPDLHVLDITVAYPGIPRMGYGQSYYTLRSVGFGGIPPP 305

Query: 307 NIHLHIRKYAI-SEMP-----------------EDEDKFTEWLRQRWIEKDALMEEFYTK 348
            IH+H++ Y +  ++P                 ED  +F EW+R+R+++KD   + +Y  
Sbjct: 306 RIHMHLKLYHVRRDVPIGQISTSGISKEVDGSEEDRVRFEEWIRERFVKKDDEFDRYYAT 365

Query: 349 GRFTGYES 356
           G   G +S
Sbjct: 366 GSLAGTDS 373



>gi|299755809|ref|XP_001828902.2| hypothetical protein CC1G_03696 [Coprinopsis cinerea okayama7#130]
 gi|298411391|gb|EAU92909.2| hypothetical protein CC1G_03696 [Coprinopsis cinerea okayama7#130]
          Length = 355

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 183/334 (54%), Gaps = 54/334 (16%)

Query: 98  VAINQFFAPSNFVITVDKSAKGVLKQ---------SWNGAKVELDMPERLILIANHQI-- 146
           +A++++FAP+  VIT ++   G   Q         +  G  V L++P + + I+NHQ+  
Sbjct: 11  LAVSKWFAPTKLVITFEREGLGKFTQEDIESYIQRNEQGEPVSLNLPTKFVYISNHQVRS 70

Query: 147 ---YADWLYVWCFTYLANAHGAIK---IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK 200
              YADW Y WCFTY ++  G  K   I LK SL+W+PI GWGMQFF +IFL R+WA+D+
Sbjct: 71  LQTYADWWYAWCFTYFSSPKGVHKYVYITLKKSLRWVPIVGWGMQFFNFIFLARSWASDR 130

Query: 201 GPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
              +  L++L  + E    P   +++PEGT+VS  TR  SKK+ADK+G+ D +HVLLPRS
Sbjct: 131 LQLASDLASLGKAAEREHRPFCFMLYPEGTLVSKDTRPISKKFADKIGVDDLKHVLLPRS 190

Query: 257 TGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR- 313
           TGLH+   SL   +    + D T    GV    + +  YTLR I+F+G  P  IHLH+R 
Sbjct: 191 TGLHYSLRSLSPRIQKLKLLDATTVYPGVPPMGYGQNYYTLRSIFFDGVPPPAIHLHLRM 250

Query: 314 ---------------------KYAISEM---PEDEDKFTEWLRQRWIEKDALMEEFYTKG 349
                                K A  E+   P +++ F  WLRQ W EKD+ +E F++ G
Sbjct: 251 FDVRTDVPIGDLSSTKSTPGEKGATPEVEIPPAEKEIFDAWLRQLWQEKDSTIETFHSSG 310

Query: 350 RFTGYESPRT----VPMKLNSVFELTQIWYFIVP 379
            F+    P T    VP++L   +E+   + F  P
Sbjct: 311 SFS--RQPDTTVVEVPLQLRRKWEVLDAFCFFWP 342



>gi|444323443|ref|XP_004182362.1| hypothetical protein TBLA_0I01850 [Tetrapisispora blattae CBS 6284]
 gi|387515409|emb|CCH62843.1| hypothetical protein TBLA_0I01850 [Tetrapisispora blattae CBS 6284]
          Length = 384

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 202/371 (54%), Gaps = 30/371 (8%)

Query: 48  VRTAVFVVFFAGQSAALNF-SQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           V T +  +  + Q   + F SQ +  LL+  + +  Q YI HT+  F  L+++I   FAP
Sbjct: 11  VITPILSIIISVQGCVMIFGSQCIIKLLYRNNPNKRQRYIDHTETAFVSLIMSILTIFAP 70

Query: 107 SNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           S+  IT +K +   G + +     ++   +    ++IANHQIY DW+++W   Y ++  G
Sbjct: 71  SSVRITTEKDSIPSGSIIKDPKKRRIISKLLPNSVMIANHQIYTDWIFLWWLCYTSDLAG 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKTL 207
            + I+LK+SL  +P+ G GM+ + +IFLKR+W  DK                 GP +K +
Sbjct: 131 NVVIMLKESLSKIPVIGGGMKNYNFIFLKRHWENDKVTMNKYLNNMNENSFGTGPIAKEV 190

Query: 208 STLATSKE------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHF 261
                 K+      P  LL+FPEGT +S  TR  S +YA K+     E  LLP +TGL++
Sbjct: 191 IKHKECKDQEVIRWPYCLLLFPEGTNLSKNTRSKSDRYAKKIDRKGFECCLLPHATGLYY 250

Query: 262 CAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP 321
              SL  S+D VYD+TIG  GV++ ++ E IYT++ I+ EG+ P+ + +HIR + ++E+P
Sbjct: 251 SLESLKPSLDVVYDVTIGYSGVKKHEYGELIYTMKNIFLEGKPPKLVDIHIRAFKLNEIP 310

Query: 322 EDE-DKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPL 380
            D  ++FTEWL + W EKD  + ++Y  G F    S  ++  ++   F++      +V +
Sbjct: 311 LDSIEEFTEWLFKVWQEKDQRLIKYYETGHFG---SDPSLSDQIIDDFKINSSEVAMVMM 367

Query: 381 VPIMWYFSNYL 391
           +PI      YL
Sbjct: 368 LPICGIIITYL 378



>gi|256269001|gb|EEU04343.1| Cst26p [Saccharomyces cerevisiae JAY291]
          Length = 397

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/372 (34%), Positives = 201/372 (54%), Gaps = 43/372 (11%)

Query: 53  FVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVIT 112
            ++FF G    L F Q     L+  +    Q  +  T+R F +L+ +I    APS   IT
Sbjct: 20  LLIFFQG-CLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSSILHVVAPSAVRIT 78

Query: 113 VDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIIL 170
            + S+  KG         ++   +    + I NHQIY DW+++W   Y +N    + IIL
Sbjct: 79  TENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIFLWWLAYTSNLGANVFIIL 138

Query: 171 KDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------------- 214
           K SL  +PI G+GM+ + +IF+ R WA DK   S +L+ L ++                 
Sbjct: 139 KKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITE 198

Query: 215 --EPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
             E +W               L++FPEGT +S  TR  S KYA K+G    ++VLLP ST
Sbjct: 199 EGESIWNPEFIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYATKIGKKPFKNVLLPHST 258

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           GL +    L  S++ +YD+TIG  GV++ ++ E IY L+ I+ EG+YP+ + +HIR + +
Sbjct: 259 GLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDV 318

Query: 318 SEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF-TGYESPRTV--PMKLNSVFELTQI 373
            ++P EDE++F+EWL + W EKDALME +Y+ G F +  E+  +V    K+N + ELT++
Sbjct: 319 KDIPLEDENEFSEWLYKIWNEKDALMERYYSTGSFVSDPETNHSVTDSFKINRI-ELTEV 377

Query: 374 WYFIVPLVPIMW 385
              I+P + I+W
Sbjct: 378 --LILPTLTIIW 387



>gi|6319516|ref|NP_009598.1| Cst26p [Saccharomyces cerevisiae S288c]
 gi|586485|sp|P38226.1|CST26_YEAST RecName: Full=Uncharacterized acyltransferase CST26; AltName:
           Full=Chromosome stability protein 26
 gi|536266|emb|CAA84984.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285810377|tpg|DAA07162.1| TPA: Cst26p [Saccharomyces cerevisiae S288c]
 gi|349576419|dbj|GAA21590.1| K7_Ybr042cp [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392300879|gb|EIW11968.1| Cst26p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 397

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/372 (34%), Positives = 201/372 (54%), Gaps = 43/372 (11%)

Query: 53  FVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVIT 112
            ++FF G    L F Q     L+  +    Q  +  T+R F +L+ +I    APS   IT
Sbjct: 20  LLIFFQG-CLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSSILHVVAPSAVRIT 78

Query: 113 VDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIIL 170
            + S+  KG         ++   +    + I NHQIY DW+++W   Y +N    + IIL
Sbjct: 79  TENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIFLWWLAYTSNLGANVFIIL 138

Query: 171 KDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------------- 214
           K SL  +PI G+GM+ + +IF+ R WA DK   S +L+ L ++                 
Sbjct: 139 KKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITE 198

Query: 215 --EPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
             E +W               L++FPEGT +S  TR  S KYA K+G    ++VLLP ST
Sbjct: 199 EGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYAAKIGKKPFKNVLLPHST 258

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           GL +    L  S++ +YD+TIG  GV++ ++ E IY L+ I+ EG+YP+ + +HIR + +
Sbjct: 259 GLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDV 318

Query: 318 SEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF-TGYESPRTV--PMKLNSVFELTQI 373
            ++P EDE++F+EWL + W EKDALME +Y+ G F +  E+  +V    K+N + ELT++
Sbjct: 319 KDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSFVSDPETNHSVTDSFKINRI-ELTEV 377

Query: 374 WYFIVPLVPIMW 385
              I+P + I+W
Sbjct: 378 --LILPTLTIIW 387



>gi|367013352|ref|XP_003681176.1| hypothetical protein TDEL_0D03810 [Torulaspora delbrueckii]
 gi|359748836|emb|CCE91965.1| hypothetical protein TDEL_0D03810 [Torulaspora delbrueckii]
          Length = 399

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 186/355 (52%), Gaps = 38/355 (10%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           LV   + ++     S +L  SQ +  L +P      Q    +T++ F  LL++I  F +P
Sbjct: 13  LVVAVLSIIMMIFGSTSLVASQAVFQLCYPKGSPQLQQKYNYTKKAFISLLISILNFVSP 72

Query: 107 SNFVITVDKS--AKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           S   I+ D +  AKG   +S NG K+   +  R I+IANHQIY DW+++W     +N   
Sbjct: 73  SAIRISTDNATIAKGTFYKS-NG-KLMSHLKHRSIIIANHQIYTDWVFLWWLLSTSNLAS 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE--------- 215
            I IILK SL+ +PI G+GM+ F++IF+ R W  DK     +L T+  +           
Sbjct: 131 NIFIILKKSLESIPILGYGMRNFRFIFISRRWVQDKITLQNSLGTIDANSRGVGPLSGNQ 190

Query: 216 -----------------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVL 252
                                  P  LL+FPEGT +S  TR  S  +A+KVG     HVL
Sbjct: 191 PLRVEEDGEMFWNTNKVDESKSWPYSLLLFPEGTNLSPTTRRRSASFAEKVGQQAFRHVL 250

Query: 253 LPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHI 312
           LP +TGL      L  SV+ VYD+TIG  GV R  + E IY L  I+  G+ P+ + +HI
Sbjct: 251 LPHATGLRTSLKLLGPSVEVVYDITIGYSGVGRDTYGEMIYRLPNIFLRGETPKLVDMHI 310

Query: 313 RKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFT-GYESPRTVPMKLN 365
           R + ++E+P +DE++F +WL + W EKD LME +YTKG F    E  +TV  K N
Sbjct: 311 RAFNVAEIPVDDEEEFNQWLYKVWKEKDDLMETYYTKGSFDLDPELDQTVVGKFN 365



>gi|366998367|ref|XP_003683920.1| hypothetical protein TPHA_0A04110 [Tetrapisispora phaffii CBS 4417]
 gi|357522215|emb|CCE61486.1| hypothetical protein TPHA_0A04110 [Tetrapisispora phaffii CBS 4417]
          Length = 409

 Score =  207 bits (528), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 172/309 (55%), Gaps = 40/309 (12%)

Query: 83  QSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLIL 140
           Q+    T++ F + LV + Q  APS+  IT D  +  K   +      ++   +    ++
Sbjct: 49  QNATNFTKKLFILTLVTLLQIVAPSSVRITYDNKSIPKDTFRIDLKSTRIISSLKPNSVI 108

Query: 141 IANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK 200
           I+NHQIY DW+++W  TY +N  G I IILK+SL+ +P+ G+GM  +++IFL+R+W TDK
Sbjct: 109 ISNHQIYTDWVFLWWLTYTSNLSGNIYIILKNSLQSIPLLGYGMTNYKFIFLERDWKTDK 168

Query: 201 GPFSKTLS-------------------TLATSKE------------------PLWLLIFP 223
                 L                     L T +E                  P  L++FP
Sbjct: 169 LTLHNMLGMLQAESKGQGYLAGNAPNVNLETGEEHWTFNQNNNHQSTNNKKWPYCLILFP 228

Query: 224 EGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGV 283
           EGT +S  TR  SK+YA K+    +++VLLPR TGL +   +L +SVD +YD+TIG  GV
Sbjct: 229 EGTNLSSNTRKKSKEYALKINRPYYKNVLLPRVTGLRYSLQTLRESVDVLYDVTIGYSGV 288

Query: 284 RRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED-EDKFTEWLRQRWIEKDALM 342
           ++ ++ E IY L KI+FEG+ P+ + +HIR + I E+P D E+KFT+WL   W EKD LM
Sbjct: 289 KKHEYGELIYRLPKIFFEGKMPKLVDIHIRAFKIEEIPVDNENKFTDWLLNVWKEKDELM 348

Query: 343 EEFYTKGRF 351
           E +Y  G F
Sbjct: 349 EYYYDNGSF 357



>gi|254577079|ref|XP_002494526.1| ZYRO0A03586p [Zygosaccharomyces rouxii]
 gi|238937415|emb|CAR25593.1| ZYRO0A03586p [Zygosaccharomyces rouxii]
          Length = 400

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 185/341 (54%), Gaps = 36/341 (10%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR  + +V F   S  +   Q +  +++  + +     I  T++ F  +L++     AP
Sbjct: 17  MVRVIIALVIFVQASLCITSMQVIVRVVYHNNVAKRHHGIDFTKKAFISMLISTLHLIAP 76

Query: 107 SNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           S   +T D ++  KG   +     ++   +  + +++ANHQIY DW+++W  T  A+  G
Sbjct: 77  SAVRVTTDNNSIPKGTFYKDLKNGRIASHLKRKSVIVANHQIYTDWVFLWWLTSTADLAG 136

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFS--- 204
            + IILK SL+++PI G+GM+ +++IF+ R W  D+                 GP S   
Sbjct: 137 KVYIILKKSLEYIPILGFGMRNYKFIFMCRKWEQDRLTLHNSLGVIDANSRGVGPISGRS 196

Query: 205 ------------KTLSTLATSKE-PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHV 251
                        T ST A  +  P  L++FPEGT +S +TR  S  YA+K+G    E+V
Sbjct: 197 PVREDADGEIFWDTTSTNARQESWPYCLILFPEGTNLSPITRQRSFNYANKIGKTPFENV 256

Query: 252 LLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH 311
           LLP +TG       L  S+D VYD+TIG  GV++G++ E +YTL  + F+G+ P+ + +H
Sbjct: 257 LLPHATGARHSLLKLRPSLDVVYDITIGYSGVKKGEYGEALYTLNNVVFKGESPKLVDMH 316

Query: 312 IRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           I+ Y I+E+P +DE +F++WL   W EKD LM  +Y KG F
Sbjct: 317 IKAYHINEIPIDDEQQFSDWLYDLWAEKDRLMNVYYEKGTF 357



>gi|366996847|ref|XP_003678186.1| hypothetical protein NCAS_0I01760 [Naumovozyma castellii CBS 4309]
 gi|342304057|emb|CCC71844.1| hypothetical protein NCAS_0I01760 [Naumovozyma castellii CBS 4309]
          Length = 394

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 195/368 (52%), Gaps = 31/368 (8%)

Query: 44  VQWLVRTAVF----VVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVA 99
           +++ VR   F    +V F   + AL  +Q + L L        +  +  T+R F ++L+ 
Sbjct: 15  IRYNVRKICFPFISIVIFVQDTMALLSAQAIGLFLLSNDPLKVRHLLDATKRAFIVILMT 74

Query: 100 INQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFT 157
           I    APS   IT D          +     ++   +    I I NHQIY DW+ +W   
Sbjct: 75  ILTIVAPSTIRITTDNKTITPSTFYRDPKKGRICSQLRNNSITICNHQIYTDWILLWWLA 134

Query: 158 YLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL-----AT 212
           Y +   G + I+LK SL+ +P+ G+GM+ F +IF+ R WA+DKG   K L+ +       
Sbjct: 135 YTSTLAGKVYIMLKKSLEKIPVLGYGMKNFNFIFMDRKWASDKGTLDKQLTEIDARARGI 194

Query: 213 SK----------------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
           SK                EP  L++FPEGTV+S+ TR  S  YA KVG    + VLLP +
Sbjct: 195 SKMQKLHDKEIKKADAGVEPYNLILFPEGTVLSENTRNQSLAYAKKVGRSPFKCVLLPHT 254

Query: 257 TGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYA 316
           TGL F    L  S+D +YD+TIG  GV++  + E  Y L+ I+FEG+YP+ + ++IR Y 
Sbjct: 255 TGLRFSLQRLKPSLDILYDVTIGYSGVKQDDYGENTYGLKSIFFEGKYPKLVDIYIRSYD 314

Query: 317 ISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWY 375
           I ++P ++E++F EW+ + W EKD L+E +Y  G F  ++  +     +NS F++  + +
Sbjct: 315 IKDIPLDNEEEFIEWIYKVWQEKDLLLENYYKYGCF--HQDEKLSTSVVNS-FKINPLEF 371

Query: 376 FIVPLVPI 383
           +   L+PI
Sbjct: 372 YGALLLPI 379



>gi|151946433|gb|EDN64655.1| chromosome stability-related protein [Saccharomyces cerevisiae
           YJM789]
 gi|190408791|gb|EDV12056.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207347768|gb|EDZ73842.1| YBR042Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|290878058|emb|CBK39117.1| Cst26p [Saccharomyces cerevisiae EC1118]
 gi|323334531|gb|EGA75905.1| Cst26p [Saccharomyces cerevisiae AWRI796]
 gi|323338847|gb|EGA80062.1| Cst26p [Saccharomyces cerevisiae Vin13]
 gi|323349683|gb|EGA83898.1| Cst26p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 397

 Score =  207 bits (526), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 201/372 (54%), Gaps = 43/372 (11%)

Query: 53  FVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVIT 112
            ++FF G    L F Q     L+  +    Q  +  T+R F +L+ +I    APS   IT
Sbjct: 20  LLIFFQG-CLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSSILHVVAPSAVRIT 78

Query: 113 VDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIIL 170
            + S+  KG         ++   +    + I NHQIY DW+++W   Y +N    + IIL
Sbjct: 79  TENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIFLWWLAYTSNLGANVFIIL 138

Query: 171 KDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK---------------- 214
           K SL  +PI G+GM+ + +IF+ R WA DK   S +L+ L ++                 
Sbjct: 139 KKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITE 198

Query: 215 --EPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRST 257
             E +W               L++FPEGT +S  TR  S KYA K+G    ++VLLP ST
Sbjct: 199 EGESIWNPEFIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYATKIGKKPFKNVLLPHST 258

Query: 258 GLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAI 317
           GL +    L  S++ +YD+TIG  GV++ ++ E IY L+ I+ EG+YP+ + +HIR + +
Sbjct: 259 GLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDV 318

Query: 318 SEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF-TGYESPRTV--PMKLNSVFELTQI 373
            ++P +DE++F+EWL + W EKDALME +Y+ G F +  E+  +V    K+N + ELT++
Sbjct: 319 KDIPLDDENEFSEWLYKIWNEKDALMERYYSTGSFVSDPETNHSVTDSFKINRI-ELTEV 377

Query: 374 WYFIVPLVPIMW 385
              I+P + I+W
Sbjct: 378 --LILPTLTIIW 387



>gi|156844513|ref|XP_001645319.1| hypothetical protein Kpol_1037p58 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115979|gb|EDO17461.1| hypothetical protein Kpol_1037p58 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 398

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 172/309 (55%), Gaps = 37/309 (11%)

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQI 146
           T+R F ILLV++    APS+  IT +     +G   +     ++   + ++ ++I NHQI
Sbjct: 56  TKRGFIILLVSVLNIVAPSSVRITTEDETIPRGTFIKDLKKGRIVSHLNKKSVMICNHQI 115

Query: 147 YADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKT 206
           Y DW+++W  TY +N  G + I+LK SL+++PI G+GM+ +++IFL R WA D+   +  
Sbjct: 116 YTDWVFLWWITYTSNLAGNVYIMLKKSLEFIPILGYGMKNYRFIFLCRKWAVDRLVMNNQ 175

Query: 207 LSTL------------ATSKE----------------------PLWLLIFPEGTVVSDVT 232
           L  +            ++ KE                      P  +++FPEGT +S  T
Sbjct: 176 LGEIDADARGCGIVSGSSPKEINEEGEESWDTSIIGDRTNVKWPYSVILFPEGTNMSVAT 235

Query: 233 RITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEI 292
           R  SK++A KV    +E+VLLPRSTGL F    L  S+D VYD+TIG  GV++ ++ E I
Sbjct: 236 RQKSKEFAAKVNRKPYENVLLPRSTGLRFTLQKLSTSIDVVYDVTIGYSGVKKDEYGELI 295

Query: 293 YTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           Y L KI+ EG+ P+ I +H+R   I ++P +DEDKF  WL   W EKD LME +Y  G F
Sbjct: 296 YRLPKIFLEGKMPKLIDIHMRALKIEDIPIDDEDKFNNWLYDIWQEKDELMEFYYKNGTF 355

Query: 352 TGYESPRTV 360
              E+   V
Sbjct: 356 KTNENCSEV 364



>gi|401840297|gb|EJT43172.1| CST26-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 398

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/380 (33%), Positives = 204/380 (53%), Gaps = 43/380 (11%)

Query: 45  QWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFF 104
           +++V     ++FF G    L F Q     ++  +    Q+ +  T+R F +L+ +I    
Sbjct: 12  KFVVPGVSLLIFFQG-CIILLFLQVTYKTIYCRNAIRKQAGLNRTKRLFIVLVSSILHVV 70

Query: 105 APSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA 162
           APS   IT + S+  KG   +     ++   +    + I NHQIY DW+++W   Y +N 
Sbjct: 71  APSAVRITTENSSIPKGTFFKDPRKNRILSHLKPNSVAICNHQIYTDWIFLWWLAYTSNL 130

Query: 163 HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-------- 214
              + IILK SL  +PI G+GM+ + +IF+ R WA DK   S +L+ L ++         
Sbjct: 131 AANVFIILKKSLASIPIIGFGMKNYHFIFMSRKWAQDKITLSNSLAGLDSNARGIGSLAG 190

Query: 215 ----------EPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHE 249
                     E +W               L++FPEGT +S  TR  S +YA K+G    +
Sbjct: 191 RSPERISEEGESIWNPEIIDPEQTHWPYNLILFPEGTNLSADTRQKSARYAAKIGKKPFK 250

Query: 250 HVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIH 309
           +VLLP STGL F    L  S+  +YD+TIG  GV++ ++ EEIY L+ I+ EG+YP+ + 
Sbjct: 251 NVLLPHSTGLRFSLQKLKPSIGVLYDVTIGYSGVKQEEYGEEIYGLKSIFLEGRYPKLVD 310

Query: 310 LHIRKYAISEMPED-EDKFTEWLRQRWIEKDALMEEFYTKGRFTG-YESPRTV--PMKLN 365
           +HIR + + ++P D E++F+EWL + W EKDAL+E +Y+ G F    E+  +V    K+N
Sbjct: 311 IHIRAFDVRDIPLDGENEFSEWLYKTWSEKDALLERYYSTGSFVADVEANHSVTDSFKIN 370

Query: 366 SVFELTQIWYFIVPLVPIMW 385
            + EL ++   I+P + I+W
Sbjct: 371 RI-ELIEV--LILPTLTIIW 387



>gi|365762104|gb|EHN03714.1| Cst26p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 398

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/380 (33%), Positives = 204/380 (53%), Gaps = 43/380 (11%)

Query: 45  QWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFF 104
           +++V     ++FF G    L F Q     ++  +    Q+ +  T+R F +L+ +I    
Sbjct: 12  KFVVPGVSLLIFFQG-CIILLFLQVTYKTIYCRNAIRKQAGLNRTKRLFIVLVSSILHVV 70

Query: 105 APSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANA 162
           APS   IT + S+  KG   +     ++   +    + I NHQIY DW+++W   Y +N 
Sbjct: 71  APSAVRITTENSSIPKGTFFKDPRKNRILSHLKPNSVAICNHQIYTDWIFLWWLAYTSNL 130

Query: 163 HGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK-------- 214
              + IILK SL  +PI G+GM+ + +IF+ R WA DK   S +L+ L ++         
Sbjct: 131 AANVFIILKKSLASIPIIGFGMKNYHFIFMSRKWAQDKTTLSNSLAGLDSNARGIGSLAG 190

Query: 215 ----------EPLW---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHE 249
                     E +W               L++FPEGT +S  TR  S +YA K+G    +
Sbjct: 191 KSPERISEEGESIWNPEIIDPEQTHWPYNLILFPEGTNLSADTRQKSARYAAKIGKKPFK 250

Query: 250 HVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIH 309
           +VLLP STGL F    L  S+  +YD+TIG  GV++ ++ E+IY L+ I+ EG+YP+ + 
Sbjct: 251 NVLLPHSTGLRFSLQKLKPSIGVLYDVTIGYSGVKQKEYGEQIYGLKSIFLEGRYPKLVD 310

Query: 310 LHIRKYAISEMPED-EDKFTEWLRQRWIEKDALMEEFYTKGRFTG-YESPRTV--PMKLN 365
           +HIR + + ++P D E++F+EWL + W EKDAL+E +Y+ G F    E+  +V    K+N
Sbjct: 311 IHIRAFDVRDIPLDGENEFSEWLYKTWSEKDALLERYYSTGSFVADVEANHSVTDSFKIN 370

Query: 366 SVFELTQIWYFIVPLVPIMW 385
            + EL ++   I+P + I+W
Sbjct: 371 RI-ELIEV--LILPTLTIIW 387



>gi|393213204|gb|EJC98701.1| acyltransferase-domain-containing protein [Fomitiporia mediterranea
           MF3/22]
          Length = 455

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 183/372 (49%), Gaps = 71/372 (19%)

Query: 53  FVVFFAG----QSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
             VF  G     +A L F   L L+    +   Y+  +++T+  FG L   + Q FAP++
Sbjct: 30  LAVFLTGCIILHAAQLAFMLPLRLVPSRRARELYERGVRYTKGAFGSLATLMCQLFAPTS 89

Query: 109 FVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYL 159
             +T +    G         ++ +  +G  VEL +P ++++IANHQIYADW +VWC TY 
Sbjct: 90  LRVTFETEGIGAFTPEQVEQIVVRDASGKVVELRLPPKMVIIANHQIYADWWFVWCLTYF 149

Query: 160 ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE---- 215
            N H  + I+LK SLKW+P+ GWGMQ F++IFL R+WA+DK      L+ L    +    
Sbjct: 150 MNIHQGLFIVLKKSLKWVPVLGWGMQIFRFIFLARSWASDKHYLVSRLAKLGRKAQLEDT 209

Query: 216 PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YV 273
           PL ++I+PEGTV S  TR  SKKYADK+G+ D  H LLPRSTGL +   +L   V    +
Sbjct: 210 PLAIIIYPEGTVPSKNTRPISKKYADKMGIEDMTHTLLPRSTGLQYSLRALVPRVRNLKL 269

Query: 274 YDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR-------------------- 313
            D+T+   G+      +  YT+R I+ +   P  +H+H+R                    
Sbjct: 270 LDITVAYPGIPPATDGQTFYTIRSIFMDRVPPPIVHMHLRLLDVASEVPIGDLSGSNPAV 329

Query: 314 --------------KYAISE-------MP-----------EDEDKFTEWLRQRWIEKDAL 341
                          Y ISE       +P           ++   F EWLR  W  KDA 
Sbjct: 330 TPPVTAGESPSKPSSYPISEQANGHVNLPGKTTVEADVSEKERVAFDEWLRALWRVKDAK 389

Query: 342 MEEFYTKGRFTG 353
           +EEF+   + TG
Sbjct: 390 LEEFHRSAQKTG 401



>gi|392576346|gb|EIW69477.1| hypothetical protein TREMEDRAFT_30543 [Tremella mesenterica DSM
           1558]
          Length = 430

 Score =  204 bits (518), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 174/331 (52%), Gaps = 52/331 (15%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDK--SAKGVLKQSWNGAKVELDMPERLI 139
           + S I  T+  +G LL+AI   FAP + ++T D   S   ++++  NG   ++++P+RL+
Sbjct: 65  FDSAIGWTKDGYGRLLIAITCLFAPHSIILTTDSPPSLTDLVERDENGRMTKINLPDRLV 124

Query: 140 LIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD 199
           +++NHQ Y+DW+Y+W     +     I I+LK SLK LP+ GWGMQFF +IF++R+W  D
Sbjct: 125 IMSNHQAYSDWMYLWILACYSGHAKGIIILLKISLKKLPVVGWGMQFFNFIFMRRSWIAD 184

Query: 200 KGPFSKTLSTLA--------------------TSKEPLWLLIFPEGTVVSDVTRITSKKY 239
           K   +K L  L                     +S+ PLWL+IFPEGT+ SD   I SK+Y
Sbjct: 185 KTNLTKALLDLGRKSQSKIEKYPSDKSSLLSNSSRAPLWLIIFPEGTITSDEEGIKSKRY 244

Query: 240 ADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRK 297
           ADK  + D E +LLPRSTGL F   +L   +    + D+TIG  GV+ G++P+  Y L  
Sbjct: 245 ADKENIEDFETLLLPRSTGLLFSLRTLLPQIPDLKLMDVTIGYPGVKIGEYPQNHYGLLS 304

Query: 298 IYFEGQYPRNIHLHIRKY---------------------AISEM----PEDEDKFTEWLR 332
           I+     P  IH+H+  Y                       SE+    PE+  +F  WLR
Sbjct: 305 IFLNSIPPPCIHIHLHIYDQLSSLTSGIPSLVPTSSTGEVTSEIGLASPEEAKEFELWLR 364

Query: 333 QRWIEKDALMEEFYTKGRF---TGYESPRTV 360
             W EK+  M+ FY   RF    G E  R V
Sbjct: 365 GVWREKEERMKRFYKDQRFYSQEGGEDAREV 395



>gi|384486573|gb|EIE78753.1| hypothetical protein RO3G_03458 [Rhizopus delemar RA 99-880]
          Length = 334

 Score =  203 bits (516), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 173/318 (54%), Gaps = 44/318 (13%)

Query: 102 QFFAPSNFVITVDKSA------------------KGVLKQSWNGAKVELDMPERLILIAN 143
           + FAP + +IT+D+S                   + +L ++ +G  + +  P++LI++AN
Sbjct: 13  RLFAPGDLIITLDESCTRGENEIDGEDDNEEDRLERLLSRNKSGEVIGISFPDKLIMMAN 72

Query: 144 HQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPF 203
           HQI  DW+YVW   YL+ AHG++KI+LK SL  +PI+G  ++             DK   
Sbjct: 73  HQILVDWIYVWFLAYLSKAHGSLKIMLKHSLSLIPIYGTRLEH------------DKDTV 120

Query: 204 SKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCA 263
            K L        P+WL++FPEGTV+SD TR  SK +A K  + D++  LLPR+TGL  C 
Sbjct: 121 IKNLERAKKRDNPMWLVLFPEGTVISDDTRARSKAFAQKFNMDDYKFALLPRTTGLLLCK 180

Query: 264 GSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMPED 323
             L   V ++YDLTIG   +  G+ PE++ T+++I+ +   P  IH+H+R+Y I  +P D
Sbjct: 181 DVLGDKVQWLYDLTIGYPDIPAGENPEDVMTMKRIFCDRNGPHKIHIHVRRYRIDTLPSD 240

Query: 324 EDKFTEWLRQRWIEKDALMEEFYTKGRFT-----------GYESPRT--VPMKL-NSVFE 369
             +FT+WL  RW EKD  +  +   G+F             Y   RT  +P+KL ++V E
Sbjct: 241 PVQFTQWLFDRWAEKDKRLIYYNQHGKFPEEPILEDEDELCYRRDRTIKIPIKLQHTVRE 300

Query: 370 LTQIWYFIVPLVPIMWYF 387
               W + +  VP++  F
Sbjct: 301 CFGYWLYFLFYVPLVLAF 318



>gi|321249081|ref|XP_003191336.1| acyltransferase [Cryptococcus gattii WM276]
 gi|317457803|gb|ADV19549.1| Acyltransferase, putative [Cryptococcus gattii WM276]
          Length = 420

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 179/356 (50%), Gaps = 53/356 (14%)

Query: 53  FVVFFAGQSAALNFSQFL--SLLLWPF-SHSYYQSYIKHTQRCFGILLVAINQFFAPSNF 109
           F + F      +N +QFL   LLL PF     +   I  T+  +G LL+AI   F P+ F
Sbjct: 26  FPIIFTLAQLGINSAQFLFIPLLLVPFVGKRLFSRAIGWTKDGYGRLLIAITILFGPTQF 85

Query: 110 VITVDKS---AKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
            IT D      + ++++  NG  V++++P+RL+++ANHQ Y DW+Y+W     A     +
Sbjct: 86  AITTDTPPSHGQSLVERDVNGQVVKINLPDRLVIMANHQAYLDWIYIWILACYAGHSPGL 145

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATS------------- 213
            I+LK SLK +P+ GWGM+FF +IFL+R+WA+D+   +  L  L                
Sbjct: 146 IILLKASLKNIPVVGWGMRFFNFIFLRRSWASDRNNLTLALRQLGKEAQSGQENSETSRL 205

Query: 214 -----KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHK 268
                K PLWLLIFPEGT+VSD  R+ S KYA + G+ D   +L PRSTGL FC  +L  
Sbjct: 206 LPLRKKSPLWLLIFPEGTIVSDEERVKSIKYAKREGIDDFATLLHPRSTGLLFCLRTLLP 265

Query: 269 SVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP----- 321
            +    + D+TIG  GV  G++ +  Y L  ++ +   P  ++LH+  Y+    P     
Sbjct: 266 QIPDLNLLDITIGYPGVPFGKYAQNWYGLFSVFLKSVPPPTVYLHLHVYSHLGEPECKIP 325

Query: 322 ----------------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYE 355
                                 E+   F  WLR+ W  K+  ME+FY   RF  + 
Sbjct: 326 SLVPRQSPRISGLSADWGLANAEEARAFELWLRKVWTAKERRMEQFYESQRFADHH 381



>gi|323305582|gb|EGA59323.1| YDR018C-like protein [Saccharomyces cerevisiae FostersB]
          Length = 403

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQIYADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQIYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVXLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|472584266|gb|EMS21872.1| lysocardiolipin and lysophospholipid acyltransferase
           [Rhodosporidium toruloides NP11]
          Length = 465

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 171/313 (54%), Gaps = 39/313 (12%)

Query: 84  SYIKHTQRCFGILLVAINQFFAPSNFVITVDKS--AKGVLKQSWNGAKVELDMPERLILI 141
           +Y+   +  FG +L  + Q+F+P+  VI+  +   A  ++++  +G   ++++P + + I
Sbjct: 61  AYLAAGKATFGRVLTLMVQWFSPTELVISAGEGIDAAKLVERDQDGRVRKVNLPTKGVWI 120

Query: 142 ANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKG 201
           +NH   ADWLY+W F YLA+   +I I LK SL+ +PI GW   +F +IFL+R WA D+ 
Sbjct: 121 SNHTTLADWLYLWDFAYLADHSSSIYIALKSSLRQIPIIGWAASWFGFIFLERRWALDRA 180

Query: 202 PFSKTLSTLATS------KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           PF + L  +A         + L LLIFPEGT+V+  TR  S K+A+K  + D+EHVLLPR
Sbjct: 181 PFRRQLKRIAQETNRGGKDQKLALLIFPEGTIVTANTRGISSKFAEKTAVSDYEHVLLPR 240

Query: 256 STGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQ----------FPEEIYTLRKIYFEGQ 303
           STGL F    L  S+    + DLT+G    RR            +  + YTL  I     
Sbjct: 241 STGLFFALRQLAPSIPNLSLVDLTVGYPLPRRSPPADGKPASPLYASDYYTLPSILLSHV 300

Query: 304 YPRNIHLHIRKYAISEMP-----------------EDEDKFTEWLRQRWIEKDALMEEFY 346
            P  +H+HIR + +S +P                 E++  F EWLR+RW EKD LME F 
Sbjct: 301 PPPELHVHIRAFPVSSIPLGDLSTMEHNPDDEGSEEEKRAFEEWLRKRWEEKDQLMERFR 360

Query: 347 TKGRFTGYESPRT 359
           TKG F   E PR+
Sbjct: 361 TKGSF--LEEPRS 371



>gi|154284113|ref|XP_001542852.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150411032|gb|EDN06420.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 363

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/221 (43%), Positives = 139/221 (62%), Gaps = 11/221 (4%)

Query: 146 IYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSK 205
           +Y DWLY+W F+Y +  HG I IILK+SLK++P+ G GM F+ +IF+ R W  DK     
Sbjct: 82  VYTDWLYLWWFSYTSQMHGHIYIILKESLKYIPLIGQGMMFYGFIFMARKWIADKPRLQH 141

Query: 206 TLSTLATSK----------EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
            L  L T+           +P+WLLIFPEGT +S  T+  S  Y  K G+    H +LPR
Sbjct: 142 RLEKLKTAHSGPRHGSLLLDPMWLLIFPEGTNLSRNTKRISDGYGAKQGIPPLRHQILPR 201

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           STGL FC   L  +VD+VYD T+G EG  +G +P+  +T+R  Y +G+ P+ ++ + R++
Sbjct: 202 STGLFFCLQQLKGTVDWVYDCTVGYEGPPKGSYPDAYFTIRSTYLQGRPPKVVNFYWRRF 261

Query: 316 AISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYE 355
           A+SE+P +D+ +F  W+ +RWIEKD L+E FY  GRF   E
Sbjct: 262 AVSEIPLDDQKEFDAWVHKRWIEKDDLLERFYETGRFPPCE 302



>gi|323334265|gb|EGA75647.1| YDR018C-like protein [Saccharomyces cerevisiae AWRI796]
          Length = 396

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFISNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVQLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|45185515|ref|NP_983231.1| ACL173Cp [Ashbya gossypii ATCC 10895]
 gi|44981233|gb|AAS51055.1| ACL173Cp [Ashbya gossypii ATCC 10895]
 gi|374106436|gb|AEY95345.1| FACL173Cp [Ashbya gossypii FDAG1]
          Length = 411

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/392 (31%), Positives = 201/392 (51%), Gaps = 44/392 (11%)

Query: 29  IIKMPALGEPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKH 88
           +I M A+ +   + ++  LV      VF  G  + + F QF    ++  +    QS +  
Sbjct: 1   MITMSAVAQQAHRTVLAALVT----FVFIQGCVSLVIF-QFSMKCMYRSNRIGLQSQLDR 55

Query: 89  TQRCFGILLVAINQFFAPSNFVITVDKS--AKGVLKQSWNGAKVELDMPERLILIANHQI 146
           +++ F +LLV I    APS   +T D +  AKG   +     ++   +    ++I+NHQI
Sbjct: 56  SKKSFILLLVTIMTIVAPSYVRVTTDNASVAKGTFWRDKGQGQLRSRLERNSVVISNHQI 115

Query: 147 YADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK------ 200
           Y DW+++W   Y +   G + I+LK SL  +P+ G+GM+ + +IF+ R W  D+      
Sbjct: 116 YTDWVFLWWLAYTSGLAGRVYIMLKKSLAAIPVLGYGMKNYGFIFMNRRWNLDRVHLGNS 175

Query: 201 -----------GPFSKTLSTLATSKE----------------PLWLLIFPEGTVVSDVTR 233
                      GP +    +  T++                 P  L++FPEGT +S  TR
Sbjct: 176 LQRLDRDGRGLGPLAGHAPSRVTAEGEEEYESQDGEASKQTWPYTLILFPEGTNMSSNTR 235

Query: 234 ITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIY 293
             S  YA K+ +   E+VLLPRSTGL F    L  S D VYD+TIG  GV++  + E+IY
Sbjct: 236 ERSNVYARKINVQPFENVLLPRSTGLRFALEKLAPSCDCVYDVTIGYSGVKKTTYAEQIY 295

Query: 294 TLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFT 352
            L+ I+  GQ P+ + +HIR + +SE+P +DE  F +WL + W EKD L+E +Y KG F 
Sbjct: 296 DLQSIFLRGQGPKLVDVHIRTFKLSEIPYKDEKAFEQWLYKVWGEKDKLLERYYQKGSF- 354

Query: 353 GYESPRTVPMKLNSVFELTQIWYFIVPLVPIM 384
             +    +   ++ + E+     F+V +VP++
Sbjct: 355 --DLDPDLTHTVSGLCEIDTAEVFLVMIVPML 384



>gi|259145263|emb|CAY78527.1| EC1118_1D0_2597p [Saccharomyces cerevisiae EC1118]
 gi|323349509|gb|EGA83733.1| YDR018C-like protein [Saccharomyces cerevisiae Lalvin QA23]
 gi|365766530|gb|EHN08026.1| YDR018C-like protein [Saccharomyces cerevisiae x Saccharomyces
           kudriavzevii VIN7]
          Length = 403

 Score =  201 bits (512), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVQLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|207346848|gb|EDZ73216.1| YDR018Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|349577088|dbj|GAA22257.1| K7_Ydr018cp [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 403

 Score =  201 bits (512), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVRLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|513033532|gb|AGO13504.1| AaceriACL173Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 411

 Score =  201 bits (512), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 191/373 (51%), Gaps = 39/373 (10%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           V  A+    F     +L   QF    L+  +    Q+++  +++ F +LLV I    APS
Sbjct: 15  VLAALVTFVFIQGCVSLVIYQFSMKWLYRSNQIERQTHLDRSKKSFILLLVTIMTIVAPS 74

Query: 108 NFVITVDKS--AKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGA 165
              +T D +  AKG  ++     ++   +    ++I+NHQIY DW+++W   Y +   G 
Sbjct: 75  YVRVTTDNASVAKGTFRRDRGQGRLRSRLESNSVVISNHQIYTDWVFLWWLAYTSGLAGR 134

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTL------------------ 207
           + I+LK SL  +P+ G+GM+ + +IF+ R W  D+   S +L                  
Sbjct: 135 VYIMLKKSLAAIPVLGYGMKNYGFIFMNRRWNLDRIHLSNSLQRMDRDGRGIGPLAGHVP 194

Query: 208 ---------------STLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVL 252
                          S  +  K P  L++FPEGT +S  TR  S  YA K+ +   E+VL
Sbjct: 195 SRVSAEGEEEYGSEDSDASEKKWPYMLILFPEGTNMSANTRERSNTYARKINVQPFENVL 254

Query: 253 LPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHI 312
           LPRSTGL F    L  S + VYD+TIG  GV++  + E+IY L+ I+ +GQ P+ + +HI
Sbjct: 255 LPRSTGLRFALEKLAPSCECVYDVTIGYSGVKKTTYAEQIYDLQSIFLQGQGPKLVDVHI 314

Query: 313 RKYAISEMPEDEDK-FTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELT 371
           R + +SE+P  E+K F  WL + W EKD L+E +Y KG F   +    +   ++ + E+ 
Sbjct: 315 RTFKLSEIPYQEEKAFESWLYKVWGEKDKLLERYYQKGSF---DLDPELTHTVSGLCEID 371

Query: 372 QIWYFIVPLVPIM 384
               F+V +VP++
Sbjct: 372 TAEVFLVMIVPML 384



>gi|151942006|gb|EDN60362.1| conserved protein [Saccharomyces cerevisiae YJM789]
          Length = 403

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVQLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|6320221|ref|NP_010301.1| putative acyltransferase [Saccharomyces cerevisiae S288c]
 gi|6136664|sp|Q12185.1|YD018_YEAST RecName: Full=Uncharacterized acyltransferase YDR018C
 gi|840871|emb|CAA89843.1| unknown [Saccharomyces cerevisiae]
 gi|1216225|emb|CAA65210.1| orf:PZF396 [Saccharomyces cerevisiae]
 gi|1431444|emb|CAA98838.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285811040|tpg|DAA11864.1| TPA: putative acyltransferase [Saccharomyces cerevisiae S288c]
 gi|392300131|gb|EIW11222.1| hypothetical protein CENPK1137D_3840 [Saccharomyces cerevisiae
           CEN.PK113-7D]
          Length = 396

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 189/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEKALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVQLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|323309500|gb|EGA62711.1| YDR018C-like protein [Saccharomyces cerevisiae FostersO]
          Length = 403

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 188/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQXYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVRLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|50303779|ref|XP_451836.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640968|emb|CAH02229.1| KLLA0B06820p [Kluyveromyces lactis]
          Length = 404

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 194/382 (50%), Gaps = 42/382 (10%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +V  A  V+F  G  + L +   ++   +  + S  Q  +  T++ F +LLV I    AP
Sbjct: 14  IVTFASMVIFIQGAISILVYQALINAF-YSKNLSTRQKLMDLTKKRFILLLVTILSLVAP 72

Query: 107 SNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           S+  IT D  +  KG +    +  ++        ++IANHQIY DW+++W   Y++   G
Sbjct: 73  SHVRITTDNESIPKGTIYMDHHKGRLISKANSNAVVIANHQIYTDWVFLWWLAYVSERAG 132

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------------G 201
            + I+LK SL+ +P+ G GM  +++IF+ R W  D+                        
Sbjct: 133 NVYIMLKKSLESIPLLGSGMTNYKFIFMNRKWEQDRINLSNKLHEIDLDARGVGIIAGNS 192

Query: 202 PFSKTLSTLATSKE----------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHV 251
           P +KT   L    E          P WL++FPEGT +S  TR  +K +A+K GL   +HV
Sbjct: 193 PTTKTEEGLNIWDEAKVEKKGEQWPYWLMLFPEGTNLSAGTRARNKAFAEKSGLSPFKHV 252

Query: 252 LLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH 311
           LLPR+TGL FC   L  S +YVYD+TI   GVR   + ++IY L  I+ +G+ P+ + ++
Sbjct: 253 LLPRTTGLKFCLQKLRNSCEYVYDITIAYSGVRAEDYGQDIYKLGNIFLKGKAPKLVDIY 312

Query: 312 IRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFT---GYESPRTVPMKLNSV 367
           IR   + ++P ED+D+F  WL   W  KD L++ +Y  G F          T P ++ S+
Sbjct: 313 IRAIRLDDIPLEDDDEFHSWLFSVWNLKDKLLDNYYKTGSFQLDPDLNHAVTGPCRV-SI 371

Query: 368 FELTQIWYF-IVPLVPIMWYFS 388
             L  I  F ++ ++PI +Y  
Sbjct: 372 LSLVSILLFPVLTMLPIFYYIG 393



>gi|256273245|gb|EEU08188.1| YDR018C-like protein [Saccharomyces cerevisiae JAY291]
          Length = 403

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 188/339 (55%), Gaps = 29/339 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I     PS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVTPSSLNVTFETSQP--LKNSPN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++++N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVRLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           ++ ++E+P +D++ F  WL   W EKD L+E++Y  G+F
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQF 347



>gi|385303300|gb|EIF47383.1| ydr018c-like protein [Dekkera bruxellensis AWRI1499]
          Length = 415

 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 116/359 (32%), Positives = 191/359 (53%), Gaps = 33/359 (9%)

Query: 52  VFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVI 111
           + +VF  G ++ ++ SQ + LLL+          ++ T++ F +LLV +    +P+  ++
Sbjct: 51  LLLVFVTGCTSIVS-SQLIILLLFHNDIRRKNMLLRFTKQNFLVLLVYLTSKVSPTELIL 109

Query: 112 TVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKII 169
           T   S      +       +   ++    I IANHQIY+DW++VW   YL      I I+
Sbjct: 110 TFGDSPXLNNAVXTDPKTKRHTFNLDNHAIXIANHQIYSDWVFVWFJAYLNKCADQIFIV 169

Query: 170 LKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVS 229
           +K SL+ LP+ G+GM+ + ++FL RNWA D+    ++   +AT  +  WLLIFPEGT +S
Sbjct: 170 MKKSLEKLPVLGFGMRNYNFVFLSRNWARDRDYMVQSFRKVATVGQKCWLLIFPEGTNLS 229

Query: 230 DVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFP 289
             T   S KYA+KV +   ++VLLPR+ GL+    +L  +   +YDLTIG  G    +  
Sbjct: 230 TTTYSKSXKYAEKVHMKPTQNVLLPRARGLYLACKNLGSTTRTLYDLTIGYSGHSSEKMA 289

Query: 290 EEIYTLRKIYFEGQYPRNIHLHIRKYAIS-EMPEDE-----------------DKFTEWL 331
           +++YTL   Y  G  P++I +HI    I  ++PE +                 ++F  WL
Sbjct: 290 QDVYTLSSTYLFGHGPKSISIHIDAIDIQHDIPEVDFSGISTNIGVNEEEEEIERFGNWL 349

Query: 332 RQRWIEKDALMEEFYTKGRFTGYESPR----TVPMKLNSVFELTQIWYFIVPLVPIMWY 386
             RW +KD LM+++Y  G+F   E+PR     + +KL + FEL  ++     L+P++ Y
Sbjct: 350 NNRWYKKDQLMKQYYETGKF---ENPRGKEXRMQLKLATSFELLNVY-----LIPLLAY 400



>gi|58262936|ref|XP_568878.1| acyltransferase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134108180|ref|XP_777288.1| hypothetical protein CNBB2730 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259975|gb|EAL22641.1| hypothetical protein CNBB2730 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223528|gb|AAW41571.1| acyltransferase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 419

 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 162/322 (50%), Gaps = 50/322 (15%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKS---AKGVLKQSWNGAKVELDMPERL 138
           +   I  T+  +G LL+AI   F P+ F IT D      + ++++  NG  V++++P+RL
Sbjct: 58  FSRAIGWTKDGYGRLLIAITVLFGPTQFAITTDTPPPHGQTLVERDMNGQVVKINLPDRL 117

Query: 139 ILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWAT 198
           +++ANHQ Y DW+Y+W     A     + I+LK SLK +P+ GWGM+FF +IFL+R+W  
Sbjct: 118 VIMANHQAYLDWIYIWILACYAGHSAGLIILLKASLKNIPVIGWGMRFFNFIFLRRSWVA 177

Query: 199 DKGPFSKTLSTLATS------------------KEPLWLLIFPEGTVVSDVTRITSKKYA 240
           D+   +  L  L                     + PLWLLIFPEGT++SD  R+ S KYA
Sbjct: 178 DRDNLTLALRQLGQEAQSGQENSETATLLPLRKRSPLWLLIFPEGTIISDEERVKSIKYA 237

Query: 241 DKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKI 298
            K G+ D   +L PRSTGL FC  +L   +    + D+TIG  GV  G +P+  Y L  +
Sbjct: 238 KKEGVDDFATLLHPRSTGLLFCLRTLLPQIPDLNLLDITIGYPGVPFGNYPQNWYGLFSV 297

Query: 299 YFEGQYPRNIHLHIRKYAISEMP---------------------------EDEDKFTEWL 331
           + +   P  ++LH+  Y+    P                           E+   F  WL
Sbjct: 298 FLKSVPPPTVYLHLHVYSHLGEPECKIPSLVPRRSSNVSGLSTDSGLANAEEARAFELWL 357

Query: 332 RQRWIEKDALMEEFYTKGRFTG 353
           R  W  K+  ME+FY   RF G
Sbjct: 358 RNLWTAKERRMEQFYESQRFGG 379



>gi|390604162|gb|EIN13553.1| hypothetical protein PUNSTDRAFT_56913 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 431

 Score =  196 bits (498), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 184/357 (51%), Gaps = 53/357 (14%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKG---------VLKQSWNGAKVEL 132
           Y+  I++T+  FG LL+ + Q+F+P+  V++ +   +G         ++ +   G    L
Sbjct: 69  YEDGIRYTKGAFGNLLILMCQWFSPTRLVVSFETEGEGAWTTEELERIVVRDGTGKVTRL 128

Query: 133 DMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFL 192
           D+P + + IANHQ+     Y WCF +       I I+LK+SL+W+P+ GWGM+FF +IFL
Sbjct: 129 DLPRKSVFIANHQVLHFRWYAWCFLHYCGMSKDIFIVLKNSLRWIPVVGWGMRFFNFIFL 188

Query: 193 KRNWATDKGPFSKTLSTLA----TSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDH 248
            R+W +D+   + +L+ +     T   P   L++PEGT+VS  TR  SKK+ADK G+ D 
Sbjct: 189 ARSWNSDRLALTTSLAKIGRRAETEDTPFAFLLYPEGTLVSRDTRPISKKFADKEGIPDM 248

Query: 249 EHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPR 306
            H LLPRSTGL +   SL   +    + D+T+   GV    + +  YTLR I+ +G  P 
Sbjct: 249 IHTLLPRSTGLQYSLRSLAPRIPSLQLIDITMAYPGVPPMGYGQSYYTLRSIFLDGIPPP 308

Query: 307 NIHLHIRKYAIS----------------------------EMPEDED-KFTEWLRQRWIE 337
           +IHLH+R++ +                             ++PE E   F  WLR  W  
Sbjct: 309 SIHLHLRRFDVRRDVPIGDLSATDPSYLPAPSKHTQTVEIDVPEAEKIAFERWLRDLWRT 368

Query: 338 KDALMEEFYTKGRFTGYESPRT--------VPMKLNSVFELTQIWYFIVP-LVPIMW 385
           KDAL++ ++ +G      S           +P++L + +E+   + F +P LV  +W
Sbjct: 369 KDALLDRWHRQGSLVSDSSTTVKMSNEVIEIPLRLRNTWEVLDAFCFFLPALVCYVW 425



>gi|367006731|ref|XP_003688096.1| hypothetical protein TPHA_0M00870 [Tetrapisispora phaffii CBS 4417]
 gi|357526403|emb|CCE65662.1| hypothetical protein TPHA_0M00870 [Tetrapisispora phaffii CBS 4417]
          Length = 383

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/375 (30%), Positives = 195/375 (52%), Gaps = 22/375 (5%)

Query: 43  LVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQ 102
           L Q+ +     + F  G    + F Q + L ++    +  +  ++ ++  F ILL+ +  
Sbjct: 8   LKQYFISFISIICFLQGCGCIVLF-QIVILTVYSKHENKLKLSLRKSKEAFIILLMCVMS 66

Query: 103 FFAPSNFVITVDKSAKGVLKQSWNG--AKVELDMPERLILIANHQIYADWLYVWCFTYLA 160
             APS+  IT D  +  +    +N     VE ++ +R I IANHQ+Y DW+Y+W   Y +
Sbjct: 67  VIAPSSIRITTDDKSMSLENFRFNKQLKHVESNLNQRSIFIANHQLYTDWIYLWKIAYTS 126

Query: 161 NAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTL------STLATSK 214
           N  G + I  K +LK +PIFG+ M  + +IFL RNW  DK    + L      ST++   
Sbjct: 127 NFGGDVYIFAKKALKKIPIFGYAMTNYNFIFLDRNWVKDKNIIIRKLISILNYSTISNKN 186

Query: 215 E--------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL 266
           E        P   +IFPEGT +     I S +YA K+G  + +H++ P + GL     SL
Sbjct: 187 ENDASSRNLPYCFIIFPEGTTLCKKAEIRSMEYAKKLGRRNFKHIVTPHTKGLRLLLTSL 246

Query: 267 HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDED 325
            K+++ +YDLT+G  G++ G + E+ Y+L+++ + G+ P+ + +HI+   + ++P +DE 
Sbjct: 247 DKNIEKIYDLTVGYSGLKYGTYGEDEYSLKQMIYHGKSPKLVDIHIKSIEVKDIPYQDEK 306

Query: 326 KFTEWLRQRWIEKDALMEEFYTKGRFT---GYESPRTVPMKLNSVFELTQIWYFIVPLVP 382
           +F  WL   W EKD L++ +Y  G F     + +    P K+ ++ E+     FI+    
Sbjct: 307 QFQAWLFDLWEEKDKLLKGYYQLGHFDVDPNFSTTTIDPFKM-TLKEVIIAAVFIIASGS 365

Query: 383 IMWYFSNYLLNRKFT 397
           I +Y  + + N K +
Sbjct: 366 IFFYLYSNINNLKIS 380



>gi|406602109|emb|CCH46296.1| putative membrane protein [Wickerhamomyces ciferrii]
          Length = 408

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 121/382 (31%), Positives = 194/382 (50%), Gaps = 52/382 (13%)

Query: 54  VVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITV 113
           V+ F     A+  SQF+  L+   +    Q+++ HT+  F +LL  +    + S   I +
Sbjct: 15  VILFISGCLAIVTSQFIGKLVTFGNKEVLQAWLSHTKEHFIVLLTTVVNIASKSPINIRI 74

Query: 114 DKSAKGV----LKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKII 169
              +K +     K + +  ++E   P   +LIANHQIY DW+++W  TY A   G + I+
Sbjct: 75  VTDSKTIPSSRFKINPSNGRLETSQPSNTVLIANHQIYTDWVFLWWLTYTAKLSGFVYIV 134

Query: 170 LKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL------------------- 210
           LK SLK LP+ G+GM+ + +IFL R W TD+      L+++                   
Sbjct: 135 LKASLKKLPVLGYGMKNYGFIFLSRKWETDQKTMGNQLASIDANARGKGSVSGNEPHKNS 194

Query: 211 ATSKE------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTG 258
            T KE            P  L+IFPEGT +S  TR  ++ YA+KVG     H+LLPR+TG
Sbjct: 195 ETGKETWPVGEEQHLSWPYSLIIFPEGTNMSANTRGKTQIYAEKVGRKPFNHLLLPRTTG 254

Query: 259 LHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
           L +    L  +VD VYD+T+   G++   + ++IY + K++ +G+ P  +   IR + I+
Sbjct: 255 LRYSLLKLRGTVDEVYDVTLAYSGLKASDYGQDIYKIEKVFLQGKNPERVDFFIRSFKIN 314

Query: 319 EMP---EDE---------DKFTEWLRQRWIEKDALMEEFYTKGRF-TGYESPRTVPMKLN 365
           E+P   EDE           F EWL   W EKD LM  +Y  G F +  + P+   + L+
Sbjct: 315 EIPIGKEDETPEEYAKSQKNFEEWLFNVWAEKDELMNNYYEYGSFLSENDDPKNFGI-LD 373

Query: 366 SVFELTQIWY---FIVPLVPIM 384
           +  ++++  +   F VPL+ I+
Sbjct: 374 TTLKVSKFDFLKIFTVPLLLIL 395



>gi|401840161|gb|EJT43068.1| YDR018C-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 408

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 178/339 (52%), Gaps = 27/339 (7%)

Query: 44  VQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQF 103
           +Q L R  +   F  G  + + F   L L+L P+S     + +  +++ F +LL  I   
Sbjct: 28  IQALQRVFIICFFLMGSFSIVIFQVCLQLIL-PWSKIRLHNGMNQSKKAFIVLLCLILNM 86

Query: 104 FAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAH 163
            APS+  +T + S                   +R +++ANHQ+YADW+Y+W  + ++N  
Sbjct: 87  VAPSSLNVTFEASKSSKSSSG---TNSSFKFKDRAVIMANHQMYADWIYLWWLSSISNLG 143

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL---ATSKEPLW-- 218
           G + IILK +LK++P+ G+GMQ F++IFL RNW  D+   +  L ++   A  K PL   
Sbjct: 144 GNVFIILKKALKYVPLLGFGMQNFKFIFLSRNWRKDETTLTNNLVSMDLNARCKGPLTNY 203

Query: 219 ---------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHE--HVLLPRSTGLHF 261
                          L++FPEGT +S  T+  S+ Y  + GL D +  H+LLP S GL F
Sbjct: 204 KTCYSKTNESVAAYNLIMFPEGTNLSPKTKKKSEAYCQRAGLQDVQLRHLLLPHSKGLKF 263

Query: 262 CAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP 321
               L  S+D VYD+TIG     R ++    +TL+KI+  G YP  I  HIR++ + E+P
Sbjct: 264 ALEKLALSLDAVYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPERIDFHIREFKVDEIP 323

Query: 322 -EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRT 359
            +D++ F  WL   W EKD L+E +Y  G+F   +  R 
Sbjct: 324 LQDDEVFFNWLLGVWKEKDQLLENYYNTGQFRSDDENRN 362



>gi|342319202|gb|EGU11152.1| Hypothetical Protein RTG_02955 [Rhodotorula glutinis ATCC 204091]
          Length = 461

 Score =  194 bits (492), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 175/317 (55%), Gaps = 39/317 (12%)

Query: 84  SYIKHTQRCFGILLVAINQFFAPSNFVITVDKS--AKGVLKQSWNGAKVELDMPERLILI 141
           +Y+   +  FG +L  + Q+F+P+  VI+  +   A  ++++  +G   ++++P + + I
Sbjct: 61  AYLAAGKATFGRVLTLMVQWFSPTELVISAGEGIDAAKLMERDRDGRVRKVNLPTKGVWI 120

Query: 142 ANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKG 201
           +NH   ADWLY+W F YLA+   +I I LK SL+ +PI GW   +F +IFL+R WA+D+ 
Sbjct: 121 SNHTTLADWLYLWDFAYLADHSSSIYIALKSSLRKIPIIGWAASWFGFIFLERRWASDRA 180

Query: 202 PFSKTLSTLAT------SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           PF + L  +A       + + L LLIFPEGT+V+  TR  S K+A+K  + D++HVLLPR
Sbjct: 181 PFRRQLKRIAQETNRGGADQKLALLIFPEGTIVTANTRGISSKFAEKTAVSDYKHVLLPR 240

Query: 256 STGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQ----------FPEEIYTLRKIYFEGQ 303
           STGL F    L  S+    + DLT+G    R+            +  + YTL  I     
Sbjct: 241 STGLFFALRQLAPSIPNLSLVDLTVGYPLPRQPPPSDGKPVSPLYASDYYTLPSILLSHV 300

Query: 304 YPRNIHLHIRKYAISEMP-----------------EDEDKFTEWLRQRWIEKDALMEEFY 346
            P  +H+H+R + +S +P                 E++  F EWLR+RW EKD L+E F 
Sbjct: 301 PPPELHIHVRAFPVSSIPLGDLSTMEHNPDDEGTEEEKRVFEEWLRKRWQEKDDLIERFR 360

Query: 347 TKGRFTGYESPRTVPMK 363
           T+G F   + PR+  +K
Sbjct: 361 TEGSF--LKQPRSNGVK 375



>gi|363752285|ref|XP_003646359.1| hypothetical protein Ecym_4505 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889994|gb|AET39542.1| hypothetical protein Ecym_4505 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 412

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/375 (29%), Positives = 182/375 (48%), Gaps = 39/375 (10%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           V + V  +FF G    +   QF    ++  +    Q ++  +++ F +LLV I    APS
Sbjct: 14  VTSVVIFIFFNG-CLTIAIYQFFVTTIYHANAVERQIHLNRSKKSFIVLLVTILCLVAPS 72

Query: 108 NFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGA 165
              IT + ++  KG  ++  +  ++   +    ++I NHQ+Y DW+++W   Y +   G 
Sbjct: 73  YVSITTENASIPKGTFRKDSSLQRIVSSLKRNSVIICNHQLYTDWIFLWWIAYTSRLAGN 132

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE---------- 215
           + I+LK SL+ +P+ G+GM+ + +IF+ R W  DK   + TL  L               
Sbjct: 133 VIIMLKKSLESIPVLGYGMKNYNFIFMNRKWELDKVNLTNTLQDLDMDSRGIGKLSGNVP 192

Query: 216 -------------------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEH 250
                                    P  L++FPEGT +S  TR+ S +Y  KV      +
Sbjct: 193 SNFTPEGIEEFSIPKSESGDGQMKWPYALILFPEGTNMSKNTRLRSDQYGAKVNRKPFSN 252

Query: 251 VLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHL 310
           VLLPR TGL F    L  S + +YD+T+G  GV +G + EEIY LR ++  G+ P+ + +
Sbjct: 253 VLLPRVTGLKFVLQKLVPSCECLYDVTLGYSGVTKGTYGEEIYNLRNVFLRGKAPKLVSI 312

Query: 311 HIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFE 369
           H+R + +SE+P  D ++F +W+   W EKD L++ +Y KG F            L  +  
Sbjct: 313 HLRAFQLSEIPYNDSEQFEKWVFDVWEEKDKLLDRYYKKGSFDLDSELNHTVTGLCQIAP 372

Query: 370 LTQIWYFIVPLVPIM 384
           L      +VPL+  M
Sbjct: 373 LEVAAILVVPLIVSM 387



>gi|325091792|gb|EGC45102.1| acyltransferase [Ajellomyces capsulatus H88]
          Length = 272

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 146/246 (59%), Gaps = 11/246 (4%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++R+   + +F      +  +Q     L+  +  Y+ +Y+  T+R FGI + A+ ++F P
Sbjct: 26  ILRSLALLAWFNCCCVCIVATQLAGAPLYFINRQYFNAYMAMTKRSFGIAITALTEWFCP 85

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   ++ DKS +G    + +G K++ + PER++LIANHQ+Y DWLY+W F+Y +  HG I
Sbjct: 86  TPIRVSGDKSVQGQFFITKDG-KLKTNFPERMVLIANHQVYTDWLYLWWFSYTSQMHGHI 144

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK----------EP 216
            IILK+SLK++P+ G GM F+ +IF+ R W  DK      L  L T+           +P
Sbjct: 145 YIILKESLKYIPLIGQGMMFYGFIFMARKWIADKPRLQHRLEKLKTAHGGPRPGSLLLDP 204

Query: 217 LWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDL 276
           +WLLIFPEGT +S  T+  S  Y  K G+    H +LPRSTGL FC   L  +VD+VYD 
Sbjct: 205 MWLLIFPEGTNLSRNTKRISDGYGAKQGIPPLRHQILPRSTGLFFCLQQLKGTVDWVYDC 264

Query: 277 TIGIEG 282
           T+G EG
Sbjct: 265 TVGYEG 270



>gi|409083356|gb|EKM83713.1| hypothetical protein AGABI1DRAFT_32690 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 338

 Score =  190 bits (482), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (52%), Gaps = 48/325 (14%)

Query: 102 QFFAPSNFVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLY 152
           Q+FAP+   +T +    G         ++ ++ NG  V L++P + +L ANHQ+YADW Y
Sbjct: 3   QWFAPTELRVTFETQGLGKFSKEEIERIVVKNVNGT-VTLNLPTKFVLTANHQVYADWWY 61

Query: 153 VWCFTYL---ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLST 209
            WC  Y    +  H  I I LK SL+W+P+ GWGMQFF +IFL R+WA+D+   + +L++
Sbjct: 62  AWCLLYFIGPSGVHRHIFITLKKSLQWVPLAGWGMQFFNFIFLARSWASDRHHLASSLAS 121

Query: 210 LATS----KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
           L         P   L++PEGT++S  TR  SKK+ADK+G+ D ++ LLPRSTGLH+   S
Sbjct: 122 LGKEARKEDRPFCFLLYPEGTLISKDTRPISKKFADKMGISDMKNTLLPRSTGLHYSLRS 181

Query: 266 LHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISE---- 319
           L   +    + DLT+   G+    + +  YTLR I+ +G  P  IH+H+R + + E    
Sbjct: 182 LAPRIPDLKLLDLTVVYPGIPPMGYGQGYYTLRSIFLDGVPPPAIHIHMRLFDVREDMPI 241

Query: 320 ---------------------MPEDED-KFTEWLRQRWIEKDALMEEFYTKGRFTGY-ES 356
                                +PE+E  +F  WLR  W EKD  + +++  G      E 
Sbjct: 242 GDLSASVLNADVSAKDAVEVDIPEEEKARFDLWLRNLWNEKDESITKYHETGNLNSLPEG 301

Query: 357 PRTV--PMKLNSVFELTQIWYFIVP 379
             TV  P+KL    E+   + F  P
Sbjct: 302 SMTVDIPLKLRRKREVLDAFCFFFP 326



>gi|426201595|gb|EKV51518.1| hypothetical protein AGABI2DRAFT_147858 [Agaricus bisporus var.
           bisporus H97]
          Length = 338

 Score =  189 bits (481), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (52%), Gaps = 48/325 (14%)

Query: 102 QFFAPSNFVITVDKSAKG---------VLKQSWNGAKVELDMPERLILIANHQIYADWLY 152
           Q+FAP+   +T +    G         ++ ++ NG  V L++P + +L ANHQ+YADW Y
Sbjct: 3   QWFAPTELRVTFETQGLGKFSKEEIERIVVKNVNGT-VTLNLPTKFVLTANHQVYADWWY 61

Query: 153 VWCFTYL---ANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLST 209
            WC  Y    +  H  I I LK SL+W+P+ GWGMQFF +IFL R+WA+D+   + +L++
Sbjct: 62  AWCLLYFIGPSGVHRHIFITLKKSLQWVPLAGWGMQFFNFIFLARSWASDRHHLASSLAS 121

Query: 210 LATS----KEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGS 265
           L         P   L++PEGT++S  TR  SKK+ADK+G+ D ++ LLPRSTGLH+   S
Sbjct: 122 LGKEARKEDRPFCFLLYPEGTLISKDTRPISKKFADKMGISDMKNTLLPRSTGLHYSLRS 181

Query: 266 LHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISE---- 319
           L   +    + DLT+   G+    + +  YTLR I+ +G  P  IH+H+R + + E    
Sbjct: 182 LAPRIPDLKLLDLTVVYPGIPPMGYGQGYYTLRSIFLDGVPPPAIHIHMRLFDVREDMPV 241

Query: 320 ---------------------MPEDED-KFTEWLRQRWIEKDALMEEFYTKGRFTGY-ES 356
                                +PE+E  +F  WLR  W EKD  + +++  G      E 
Sbjct: 242 GDLSASVLNADVSAKDAVEVDIPEEEKARFDLWLRNLWNEKDESITKYHETGTLNSLPEG 301

Query: 357 PRTV--PMKLNSVFELTQIWYFIVP 379
             TV  P+KL    E+   + F  P
Sbjct: 302 SMTVDIPLKLRRKREVLDAFCFFFP 326



>gi|392597164|gb|EIW86486.1| hypothetical protein CONPUDRAFT_44786 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 422

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 184/350 (52%), Gaps = 44/350 (12%)

Query: 78  SHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELD---- 133
           + + Y   +++++  F  L+  +NQ+FAP+   IT ++  +G + +      VE D    
Sbjct: 61  TQNLYDEGVRYSKGAFASLINLMNQWFAPTQLKITFEREGQGKVSEEDIERFVERDGSGK 120

Query: 134 -----MPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQ 188
                +P++ ++ +NHQ+Y+DW Y+W  TY    H  + I+LK SLKW+PI G GMQ F+
Sbjct: 121 ISFLRLPQKSVITSNHQVYSDWWYIWGLTYYMGTHKDVFIVLKKSLKWVPIIGPGMQIFR 180

Query: 189 YIFLKRNWATDKGPFSKTLSTLATSKE----PLWLLIFPEGTVVSDVTRITSKKYADKVG 244
           +IFL R+WA DK   S+ L+ L    E    P   ++FPEGT+VS  T+  SKKYA+K+G
Sbjct: 181 FIFLARSWAHDKLILSRKLAKLGRQAELQDKPFTFILFPEGTLVSKDTKPISKKYAEKIG 240

Query: 245 LVDHEHVLLPRSTGLHFCAGSLHKSVDY--VYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
           + D  ++LLPRSTGL +   SL   +    + D+T+   GV    + +  YTLR I+ + 
Sbjct: 241 ISDLSNLLLPRSTGLLYSLRSLAPRMPSLKLIDITMVYPGVPPMGYGQSWYTLRSIFCDR 300

Query: 303 QYPRNIHLHIRKYAIS---------------------------EMPE-DEDKFTEWLRQR 334
             P  +++HIR + +S                           ++PE + + F  WLR+ 
Sbjct: 301 VPPPVVNMHIRIFDVSQEVPIGDISGTNPKTIPNGSARDTVEIDVPEYEREAFDLWLRKL 360

Query: 335 WIEKDALMEEFY-TKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPLVPI 383
           W +KD  + +F+ T+       +   +P+ L S  E+   + F VP V +
Sbjct: 361 WTDKDEFITKFHATESDVLARRATIDIPLALKSDREIPNAFCFFVPTVAV 410



>gi|403217686|emb|CCK72179.1| hypothetical protein KNAG_0J00970 [Kazachstania naganishii CBS
           8797]
          Length = 404

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 112/392 (28%), Positives = 192/392 (48%), Gaps = 48/392 (12%)

Query: 44  VQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQF 103
           V+ +V   V ++ F      L   Q  ++   P + +  QS +  T++ F I L +I   
Sbjct: 11  VRKVVIPLVSMIVFIENILLLMVIQVPTVYCLPTNSALAQSLLDFTKKLFVITLTSILSV 70

Query: 104 FAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLAN 161
            AP++  IT D  +   G +       +V   +    + I NHQIY DW+Y+W   Y +N
Sbjct: 71  VAPAHVRITTDNDSIPAGTIYMDIAKGRVSSQLRPDSVTICNHQIYTDWIYLWWLAYTSN 130

Query: 162 AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPF- 203
             G + I+LK SL+ +PI G+GM+ F+++F+ R WA D+                 GP  
Sbjct: 131 LGGRVHIMLKKSLRRIPILGFGMKNFKFLFMNRKWADDRVNVVNNLRELDANARGLGPLH 190

Query: 204 -SKTLSTLATSKE--------------------PLWLLIFPEGTVVSDVTRITSKKYADK 242
             K ++T     +                    P   ++FPEGT ++  TR  ++ YA K
Sbjct: 191 GGKPMTTTENGTKVWNQSTQPSYTEELRGDRFWPYNFILFPEGTNLTQNTRNKTEIYAKK 250

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEG 302
           V      HVL+P  TGL F   +L  S+D +YD+T+   GV+   +  + Y L+ I+ EG
Sbjct: 251 VNKTPFRHVLMPHVTGLKFTLETLEPSLDILYDVTVAYSGVKPSGYAADSYGLKNIFLEG 310

Query: 303 QYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP 361
           QYP+ + +++R + I  +P +D+++F +W+ + W EKD LM  +Y  G F   +  +T  
Sbjct: 311 QYPKLVDIYVRAFDIKSIPIKDDEQFEKWVEKVWAEKDELMNNYYETGGF-ALDPAKT-- 367

Query: 362 MKLNSVFELTQ---IWYFIVPLVPIMWYFSNY 390
             L SVF + +   +   ++P + ++W   ++
Sbjct: 368 SSLTSVFNVCRYEFVMISVLPFITLLWMLKSF 399



>gi|156848481|ref|XP_001647122.1| hypothetical protein Kpol_1036p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117806|gb|EDO19264.1| hypothetical protein Kpol_1036p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 398

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 185/347 (53%), Gaps = 37/347 (10%)

Query: 39  QSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLV 98
           +S+  V+ L+ T++    F G     +    ++ L +   +   ++ +K T++ F ++L+
Sbjct: 6   KSKQFVKALISTSIL---FNGVVLIASVQFIINNLFFFVKNDTTKTALKRTKKAFIMMLI 62

Query: 99  AINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
                 AP+   IT D S+  KG +K +    +V  ++ ER I+++NH IY DW+Y+W  
Sbjct: 63  TSLSIIAPATVRITTDNSSIKKGTVKFNPVKGRVVSNLKERSIVVSNHLIYTDWVYIWWL 122

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLAT---- 212
            Y +N  G+I  +LK+SL+ LP+  + M  + +I L RNW  DK    + L  +      
Sbjct: 123 LYTSNLSGSIFFLLKNSLQSLPLLSYIMNNYGFIPLTRNWTIDKLVVEEKLRLINNDAKI 182

Query: 213 ---------------------------SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGL 245
                                      SK P  ++++PEGT +S   R  S++Y+ K+G 
Sbjct: 183 IIKDQEEVHTVQSNQSSITVKSNVSPKSKWPYSVVLYPEGTNMSKRARQKSEEYSRKMGR 242

Query: 246 VDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYP 305
              ++VLLP +TGL      L  ++D VYD+TI   GV++ ++ EE+YTL+ ++F+G  P
Sbjct: 243 EPFKNVLLPHTTGLRHSITLLQGTLDTVYDITIAYSGVKQDEYGEELYTLKNVFFKGIAP 302

Query: 306 RNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           R   ++IR Y ISE+P  +E+KFT+WL   W EK+ ++E +Y  G F
Sbjct: 303 RLTDIYIRSYNISEIPFTNEEKFTKWLFDVWEEKEKILETYYETGTF 349



>gi|255712585|ref|XP_002552575.1| KLTH0C08096p [Lachancea thermotolerans]
 gi|238933954|emb|CAR22137.1| KLTH0C08096p [Lachancea thermotolerans CBS 6340]
          Length = 400

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/383 (30%), Positives = 188/383 (49%), Gaps = 40/383 (10%)

Query: 40  SQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVA 99
           +Q  V+ LV  A  V+F  G    +   Q L+           Q ++  +++ F ILL+ 
Sbjct: 7   AQRAVKLLVTLASIVIFIQGAFVIVTH-QVLTKTFLTHDPIRMQKHLDRSKKSFIILLIT 65

Query: 100 INQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFT 157
           I    APS   IT D  +  K  + +      +   M ++ +LI+NHQIY DW+++W   
Sbjct: 66  ILTIVAPSGVRITTDNRSIPKNTMVKDLRTGGIISSMKQKSVLISNHQIYTDWVFLWWLA 125

Query: 158 YLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL------- 210
           Y  +  G + I+LK+SL  +PI G+GM+ + +IF+ R W+ D+   +  L  L       
Sbjct: 126 YTGDLAGNVYIMLKNSLAKIPIMGYGMRNYNFIFMNRKWSKDRINLANHLGNLDHNARGV 185

Query: 211 ------------ATSKE-----------------PLWLLIFPEGTVVSDVTRITSKKYAD 241
                       A+ KE                 P  L+IFPEGT +S  TR  S+ +++
Sbjct: 186 GRLAGKHPSLDIASGKEVWSDNGAATKDHRQIRWPYTLIIFPEGTNLSANTREKSRVFSE 245

Query: 242 KVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFE 301
           K  L    +++LPR TGL F    L  S + VYD TIG  GV++ ++ ++IY L  I+  
Sbjct: 246 KANLPIFNNLVLPRVTGLRFSLQELRNSCEVVYDTTIGYSGVKQNEYGQDIYQLSNIFLR 305

Query: 302 GQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTV 360
           G  P  + ++IR + + ++P +DE++FT+WL   W EKD L++ FY KG F    +   V
Sbjct: 306 GHSPDLVDIYIRAFNLKDIPLDDEEEFTKWLLDVWHEKDKLLDTFYAKGSFDLDPNTHQV 365

Query: 361 PMKLNSVFELTQIWYFIVPLVPI 383
                 +       + I+PL+ +
Sbjct: 366 TTGTCKIKSSEVAQFLILPLLSL 388



>gi|254566157|ref|XP_002490189.1| Protein of unknown function, affects chromosome stability when
           overexpressed [Komagataella pastoris GS115]
 gi|238029985|emb|CAY67908.1| Protein of unknown function, affects chromosome stability when
           overexpressed [Komagataella pastoris GS115]
          Length = 393

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/376 (31%), Positives = 193/376 (51%), Gaps = 44/376 (11%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R    ++FF     ++  +Q +  +L+ F+    Q  +  T+R F ILL  +    +P+ 
Sbjct: 15  RLGFIILFFFSGCLSIVITQIIVKILFCFNPLQQQRLLNFTKRNFIILLTFVTSLVSPTK 74

Query: 109 FVITVDKSAKG---VLKQSWNGAK-VELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
            +IT D+S         +++ G   V   +  + I++ANHQIY DWL++W F ++++   
Sbjct: 75  IIITHDESIPNGTFTHHRTFTGNDIVRAALSPQAIVVANHQIYTDWLFMWWFAFISDVSD 134

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL--------ATSKEP 216
            + II+K SL  +P+ G+GM  +++IFL R W  DK    + L  +        A + + 
Sbjct: 135 NVYIIMKKSLSKIPVLGYGMTNYRFIFLSRKWEDDKSIMIRQLKEITYFYGNKSAKAFDD 194

Query: 217 L---WLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYV 273
           L   WL+IFPEGT +SD  R  S +Y  K GL    HVL PR+ GL+     L  +  Y+
Sbjct: 195 LKKHWLIIFPEGTNMSDNRRKISNEYIQKNGLEPLNHVLSPRAKGLYVSVEKLSPTTKYI 254

Query: 274 YDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEM------PEDEDK- 326
           YDLTI   G    ++ ++IYTL +I+  G+ P ++++HIR   + ++      PE  +  
Sbjct: 255 YDLTIAYSGHTPDEYAQDIYTLSQIFIHGKGPHSVNIHIRALDLHQIGGVNFDPEIVNSS 314

Query: 327 ----------FTEWLRQRWIEKDALMEEFYTKGRFTG-YESPRTVPMKLNSVFELTQI-- 373
                     F  WL + W EKDAL+++F++   F   YES  T  +KL S +EL  I  
Sbjct: 315 NEIQESNLVPFQNWLYKVWCEKDALLDQFFSTKSFGAQYESIET-ELKLFSKWELLSIFT 373

Query: 374 --------WYFIVPLV 381
                   +YF+V L+
Sbjct: 374 PTWLLLLGFYFVVKLL 389



>gi|323338336|gb|EGA79564.1| YDR018C-like protein [Saccharomyces cerevisiae Vin13]
          Length = 347

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 113/328 (34%), Positives = 179/328 (54%), Gaps = 29/328 (8%)

Query: 37  EPQSQNLVQWLVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGIL 96
           E      ++ L R  +  +F +G  + + F   L +LL P+S   +Q+ I  +++ F +L
Sbjct: 14  EKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLL-PWSKIRFQNGINQSKKAFIVL 72

Query: 97  LVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCF 156
           L  I    APS+  +T + S    LK S N AK      +R I+IANHQ+YADW+Y+W  
Sbjct: 73  LCMILNMVAPSSLNVTFETSRP--LKNSSN-AKPCFRFKDRAIIIANHQMYADWIYLWWL 129

Query: 157 TYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATD----------------- 199
           ++ +N  G + IILK +L+++P+ G+GM+ F++IFL RNW  D                 
Sbjct: 130 SFXSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEEALTNSLVSMDLNARC 189

Query: 200 KGPFSKTLSTLATSKEPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDH---EHVLL 253
           KGP +   S  + + E +    L++FPEGT +S  TR  S+ +  +  L DH    H+LL
Sbjct: 190 KGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHL-DHVQLRHLLL 248

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P S GL F    L  S+D +YD+TIG     R ++    +TL+KI+  G YP  +  +IR
Sbjct: 249 PHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIR 308

Query: 314 KYAISEMP-EDEDKFTEWLRQRWIEKDA 340
           ++ ++E+P +D++ F  WL   W EK +
Sbjct: 309 EFRVNEIPLQDDEVFFNWLLGVWKEKRS 336



>gi|448533912|ref|XP_003870724.1| hypothetical protein CORT_0F03730 [Candida orthopsilosis Co 90-125]
 gi|380355079|emb|CCG24596.1| hypothetical protein CORT_0F03730 [Candida orthopsilosis]
          Length = 419

 Score =  183 bits (464), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 173/351 (49%), Gaps = 48/351 (13%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VRTA+ V  F     A+ F+Q + L L+  + S  Q+ I  T+  F ILL  +     P
Sbjct: 11  IVRTAIIVPLFIIGCLAIVFTQLIGLFLFKNNPSLKQAMINETKTHFVILLSGLTSIINP 70

Query: 107 SNFVITVDKSAKGVLKQSWNGA--KVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
             F IT+D  +    +Q    +   +   +    ++I+NHQIY DWL++W  TY +N   
Sbjct: 71  CKFAITIDTESVPNSQQFHVDSYKHIHTLLQPNSVIISNHQIYTDWLFLWFLTYTSNLSN 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKTL 207
           A+ IILKD L  +P+ G+GM+ + ++FL R W  DK                 GP +   
Sbjct: 131 AVYIILKD-LSKIPVLGYGMKNYNFLFLSRKWEHDKVVLTNQLLEIDANARGHGPANGYR 189

Query: 208 STLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
              +T KE              P  L++FPEGTV SD T   S +Y    GL   +HVLL
Sbjct: 190 LLSSTDKEVKKWPQGADDSKIWPYELILFPEGTVPSDRTTKKSAEYIASKGLPPLKHVLL 249

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           PR  GL+     L  +V+ VYD+T    G++  ++ E +++L+K Y +G  P  ++  I+
Sbjct: 250 PRIRGLYLALQKLRNTVEVVYDVTTAYSGLKEDEYGELVFSLKKFYIQGYGPPVVNYFIK 309

Query: 314 KYAISEMP--------------EDEDKFTEWLRQRWIEKDALMEEFYTKGR 350
            Y + ++P              ED  KF +WL + W EKD LM+ FY  G+
Sbjct: 310 GYKLKDIPLGKEELDSTVEASDEDLQKFEDWLLKIWYEKDQLMDNFYKTGQ 360



>gi|353235835|emb|CCA67841.1| related to acetyltransferase [Piriformospora indica DSM 11827]
          Length = 416

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 181/356 (50%), Gaps = 57/356 (16%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSW-----NGAKVELDMPE 136
           Y   I++T+  FGI+LV + Q FAP+ F +T + S  G   + W         + L +P+
Sbjct: 67  YHMGIRYTKAAFGIVLVFMCQAFAPTKFRVTYEIS--GSYSEEWLEVDPKSGSLMLKLPK 124

Query: 137 RLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIF-LKRN 195
           +L++I+NHQIYADW Y+W  +Y+AN H  I I+LK SLKWLP+ GW   ++  ++ L  +
Sbjct: 125 KLVVISNHQIYADWWYLWVLSYMANTHAYILIVLKRSLKWLPVLGWVSDWYHLLWKLAAH 184

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
             T       T +      EPL  L+FPEGT+VS  T   S KYA+K+ L   EH+LLPR
Sbjct: 185 HVT-------TTADRPEDDEPLNFLLFPEGTLVSRDTYPKSTKYAEKMNLPHPEHLLLPR 237

Query: 256 STGLHFCAGSLHKSVD-YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRK 314
           STGLH    +L +    Y+ D+T+   G+   +F ++ YTLR I+ +G  P  +  HIR 
Sbjct: 238 STGLHTTLLALSQLPSLYLMDVTMLYPGIPVTKFGQDYYTLRSIFIDGVSPPEVVYHIRL 297

Query: 315 YAIS-EMP-----------------------------------EDEDKFTEWLRQRWIEK 338
           Y +  E+P                                   ED+  F  WLR+RW EK
Sbjct: 298 YNVQKEVPIRANGTDTNTGLTMEQRKHLAHSMSKDPTMLEIGEEDKVVFDTWLRERWREK 357

Query: 339 DALMEEFYTKGR----FTGYESPRTV-PMKLNSVFELTQIWYFIVPLVPIMWYFSN 389
           D +++ +  +G      TG      V P+KL S++EL   +    P+    +  SN
Sbjct: 358 DQMIDSWLKRGGKGPIATGDNIKEVVLPVKLRSIWELVGPFLAFAPIAVAYYSLSN 413



>gi|328769671|gb|EGF79714.1| hypothetical protein BATDEDRAFT_31859 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 352

 Score =  181 bits (459), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 156/325 (48%), Gaps = 53/325 (16%)

Query: 82  YQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSAKGVLKQSWNGAKVELDMPERLILI 141
           Y+ Y ++ +  FG  +V +    AP+  VIT D  A    KQ              LIL+
Sbjct: 2   YKWYNRYLESIFGSSVVMLVNTLAPATLVITGDIEAIKDTKQ--------------LILM 47

Query: 142 ANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKG 201
           +NHQIY DW Y+WC   L N H  +KI+L   LK+LP+FG  M  F++IFL R  + D  
Sbjct: 48  SNHQIYVDWAYLWCLARLTNHHADLKIMLMSVLKYLPLFGVSMAMFEFIFLDRKLSVDHR 107

Query: 202 PFSKTLSTLATSKE--PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDH-EHVLLPRSTG 258
                +S   T     P+ L+IFPEGT+ +   R  S+ YA K  + D  E+V+LP+ TG
Sbjct: 108 NIVNIMSRQKTDAPNLPMMLVIFPEGTLNTPNNREVSRSYAKKTDIPDDPEYVILPKGTG 167

Query: 259 LHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAIS 318
           L  C   L+  VD ++D+T+G   +   Q P E Y    ++F  +YP  +H+HI+ + I+
Sbjct: 168 LFMCCDVLYPQVDRIFDVTVGYGALSAEQIPYEEYLPGNVFFSKKYPPAVHMHIQSFPIN 227

Query: 319 EMPEDEDK------------------------------------FTEWLRQRWIEKDALM 342
            +P  +                                      F+EW+R+R++ KD LM
Sbjct: 228 TLPGFDGALTAETLALDPAFKQSATTAAAKSGAFTPIVEARRHVFSEWVRKRFMYKDKLM 287

Query: 343 EEFYTKGRFTGYESPRTVPMKLNSV 367
           E FY +G F   E     P  L+ +
Sbjct: 288 ERFYAEGEFPSVEVGVNDPQPLDKI 312



>gi|354543138|emb|CCE39856.1| hypothetical protein CPAR2_602750 [Candida parapsilosis]
          Length = 413

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 174/357 (48%), Gaps = 60/357 (16%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VRTA+ +  F     A+  +Q + L ++  + S  Q+ I  T+  F ILL  +     P
Sbjct: 11  IVRTAIIIPVFVIGCLAIVLTQLVGLFIFKNNPSSKQAVINETKTHFVILLAGLTSIINP 70

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERL--------ILIANHQIYADWLYVWCFTY 158
             F IT+D ++        +G+   +D    +        ++I+NHQIY DWL++W  TY
Sbjct: 71  CKFAITIDTNSVP------HGSSFNVDSSNHIHTLLQPNSVIISNHQIYTDWLFLWFLTY 124

Query: 159 LANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------G 201
            ++   A+ IILKD L  +PI G+GM+ + ++FL R W  DK                 G
Sbjct: 125 TSHLSNAVYIILKD-LSKIPILGYGMKNYNFLFLSRKWEHDKVVLTNQLLEIDANARGHG 183

Query: 202 PFSKTLSTLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVD 247
           P +      +T KE              P  L++FPEGTV SD T   S +Y    GL  
Sbjct: 184 PANGYRLLSSTDKEVKKWPQGVDNSKIWPYELILFPEGTVPSDRTTKKSAEYIASKGLPP 243

Query: 248 HEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRN 307
            +HVLLPR  GL+     L  +V+ VYD+T    G++  ++ E +++L+K Y +G  P  
Sbjct: 244 LKHVLLPRIRGLYLALQKLRNTVEVVYDVTTAYSGLKEDEYGELVFSLKKFYLKGHGPPV 303

Query: 308 IHLHIRKYAISEMP--------------EDEDKFTEWLRQRWIEKDALMEEFYTKGR 350
           ++  I+ Y + ++P              ED  KF +WL + W EKD LM+ FY  G+
Sbjct: 304 VNYFIKGYKLKDIPLGKEELDSTVEASDEDLQKFEDWLLKIWYEKDQLMDNFYKTGK 360



>gi|150865478|ref|XP_001384714.2| hypothetical protein PICST_83738 [Scheffersomyces stipitis CBS
           6054]
 gi|149386734|gb|ABN66685.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 418

 Score =  180 bits (456), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 121/372 (32%), Positives = 181/372 (48%), Gaps = 55/372 (14%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VRTA+   FF     ++ F+QF+  +++  S +  QS +  T+  F +L+ +I +   P
Sbjct: 12  IVRTALITPFFIFGVLSIVFTQFVGAVIFKSSPANRQSVMNLTKNHFILLIGSIARLVCP 71

Query: 107 SNFVITVDKSAKGVLKQSWN-----GAKVELDMPERLILIANHQIYADWLYVWCFTYLAN 161
               +T DK     L +S +     G  +   +    ++I+NHQIY DWL++W  +Y A 
Sbjct: 72  CEISVTYDKET---LPESDSFRVDSGRHLISSLTPNSVIISNHQIYTDWLFLWFLSYTAR 128

Query: 162 AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTL----------- 210
               I IILKD +  +P+ G+GM  + ++FL R W  DK   S  L+ L           
Sbjct: 129 FSYYIHIILKD-MSNIPVLGFGMTNYNFLFLSRKWEKDKIQLSNQLAVLDANSRGMGPAN 187

Query: 211 -----ATSKE-----------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDH 248
                ATS                   P  L++FPEGTV S  TR  S +Y     L   
Sbjct: 188 GVQLVATSATEGGIVKWPKGRRENQIFPYQLILFPEGTVPSVRTRGKSAEYIKFKDLPPL 247

Query: 249 EHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNI 308
           +HVLLPR  GL+     L  S++ VYD+T G  G+  G+  EE ++L++ + +G  P  I
Sbjct: 248 KHVLLPRVRGLYLSLRELRNSIEVVYDITTGYSGLVAGEIGEESFSLKRHFLKGYGPSRI 307

Query: 309 HLHIRKYAISEMP-------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYE 355
           + HIR + ISE+P             E+  KF +WL + W EKDALM+ F+  GRF   +
Sbjct: 308 NFHIRGFKISEIPLGDSNIDIDDVPEEELQKFEDWLLKVWYEKDALMDGFFKHGRFVDPK 367

Query: 356 SPRTVPMKLNSV 367
            P       NSV
Sbjct: 368 DPENKEFFKNSV 379



>gi|448098457|ref|XP_004198931.1| Piso0_002326 [Millerozyma farinosa CBS 7064]
 gi|359380353|emb|CCE82594.1| Piso0_002326 [Millerozyma farinosa CBS 7064]
          Length = 400

 Score =  177 bits (450), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 109/333 (32%), Positives = 164/333 (49%), Gaps = 31/333 (9%)

Query: 48  VRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPS 107
           V+  +F+VFFA     +  +Q + L L        Q  I  T+  F  L+  +  F +P 
Sbjct: 13  VKGVLFLVFFAVGCVGIVSTQAIGLKLLKAGSESRQKLIDLTRTQFVALMTFVVSFMSPC 72

Query: 108 NFVITVDKSA---KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
              IT D ++       +  + G  V    P   + I NHQIY DWL++W     +   G
Sbjct: 73  KITITHDPNSVPESNYFRVDYKGNLVSSLSPN-CVFIGNHQIYTDWLFIWFINQSSRLGG 131

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE--------- 215
              II+K+ L  +P+ G+GM+ F ++FL R W +DK   S  L+T+ ++           
Sbjct: 132 HFHIIMKN-LSEIPVLGYGMKNFNFMFLSRRWESDKAMLSGQLATIDSNARGVGPSNKDN 190

Query: 216 ----PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD 271
               P  +LI+PEGTVVS+ T+  S K+    GL   +HVL PR  GL+     L KS  
Sbjct: 191 KEHWPYSVLIYPEGTVVSENTKQRSAKFLAGKGLPPLKHVLFPRVRGLYLTLRGLRKSAT 250

Query: 272 YVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP--------ED 323
            VYD T G  G++     E++++L+ ++  G  PR  H +IR + +S++P        +D
Sbjct: 251 VVYDATCGYGGLKPEDCGEDLFSLKNVFLRGNGPRASHYYIRAWKLSDIPLGDENTATDD 310

Query: 324 EDK-----FTEWLRQRWIEKDALMEEFYTKGRF 351
            D+     F +WL Q W EKD LM  FY  GRF
Sbjct: 311 FDEEHLAVFEKWLTQVWFEKDKLMASFYQHGRF 343



>gi|58262934|ref|XP_568877.1| acyltransferase [Cryptococcus neoformans var. neoformans JEC21]
 gi|57223527|gb|AAW41570.1| acyltransferase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 316

 Score =  176 bits (447), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 139/275 (50%), Gaps = 47/275 (17%)

Query: 126 NGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQ 185
           NG  V++++P+RL+++ANHQ Y DW+Y+W     A     + I+LK SLK +P+ GWGM+
Sbjct: 2   NGQVVKINLPDRLVIMANHQAYLDWIYIWILACYAGHSAGLIILLKASLKNIPVIGWGMR 61

Query: 186 FFQYIFLKRNWATDKGPFSKTLSTLATS------------------KEPLWLLIFPEGTV 227
           FF +IFL+R+W  D+   +  L  L                     + PLWLLIFPEGT+
Sbjct: 62  FFNFIFLRRSWVADRDNLTLALRQLGQEAQSGQENSETATLLPLRKRSPLWLLIFPEGTI 121

Query: 228 VSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRR 285
           +SD  R+ S KYA K G+ D   +L PRSTGL FC  +L   +    + D+TIG  GV  
Sbjct: 122 ISDEERVKSIKYAKKEGVDDFATLLHPRSTGLLFCLRTLLPQIPDLNLLDITIGYPGVPF 181

Query: 286 GQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP------------------------ 321
           G +P+  Y L  ++ +   P  ++LH+  Y+    P                        
Sbjct: 182 GNYPQNWYGLFSVFLKSVPPPTVYLHLHVYSHLGEPECKIPSLVPRRSSNVSGLSTDSGL 241

Query: 322 ---EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTG 353
              E+   F  WLR  W  K+  ME+FY   RF G
Sbjct: 242 ANAEEARAFELWLRNLWTAKERRMEQFYESQRFGG 276



>gi|366988425|ref|XP_003673979.1| hypothetical protein NCAS_0A10400 [Naumovozyma castellii CBS 4309]
 gi|342299842|emb|CCC67598.1| hypothetical protein NCAS_0A10400 [Naumovozyma castellii CBS 4309]
          Length = 384

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/333 (30%), Positives = 181/333 (54%), Gaps = 23/333 (6%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           L  T++ ++ F     ++  +QF   L +  +    Q  +  T+R F ILL++I    +P
Sbjct: 17  LTTTSLSIIVFIQGCISILITQFFIKLFYYKNSEKLQRGLNQTKRSFIILLLSIFSNVSP 76

Query: 107 SNFVITVDKSAKGVLKQSWNGAKV-----ELDMPERLILIANHQIYADWLYVWCFTYLAN 161
           ++  IT D +   + + S+   ++     +LD     I+ +NHQ+Y DW+ +W   +LAN
Sbjct: 77  TSIRITTDDAT--MRRDSFQINRIGDIIAQLDTNS--IIFSNHQLYIDWVIIWWLAHLAN 132

Query: 162 AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSK------- 214
             G   I+LK SL+ +P+ G+GM+ +++IF+ R WA DK    ++L  + T+        
Sbjct: 133 LSGNFFILLKKSLEKIPLLGYGMKNYKFIFMNRKWAQDKSLLEQSLGAINTNAIENGKNK 192

Query: 215 --EPLW---LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKS 269
                W   +L+FPEGT +       +  Y  K+GL   ++VL+P +TGL F   +L  S
Sbjct: 193 DLTNAWGYNILLFPEGTNLCTNGIRKNNAYCKKMGLKPMKNVLMPHTTGLRFMIQNLQPS 252

Query: 270 VDYVYDLTIGIEGVR-RGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKF 327
           +  +YD+TIG  GV+   +F E  Y+L+ I+ +G  P  I +HIR + + E+P +DE+ F
Sbjct: 253 LTKIYDVTIGYSGVKGEHEFAEIKYSLKNIFLKGLGPSMIDIHIRSFNLYEIPYQDEEAF 312

Query: 328 TEWLRQRWIEKDALMEEFYTKGRFTGYESPRTV 360
           ++WL   W +K+ L++++Y    F G +   T+
Sbjct: 313 SKWLFTVWEDKNRLLDQYYINDTFQGMDGKTTL 345



>gi|255727202|ref|XP_002548527.1| hypothetical protein CTRG_02824 [Candida tropicalis MYA-3404]
 gi|240134451|gb|EER34006.1| hypothetical protein CTRG_02824 [Candida tropicalis MYA-3404]
          Length = 408

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 170/359 (47%), Gaps = 51/359 (14%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RTA  +  F        F+Q+L+LL+        Q+ I  T+  F ILL  I Q   P
Sbjct: 11  IIRTAFIIPIFILGCLCTVFTQWLALLVLHNKSDTIQAIINITKNHFVILLSFITQIVNP 70

Query: 107 SNFVITVDKSAKGVLKQ---SWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAH 163
           S   IT+D +     +Q     +G    +  P   ILI+NHQIY DWLY+W  TY +   
Sbjct: 71  SKIEITIDTTTVPDAQQFKVDESGNLHTMFQPNS-ILISNHQIYTDWLYLWFLTYTSKLS 129

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKT 206
            ++ IILKD L  +P+ G+GM+ + ++FL R W  DK                 GP +  
Sbjct: 130 DSVFIILKD-LSKIPVLGYGMKNYNFMFLSRKWEKDKIVLTNQLLEIDANARGMGPANGV 188

Query: 207 LSTLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVL 252
                T K               P  L++FPEGTV SD T   S +Y    GL   +HVL
Sbjct: 189 KLVSTTDKTFTKWPQGKNSDKIWPYELILFPEGTVPSDRTTKKSAEYTSSKGLPPLKHVL 248

Query: 253 LPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHI 312
           LPR  GL      L  +V+ VYD+T    G+   Q+ E  Y+L++ Y  G  P  I+ HI
Sbjct: 249 LPRVRGLFLALKKLRSTVEVVYDITTVYGGLTEDQYGEIEYSLKRFYLRGYGPPKINYHI 308

Query: 313 RKYAISEMPEDED-------------KFTEWLRQRWIEKDALMEEFYTKGRF--TGYES 356
           R + + ++P  ED             KF  WL   W +KD LM+ FYT G++  T YE+
Sbjct: 309 RGWRLKDIPLGEDVDDIDDIPEEDLKKFENWLLGIWYDKDKLMQNFYTHGKWPETKYET 367



>gi|241956392|ref|XP_002420916.1| uncharacterized acyltransferase, putative [Candida dubliniensis
           CD36]
 gi|223644259|emb|CAX41069.1| uncharacterized acyltransferase, putative [Candida dubliniensis
           CD36]
          Length = 411

 Score =  174 bits (442), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 188/399 (47%), Gaps = 51/399 (12%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RTA     F     ++  +QFL+LL++  +    Q+ I +T+  F ILL  I     P
Sbjct: 11  ILRTAFITPLFILGCLSIVVTQFLTLLIFKTNPDVKQAIINNTKNHFVILLTYITTIVNP 70

Query: 107 SNFVITVDKSAKGVLKQ-SWNGAKVELDM-PERLILIANHQIYADWLYVWCFTYLANAHG 164
               +T+D+S        + +G+     M     ILI+NHQIY DWL++W  TY +    
Sbjct: 71  CEIELTIDESTVPNFDHFTVDGSNNLHTMFQPNSILISNHQIYTDWLFLWFLTYTSKFGN 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKTL 207
           ++ IILKD L  +P+ G+GM+ + ++FL R W  DK                 GP +   
Sbjct: 131 SVFIILKD-LSKIPVLGYGMKNYNFLFLSRKWEKDKIVLTNQLLEIDANARGLGPANGVE 189

Query: 208 STLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
               T KE              P  L++FPEGTV SD T   S ++    GL   +HVLL
Sbjct: 190 LVSTTEKEFTKWPQGSNTNKIWPYELILFPEGTVPSDRTTKKSAEFTASRGLPPLKHVLL 249

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           PR  GL      L  SV+ VYD+T    G+   Q+ E  Y+L+  Y +G  P  I+ +IR
Sbjct: 250 PRVRGLFLALKKLKNSVEIVYDITTAYSGLTEDQYGEIEYSLKNFYVKGYGPPKINYYIR 309

Query: 314 KYAISEMP-------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTV 360
            + + ++P             ED  KF +WL + W +KD LM  +Y  G + G E P+  
Sbjct: 310 GWKLKDIPLGKDVDDIDNIPEEDLKKFEDWLLKLWYDKDRLMNNYYKFGNWDGTEEPKYK 369

Query: 361 PMKLNSVFELTQIWY----FIVPLVPIMWYFSNYLLNRK 395
              +   F+L   +     F+V +  I++    Y+L R+
Sbjct: 370 TKSIIGGFKLRNQFEIFLPFLVTIATILFLRIAYILIRR 408



>gi|472580710|gb|EMS18488.1| lysophosphatidic acid acyltransferase / lysophosphatidylinositol
           acyltransferase [Rhodosporidium toruloides NP11]
          Length = 398

 Score =  174 bits (442), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 153/311 (49%), Gaps = 25/311 (8%)

Query: 66  FSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSA--KGVLKQ 123
           F+  L L+  P   + Y +   H +  F   L+ I  FF P+  V+T D+S   + ++++
Sbjct: 43  FTLVLLLIPHPSVRALYTALNTHAKEAFASDLIFITHFFGPAKLVLTADESVNLEELVRR 102

Query: 124 SWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWG 183
           +  G  V   + +  + ++NHQ+YADW+Y W     A     + IILK SL+W PI G  
Sbjct: 103 NEKGEVVGFRLAKHAVWMSNHQMYADWIYPWILQRFAGVSSGLIIILKASLEWAPIVGPA 162

Query: 184 MQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKV 243
           MQ F + F+ +     K    +         EP   L+FPEGT+ S +TR  S KYA   
Sbjct: 163 MQLFHFCFISKTKTLAKSNLFRVAKEARDRDEPYHCLLFPEGTLYSRLTRPRSAKYAQAS 222

Query: 244 GLVDHEHVLLPRSTGLHF---CAGSL-HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIY 299
           G+ D  +VLLPRSTGL +   C  ++ + S    YDLT+G  GV    + ++ YTL+ IY
Sbjct: 223 GIPDAVNVLLPRSTGLLYTLRCLSTVFNPSKLAFYDLTVGYAGVPAQGYAQDYYTLQTIY 282

Query: 300 FEGQYPRNIHLHIRKYAISEMP-------------------EDEDKFTEWLRQRWIEKDA 340
                P  +H+H R+  + ++P                   E +  F  WLR RW EKD 
Sbjct: 283 GCRVPPPTVHMHFRQIRLDDLPLGTIRPSARPQHIAEEVTSETKQDFDVWLRNRWEEKDR 342

Query: 341 LMEEFYTKGRF 351
           LM +F   G F
Sbjct: 343 LMGQFGATGEF 353



>gi|448102358|ref|XP_004199782.1| Piso0_002326 [Millerozyma farinosa CBS 7064]
 gi|359381204|emb|CCE81663.1| Piso0_002326 [Millerozyma farinosa CBS 7064]
          Length = 400

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/398 (30%), Positives = 189/398 (47%), Gaps = 48/398 (12%)

Query: 41  QNLVQWLV--RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLV 98
           Q L Q LV  +  +F+VFFA     +  +Q + L L        Q  I  T+  F  L+ 
Sbjct: 4   QELQQALVTVKGVLFLVFFAVGCVGIVSTQVIGLKLLKAGSESRQKLIDLTRTQFVALMT 63

Query: 99  AINQFFAPSNFVITVDKSA---KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWC 155
            +  + +P    IT D  +       +    G  V    P   + I NHQIY DWL++W 
Sbjct: 64  FVVSYMSPCKITITHDPDSVPENNYFRVDSKGNLVSSLTPN-CVFIGNHQIYTDWLFIWF 122

Query: 156 FTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKE 215
               +   G   II+K+ L  +P+ G+GM+ F ++FL R W +DK   S  L+T+ ++  
Sbjct: 123 INQSSRLGGHFHIIMKN-LSNIPVLGYGMKNFNFMFLSRKWESDKAVLSGQLATIDSNAR 181

Query: 216 -------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFC 262
                        P  +LI+PEGTVVS+ T+  S K+    GL   +HVL PR  GL+  
Sbjct: 182 GVGPSNKDNKEHWPYSVLIYPEGTVVSENTKQRSAKFLAGKGLPPLKHVLFPRVRGLYLT 241

Query: 263 AGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP- 321
              L KS   VYD+T G  G++     E++++L+ ++  G  P+  H +IR + +S++P 
Sbjct: 242 LRGLRKSATVVYDVTCGYAGLKPEDCGEDLFSLKNVFLRGNGPQASHYYIRAWKLSDIPL 301

Query: 322 -------EDEDK-----FTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPM---KLNS 366
                  +D D+     F +WL + W EKD LM  FY  GRF    S  +  +   K N+
Sbjct: 302 GDENTATDDFDEEQLAVFEKWLTKVWFEKDKLMASFYQHGRFIDPNSSTSNTLDKVKRNT 361

Query: 367 V---FELTQI---------WYFIVPLVPIMWYFSNYLL 392
           V   F++ QI           F V L+ ++W  ++  L
Sbjct: 362 VTADFKVRQISDVVGAFGTLAFFVILINLIWVSASSFL 399



>gi|505756761|gb|EOR00902.1| hypothetical protein J056_004714 [Wallemia ichthyophaga EXF-994]
          Length = 336

 Score =  174 bits (440), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 165/337 (48%), Gaps = 20/337 (5%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           R   F V F   +  +N  Q  S      S S Y S I +++  F   LV          
Sbjct: 6   RVLKFWVIFVIATLNINLVQIFSSPFKLISKSIYTSIIDYSKASFSKFLV---------- 55

Query: 109 FVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTY-LANAHGAIK 167
             I ++    G + + +N   V+   P+ +I  +NHQ+Y DW+Y+W   Y L +    + 
Sbjct: 56  --ILLNLQGNGSVVRVYNPVTVQ---PQSVIF-SNHQLYTDWIYIWTLLYKLESNADHLI 109

Query: 168 IILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTV 227
           IILK SLK +PI GWGMQFF +IFL+R+WA D    S  L  ++ +  P  LL+FPEGT 
Sbjct: 110 IILKHSLKHIPILGWGMQFFNFIFLRRSWAVDNKTLSNQLHQISANSNPYTLLLFPEGTT 169

Query: 228 VSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSL-HKSVDYVYDLTIGIEGVRRG 286
           +S+ +R  S  +  K+G+ D  H+L PR TGL     SL H     V D T+    +  G
Sbjct: 170 ISNDSRPKSNNFTKKIGVEDFHHLLYPRVTGLLHSLRSLSHNPNLQVIDSTLAYPDIPPG 229

Query: 287 QFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQRWIEKDALMEEF 345
            + ++ YTL+  +     P  IHLH+  + + ++P   +D FT WL QRW EK+  +  F
Sbjct: 230 VYGQDWYTLKNTFLRRISPDIIHLHMSSWKLCDIPIHSDDLFTSWLLQRWHEKEQRLRVF 289

Query: 346 YTKGRFTGYESPRTVPMKLNSVFELT-QIWYFIVPLV 381
                       + +P+ L      T   + + VP++
Sbjct: 290 QESHTLDPSGKYQDIPLNLTHPLAHTLDAFIYFVPII 326



>gi|410077219|ref|XP_003956191.1| hypothetical protein KAFR_0C00610 [Kazachstania africana CBS 2517]
 gi|372462775|emb|CCF57056.1| hypothetical protein KAFR_0C00610 [Kazachstania africana CBS 2517]
          Length = 411

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 157/325 (48%), Gaps = 45/325 (13%)

Query: 76  PFSHSYYQSYIKHTQRCFGILLVAINQFFAPSNFVITVDKSA--KGVLKQSWNGAKVELD 133
           P     +Q+ +  T++ F  +L+ I    APS   IT D     KG         K   +
Sbjct: 46  PKDTPRFQNALDQTKKAFICILITIWHVVAPSKVRITTDNKTIPKGTFFIDLKKNKFSSN 105

Query: 134 MPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLK 193
           +    + IANHQIY DW+++W   Y +N  G + I+LK SL+ +P+ G+GM  F++IF+ 
Sbjct: 106 IKPNSVTIANHQIYTDWVFLWWLAYTSNLAGRVYIMLKKSLQSIPVLGYGMTNFKFIFMN 165

Query: 194 RNWATDKGPFSKTLSTL-----------------------------------------AT 212
           R WA D+     +L  L                                          T
Sbjct: 166 RKWAADRVHLINSLRELDADARGTGSLTGSRPVSVDDNGLINWNTTIQPSAEIKQSKKGT 225

Query: 213 SKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDY 272
           S  P  L++FPEGT  +  T   S  +A+K      ++VLLP STGL FC  +L  S+D 
Sbjct: 226 SCWPYNLILFPEGTNHTANTLSKSIIFAEKANRKPLKNVLLPHSTGLRFCLRNLKPSLDI 285

Query: 273 VYDLTIGIEGV-RRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEW 330
           +YD+TI   G+ +  +F  + Y L  I+ EG+YP  + ++IR + I  +P +DED+F +W
Sbjct: 286 LYDVTIAYSGIDKETKFAADAYGLGSIFLEGKYPSIVDIYIRAFEIENIPIDDEDQFVDW 345

Query: 331 LRQRWIEKDALMEEFYTKGRFTGYE 355
           +   W EKD L+E ++  G   G +
Sbjct: 346 IYNVWKEKDELLENYHKNGNSFGLD 370



>gi|459366322|gb|EMG45703.1| hypothetical protein G210_4088, partial [Candida maltosa Xu316]
          Length = 408

 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 187/397 (47%), Gaps = 59/397 (14%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RT+  +  F     ++ F+Q+L LL++  +    Q+ I +T+  F ILL  +     P
Sbjct: 11  ILRTSFVIPVFIFGCLSIVFTQWLGLLIFGNNPPVRQAIISNTKTHFLILLSFLTSLINP 70

Query: 107 SNFVITVDKSAKGVLKQ--SWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHG 164
           S   IT+D +     +Q  S +   +        +LI+NHQIY DWL++W  TY +    
Sbjct: 71  SKVEITIDTTTVPNAQQFKSDSANNLHTMFQPNSVLISNHQIYTDWLFLWFLTYTSKLSD 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKTL 207
           +I IILKD L  +P+ G+GM+ + ++FL R W  DK                 GP +   
Sbjct: 131 SIYIILKD-LSNIPVLGYGMKNYNFMFLSRKWEKDKVVLTNQLLEIDANARGLGPANGVK 189

Query: 208 STLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
              +T K               P  L++FPEGTV SD T   S +Y    GL   +HVLL
Sbjct: 190 LISSTDKTFTKWPEGNNSDKIWPYELILFPEGTVPSDRTTKKSAEYVASKGLPPLKHVLL 249

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           PR  GL      L  +V+ VYD+T G  G++  ++ E +++L++ Y +G  P  I+ +I+
Sbjct: 250 PRVRGLFLALKKLQNTVEVVYDITTGYGGLKDDEYGELVFSLKRYYLKGYGPPKINYYIK 309

Query: 314 KYAISEMP-------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPR-- 358
            + + ++P             ED  KF  WL   W EKD LM  FY  G +   ++    
Sbjct: 310 GWKLKDIPLGKDVEDIDDVSEEDLAKFETWLMDVWYEKDRLMSNFYATGTWGESKNETKT 369

Query: 359 -TVPMKLNSVFELTQIWYFIVPLVPIMWYFSNYLLNR 394
            T   KL S FE+          VP +  FS  L+ R
Sbjct: 370 ITGDFKLRSPFEI---------FVPFLVVFSTLLILR 397



>gi|344300018|gb|EGW30358.1| hypothetical protein SPAPADRAFT_63211 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 404

 Score =  171 bits (432), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 46/359 (12%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR+A  V  F      + F+Q + L ++  +    Q+ I  T+  F IL+  +     P
Sbjct: 11  IVRSAFLVPTFLIGCLFIVFTQVVGLYVFQHNAPSRQAMINITKTHFVILITFMTSLINP 70

Query: 107 SNFVITVDKSAKGVLKQSW-NGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGA 165
           +   IT+DKS     + +  NG  +        I I+NHQIY DWL++W   Y +     
Sbjct: 71  TKIAITLDKSVPNPQQFTVDNGGHLHTSFKPNSIFISNHQIYTDWLFLWFLNYTSRLSDY 130

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSKT-- 206
           I I+LKD L  +P+ G+GM+ + ++FL R W  DK                 GP +    
Sbjct: 131 IYIVLKD-LSSIPVLGYGMKNYNFLFLSRKWEKDKIKLTNQLLEIDANARGVGPANGVTL 189

Query: 207 LSTLATSKEPLW-------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
           +ST  T+K   W             L++FPEGTV SD T   S++Y    G    +HVLL
Sbjct: 190 VSTTNTNKIREWPKTNQPSKIWPYQLILFPEGTVPSDRTTKKSREYIQANGHEPMKHVLL 249

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           PR  GL+     L  +++ VYD+TI    ++  ++ E++++L++ Y +G  P  I+ ++R
Sbjct: 250 PRIRGLYLALKKLQNTLEVVYDITIAYSNLKETEYGEDVFSLKRYYLKGYGPERINYYVR 309

Query: 314 KYAISEMP----EDED--------KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTV 360
            ++I ++P    ED D        KF +WL   W EKD LM  FY  G +     P  V
Sbjct: 310 CFSIKDIPLGDEEDVDDISPEALKKFEQWLLNVWYEKDELMSNFYKLGHWDKPNDPTVV 368



>gi|149236065|ref|XP_001523910.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452286|gb|EDK46542.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 422

 Score =  170 bits (431), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 126/393 (32%), Positives = 185/393 (47%), Gaps = 62/393 (15%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VRTA+ +  F      + F+Q++SL+L+  S S   S I  T+  F ILL  +     P
Sbjct: 11  IVRTAILIPTFILGCLCIVFTQWVSLILFRNSPSTTNSIIGTTKTHFVILLGLLTSIVNP 70

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELD--MPERLILIANHQIYADWLYVWCFTYLANAHG 164
               +TVD  +    +Q    + + L   +    ++I+NHQIY DWL++W  TY +N   
Sbjct: 71  CKIAVTVDVDSVPHSQQFKVDSSLNLHTFLDPNSVIISNHQIYTDWLFLWFLTYTSNLSN 130

Query: 165 AIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFS--K 205
           A+ IILKD L  +P+ G+GM  F ++FL R WA DK                 GP +  +
Sbjct: 131 AVFIILKD-LSKIPVLGYGMTNFNFLFLSRKWAKDKIVLTNQLLEIDANARGLGPANGVQ 189

Query: 206 TLSTLATSKE-------------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLV 246
            +S+ +TS +                   P  L++FPEGTV SD T   S +Y    G  
Sbjct: 190 LVSSKSTSADIDIKKWPTGKNPRKDQKLWPYELILFPEGTVPSDRTTKKSAEYVLSKGYP 249

Query: 247 DHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPR 306
             +HVLLPR  GL      L  SV+ VYD+T     ++  ++ E  ++L+  Y  G  P 
Sbjct: 250 PLKHVLLPRVRGLFLALKKLRNSVEEVYDITTAYSDLKADEYGEIKFSLKNFYLRGYGPP 309

Query: 307 NIHLHIRKYAISEMP--------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRF- 351
            I+  IR Y I ++P              E   KF +WL + W EKD LM  FY  G + 
Sbjct: 310 VINYFIRAYKIKDIPLGDEDEDDIDETSDESLQKFEKWLLKIWYEKDELMNNFYETGEWN 369

Query: 352 -TGYESPRTVPMKLNSVFELTQIWYFIVPLVPI 383
              Y++ RTV       F+L   W  + P +PI
Sbjct: 370 ANAYDT-RTVIGD----FKLKNKWEIVRPYLPI 397



>gi|388492986|gb|AFK34559.1| unknown [Medicago truncatula]
 gi|388516089|gb|AFK46106.1| unknown [Medicago truncatula]
          Length = 383

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 138/257 (53%), Gaps = 14/257 (5%)

Query: 132 LDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIF 191
           + M ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGWG Q  ++I 
Sbjct: 94  IPMRERVLLIANHRTEVDWMYLWDLALRKGRLGFIKYILKSSLMKLPIFGWGFQILEFIA 153

Query: 192 LKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHV 251
           ++R W  D+    + LST    K+PLWL +FPEGT  ++    +S+K+A +VGL    +V
Sbjct: 154 VERKWEIDEQILQQNLSTFRDPKDPLWLSLFPEGTDYNEQKCKSSQKFAAEVGLPVLTNV 213

Query: 252 LLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH 311
           LLP++ G H C  +L  S+D VYD+TI  +  +   F + ++        G  P  +HLH
Sbjct: 214 LLPKTKGFHTCLETLRGSLDAVYDVTIAYKN-QCPSFLDNVF--------GLDPSEVHLH 264

Query: 312 IRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELT 371
           IR+  I E+P  E K   WL   +  KD L+ +F  +G F   ++   +     S F+  
Sbjct: 265 IRRIPIEEIPVSETKAASWLMDAFQIKDQLLSDFKVQGHFPNQQNEEEI-----STFKCL 319

Query: 372 QIWYFIVPLVPIMWYFS 388
             +  IV    +  YF+
Sbjct: 320 FTFTVIVCFTALFTYFT 336



>gi|502125937|ref|XP_004499122.1| PREDICTED: LOW QUALITY PROTEIN: probable
           1-acyl-sn-glycerol-3-phosphate acyltransferase 4-like
           [Cicer arietinum]
          Length = 434

 Score =  166 bits (421), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 137/258 (53%), Gaps = 14/258 (5%)

Query: 131 ELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYI 190
            + M ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGWG    ++I
Sbjct: 130 SIPMRERVLLIANHRTEVDWMYLWDLALRKGRLGCIKYILKSSLMKLPIFGWGFHILEFI 189

Query: 191 FLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEH 250
            ++R W  D+    + LST     +PLWL IFPEGT  ++    +S+K+A +VGL    +
Sbjct: 190 AVERKWEIDEQILQQNLSTFQDPDDPLWLSIFPEGTDYTEQKCKSSQKFAAEVGLPVLTN 249

Query: 251 VLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHL 310
           VLLP++ G H C  +L  S+D VYD+TI  +  +   F + ++        G  P  +H+
Sbjct: 250 VLLPKTKGFHTCLEALRSSLDAVYDVTIAYKN-QCPSFLDNVF--------GLNPSEVHM 300

Query: 311 HIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFEL 370
           H+R+  + E+P  E K   WL  ++  KD L+ +F  +G F     P  +  +  S F+ 
Sbjct: 301 HVRRIPVDEIPVSETKAASWLMDKFQTKDQLLSDFKVQGHF-----PNQLNEEEISTFKC 355

Query: 371 TQIWYFIVPLVPIMWYFS 388
              +  I+    +  YF+
Sbjct: 356 LITFTLIISFTAMFAYFT 373



>gi|359807379|ref|NP_001241383.1| uncharacterized protein LOC100808657 [Glycine max]
 gi|255635102|gb|ACU17909.1| unknown [Glycine max]
          Length = 383

 Score =  166 bits (421), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 122/218 (55%), Gaps = 9/218 (4%)

Query: 134 MPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLK 193
           M ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGWG    ++I ++
Sbjct: 96  MKERVLLIANHRTEVDWMYLWDLALRKGRLGCIKYILKSSLMKLPIFGWGFHILEFIAVE 155

Query: 194 RNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
           R W  D+    + LST    ++PLWL +FPEGT  +D    TSKK+A + GL    +VLL
Sbjct: 156 RKWEIDEQILQQKLSTFKDPQDPLWLALFPEGTDYTDQKSKTSKKFAAEAGLPVLTNVLL 215

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P++ G H C  +L  S+D VYD+TI  +  +   F + ++        G  P  +HLH+R
Sbjct: 216 PKTKGFHACLEALRGSLDAVYDVTIAYKN-QCPSFLDNVF--------GVDPSEVHLHVR 266

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +  + E+P  E K   WL   +  KD L+ +F  +G F
Sbjct: 267 RIPVEEIPASETKAASWLIDTFQIKDQLLSDFKIQGHF 304



>gi|195998323|ref|XP_002109030.1| hypothetical protein TRIADDRAFT_52645 [Trichoplax adhaerens]
 gi|190589806|gb|EDV29828.1| hypothetical protein TRIADDRAFT_52645 [Trichoplax adhaerens]
          Length = 364

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 139/261 (53%), Gaps = 12/261 (4%)

Query: 133 DMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFL 192
           D  ER I+I NH+   DWL  W  ++   A   IKIIL+  LK++P  GWGMQ   +IFL
Sbjct: 76  DPKERCIIIMNHRTRQDWLLFWAVSHRYFAVENIKIILRGDLKYVPGVGWGMQMLNFIFL 135

Query: 193 KRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVL 252
           KR W  D+  FS+TL        P  ++IFPEGT   +++ +   KYA+  GL  +E+ L
Sbjct: 136 KRKWEKDRIVFSRTLDYFNDIDYPAKIIIFPEGTNYEEISALRGYKYANIHGLQQYEYCL 195

Query: 253 LPRSTGLHFCAGSL-HKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH 311
            PR TG  F    L  K +D VYD+T+         +P+ +        +G  P  +H  
Sbjct: 196 HPRVTGFAFLVSKLREKRLDAVYDVTVA--------YPKTMPQSEMTLLKGNIPEELHYQ 247

Query: 312 IRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGR-FTGYESPRTVPMKLNSVFEL 370
           I++Y  SE+PED+++  EW ++RW EK+  + +FYT  + F G  +P T   K   +   
Sbjct: 248 IKRYDNSELPEDQEELGEWCKKRWAEKEDRLRQFYTVDKTFDGNNTPDTTG-KFKFILA- 305

Query: 371 TQIWYFIVPLVPIMWYFSNYL 391
           T  W  IVP+   + Y++  L
Sbjct: 306 TLFWILIVPISMYLTYYNTIL 326



>gi|294658704|ref|XP_002770829.1| DEHA2F15664p [Debaryomyces hansenii CBS767]
 gi|202953324|emb|CAR66352.1| DEHA2F15664p [Debaryomyces hansenii CBS767]
          Length = 420

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 168/358 (46%), Gaps = 52/358 (14%)

Query: 49  RTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAPSN 108
           RT V   FF     ++  +Q +   ++       Q+ I  T++ F  L   I Q+ +P  
Sbjct: 13  RTLVLGFFFVIGCISILGNQLIGTFVFANDAVQKQAVINLTKKHFIALFGTITQWVSPCK 72

Query: 109 FVITVDKSA---KGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGA 165
             IT D S        K   +G    +  P   +LI+NHQ+Y DWLY+W   Y A    +
Sbjct: 73  ISITYDPSTLPEGDSFKVDPSGNLSSILSPNS-VLISNHQLYTDWLYLWFILYTAKLGDS 131

Query: 166 IKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GP---FSK 205
           + I+LKD L  +P+ G GM+ + ++FL R W  DK                 GP    + 
Sbjct: 132 VYIMLKD-LSKIPVLGIGMKNYNFLFLSRKWEKDKIVLTNQLLTIDANARGLGPANGVTH 190

Query: 206 TLSTLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHV 251
             ST   S E              P  ++++PEGTV S  TR  S K+ ++  +   +H 
Sbjct: 191 VTSTNVGSSELHHWPEGHKAGQIWPYSVILYPEGTVTSARTRAKSNKFCEERNMPVLKHT 250

Query: 252 LLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLH 311
           LLPR  GL      L  +V+ VYD T G   ++ G++ E+IYTL++ Y +G  P+ I  H
Sbjct: 251 LLPRVRGLFLTLRKLRNTVEIVYDFTCGYSDLKPGEYGEDIYTLKRHYLKGYGPKKISYH 310

Query: 312 IRKYAISEMP-------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYES 356
           +R + +SE+P             ED  KF EWL + W EKD ++++FY  G F   ES
Sbjct: 311 LRGWKLSEIPLGEETEDIDDVSSEDLIKFEEWLFKVWYEKDRMLDQFYKLGSFVDPES 368



>gi|359475266|ref|XP_003631627.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like [Vitis vinifera]
          Length = 370

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 135/246 (54%), Gaps = 14/246 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LP+FGWG    ++I ++R 
Sbjct: 98  ERVLLIANHRTEVDWMYLWDLALRKGCLGCIKYILKSSLMKLPVFGWGFHIMEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LST    ++PLWL +FPEGT  ++   I S+KYA + GL   ++VLLP+
Sbjct: 158 WEIDEPLMHQMLSTFRDPRDPLWLAVFPEGTDFTEQKCIRSQKYAAEKGLPILKNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYDLTIG +  +   F + ++        G  P  +H+H+R+ 
Sbjct: 218 TKGFCACLEDLRGSLDAVYDLTIGYKH-QCPSFLDNVF--------GVDPSEVHMHVRRI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF-----TGYESPRTVPMKLNSVFEL 370
            ++ +P  E++ T WL   +I KD L+  FY++G F      G  S     +   +V  L
Sbjct: 269 PLNNIPTSENEVTTWLMDTFILKDQLLSNFYSQGGFPHQGTEGTLSTMKCLVNFVAVIGL 328

Query: 371 TQIWYF 376
           T I+ F
Sbjct: 329 TGIFTF 334



>gi|388522193|gb|AFK49158.1| unknown [Lotus japonicus]
          Length = 398

 Score =  165 bits (417), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 136/255 (53%), Gaps = 14/255 (5%)

Query: 134 MPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLK 193
           M ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGWG    ++I ++
Sbjct: 96  MKERVLLIANHRTEVDWMYLWSLAIRKGRLGYIKYILKSSLMKLPIFGWGFHILEFIAVE 155

Query: 194 RNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
           R W  D+    + LST    ++PLWL IFPEGT  ++    +S+K+A +VGL    +VLL
Sbjct: 156 RKWEIDEQIMQQKLSTFKDPQDPLWLAIFPEGTDYTEQKCKSSQKFAAEVGLPVLTNVLL 215

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P++ G H C  +L  S+D VYD+TI  +  +   F + ++        G  P  +HLHIR
Sbjct: 216 PKTKGFHACLEALRGSLDAVYDVTIAYKN-QCPSFLDNVF--------GVDPSEVHLHIR 266

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
           +  + E+P  E K   WL   +  KD L+ +F  +G F     P  V  K  S F+    
Sbjct: 267 RIPVEEIPASEAKADSWLMNTFEIKDQLLSDFKVEGHF-----PNQVNDKELSTFKGLLT 321

Query: 374 WYFIVPLVPIMWYFS 388
           +  +V    +  YF+
Sbjct: 322 FTMVVGFTAMFTYFT 336



>gi|356564243|ref|XP_003550365.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           4-like [Glycine max]
          Length = 383

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 122/218 (55%), Gaps = 9/218 (4%)

Query: 134 MPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLK 193
           M ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGWG    ++I ++
Sbjct: 96  MKERVLLIANHRTEVDWMYLWDLALRKGRLGCIKYILKSSLMKLPIFGWGFHILEFIAVE 155

Query: 194 RNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
           R W  D+    + LSTL   ++PLWL +FPEGT  +D     S+K+A + GL    +VLL
Sbjct: 156 RKWEIDEQILQQKLSTLKDPQDPLWLALFPEGTDYTDQKSKNSQKFAAEAGLPVLTNVLL 215

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           P++ G H C  +L  S+D VYD+TI      + Q P     L  ++  G  P  +HLH+R
Sbjct: 216 PKTKGFHACLEALRASLDAVYDVTIAY----KNQCPS---FLDNVF--GVDPPEVHLHVR 266

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           +  + E+P  E K   WL   +  KD L+ +F  +G F
Sbjct: 267 RIPVEEIPASETKAASWLIDTFQIKDQLLSDFKIQGHF 304



>gi|224105447|ref|XP_002313814.1| predicted protein [Populus trichocarpa]
 gi|222850222|gb|EEE87769.1| predicted protein [Populus trichocarpa]
          Length = 368

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 123/216 (56%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G I+ +LK SL  LP+FGWG    ++I ++R 
Sbjct: 98  ERVLLIANHRTEVDWMYLWDLALRKGCLGCIRYVLKSSLMKLPVFGWGFHILEFISVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LS+    ++PLWL +FPEGT  ++   I SKKYA + GL    +VLLP+
Sbjct: 158 WEVDESNIHQMLSSFKDPRDPLWLALFPEGTDFTEQKCIRSKKYAAEHGLPILNNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G + C   L  S+D VYD+TIG +       P     L  ++  G  P  +H+H+R+ 
Sbjct: 218 TKGFYACMEDLRGSLDAVYDVTIGYK-------PRCPSLLDNVF--GVNPSEVHIHVRRI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           A+ E+P  E + + WL   +  KD L+ +FY +G F
Sbjct: 269 ALGEIPTSEKEVSAWLTNTFQLKDQLLSDFYLQGHF 304



>gi|259490769|ref|NP_001159241.1| hypothetical protein [Zea mays]
 gi|223942953|gb|ACN25560.1| unknown [Zea mays]
 gi|414880222|tpg|DAA57353.1| TPA: hypothetical protein ZEAMMB73_299612 [Zea mays]
          Length = 399

 Score =  163 bits (413), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 132/247 (53%), Gaps = 14/247 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
            R++L ANH+   DW+Y+W         G IK ILK SL  LPIF W    F++I ++R 
Sbjct: 116 RRVLLFANHRTEVDWMYLWDLALRKGHLGYIKYILKSSLMKLPIFSWAFHIFEFIPVERK 175

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+      LS     ++P+WL +FPEGT  ++   I S++YA + GL   EHVLLP+
Sbjct: 176 WEIDEAIIQNKLSKFKNPRDPIWLAVFPEGTDYTEKKCIMSQEYASEHGLPMLEHVLLPK 235

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYD+TI  +  R   F + +Y        G  P  +H+H+R  
Sbjct: 236 TKGFICCLQELRSSLDAVYDVTIAYKH-RLPDFLDNVY--------GVDPSEVHIHVRMV 286

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF--TGYESPRTVPMKLN---SVFEL 370
            +  +P  EDK TEW+ +R+ +KD L+ +F+ KG F   G E   + P  L    +V  L
Sbjct: 287 QLHHIPTTEDKITEWMVERFRQKDQLLADFFMKGHFPDEGTEGDLSTPKCLANFLTVVCL 346

Query: 371 TQIWYFI 377
           T I  ++
Sbjct: 347 TAICLYL 353



>gi|242058907|ref|XP_002458599.1| hypothetical protein SORBIDRAFT_03g036470 [Sorghum bicolor]
 gi|241930574|gb|EES03719.1| hypothetical protein SORBIDRAFT_03g036470 [Sorghum bicolor]
          Length = 399

 Score =  163 bits (413), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 132/246 (53%), Gaps = 14/246 (5%)

Query: 137 RLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNW 196
           R++L ANH+   DW+Y+W         G IK ILK SL  LPIF W    F++I ++R W
Sbjct: 117 RVLLFANHRTEVDWMYLWDLALRKGHLGYIKYILKSSLMKLPIFSWAFHIFEFIPVERKW 176

Query: 197 ATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRS 256
             D+      LS     ++P+WL +FPEGT  ++   I S++YA + GL   EHVLLP++
Sbjct: 177 EIDEAIIQNKLSKFKNPRDPIWLAVFPEGTDYTEKKCIKSQEYASEHGLPKLEHVLLPKT 236

Query: 257 TGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYA 316
            G   C   L  S+D VYD+TI  +  R   F + +Y        G  P  +H+HIR   
Sbjct: 237 KGFICCLQELRSSLDEVYDVTIAYKH-RLPDFLDNVY--------GVDPSEVHIHIRTVQ 287

Query: 317 ISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF--TGYESPRTVPMKLN---SVFELT 371
           +  +P  ED+ TEW+ +R+ +KD L+ +F+ KG F   G E   + P  L    +V  LT
Sbjct: 288 LHHIPTSEDEITEWMIERFRQKDQLLSDFFVKGHFPDEGMEGDLSTPKCLANFLTVVGLT 347

Query: 372 QIWYFI 377
            I  ++
Sbjct: 348 VICLYL 353



>gi|68483565|ref|XP_714343.1| potential acyltransferase [Candida albicans SC5314]
 gi|46435901|gb|EAK95274.1| potential acyltransferase [Candida albicans SC5314]
          Length = 413

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 193/408 (47%), Gaps = 62/408 (15%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RTA     F     +++ +QFL+LL++  +    Q+ I +T+  F IL+  I     P
Sbjct: 11  ILRTAFITPLFILGCLSISLTQFLTLLIFKNNPDVKQAIINNTKNHFVILISYITTIVNP 70

Query: 107 SNFVITVDK-----SAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLAN 161
               IT+D+     S    + +S N   +        +LI+NHQIY DWLY+W  TY + 
Sbjct: 71  CKIEITIDETTVPNSDHFTVDESNN---IHTMFQPNSVLISNHQIYTDWLYLWFLTYTSK 127

Query: 162 AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTL-------------- 207
              ++ IILKD L  +P+ G+GM+ + ++FL R W  DK   +  L              
Sbjct: 128 FGNSVFIILKD-LSKIPVLGYGMKNYNFLFLSRKWEKDKIVLTNQLLEIDANARGMGPAN 186

Query: 208 ------STLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVD 247
                 S+  T+ E              P  L++F EGTV SD T   S ++    GL  
Sbjct: 187 GVQLIGSSSTTNTEFTKWPQGSNVNKIWPYELILFAEGTVPSDRTTKKSAEFIASRGLPP 246

Query: 248 HEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRN 307
            +HVLLPR  GL      L  SV+ VYD+T    G+   Q+ E  Y+L++ Y +G  P  
Sbjct: 247 LKHVLLPRIRGLFLALKKLKSSVEIVYDITTAYSGLTEDQYGEIEYSLKRFYLKGYGPPK 306

Query: 308 IHLHIRKYAISEMPEDED-------------KFTEWLRQRWIEKDALMEEFYTKGRFT-- 352
           I+ +I+ + + ++P  ED             KF +WL + W EKD LM+  Y  G +   
Sbjct: 307 INYYIKGWKLKDIPLGEDVDDIDNILEQDLKKFEDWLLKIWYEKDKLMDNHYKLGNWGEL 366

Query: 353 GYESPRTV--PMKLNSVFELTQIWYFIVPLVPIMWYFSNYLLNRKFTS 398
            +++ R++    KL + FE+     F+  +  I++    Y+L R+  +
Sbjct: 367 NHKTTRSIIGDFKLRNQFEI--FLPFLATIATILFLRIAYILIRRIIN 412



>gi|260939890|ref|XP_002614245.1| hypothetical protein CLUG_05731 [Clavispora lusitaniae ATCC 42720]
 gi|238852139|gb|EEQ41603.1| hypothetical protein CLUG_05731 [Clavispora lusitaniae ATCC 42720]
          Length = 411

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 184/402 (45%), Gaps = 62/402 (15%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RTA  +  F   +  +   Q L  +++    +++ + +  T+  F  LL  +     P
Sbjct: 11  VLRTAFVIFAFIFGTLGIRLLQELGGVVFSRHPAHFHACVALTKSHFLALLTFLTALVNP 70

Query: 107 SNFVITVDKSAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAI 166
           +   +T D       +       +   +    + I+NHQIY DWL+ W   Y     GA 
Sbjct: 71  TAVSVTWDARQMSSSRFEVRAGHLHSTLAANAVWISNHQIYTDWLFWWFLAYTGGHAGAA 130

Query: 167 KIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GPFSK-TLS 208
            I+LK++L  +P+ G GM+ F+++FL R WATDK                 GP +  T +
Sbjct: 131 YIVLKENLAKIPVLGPGMRRFRFMFLSRKWATDKLRLTSQLLELDANARGMGPVAGVTCA 190

Query: 209 TLATSKEP---LW------------LLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLL 253
              +S+ P    W            L+++PEGTV+S  TR  S K+   +      HVLL
Sbjct: 191 ASESSRLPGVRQWPPGHGSVAANYHLIVYPEGTVMSPHTRERSDKFCASINRPPLRHVLL 250

Query: 254 PRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           PR+ GL     SL  SVD VYDLT G  G+   Q+ EE++TL+  Y  G  PR I+  +R
Sbjct: 251 PRARGLFLMLRSLRGSVDVVYDLTTGYTGLGPEQYGEEVFTLKAYYLFGYGPRKINFAVR 310

Query: 314 KYAISEMPEDED---------------KFTEWLRQRWIEKDALMEEFYTKGRFTGYESPR 358
            + ++++P   D               +F EWL   W  KD LM  F+  G F G E+ +
Sbjct: 311 TWNLADIPLGPDDGNIDVDDVDPQVMRQFEEWLYDAWYAKDELMSRFFATGSFEGEET-K 369

Query: 359 TV--PMKLNSVFELTQIWYFIVPLVP-----IMWYFSNYLLN 393
           TV  P +L S  E       + P VP     +M Y S  L++
Sbjct: 370 TVEAPFQLRSPLEA------LAPFVPSLTLVLMLYLSVRLIS 405



>gi|255556121|ref|XP_002519095.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gi|223541758|gb|EEF43306.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
          Length = 356

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 121/216 (56%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           E ++LIANH+   DW+Y+W   +     G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 98  ECVLLIANHRTEVDWMYLWDLAWRKGCLGFIKYVLKSSLMKLPIFGWGFHILEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D     + LS+    K+PLWL +FPEGT  +D     SKKYA + GL    +VLLP+
Sbjct: 158 WEVDGSNMRRVLSSFKDPKDPLWLALFPEGTDFTDQKCERSKKYAAENGLPILNNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G + C   L  S+D VYD+TIG +       P     L  ++  G  P  +H+H+R+ 
Sbjct: 218 TKGFYACLECLRGSMDAVYDVTIGYK-------PRCPSLLDNVF--GVNPSEVHIHVRRI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           A+  +P+ E++   WL   +  KD L+  FY++G F
Sbjct: 269 ALDGIPKSEEEVAAWLMNTFQLKDQLLSNFYSQGHF 304



>gi|460385052|ref|XP_004238219.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           4-like [Solanum lycopersicum]
          Length = 384

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 125/216 (57%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+YVW   Y     G IK +LK SL  LP+FGWG    ++I L+R+
Sbjct: 98  ERVLLIANHRTEVDWMYVWNLAYRKGCLGHIKYLLKKSLMKLPVFGWGFYVLEFIPLERD 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    +TLST    ++PLWL +FPEGT  SD     S+K+A + GL   ++VLLP+
Sbjct: 158 WIVDEPVIKETLSTFTNPQDPLWLTVFPEGTDYSDEKCKASQKFASQNGLPVLKNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G + C   L  S+D VYD+TI      + Q P    T     F G  P  +H+H+R+ 
Sbjct: 218 TKGFYACLEILRSSLDAVYDVTIAY----KNQCP----TFLDNAF-GVDPSEVHIHVRRI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            + ++PE E + ++WL + +  KD L+ +F   G F
Sbjct: 269 PLDKIPEFEKEVSKWLMETFDFKDRLLFDFIANGHF 304



>gi|405118533|gb|AFR93307.1| acyltransferase [Cryptococcus neoformans var. grubii H99]
          Length = 300

 Score =  160 bits (405), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 137/293 (46%), Gaps = 67/293 (22%)

Query: 141 IANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK 200
           +ANHQ Y DW+Y+W     A     + I+LK SLK +P+ GWGM+FF +IFL+R+WA D+
Sbjct: 1   MANHQAYLDWIYIWILACYAGHSPGLIILLKASLKNIPVIGWGMRFFNFIFLRRSWAADR 60

Query: 201 GPFSKTLSTLATS------------------KEPLWLLIFPEGTVVSDVTRITSKKYADK 242
              +  L  L                     + PLWLLIFPEGT++SD  R+ S KYA +
Sbjct: 61  DNLTLALRQLGEEAQSGQENSETSTLLPLRKRSPLWLLIFPEGTIISDEERVKSIKYAKR 120

Query: 243 VGLVDHEHVLLPRSTGLHFCAGSLHKSVD--YVYDLTIGIEGVRRGQFPEEIYTLRKIYF 300
            G+ D   +L PRSTGL FC  +L   +    + D+TIG  GV  G +P+  Y L  ++ 
Sbjct: 121 EGVDDFATLLHPRSTGLLFCLRTLLPQIPDLNLLDITIGYPGVPFGNYPQNWYGLFSVFL 180

Query: 301 EGQYPRNIHLHIRKYA----------------ISEMP-----------EDEDKFTEWLRQ 333
           +   P  ++LH+  Y+                 S  P           E+   F  WLR 
Sbjct: 181 KSVPPPTVYLHLHLYSHLGERECKIPSLVPRRSSSAPGLSTDSGLANAEEARAFELWLRD 240

Query: 334 RWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWYFIVPLVPIMWY 386
            W  K+  ME+FY   RF+G                     Y IVP+  I WY
Sbjct: 241 LWTAKERRMEQFYKSQRFSGP--------------------YDIVPIQQIKWY 273



>gi|460370196|ref|XP_004230940.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like isoform 1 [Solanum lycopersicum]
 gi|460370198|ref|XP_004230941.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like isoform 2 [Solanum lycopersicum]
          Length = 370

 Score =  159 bits (403), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 133/240 (55%), Gaps = 12/240 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R+++IANH+   DW+Y+W         G+I+ ILK SL  LP+FGW     ++I ++R 
Sbjct: 98  KRVLVIANHRTEVDWMYLWDLALRKGCVGSIRYILKSSLMKLPVFGWVFHIMEFIPVERR 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D     + L T    ++PLWL++FPEGT  ++   I SKKYA + GL    +VLLP+
Sbjct: 158 WEADALKLRQILCTYKDPEDPLWLVVFPEGTDFTEQKCIRSKKYASEKGLPILNNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
             G + C   L  S+D VYD+TIG +      F +  +        G  P  +H+H+R  
Sbjct: 218 RKGFYACLEELRGSLDAVYDITIGYKH-HCPSFLDNAF--------GVDPAEVHMHVRCI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF--TGYESP-RTVPMKLNSVFELTQ 372
           AI+++PE E++   WL   + +KD L+ +F+++G F   G ES   TV    N +F LT 
Sbjct: 269 AIADIPESENEAASWLMDTFCDKDKLLSDFHSQGHFPREGIESELSTVKCLANFIFVLTS 328



>gi|344229672|gb|EGV61557.1| hypothetical protein CANTEDRAFT_115023 [Candida tenuis ATCC 10573]
          Length = 424

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 112/363 (30%), Positives = 165/363 (45%), Gaps = 55/363 (15%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           +VR  + ++FF     ++ ++Q + L +      Y  S I  T+R F  L   +      
Sbjct: 13  VVRNIILLIFFLFGCVSIVWTQRVFLFILKDRPKYRHSMINLTKRHFLQLFTFVISILNS 72

Query: 107 SNFVITVDKSAKGVLKQSWN---GAKVELDMPERLILIANHQIYADWLYVWCFTYLANAH 163
           +   IT D S K  L+ S++   G  +   +    ++I+NHQIY DW Y+W   Y +   
Sbjct: 73  TTISITYDPS-KLPLENSFSQLPGNLISTSLSPNSVMISNHQIYTDWFYLWFLNYTSRLS 131

Query: 164 GAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNWATDK-----------------GP---- 202
             + II+KD  K  PI G+GM  F ++FL R W  DK                 GP    
Sbjct: 132 EFVYIIMKDMSK-TPILGYGMTNFNFMFLSRKWDEDKIKLTSQLLEVDANARGSGPASGV 190

Query: 203 -----FSKTLST----------LATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVD 247
                F  T S           ++    P  +L+FPEGTV S  T   S+++ D   L  
Sbjct: 191 RHVTSFRATTSVSDVQSWPKEKVSDDISPYQILLFPEGTVPSLRTTKKSREFCDANNLPP 250

Query: 248 HEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRN 307
            +HVLLPR  GL      L  +V+ VYD+T    G++ G+F E+I+TL+ ++   + P  
Sbjct: 251 LKHVLLPRIRGLFLVLRKLRGTVEVVYDITTAYGGLKAGEFGEDIFTLKGLFLLSRGPEK 310

Query: 308 IHLHIRKYAISEMP--------------EDEDKFTEWLRQRWIEKDALMEEFYTKGRFTG 353
           I+ H R + I ++P              E   KF  WL Q W EKDALM+ FY  G F  
Sbjct: 311 INYHFRSFRIEDIPLGDDDVADVDLVDEETLKKFENWLFQIWYEKDALMDSFYKHGSFVS 370

Query: 354 YES 356
             S
Sbjct: 371 PNS 373



>gi|449461156|ref|XP_004148308.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like [Cucumis sativus]
          Length = 369

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 124/216 (57%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I ++R 
Sbjct: 93  ERVLLIANHRTEVDWMYLWDLAIRKGQLGYIKYILKSSLMKLPVFGWAFHILEFISVERK 152

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LST     +PLWL +FPEGT  ++   I S+K+A + GL   ++VLLP+
Sbjct: 153 WEADESTMHQMLSTFKDYHDPLWLALFPEGTDFTEQKCIRSQKHAAEKGLPILKNVLLPK 212

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G H C   L + +D VYD+TIG     + Q P     L  ++  G  P  +H+HI++ 
Sbjct: 213 TKGFHMCVQDLRQCLDAVYDVTIGY----KHQCPS---LLDNVF--GLEPSEVHIHIQRI 263

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +  +P  E++ T WL   +  K+ L+++FY++G F
Sbjct: 264 PLHHIPTTENQVTNWLMNTFSRKNQLLDKFYSQGHF 299



>gi|449518791|ref|XP_004166419.1| PREDICTED: LOW QUALITY PROTEIN: probable
           1-acyl-sn-glycerol-3-phosphate acyltransferase 5-like
           [Cucumis sativus]
          Length = 369

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 124/216 (57%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I ++R 
Sbjct: 93  ERVLLIANHRTEVDWMYLWDLAIRKGQLGYIKYILKSSLMKLPVFGWAFHILEFISVERK 152

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LST     +PLWL +FPEGT  ++   I S+K+A + GL   ++VLLP+
Sbjct: 153 WEADESTMHQMLSTFKDYHDPLWLALFPEGTDFTEQKCIRSQKHAAEKGLPILKNVLLPK 212

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G H C   L + +D VYD+TIG     + Q P     L  ++  G  P  +H+HI++ 
Sbjct: 213 TKGFHMCVQDLRQCLDAVYDVTIGY----KHQCPS---LLDNVF--GLEPSEVHIHIQRI 263

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +  +P  E++ T WL   +  K+ L+++FY++G F
Sbjct: 264 PLHHIPTTENQVTNWLMNTFSRKNQLLDKFYSQGHF 299



>gi|356545295|ref|XP_003541079.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like [Glycine max]
          Length = 375

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 122/223 (54%), Gaps = 9/223 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I +KR 
Sbjct: 98  ERILLIANHRTEVDWMYLWDLALRKGCLGYIKYILKSSLMRLPVFGWAFHILEFIPVKRK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+      LST    ++PLWL +FPEGT  ++   + S+KYA +  L   ++VLLPR
Sbjct: 158 WEADESIMRHMLSTFKDPQDPLWLALFPEGTDFTEQKCLRSQKYAAEHKLPVLKNVLLPR 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+  VYD+TIG +  R   F + ++        G  P  +H+HI ++
Sbjct: 218 TKGFCACLQELRSSLTAVYDVTIGYK-YRCPSFLDNVF--------GVDPSEVHIHIHRF 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPR 358
            +  +P  ED+ + WL  R+  KD L+  F T+G+F    S R
Sbjct: 269 PLDSIPVSEDEISMWLINRFQTKDQLLSNFQTQGQFPDQASER 311



>gi|68484125|ref|XP_714065.1| potential acyltransferase [Candida albicans SC5314]
 gi|46435592|gb|EAK94971.1| potential acyltransferase [Candida albicans SC5314]
          Length = 413

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 181/380 (47%), Gaps = 60/380 (15%)

Query: 47  LVRTAVFVVFFAGQSAALNFSQFLSLLLWPFSHSYYQSYIKHTQRCFGILLVAINQFFAP 106
           ++RTA     F     +++ +QFL+LL++  +    Q+ I +T+  F IL+  I     P
Sbjct: 11  ILRTAFITPLFILGCLSISLTQFLTLLIFKNNPDVKQAIINNTKNHFVILISYITTIVNP 70

Query: 107 SNFVITVDK-----SAKGVLKQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLAN 161
               IT+D+     S    + +S N   +        +LI+NHQIY DWLY+W  TY + 
Sbjct: 71  CKIEITIDETTVPNSDHFTVDESNN---IHTMFQPNSVLISNHQIYTDWLYLWFLTYTSK 127

Query: 162 AHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRNW-----------------ATDKGPFS 204
              ++ IILKD L  +P+ G+GM  + + FL R W                 A   GP +
Sbjct: 128 FGNSVFIILKD-LSKIPVLGYGMTNYNFYFLSRKWEKVKIVLTNQLLEIDANARGMGPAN 186

Query: 205 KTL---STLATSKE--------------PLWLLIFPEGTVVSDVTRITSKKYADKVGLVD 247
                 S+  T+ E              P  L++FPEGTV SD T   S ++    GL  
Sbjct: 187 GVQLIGSSSTTNTEFTKWPQGSNVNKIWPYELILFPEGTVPSDRTTKKSAEFIASRGLPP 246

Query: 248 HEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRN 307
            +HVLLPR  GL      L  SV+ VY++T    G+   Q+ E  Y+L++ Y +G  P  
Sbjct: 247 LKHVLLPRIRGLFLALKKLKNSVEIVYEITTAYSGLTEDQYGEIEYSLKRFYLKGYGPSK 306

Query: 308 IHLHIRKYAISEMPEDED-------------KFTEWLRQRWIEKDALMEEFYTKGRF--T 352
           I+ +I+ + + ++P  ED             KF +WL + W EKD LM+  Y  G +  +
Sbjct: 307 INYYIKGWKLKDIPLGEDVDDIDNISEQDLKKFEDWLLKIWYEKDKLMDNHYKLGNWGES 366

Query: 353 GYESPRTV--PMKLNSVFEL 370
            +++ R++    KL + FE+
Sbjct: 367 NHKTTRSIIGDFKLRNQFEI 386



>gi|183211900|gb|ACC59200.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ricinus communis]
          Length = 374

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 120/216 (55%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           E ++LIANH+   DW+Y+W   +     G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 98  ECVLLIANHRTEVDWMYLWDLAWRKGCLGFIKYVLKSSLMKLPIFGWGFHILEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D     + LS+    K+PLWL +FPEGT  +D     SKKYA + GL    +VLLP+
Sbjct: 158 WEVDGSNMRRVLSSFKDPKDPLWLALFPEGTDFTDQKCERSKKYAAENGLPILNNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G + C   LH  V  VYD+TIG +       P     L  ++  G  P  +H+H+R+ 
Sbjct: 218 TKGFYACLECLHILVHAVYDVTIGYK-------PRCPSLLDNVF--GVNPSEVHIHVRRI 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           A+  +P+ E++   WL   +  KD L+  FY++G F
Sbjct: 269 ALDGIPKSEEEVAAWLMNTFQLKDQLLSNFYSQGHF 304



>gi|502149143|ref|XP_004507408.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like isoform X3 [Cicer arietinum]
          Length = 355

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/256 (35%), Positives = 135/256 (52%), Gaps = 16/256 (6%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGW     ++I ++R 
Sbjct: 98  ERILLIANHRTEVDWMYLWNLALRKGCLGYIKYILKSSLMRLPIFGWAFHIMEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LST    ++PLWL IFPEGT  ++   + S+KYA + GL   ++VLLP+
Sbjct: 158 WEADESNMRQMLSTFKDPRDPLWLAIFPEGTDFTEQKCLRSQKYAAEHGLPILKNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S++ VYD+TIG +  R   F + ++        G  P  +H+HI  +
Sbjct: 218 TKGFCTCLQELRGSLNAVYDVTIGYK-YRCPSFLDNVF--------GVDPSEVHIHICHF 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP-----MKLNSVFEL 370
            I  +P  ED+   WL  R+  KD L+  F  +G+F    +   +P     +   +V  L
Sbjct: 269 PIDSIPTSEDEICMWLLDRFRFKDQLLFNFQNQGQFPDQATKSDLPAVKSILNCMTVIIL 328

Query: 371 TQIWYFIVPLVPIMWY 386
           T I  F   LVP  ++
Sbjct: 329 TGI--FCAYLVPATYF 342



>gi|367038263|ref|XP_003649512.1| hypothetical protein THITE_2108080 [Thielavia terrestris NRRL 8126]
 gi|346996773|gb|AEO63176.1| hypothetical protein THITE_2108080 [Thielavia terrestris NRRL 8126]
          Length = 223

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 105/138 (76%), Gaps = 1/138 (0%)

Query: 215 EPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVY 274
           +P+WLL+FPEGT  +  +R  S K+A+KVG+ D EHVLLPRSTG++FC   L  +VDYVY
Sbjct: 29  DPMWLLLFPEGTTATQNSRNKSAKWAEKVGIKDPEHVLLPRSTGIYFCLSELKGTVDYVY 88

Query: 275 DLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKYAISEMP-EDEDKFTEWLRQ 333
           D T+  EG+ RG+F E+I+TL++ Y  GQ P++++ + R++ ++++P  ++++F  WLR+
Sbjct: 89  DCTVAYEGIPRGKFGEDIFTLQRTYIRGQPPKSVNFYWRRFRVADIPLGNQEEFEVWLRE 148

Query: 334 RWIEKDALMEEFYTKGRF 351
           RW EKDALME++ + GRF
Sbjct: 149 RWYEKDALMEQYLSTGRF 166



>gi|502149138|ref|XP_004507406.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like isoform X1 [Cicer arietinum]
 gi|502149140|ref|XP_004507407.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like isoform X2 [Cicer arietinum]
          Length = 372

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 131/248 (52%), Gaps = 14/248 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LPIFGW     ++I ++R 
Sbjct: 98  ERILLIANHRTEVDWMYLWNLALRKGCLGYIKYILKSSLMRLPIFGWAFHIMEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LST    ++PLWL IFPEGT  ++   + S+KYA + GL   ++VLLP+
Sbjct: 158 WEADESNMRQMLSTFKDPRDPLWLAIFPEGTDFTEQKCLRSQKYAAEHGLPILKNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S++ VYD+TIG +  R   F + ++        G  P  +H+HI  +
Sbjct: 218 TKGFCTCLQELRGSLNAVYDVTIGYK-YRCPSFLDNVF--------GVDPSEVHIHICHF 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP-----MKLNSVFEL 370
            I  +P  ED+   WL  R+  KD L+  F  +G+F    +   +P     +   +V  L
Sbjct: 269 PIDSIPTSEDEICMWLLDRFRFKDQLLFNFQNQGQFPDQATKSDLPAVKSILNCMTVIIL 328

Query: 371 TQIWYFIV 378
           T I  + +
Sbjct: 329 TGICMYCI 336



>gi|470106525|ref|XP_004289619.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like [Fragaria vesca subsp. vesca]
          Length = 378

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/237 (35%), Positives = 127/237 (53%), Gaps = 14/237 (5%)

Query: 120 VLKQSWNGAKV-----ELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSL 174
           VL +  NG KV      +   ER++LI+NH+   DW+Y+W         G IK ILK SL
Sbjct: 75  VLFEKINGTKVIFSGETVPRGERILLISNHRTEVDWMYLWDLALRKGHQGFIKYILKSSL 134

Query: 175 KWLPIFGWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRI 234
             LP+FGW     ++I ++R W  D+    + LSTL  S++ LWL +FPEGT  ++   +
Sbjct: 135 MKLPVFGWSFHILEFISVERKWEVDEPNMRQMLSTLNDSQDSLWLALFPEGTDFTEQKCL 194

Query: 235 TSKKYADKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYT 294
            ++KYA + GL   +HVLLP++ G   C   L  S+D VYD+TIG        F      
Sbjct: 195 RNQKYAVEHGLPVLKHVLLPKTKGFCACLEELRGSLDAVYDVTIGYRPSSPTFFDNA--- 251

Query: 295 LRKIYFEGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
                  G  P  +H+H+R+  +  +P  ED+ T WL   +  KD L+ +F+++G F
Sbjct: 252 ------SGVNPSEVHMHVRRIPLDTIPTSEDEVTTWLMNTFHFKDQLLSDFHSQGHF 302



>gi|53791688|dbj|BAD53283.1| putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Oryza
           sativa Japonica Group]
          Length = 361

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 128/233 (54%), Gaps = 11/233 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++L ANH+   DW+Y+W         G IK ILK SL  LP+F W    F++I ++R 
Sbjct: 78  KRVLLFANHRTEVDWMYLWDLALRKGYLGYIKYILKSSLMKLPVFSWAFHIFEFIPVERK 137

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+      LS     ++PLWL +FPEGT  ++   I S++YA + GL   ++VLLP+
Sbjct: 138 WEIDEAIIQNKLSAFKDPRDPLWLAVFPEGTDYTEKKCIKSQEYASEHGLPILKNVLLPK 197

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYD+TI  +  R   F + IY        G  P  +H+HIR  
Sbjct: 198 TKGFLCCLQELKSSLDAVYDVTIAYKH-RLPDFLDIIY--------GTDPSEVHIHIRTV 248

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF--TGYESPRTVPMKLNS 366
            + ++P  ED+ T+W+ +R+ +KD L+ +F+ +G F   G E   + P  L +
Sbjct: 249 KLCDIPTSEDEVTDWMIERFRQKDQLLSDFFMQGHFPDEGTEGDVSTPECLAN 301



>gi|302767976|ref|XP_002967408.1| hypothetical protein SELMODRAFT_270630 [Selaginella moellendorffii]
 gi|300165399|gb|EFJ32007.1| hypothetical protein SELMODRAFT_270630 [Selaginella moellendorffii]
          Length = 416

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 125/217 (57%), Gaps = 9/217 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER I+I NH+   DW+Y+W         G +K ++K+S++ LP+FGW +   +++ ++R 
Sbjct: 149 ERAIVICNHRTEVDWMYIWNLALRKGRIGHVKYVVKNSVRDLPVFGWALYVMEFLLIERK 208

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LS+   +++PLWL++FPEGT  ++  ++  ++ A+K GL    HVL+P+
Sbjct: 209 WEVDEPLMERYLSSFKDARDPLWLILFPEGTDYTEQKKLAGQELAEKKGLRKLNHVLMPK 268

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C  +L  S+D VYDLTIG +  R   F + ++        G  P  +H+HIR+ 
Sbjct: 269 TKGFQSCVKNLGSSLDAVYDLTIGYKN-RCPLFIDNLF--------GIDPSEVHIHIRRI 319

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFT 352
            + ++P D +  + WL + +  KD L+  F  KG F+
Sbjct: 320 PVEQIPSDANGCSSWLYKAYERKDELLSSFIKKGYFS 356



>gi|126303648|ref|XP_001380699.1| PREDICTED: lysocardiolipin acyltransferase 1 [Monodelphis
           domestica]
          Length = 376

 Score =  157 bits (397), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 137/261 (52%), Gaps = 18/261 (6%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++W      +     KI LK SLK +P FGW MQ   YIF+ R 
Sbjct: 77  ERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKSSLKSVPGFGWAMQAAAYIFIHRK 136

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK  F   L+     +EPL LLIFPEGT +++ ++  S ++A+K GL  +E+VL PR
Sbjct: 137 WKDDKSHFENMLNYFCDIQEPLQLLIFPEGTDLTENSKAKSNEFAEKNGLEKYEYVLHPR 196

Query: 256 STGLHFCAGSLH--KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L   K++D ++D+T+         +P  I    K    G +P+ IH HI 
Sbjct: 197 TTGFTFVVECLREGKNLDAIHDITVA--------YPHNIPQTEKHLLSGNFPKEIHFHIN 248

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQI 373
           +Y +  +PE +++   W  +RW EK+  +  FY +G    Y + ++V     S F +  +
Sbjct: 249 RYPVESLPETKEELQVWCHKRWQEKEDRLRMFY-EGPKNFYFTGKSVIPPCKSEFRVLMV 307

Query: 374 -------WYFIVPLVPIMWYF 387
                  W F  P + I+ YF
Sbjct: 308 KWMSILYWTFFTPAMFILLYF 328



>gi|18410753|ref|NP_565098.1| lysophosphatidyl acyltransferase 4 [Arabidopsis thaliana]
 gi|42572107|ref|NP_974144.1| lysophosphatidyl acyltransferase 4 [Arabidopsis thaliana]
 gi|83287832|sp|Q8L4Y2.1|LPAT4_ARATH RecName: Full=Probable 1-acyl-sn-glycerol-3-phosphate
           acyltransferase 4; AltName: Full=Lysophosphatidyl
           acyltransferase 4
 gi|20466163|gb|AAM20399.1| putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase
           [Arabidopsis thaliana]
 gi|21536942|gb|AAM61283.1| putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase
           [Arabidopsis thaliana]
 gi|24899817|gb|AAN65123.1| putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase
           [Arabidopsis thaliana]
 gi|332197541|gb|AEE35662.1| lysophosphatidyl acyltransferase 4 [Arabidopsis thaliana]
 gi|332197542|gb|AEE35663.1| lysocardiolipin and lysophospholipid acyltransferase [Arabidopsis
           thaliana]
          Length = 378

 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 14/255 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++LIANH+   DW+Y+W         G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 97  KRVLLIANHRTEVDWMYLWNIALRKGCLGYIKYVLKSSLMKLPIFGWGFHVLEFIPVERK 156

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
              D+    + LS+    +EPLWL +FPEGT  ++     S+K+A +VGL    +VLLP+
Sbjct: 157 REVDEPVLLQMLSSFKDPQEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPK 216

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   LH S+D VYDLTI  +  R   F + ++        G  P  +H+H+R+ 
Sbjct: 217 TRGFGVCLEVLHNSLDAVYDLTIAYKP-RCPSFMDNVF--------GTDPSEVHIHVRRV 267

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWY 375
            + E+P +E + + WL   +  KD L+ +F  +G+F     P   P +  SV +    + 
Sbjct: 268 LLKEIPANEAESSAWLMDSFKLKDKLLSDFNAQGKF-----PNQRPEEELSVLKCIATFA 322

Query: 376 FIVPLVPIMWYFSNY 390
            ++ L  +  Y + Y
Sbjct: 323 GVISLTVVFIYLTLY 337



>gi|482569221|gb|EOA33409.1| hypothetical protein CARUB_v10020475mg [Capsella rubella]
          Length = 378

 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 14/255 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++LIANH+   DW+YVW         G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 97  KRVLLIANHRTEVDWMYVWNIALRKGCLGYIKYVLKSSLMRLPIFGWGFHVLEFIPVERK 156

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
              D+    + LS+     EPLWL +FPEGT  ++     S+K+A +VGL    +VLLP+
Sbjct: 157 REVDEPVLLQMLSSFKDPHEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPK 216

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   LH S+D VYDLTI  +  R   F + ++        G  P  +H+H+R+ 
Sbjct: 217 TRGFGVCLEVLHNSLDAVYDLTIAYKP-RCPSFMDNVF--------GTDPSEVHIHVRRI 267

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWY 375
            + E+P++E + + WL   +  KD L+ +F  +G+F     P   P +  S+ +    + 
Sbjct: 268 PLKEIPDNEAESSAWLMDSFQLKDKLLSDFNAQGQF-----PNQRPGEELSLLKCIATFA 322

Query: 376 FIVPLVPIMWYFSNY 390
            ++ L  +  Y + Y
Sbjct: 323 VVISLTVLFIYLTLY 337



>gi|149633443|ref|XP_001510123.1| PREDICTED: lysocardiolipin acyltransferase 1 [Ornithorhynchus
           anatinus]
          Length = 376

 Score =  157 bits (396), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 135/262 (51%), Gaps = 16/262 (6%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++W      +     K+ LK SLK +P FGW MQ   YIF+ R 
Sbjct: 77  ERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKVCLKSSLKSVPGFGWAMQAAAYIFIHRR 136

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK  F   L      +EPL LLIFPEGT +++ +++ S ++A+K GL  +E+VL PR
Sbjct: 137 WKDDKSHFEAMLDYFCDIREPLQLLIFPEGTDLTENSKVRSNEFAEKNGLQKYEYVLHPR 196

Query: 256 STGLHFCAGSLH--KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L   +++D ++D+T+         +P  I    K   EG +P+ IH HI 
Sbjct: 197 TTGFTFVVERLREGRNLDAIHDITVA--------YPHNIPQTEKHLLEGNFPKEIHFHIH 248

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTV-PMKLNSVFELTQ 372
           +Y +  +P   ++   W  +RW EK+  +  FY   R      P T+ P K  +   L +
Sbjct: 249 RYPVDLLPASTEELQVWCHKRWEEKEERLRSFYQGQRNFEVSGPITIPPCKSETRVLLVK 308

Query: 373 -----IWYFIVPLVPIMWYFSN 389
                 W    P + ++ YFS+
Sbjct: 309 WISLLYWSLFSPAMVVLMYFSS 330



>gi|395507084|ref|XP_003757858.1| PREDICTED: lysocardiolipin acyltransferase 1 [Sarcophilus harrisii]
          Length = 376

 Score =  157 bits (396), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 123/228 (53%), Gaps = 10/228 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++W      +     KI LK SLK +P FGW MQ   YIF+ R 
Sbjct: 77  ERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKSSLKSVPGFGWAMQAAAYIFIHRR 136

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK  F   L+     +EPL LLIFPEGT +++ ++  S ++A+K GL  +E+VL PR
Sbjct: 137 WKDDKSHFENMLNYFCDIQEPLQLLIFPEGTDLTENSKAKSNEFAEKNGLEKYEYVLHPR 196

Query: 256 STGLHFCAGSLH--KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L   K++D ++D+T+         +P  I    K    G +P+ IH HI 
Sbjct: 197 TTGFTFVVECLREGKNLDAIHDVTVA--------YPHNIPQTEKHLINGNFPKEIHFHIS 248

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP 361
           +Y +  +PE +++   W  +RW EK+  +  FY   +  G+     +P
Sbjct: 249 RYPLETLPESKEELQVWCHKRWQEKEERLRMFYEGPKNFGFTGKSVIP 296



>gi|462424422|gb|EMJ28685.1| hypothetical protein PRUPE_ppa006921mg [Prunus persica]
          Length = 390

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 87/231 (37%), Positives = 122/231 (52%), Gaps = 14/231 (6%)

Query: 126 NGAKV-----ELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIF 180
           NG KV      +   ER +LIANH+   DW+Y+W       + G IK +LK SL  LP+F
Sbjct: 83  NGTKVVFTGDTVPPKERTLLIANHKTEVDWMYLWDLALRKGSLGHIKYVLKSSLMKLPVF 142

Query: 181 GWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYA 240
           GWG    ++I LKR W  D+    K LS+ A   +PLWL IFPEGT  ++     S+ +A
Sbjct: 143 GWGFHVLEFIPLKRKWEVDEPVMRKLLSSFADPADPLWLAIFPEGTDYNEEKCKKSQIFA 202

Query: 241 DKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYF 300
            + GL    HVLLPR+ G   C  +L  S+D VYDLTI  +  +   F +  +       
Sbjct: 203 AETGLPVLSHVLLPRTKGFCACLEALRSSLDAVYDLTIAYKN-QCPSFMDNAF------- 254

Query: 301 EGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            G  P  +H+H+R+  I ++PE       WL   +  KD L+ +F T+G F
Sbjct: 255 -GVDPSEVHIHVRRIPIEDIPESIADAASWLTDTFQLKDNLLSDFNTQGHF 304



>gi|115440337|ref|NP_001044448.1| Os01g0782500 [Oryza sativa Japonica Group]
 gi|113533979|dbj|BAF06362.1| Os01g0782500 [Oryza sativa Japonica Group]
 gi|215737195|dbj|BAG96124.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222619366|gb|EEE55498.1| hypothetical protein OsJ_03688 [Oryza sativa Japonica Group]
          Length = 399

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 127/231 (54%), Gaps = 11/231 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++L ANH+   DW+Y+W         G IK ILK SL  LP+F W    F++I ++R 
Sbjct: 116 KRVLLFANHRTEVDWMYLWDLALRKGYLGYIKYILKSSLMKLPVFSWAFHIFEFIPVERK 175

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+      LS     ++PLWL +FPEGT  ++   I S++YA + GL   ++VLLP+
Sbjct: 176 WEIDEAIIQNKLSAFKDPRDPLWLAVFPEGTDYTEKKCIKSQEYASEHGLPILKNVLLPK 235

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYD+TI  +  R   F + IY        G  P  +H+HIR  
Sbjct: 236 TKGFLCCLQELKSSLDAVYDVTIAYKH-RLPDFLDIIY--------GTDPSEVHIHIRTV 286

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF--TGYESPRTVPMKL 364
            + ++P  ED+ T+W+ +R+ +KD L+ +F+ +G F   G E   + P  L
Sbjct: 287 KLCDIPTSEDEVTDWMIERFRQKDQLLSDFFMQGHFPDEGTEGDVSTPECL 337



>gi|356538815|ref|XP_003537896.1| PREDICTED: probable 1-acyl-sn-glycerol-3-phosphate acyltransferase
           5-like [Glycine max]
          Length = 375

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 123/223 (55%), Gaps = 9/223 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LIANH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I ++R 
Sbjct: 98  ERILLIANHRTEVDWMYLWDLALRKGCLGYIKYILKSSLMRLPVFGWAFHILEFIPVERK 157

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+      LST    ++PLWL +FPEGT  ++   + SKKYA + GL   ++VLLP+
Sbjct: 158 WEADESIMRYMLSTFKDPQDPLWLALFPEGTDFTEQKCLRSKKYAAEHGLPVLKNVLLPK 217

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+  VYD+TIG +  R   F + ++        G  P  +H+HI ++
Sbjct: 218 TKGFCACLQELRSSLAAVYDVTIGYK-YRCPSFLDNVF--------GVDPSEVHIHICRF 268

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPR 358
            +  +P  E++ + WL  R+  KD L+  F T+G+F    + R
Sbjct: 269 PLDSIPVSEEEMSMWLINRFQTKDQLLSNFQTQGQFPDQAAER 311



>gi|483510224|gb|EOA99563.1| Lysocardiolipin acyltransferase, partial [Anas platyrhynchos]
          Length = 376

 Score =  156 bits (395), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 123/228 (53%), Gaps = 10/228 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++W      +     KI LK SLK +P FGW MQ   +IF++R 
Sbjct: 77  ERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKICLKSSLKSIPGFGWAMQVAAFIFIQRK 136

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK  F K L       EPL LLIFPEGT +++ T+  S  +A+K GL  +E+VL PR
Sbjct: 137 WEDDKSHFEKMLDYFCDINEPLQLLIFPEGTDLTESTKARSNDFAEKNGLRKYEYVLHPR 196

Query: 256 STGLHFCAGSLHK--SVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L +  ++D ++D+T+         +P+ I    K    G +P+ IH H++
Sbjct: 197 TTGFTFVVECLREGNNLDAIHDITVA--------YPQNIPQTEKHLLNGNFPKEIHFHVQ 248

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP 361
           +Y I  +P  +++   W ++RW EK+  +  FY  G+         +P
Sbjct: 249 RYPIETVPTSKEELQLWCQKRWEEKEERLRHFYEGGKCFDKTRQSVIP 296



>gi|302753762|ref|XP_002960305.1| hypothetical protein SELMODRAFT_437414 [Selaginella moellendorffii]
 gi|300171244|gb|EFJ37844.1| hypothetical protein SELMODRAFT_437414 [Selaginella moellendorffii]
          Length = 413

 Score =  156 bits (395), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 125/217 (57%), Gaps = 9/217 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER I+I NH+   DW+Y+W         G +K ++K+S++ LP+FGW +   +++ ++R 
Sbjct: 146 ERAIVICNHRTEVDWMYIWNLALRKGRIGHVKYVVKNSVRDLPVFGWALYVMEFLLIERK 205

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LS+   +++PLWL++FPEGT  ++  ++  ++ A+K GL    HVL+P+
Sbjct: 206 WEVDEPLMERYLSSFKDARDPLWLILFPEGTDYTEQKKLAGQELAEKKGLRKLNHVLMPK 265

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C  +L  S+D VYDLTIG +  R   F + ++        G  P  +H+HIR+ 
Sbjct: 266 TKGFQSCMKNLGSSLDAVYDLTIGYKN-RCPLFIDNLF--------GIDPSEVHIHIRRI 316

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFT 352
            + ++P D +  + WL + +  KD L+  F  KG F+
Sbjct: 317 PVEQIPSDGNGCSSWLYKAYERKDELLSSFIKKGYFS 353



>gi|297834800|ref|XP_002885282.1| hypothetical protein ARALYDRAFT_318646 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297331122|gb|EFH61541.1| hypothetical protein ARALYDRAFT_318646 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 375

 Score =  156 bits (395), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 125/230 (54%), Gaps = 11/230 (4%)

Query: 122 KQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFG 181
           K  ++G KV  +  +R++LIANH+   DW+Y W         G IK +LK SL  LP+FG
Sbjct: 80  KVIFSGDKVPCE--DRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYVLKSSLMKLPLFG 137

Query: 182 WGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYAD 241
           W    F++I ++R W  D+    + LS+    ++ LWL +FPEGT  ++     SKK+A 
Sbjct: 138 WAFHLFEFIPVERKWEVDEANLRQILSSFKDPRDALWLALFPEGTDYTEAKCERSKKFAA 197

Query: 242 KVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFE 301
           + GL    +VLLPR+ G   C   L  S+D VYD+TIG +  R   F + +Y        
Sbjct: 198 ENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYK-TRCPSFLDNVY-------- 248

Query: 302 GQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           G  P  +H+HIR+  ++++P  E     WL   +  KD L+ +FY+ G F
Sbjct: 249 GIEPSEVHIHIRRINVTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHF 298



>gi|508706661|gb|EOX98557.1| Lysophosphatidyl acyltransferase 5 [Theobroma cacao]
          Length = 372

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 126/231 (54%), Gaps = 16/231 (6%)

Query: 133 DMP--ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYI 190
           D+P  ER++LI NH+   DW+Y+W F       G IK ILK SL  LP+FGW     ++I
Sbjct: 90  DVPPRERVLLICNHRTEVDWMYLWDFALRKGCLGYIKYILKSSLMKLPVFGWAFHILEFI 149

Query: 191 FLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEH 250
            ++R W  D+      LST    ++PLWL++FPEGT  ++   + S+KYA + GL   ++
Sbjct: 150 PVERKWEVDESNMRNMLSTFKDPQDPLWLVLFPEGTDFTEQKCLRSQKYAAENGLPILKN 209

Query: 251 VLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHL 310
           +LLP+S G   C   L  S+D VYD+TIG +      F + ++        G  P  +H+
Sbjct: 210 LLLPKSKGFFACLEDLRSSLDAVYDVTIGYKHC-CPSFLDNVF--------GVDPSEVHI 260

Query: 311 HIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVP 361
           HIR+  + ++P  E + T WL   +  KD L+  F ++G F     PR  P
Sbjct: 261 HIRRITLDDIPISERELTAWLMDTFQHKDQLLSNFKSEGYF-----PRQGP 306



>gi|224063587|ref|XP_002301215.1| predicted protein [Populus trichocarpa]
 gi|222842941|gb|EEE80488.1| predicted protein [Populus trichocarpa]
          Length = 372

 Score =  156 bits (394), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 128/231 (55%), Gaps = 14/231 (6%)

Query: 126 NGAKV----ELDMP-ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIF 180
           NG KV    +L  P ER+++IANH+   DW+Y+W         G IK ILK SL  LP+F
Sbjct: 84  NGTKVVFSGDLVPPKERVLIIANHRTEVDWMYLWDLALRKGCLGYIKYILKSSLMKLPVF 143

Query: 181 GWGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYA 240
           GWG    ++I ++RNW  D+    + LST    ++PLWL +FPEGT  S+     S+K+A
Sbjct: 144 GWGFHILEFISVERNWEVDEPTMREMLSTFKDPQDPLWLALFPEGTDFSEQKCQRSQKFA 203

Query: 241 DKVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYF 300
           ++VGL   ++VLLP++ G   C   L  S+D VYD++I      + Q P     L  ++ 
Sbjct: 204 NEVGLPVLKNVLLPKTRGFCVCLEVLRGSLDAVYDVSIAY----KHQLPT---FLDNVF- 255

Query: 301 EGQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            G  P  +H+H+R+    E+P  + +   WL  R+  KD L+ +F   G F
Sbjct: 256 -GTDPSEVHIHVRRIPAKEIPASDSEAATWLMDRFQLKDRLLSDFKAHGHF 305



>gi|297839375|ref|XP_002887569.1| hypothetical protein ARALYDRAFT_476640 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333410|gb|EFH63828.1| hypothetical protein ARALYDRAFT_476640 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 379

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 14/255 (5%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++LIANH+   DW+Y+W         G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 97  KRVLLIANHRTEVDWMYLWNIALRKRCLGYIKYVLKSSLMKLPIFGWGFHVLEFIPVERK 156

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
              D+    + LS+    +EPLWL +FPEGT  ++     S+K+A +VGL    +VLLP+
Sbjct: 157 REVDEPVLLQMLSSFKDPQEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPK 216

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   LH S+D VYDLTI  +  R   F + ++        G  P  +H+H+R+ 
Sbjct: 217 TRGFGVCLEVLHNSLDAVYDLTIAYKP-RCPSFMDNVF--------GTDPSEVHIHVRRV 267

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRFTGYESPRTVPMKLNSVFELTQIWY 375
            + E+P +E + + WL   +  KD L+ +F  +G+F     P   P +  SV +    + 
Sbjct: 268 LLKEIPANEAESSAWLMDSFQLKDKLLSDFNAQGQF-----PSQRPEEELSVLKCIATFA 322

Query: 376 FIVPLVPIMWYFSNY 390
            ++ L  +  Y + Y
Sbjct: 323 GVISLTVLFIYLTLY 337



>gi|507958676|ref|XP_004686379.1| PREDICTED: lysocardiolipin acyltransferase 1 [Condylura cristata]
          Length = 376

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 137/267 (51%), Gaps = 24/267 (8%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++W      +     KI LK SLK +P FGW MQ   YIF+ R 
Sbjct: 77  ERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKSVPGFGWAMQAAAYIFIHRK 136

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK  F   +      +EPL LLIFPEGT +++ ++  S  +A+K GL  +E+VL PR
Sbjct: 137 WKDDKSHFEDMIDYFCDIREPLQLLIFPEGTDLTENSKARSNDFAEKNGLQKYEYVLHPR 196

Query: 256 STGLHFCAGSLH--KSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L   K++D ++D+T+         +P  I    K   +G +P+ IH H+ 
Sbjct: 197 TTGFTFVVDRLREGKNLDAIHDITVA--------YPHNIPQTEKHLLQGDFPKEIHFHVL 248

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGR---FTGYES-------PRTVPMK 363
           +Y I+ +P D +    W  +RW EK+  +  FY   +   F G+ +       PR + +K
Sbjct: 249 RYPIAALPTDREALQLWCHKRWEEKEQRLRAFYRGEKSFHFAGHSAVPPCKSEPRVLVVK 308

Query: 364 LNSVFELTQIWYFIVPLVPIMWYFSNY 390
           L S+      W    P + ++ YF  +
Sbjct: 309 LLSIL----YWTLFSPAMCLLVYFYTF 331



>gi|482566635|gb|EOA30824.1| hypothetical protein CARUB_v10013968mg [Capsella rubella]
          Length = 375

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 127/230 (55%), Gaps = 11/230 (4%)

Query: 122 KQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFG 181
           K  ++G KV  +  ER++LIANH+   DW+Y W         G +K +LK SL  LP+FG
Sbjct: 80  KVIFSGDKVPCE--ERVLLIANHRTEVDWMYFWDLALRKGQIGNMKYVLKSSLMRLPLFG 137

Query: 182 WGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYAD 241
           W    F++I ++R W  D+    + +S+    ++ LWL +FPEGT  ++     SKK+A 
Sbjct: 138 WAFHLFEFIPVERKWQVDEANLRQIVSSFKDPRDALWLALFPEGTDYTEAKCERSKKFAA 197

Query: 242 KVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFE 301
           + GL   ++VLLPR+ G   C   L  S+D VYD+TIG +  R   F + +Y        
Sbjct: 198 ENGLPVLKNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYK-TRCPSFLDNVY-------- 248

Query: 302 GQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           G  P  +H+HIR+  ++++P +E     WL   +  KD L+ +FY+ G F
Sbjct: 249 GIEPSEVHVHIRRINLNQIPNEEKDINAWLMNTFQLKDQLLNDFYSSGHF 298



>gi|462396456|gb|EMJ02255.1| hypothetical protein PRUPE_ppa007197mg [Prunus persica]
          Length = 378

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 119/216 (55%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LI+NH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I ++R 
Sbjct: 96  ERILLISNHRTEVDWMYLWDLALRKGRQGYIKYILKSSLMKLPLFGWSFHILEFISVERK 155

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LS+L   ++ LWL +FPEGT  ++   I S+KYA + GL   +HVLLP+
Sbjct: 156 WEVDELNMRRMLSSLKDPQDSLWLALFPEGTDFTEQKCIRSQKYAAENGLPVLKHVLLPK 215

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYD+TIG +      F             G  P  +H+H+++ 
Sbjct: 216 TKGFSACLEELRGSLDAVYDVTIGYKPSCPTFFDNA---------SGVNPSEVHMHVQRI 266

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +  +P  ED+ T WL  R+  KD L+ +F ++G F
Sbjct: 267 PLDNIPTSEDEVTTWLMNRFHLKDQLLSDFDSQGHF 302



>gi|15230215|ref|NP_188515.1| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|42572479|ref|NP_974335.1| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|145322898|ref|NP_001030724.2| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|145332635|ref|NP_001078183.1| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|83287833|sp|Q9LHN4.1|LPAT5_ARATH RecName: Full=Probable 1-acyl-sn-glycerol-3-phosphate
           acyltransferase 5; AltName: Full=Lysophosphatidyl
           acyltransferase 5
 gi|9294694|dbj|BAB03094.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Arabidopsis
           thaliana]
 gi|20466766|gb|AAM20700.1| unknown protein [Arabidopsis thaliana]
 gi|30725598|gb|AAP37821.1| At3g18850 [Arabidopsis thaliana]
 gi|332642634|gb|AEE76155.1| lysocardiolipin and lysophospholipid acyltransferase [Arabidopsis
           thaliana]
 gi|332642635|gb|AEE76156.1| lysocardiolipin and lysophospholipid acyltransferase [Arabidopsis
           thaliana]
 gi|332642636|gb|AEE76157.1| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|332642637|gb|AEE76158.1| lysocardiolipin and lysophospholipid acyltransferase [Arabidopsis
           thaliana]
          Length = 375

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 125/230 (54%), Gaps = 11/230 (4%)

Query: 122 KQSWNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFG 181
           K  ++G KV  +  +R++LIANH+   DW+Y W         G IK +LK SL  LP+FG
Sbjct: 80  KVIFSGDKVPCE--DRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYVLKSSLMKLPLFG 137

Query: 182 WGMQFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYAD 241
           W    F++I ++R W  D+    + +S+    ++ LWL +FPEGT  ++     SKK+A 
Sbjct: 138 WAFHLFEFIPVERRWEVDEANLRQIVSSFKDPRDALWLALFPEGTDYTEAKCQRSKKFAA 197

Query: 242 KVGLVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFE 301
           + GL    +VLLPR+ G   C   L  S+D VYD+TIG +  R   F + +Y        
Sbjct: 198 ENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYK-TRCPSFLDNVY-------- 248

Query: 302 GQYPRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           G  P  +H+HIR+  ++++P  E     WL   +  KD L+ +FY+ G F
Sbjct: 249 GIEPSEVHIHIRRINLTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHF 298



>gi|462396455|gb|EMJ02254.1| hypothetical protein PRUPE_ppa007197mg [Prunus persica]
          Length = 331

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 119/216 (55%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER++LI+NH+   DW+Y+W         G IK ILK SL  LP+FGW     ++I ++R 
Sbjct: 49  ERILLISNHRTEVDWMYLWDLALRKGRQGYIKYILKSSLMKLPLFGWSFHILEFISVERK 108

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  D+    + LS+L   ++ LWL +FPEGT  ++   I S+KYA + GL   +HVLLP+
Sbjct: 109 WEVDELNMRRMLSSLKDPQDSLWLALFPEGTDFTEQKCIRSQKYAAENGLPVLKHVLLPK 168

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   L  S+D VYD+TIG +      F             G  P  +H+H+++ 
Sbjct: 169 TKGFSACLEELRGSLDAVYDVTIGYKPSCPTFFDNA---------SGVNPSEVHMHVQRI 219

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            +  +P  ED+ T WL  R+  KD L+ +F ++G F
Sbjct: 220 PLDNIPTSEDEVTTWLMNRFHLKDQLLSDFDSQGHF 255



>gi|498933271|ref|XP_004540399.1| PREDICTED: lysocardiolipin acyltransferase 1-like [Maylandia zebra]
          Length = 385

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 116/214 (54%), Gaps = 10/214 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           ER ++I NH+   DW+++WC     +     KI LK +LK +P FGW MQ   ++F++R 
Sbjct: 78  ERSVIIMNHRTRLDWMFLWCCLLRYSYLRLEKICLKAALKAVPGFGWAMQVACFVFIQRR 137

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
           W  DK      L      +EPL LL+FPEGT +++ TR  S  +A +  L   E+VL PR
Sbjct: 138 WEEDKKHLENMLDYFCDIREPLQLLLFPEGTDLTENTRAKSDAFAAQNSLPKFEYVLHPR 197

Query: 256 STGLHFCAGSLHK--SVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIR 313
           +TG  F    L K  ++D V+D+T+         +P+ I    +    G +PR IH H+R
Sbjct: 198 TTGFTFIVDRLRKGDNLDAVHDITVA--------YPKNIPQTERHLISGHFPREIHFHVR 249

Query: 314 KYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYT 347
           +Y +S +P        W R+RW EK+  + +FY+
Sbjct: 250 RYPVSALPTSSSDLESWCRERWAEKEVRLRDFYS 283



>gi|145332637|ref|NP_001078184.1| lysophosphatidyl acyltransferase 5 [Arabidopsis thaliana]
 gi|332642638|gb|AEE76159.1| lysocardiolipin and lysophospholipid acyltransferase [Arabidopsis
           thaliana]
          Length = 352

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/227 (35%), Positives = 124/227 (54%), Gaps = 11/227 (4%)

Query: 125 WNGAKVELDMPERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGM 184
           ++G KV  +  +R++LIANH+   DW+Y W         G IK +LK SL  LP+FGW  
Sbjct: 60  FSGDKVPCE--DRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYVLKSSLMKLPLFGWAF 117

Query: 185 QFFQYIFLKRNWATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVG 244
             F++I ++R W  D+    + +S+    ++ LWL +FPEGT  ++     SKK+A + G
Sbjct: 118 HLFEFIPVERRWEVDEANLRQIVSSFKDPRDALWLALFPEGTDYTEAKCQRSKKFAAENG 177

Query: 245 LVDHEHVLLPRSTGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQY 304
           L    +VLLPR+ G   C   L  S+D VYD+TIG +  R   F + +Y        G  
Sbjct: 178 LPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYK-TRCPSFLDNVY--------GIE 228

Query: 305 PRNIHLHIRKYAISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
           P  +H+HIR+  ++++P  E     WL   +  KD L+ +FY+ G F
Sbjct: 229 PSEVHIHIRRINLTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHF 275



>gi|5882722|gb|AAD55275.1|AC008263_6 Contains similarity to gb|Z95637
           acyl-CoA:1-acylglycerol-3-phosphate acyltransferase from
           Brassica napus [Arabidopsis thaliana]
          Length = 373

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 122/216 (56%), Gaps = 9/216 (4%)

Query: 136 ERLILIANHQIYADWLYVWCFTYLANAHGAIKIILKDSLKWLPIFGWGMQFFQYIFLKRN 195
           +R++LIANH+   DW+Y+W         G IK +LK SL  LPIFGWG    ++I ++R 
Sbjct: 97  KRVLLIANHRTEVDWMYLWNIALRKGCLGYIKYVLKSSLMKLPIFGWGFHVLEFIPVERK 156

Query: 196 WATDKGPFSKTLSTLATSKEPLWLLIFPEGTVVSDVTRITSKKYADKVGLVDHEHVLLPR 255
              D+    + LS+    +EPLWL +FPEGT  ++     S+K+A +VGL    +VLLP+
Sbjct: 157 REVDEPVLLQMLSSFKDPQEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPK 216

Query: 256 STGLHFCAGSLHKSVDYVYDLTIGIEGVRRGQFPEEIYTLRKIYFEGQYPRNIHLHIRKY 315
           + G   C   LH S+D VYDLTI  +  R   F + ++        G  P  +H+H+R+ 
Sbjct: 217 TRGFGVCLEVLHNSLDAVYDLTIAYKP-RCPSFMDNVF--------GTDPSEVHIHVRRV 267

Query: 316 AISEMPEDEDKFTEWLRQRWIEKDALMEEFYTKGRF 351
            + E+P +E + + WL   +  KD L+ +F  +G+F
Sbjct: 268 LLKEIPANEAESSAWLMDSFKLKDKLLSDFNAQGKF 303