BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10041_c0_seq1-m.15 complete 81-470(-) 130 (-)
         (129 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|302771858|ref|XP_002969347.1| hypothetical protein SELMODRAFT...    90   2e-16   Selaginella moellendorffii
gi|302774527|ref|XP_002970680.1| hypothetical protein SELMODRAFT...    89   5e-16   Selaginella moellendorffii
gi|296088487|emb|CBI37478.3| unnamed protein product [Vitis vini...    86   3e-15   Vitis vinifera
gi|215697292|dbj|BAG91286.1| unnamed protein product [Oryza sati...    86   4e-15   Oryza sativa Japonica Group [Japonica rice]
gi|115449807|ref|NP_001048557.1| Os02g0822200 [Oryza sativa Japo...    85   6e-15   
gi|357137681|ref|XP_003570428.1| PREDICTED: ubiquitin carboxyl-t...    83   2e-14   Brachypodium distachyon [annual false brome]
gi|475605408|gb|EMT26052.1| Ubiquitin carboxyl-terminal hydrolas...    81   9e-14   Aegilops tauschii
gi|474246845|gb|EMS60015.1| Ubiquitin carboxyl-terminal hydrolas...    81   1e-13   Triticum urartu
gi|326497123|dbj|BAK02146.1| predicted protein [Hordeum vulgare ...    80   2e-13   Hordeum vulgare subsp. vulgare [barley]
gi|294846029|gb|ADF43187.1| UBCH1m [Chlamydomonas reinhardtii]         79   4e-13   Chlamydomonas reinhardtii
gi|225431633|ref|XP_002262954.1| PREDICTED: ubiquitin carboxyl-t...    78   8e-13   Vitis vinifera
gi|168004205|ref|XP_001754802.1| predicted protein [Physcomitrel...    77   1e-12   Physcomitrella patens
gi|356535244|ref|XP_003536158.1| PREDICTED: ubiquitin carboxyl-t...    77   1e-12   Glycine max [soybeans]
gi|502116664|ref|XP_004495540.1| PREDICTED: ubiquitin carboxyl-t...    77   2e-12   Cicer arietinum [garbanzo]
gi|508717188|gb|EOY09085.1| Ubiquitin carboxyl-terminal hydrolas...    77   2e-12   Theobroma cacao [chocolate]
gi|46850173|gb|AAT02518.1| ubitquitin C-terminal hydrolase [Chla...    77   2e-12   Chlamydomonas reinhardtii
gi|508717187|gb|EOY09084.1| Ubiquitin carboxyl-terminal hydrolas...    77   2e-12   Theobroma cacao [chocolate]
gi|508717184|gb|EOY09081.1| Ubiquitin carboxyl-terminal hydrolas...    77   2e-12   Theobroma cacao [chocolate]
gi|508717186|gb|EOY09083.1| Ubiquitin carboxyl-terminal hydrolas...    77   2e-12   Theobroma cacao [chocolate]
gi|356576644|ref|XP_003556440.1| PREDICTED: ubiquitin carboxyl-t...    76   3e-12   Glycine max [soybeans]
gi|116787498|gb|ABK24529.1| unknown [Picea sitchensis] >gi|11678...    75   4e-12   Picea sitchensis
gi|255556663|ref|XP_002519365.1| ubiquitin carboxyl-terminal hyd...    75   6e-12   Ricinus communis
gi|384483302|gb|EIE75482.1| hypothetical protein RO3G_00186 [Rhi...    75   6e-12   Rhizopus delemar RA 99-880
gi|224080017|ref|XP_002305992.1| predicted protein [Populus tric...    75   8e-12   Populus trichocarpa [western balsam poplar]
gi|470326143|ref|XP_004364624.1| UCH2 [Capsaspora owczarzaki ATC...    74   9e-12   
gi|449447631|ref|XP_004141571.1| PREDICTED: ubiquitin carboxyl-t...    74   1e-11   Cucumis sativus [cucumbers]
gi|449527357|ref|XP_004170678.1| PREDICTED: ubiquitin carboxyl-t...    74   1e-11   
gi|297841111|ref|XP_002888437.1| ubiquitin carboxyl-terminal hyd...    74   1e-11   Arabidopsis lyrata subsp. lyrata
gi|482571250|gb|EOA35438.1| hypothetical protein CARUB_v10020640...    74   2e-11   Capsella rubella
gi|18408331|ref|NP_564858.1| peptidase C12, ubiquitin carboxyl-t...    73   2e-11   Arabidopsis thaliana [mouse-ear cress]
gi|15724238|gb|AAL06512.1|AF412059_1 F5I14.29/F5I14.29 [Arabidop...    73   2e-11   Arabidopsis thaliana [mouse-ear cress]
gi|470122784|ref|XP_004297418.1| PREDICTED: ubiquitin carboxyl-t...    73   3e-11   Fragaria vesca subsp. vesca
gi|462419497|gb|EMJ23760.1| hypothetical protein PRUPE_ppa008376...    72   3e-11   Prunus persica
gi|6686411|gb|AAF23845.1|AC007234_17 F1E22.3 [Arabidopsis thaliana]    72   4e-11   Arabidopsis thaliana [mouse-ear cress]
gi|460401489|ref|XP_004246256.1| PREDICTED: ubiquitin carboxyl-t...    72   4e-11   
gi|460401487|ref|XP_004246255.1| PREDICTED: ubiquitin carboxyl-t...    72   4e-11   Solanum lycopersicum
gi|224140903|ref|XP_002323817.1| predicted protein [Populus tric...    72   4e-11   
gi|330792465|ref|XP_003284309.1| ubiquitin carboxyl-terminal hyd...    72   5e-11   Dictyostelium purpureum
gi|58177865|gb|AAH89167.1| LOC733154 protein [Xenopus laevis]          72   6e-11   Xenopus laevis [clawed frog]
gi|148237776|ref|NP_001089066.1| ubiquitin carboxyl-terminal hyd...    72   6e-11   Xenopus laevis [clawed frog]
gi|384249242|gb|EIE22724.1| ubiquitinyl hydrolase [Coccomyxa sub...    71   9e-11   Coccomyxa subellipsoidea C-169


>gi|302771858|ref|XP_002969347.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
 gi|300162823|gb|EFJ29435.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
          Length = 324

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 76/118 (64%), Gaps = 10/118 (8%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNN----------SSELMQL 50
           + +Y+ +EIRFNL+A+IKNR+D+Y  ++ E+D+R    S  +           + EL Q+
Sbjct: 205 IEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDKRKTEISGDDGMDVDSKSGSGNEELAQI 264

Query: 51  SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
             E  +L ++I  E  KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE AR+
Sbjct: 265 DAEIARLTEKITQEDEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKARQ 322



>gi|302774527|ref|XP_002970680.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
 gi|300161391|gb|EFJ28006.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
          Length = 324

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 75/118 (63%), Gaps = 10/118 (8%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNN----------SSELMQL 50
           + +Y+ +EIRFNL+A+IKNR+D+Y  ++ E+D R    S  +           + EL Q+
Sbjct: 205 IEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDRRKNEISGDDGMDVDSKSGSGNEELAQI 264

Query: 51  SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
             E  +L ++I  E  KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE AR+
Sbjct: 265 DAEIARLTEKITQEDEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKARQ 322



>gi|296088487|emb|CBI37478.3| unnamed protein product [Vitis vinifera]
          Length = 313

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 72/108 (66%), Gaps = 5/108 (4%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQR 60
           + RY+ +EIRFNL+A+IKNR+D+Y   + E+ +R  H  +     +L  L  ER    ++
Sbjct: 205 IERYSRSEIRFNLMAIIKNRKDIYTGELKELQKRREHILH-----QLAALQSERMGATEK 259

Query: 61  IEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
           I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE A++
Sbjct: 260 ILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQ 307



>gi|215697292|dbj|BAG91286.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215764981|dbj|BAG86678.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 278

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 79/115 (68%), Gaps = 8/115 (6%)

Query: 3   RYTSAEIRFNLLALIKNREDVYRTRIGEIDER-------MRHASNTNN-SSELMQLSEER 54
           RY+ +EIRFNL+A+IKNR+DVY   + E+++R       M  +S   + +SEL +++   
Sbjct: 154 RYSQSEIRFNLMAIIKNRKDVYTAELKELEKRRDQLLQEMNESSAAESLNSELAEVTSAI 213

Query: 55  DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
           + + ++I ME+ KFK++  EN  RKHN+I F++N +++LAE+ +L+  +E A+++
Sbjct: 214 ETVSEKIIMEEEKFKKWRTENIRRKHNYIPFLFNFLKMLAEKKQLKPLVEKAKQQ 268



>gi|115449807|ref|NP_001048557.1| Os02g0822200 [Oryza sativa Japonica Group]
 gi|48716277|dbj|BAD22892.1| putative ubitquitin C-terminal hydrolase [Oryza sativa Japonica
           Group]
 gi|48716519|dbj|BAD23124.1| putative ubiquitin C-terminal hydrolase [Oryza sativa Japonica
           Group]
 gi|113538088|dbj|BAF10471.1| Os02g0822200 [Oryza sativa Japonica Group]
 gi|125541669|gb|EAY88064.1| hypothetical protein OsI_09494 [Oryza sativa Indica Group]
 gi|125584190|gb|EAZ25121.1| hypothetical protein OsJ_08921 [Oryza sativa Japonica Group]
 gi|215764980|dbj|BAG86677.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 331

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 79/115 (68%), Gaps = 8/115 (6%)

Query: 3   RYTSAEIRFNLLALIKNREDVYRTRIGEIDER-------MRHASNTNN-SSELMQLSEER 54
           RY+ +EIRFNL+A+IKNR+DVY   + E+++R       M  +S   + +SEL +++   
Sbjct: 207 RYSQSEIRFNLMAIIKNRKDVYTAELKELEKRRDQLLQEMNESSAAESLNSELAEVTSAI 266

Query: 55  DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
           + + ++I ME+ KFK++  EN  RKHN+I F++N +++LAE+ +L+  +E A+++
Sbjct: 267 ETVSEKIIMEEEKFKKWRTENIRRKHNYIPFLFNFLKMLAEKKQLKPLVEKAKQQ 321



>gi|357137681|ref|XP_003570428.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Brachypodium distachyon]
          Length = 329

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 79/115 (68%), Gaps = 8/115 (6%)

Query: 3   RYTSAEIRFNLLALIKNREDVYRTRIGEIDER----MRHASNTNNS----SELMQLSEER 54
           RY+ +EIRFNL+A+IKNR+DVY   + E++++    ++  + T  +    SEL +++   
Sbjct: 207 RYSQSEIRFNLMAIIKNRKDVYTAELKELEKKREQILQEMNKTTAAESLNSELSEVASAI 266

Query: 55  DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
           + + ++I ME+ KF +++ EN  RKHN+I F++N+++ LAE+ +L+  +E AR++
Sbjct: 267 ETVGEKIMMEEEKFMKWKTENVRRKHNYIPFLFNLLKTLAEKKQLKPLVEKARQQ 321



>gi|475605408|gb|EMT26052.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aegilops
           tauschii]
          Length = 335

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%), Gaps = 12/121 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID------------ERMRHASNTNNSSELM 48
           + RY+ +EIRFNL+A+IKNR+DVY   + E++            E    A     +S L 
Sbjct: 205 IERYSQSEIRFNLMAIIKNRKDVYTAELKELEKKREQILQELSSEATAAAEKEPLNSALA 264

Query: 49  QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
           +++   + + ++I ME+ KF++++ EN  RKHN+I F++N+++ LAE+ +L   +E AR+
Sbjct: 265 EVAVAGEAVGEKIAMEEEKFRKWKTENVRRKHNYIPFLFNLLKALAEKKQLTPLVEKARQ 324

Query: 109 E 109
           +
Sbjct: 325 Q 325



>gi|474246845|gb|EMS60015.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Triticum urartu]
          Length = 288

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 79/121 (65%), Gaps = 12/121 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER----MRHASNTNNSSE--------LM 48
           + RY+ +EIRFNL+A+IKNR+DVY   + E++++    ++  SN   ++         L 
Sbjct: 155 IERYSQSEIRFNLMAIIKNRKDVYTAELKELEKKREQILQELSNEATAAAEKEPLNGVLA 214

Query: 49  QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
           +++   + + ++I ME+ KF++++ EN  RKHN+I F++N+++ LAE+ +L   +E AR+
Sbjct: 215 EVALAVEAVGEKIAMEEEKFRKWKTENVRRKHNYIPFLFNLLKALAEKKQLTPLVEKARQ 274

Query: 109 E 109
           +
Sbjct: 275 Q 275



>gi|326497123|dbj|BAK02146.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 339

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 77/119 (64%), Gaps = 12/119 (10%)

Query: 3   RYTSAEIRFNLLALIKNREDVYRTRIGEIDER----MRHASNTNNSSE--------LMQL 50
           RY+ +EIRFNL+A+IKNR+DVY   + E++++    ++  SN   ++         L ++
Sbjct: 207 RYSQSEIRFNLMAIIKNRKDVYTAELKELEKKREQILQELSNEATAAAEKESLNGALAEV 266

Query: 51  SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
           +     + ++I ME+ KF++++ EN  RKHN+I F++N+++ LAE+ +L   +E AR++
Sbjct: 267 ASAVASVGEKIVMEEEKFRKWKTENVRRKHNYIPFLFNLLKALAEKKQLTPLVEKARQQ 325



>gi|294846029|gb|ADF43187.1| UBCH1m [Chlamydomonas reinhardtii]
          Length = 331

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 23/129 (17%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRI------------------GEIDERMRHASNTN 42
           M RY ++EIRFNL+AL+ NR D+YR+R+                  G  DE + HA    
Sbjct: 199 MERYAASEIRFNLMALVGNRADIYRSRLAAATAQRDQLAAAAAAADGMSDEDLAHAQ--- 255

Query: 43  NSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQAR 102
             ++L++   E   L + +  E+ K + +  EN  RKHN++ F++ +++++A RG++   
Sbjct: 256 --AKLLEAETEVANLQEALAAEQAKHRTWHEENVRRKHNYVPFLFQLLKLMAARGQMGPL 313

Query: 103 IEYARKEMS 111
           +E AR+  +
Sbjct: 314 LERARRPAA 322



>gi|225431633|ref|XP_002262954.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Vitis
           vinifera]
 gi|147766506|emb|CAN60599.1| hypothetical protein VITISV_027729 [Vitis vinifera]
          Length = 334

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 74/124 (59%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH-------------ASNTNNSSEL 47
           + RY+ +EIRFNL+A+IKNR+D+Y   + E+ +R  H               N+N  +  
Sbjct: 205 IERYSRSEIRFNLMAIIKNRKDIYTGELKELQKRREHILHQLAALQSERMVDNSNIEALN 264

Query: 48  MQLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             LSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|168004205|ref|XP_001754802.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693906|gb|EDQ80256.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 323

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 74/118 (62%), Gaps = 12/118 (10%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHA----------SNTNNSSELMQL 50
           + +Y+ +EIRFNL+A+IKNR+D+Y   + +++  MR A             +++ +   +
Sbjct: 206 IEKYSKSEIRFNLMAVIKNRKDIYNEEMTQLE--MRRARLWDRIEKLEGKRDDTMDFADV 263

Query: 51  SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 108
             E  ++  +I ME  KF++++ EN  RKHN+I F++N ++ILAE+ +L+  IE AR+
Sbjct: 264 ESELAKVQDKIAMEDEKFRKWKTENIRRKHNYIPFLFNFLKILAEKKQLRPLIEKARQ 321



>gi|356535244|ref|XP_003536158.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Glycine max]
          Length = 334

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (62%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER------MRHASNTN----NSS----- 45
           + RY+ +EIRFNLLA+IKNR+++Y   + E+ +R         AS ++    NSS     
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKELYTAELKELQKRRERILQQLAASKSDRLVDNSSFEALN 264

Query: 46  -ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             L +++   +   ++I ME+ KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 NSLSEVNAGIEAATEKILMEEEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 325 KAKQKTS 331



>gi|502116664|ref|XP_004495540.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Cicer arietinum]
          Length = 334

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (62%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER-----MRHASN-----TNNSS----- 45
           + RY+  EIRFNLLA+IKNR++VY + + E+ +R      + A++      +NSS     
Sbjct: 205 IERYSQNEIRFNLLAIIKNRKEVYTSELKELQKRRERILQQLAASKAERLVDNSSFDVLN 264

Query: 46  -ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             L +++   +   ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 NSLSEVNAGIEAATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 325 KAKQKTS 331



>gi|508717188|gb|EOY09085.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 5
           [Theobroma cacao]
          Length = 243

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID---ERMRHASNTNNSSELM--------- 48
           + RY+ +EIRFNL+A+IKNR+++Y   + E+    ER+     T  S  L          
Sbjct: 114 IERYSKSEIRFNLMAVIKNRKEMYTAELKELQKKRERILQQLATIQSDRLADRSSFEALN 173

Query: 49  -QLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
            QLSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 174 KQLSEVNSGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 233

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 234 KAKQKTS 240



>gi|46850173|gb|AAT02518.1| ubitquitin C-terminal hydrolase [Chlamydomonas reinhardtii]
          Length = 331

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 23/129 (17%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRI------------------GEIDERMRHASNTN 42
           M RY ++EIRFNL+AL+ NR D+Y +R+                  G  DE + HA    
Sbjct: 199 MERYAASEIRFNLMALVGNRADIYSSRLAAATAQRDQLAAAAAAADGMSDEDLAHAQ--- 255

Query: 43  NSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQAR 102
             ++L++   E   L + +  E+ K + +  EN  RKHN++ F++ +++++A RG++   
Sbjct: 256 --AKLLEAETEVANLQEALAAEQAKHRTWHEENVRRKHNYVPFLFQLLKLMAARGQMGPL 313

Query: 103 IEYARKEMS 111
           +E AR+  +
Sbjct: 314 LERARRPAA 322



>gi|508717187|gb|EOY09084.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 4
           [Theobroma cacao]
          Length = 335

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID---ERMRHASNTNNSSELM--------- 48
           + RY+ +EIRFNL+A+IKNR+++Y   + E+    ER+     T  S  L          
Sbjct: 206 IERYSKSEIRFNLMAVIKNRKEMYTAELKELQKKRERILQQLATIQSDRLADRSSFEALN 265

Query: 49  -QLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
            QLSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 266 KQLSEVNSGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 325

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 326 KAKQKTS 332



>gi|508717184|gb|EOY09081.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1
           [Theobroma cacao]
 gi|508717185|gb|EOY09082.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1
           [Theobroma cacao]
          Length = 334

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID---ERMRHASNTNNSSELM--------- 48
           + RY+ +EIRFNL+A+IKNR+++Y   + E+    ER+     T  S  L          
Sbjct: 205 IERYSKSEIRFNLMAVIKNRKEMYTAELKELQKKRERILQQLATIQSDRLADRSSFEALN 264

Query: 49  -QLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
            QLSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KQLSEVNSGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 325 KAKQKTS 331



>gi|508717186|gb|EOY09083.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 3
           [Theobroma cacao]
          Length = 335

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID---ERMRHASNTNNSSELM--------- 48
           + RY+ +EIRFNL+A+IKNR+++Y   + E+    ER+     T  S  L          
Sbjct: 206 IERYSKSEIRFNLMAVIKNRKEMYTAELKELQKKRERILQQLATIQSDRLADRSSFEALN 265

Query: 49  -QLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
            QLSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 266 KQLSEVNSGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 325

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 326 KAKQKTS 332



>gi|356576644|ref|XP_003556440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Glycine max]
          Length = 334

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 79/127 (62%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER------MRHASNTN----NSS----- 45
           + RY+ +EIRFNLLA+IKNR+++Y   + E+ +R         AS ++    NSS     
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKEMYTAELKELQKRRERILQQLAASKSDRLVDNSSFEALN 264

Query: 46  -ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             L +++   +   ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 NSLSEVNAGIEAATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 325 KAKQKTS 331



>gi|116787498|gb|ABK24529.1| unknown [Picea sitchensis]
 gi|116787872|gb|ABK24676.1| unknown [Picea sitchensis]
 gi|224284295|gb|ACN39883.1| unknown [Picea sitchensis]
          Length = 340

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 74/133 (55%), Gaps = 26/133 (19%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH------ASNTNNSS--------- 45
           + +Y+ +EIRFNL+A+IKNR D+Y+    +++ R +       AS  N            
Sbjct: 205 IEKYSKSEIRFNLMAIIKNRLDIYKAEQRDLENRKKQIQQQLDASKCNGDDRMDVDNGSG 264

Query: 46  -----------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILA 94
                       L+++  E   + Q++ +EK KFK+++ EN  RKHN+I F++N ++ILA
Sbjct: 265 RQSASVEGLNRSLVEIDFELANVEQKLSIEKDKFKKWKTENIRRKHNYIPFLFNFLKILA 324

Query: 95  ERGELQARIEYAR 107
           E+ +L+  IE AR
Sbjct: 325 EKDQLKPLIEKAR 337



>gi|255556663|ref|XP_002519365.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus
           communis]
 gi|223541432|gb|EEF42982.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus
           communis]
          Length = 335

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 76/124 (61%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER------MRHASNTN---NSSELMQLS 51
           + RY++ EIRFNL+A+IKNR +VY   + E+  R         AS ++   +SS   QLS
Sbjct: 205 IERYSNNEIRFNLMAVIKNRREVYTAELKELQRRRERILQQLAASQSDRLVDSSTSEQLS 264

Query: 52  EERDQL-------LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           +   ++        ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLSEVNSGIEAATEKILMEEEKFKKWRTENVRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|384483302|gb|EIE75482.1| hypothetical protein RO3G_00186 [Rhizopus delemar RA 99-880]
          Length = 325

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQR 60
           M +Y ++E+ F+L+AL K++ ++Y  +I E+D  +   S  +   E  +L+ ER  L  +
Sbjct: 208 MKQYGASELHFSLMALTKDQIELYEEQIEELDGLILSLSE-DLVEERNRLNHERSMLTHK 266

Query: 61  IEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 107
           + +EK K +R+ REN+LRKHNFI  IYN+++ LAE+ +LQ  +  A+
Sbjct: 267 LHLEKEKRQRWHRENTLRKHNFIPLIYNLLKHLAEKDQLQPLMAKAK 313



>gi|224080017|ref|XP_002305992.1| predicted protein [Populus trichocarpa]
 gi|222848956|gb|EEE86503.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (59%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM-------------RHASNTNNSSEL 47
           + R++++EIRFNLLA++KNR+++Y   + E+ +R              R   N N  S  
Sbjct: 205 IERHSNSEIRFNLLAIVKNRKEMYTAELKELQKRRERIVQQLAAFQAERLVDNGNYESLN 264

Query: 48  MQLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             LSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLSEVNAAIESATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARKEMS 111
            A+++ S
Sbjct: 325 KAKQKTS 331



>gi|470326143|ref|XP_004364624.1| UCH2 [Capsaspora owczarzaki ATCC 30864]
 gi|320166813|gb|EFW43712.1| UCH2 [Capsaspora owczarzaki ATCC 30864]
          Length = 324

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 72/124 (58%), Gaps = 2/124 (1%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER--MRHASNTNNSSELMQLSEERDQLL 58
           + RY+S EIRFNL+A++ ++   Y   +  +DE+  M  + +   S +L  L     +L 
Sbjct: 201 IERYSSTEIRFNLMAVVADKTVQYTQELAAVDEQRAMLMSQSDQVSGDLAALDARSSELQ 260

Query: 59  QRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKRIKDRA 118
             +  E+ K +RY  EN  R+HNF+ FI  ++R+LAE+ +LQ  I  A++ ++ + K  A
Sbjct: 261 MLLATEQEKNERYRTENIRRRHNFVPFIVKLLRLLAEKHQLQPLIAKAKETVAAKNKANA 320

Query: 119 EKKK 122
           E +K
Sbjct: 321 ESRK 324



>gi|449447631|ref|XP_004141571.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Cucumis sativus]
          Length = 334

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 75/124 (60%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER----------------MRHASNTNNS 44
           + RY+ +EIRFNL+A+IKNR+++Y   + E+ ++                + H++N   +
Sbjct: 205 IERYSKSEIRFNLMAIIKNRKEMYTVELKELQKKRERILQQLAALQSETLLEHSNNEFLN 264

Query: 45  SELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             L +++   +   ++I ME+ K K++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLSEVNAGIESATEKILMEEEKLKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|449527357|ref|XP_004170678.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like,
           partial [Cucumis sativus]
          Length = 308

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 75/124 (60%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER----------------MRHASNTNNS 44
           + RY+ +EIRFNL+A+IKNR+++Y   + E+ ++                + H++N   +
Sbjct: 179 IERYSKSEIRFNLMAIIKNRKEMYTVELKELQKKRERILQQLAALQSETLLEHSNNEFLN 238

Query: 45  SELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             L +++   +   ++I ME+ K K++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 239 KSLSEVNAGIESATEKILMEEEKLKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 298

Query: 105 YARK 108
            A++
Sbjct: 299 KAKQ 302



>gi|297841111|ref|XP_002888437.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297334278|gb|EFH64696.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 330

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 71/120 (59%), Gaps = 11/120 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQ- 59
           + RY+ +EIRFNLLA+IKNR+D+Y   + E+  +        N+      +E  + L++ 
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQREQLLQQANTCVDKSEAEAVNALIEE 264

Query: 60  ----------RIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
                     +I ME+ KF ++  EN  RKHN+I F++N +++LAE+ +L+  IE A+K+
Sbjct: 265 VGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQ 324



>gi|482571250|gb|EOA35438.1| hypothetical protein CARUB_v10020640mg [Capsella rubella]
          Length = 329

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 10/119 (8%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSE------LMQLSEER 54
           + RY+ +EIRFNLLA+IKNR+D+Y   + ++  +        N  +      L  L EE 
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKDIYTAELKDLQRQREQLLQQANGMDKTEAETLNPLIEEV 264

Query: 55  ----DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
               + +  +I ME+ KF +++ EN  RKHN+I F++N +++LAE+ +L+  IE A K+
Sbjct: 265 SIGIEAVSDKIIMEEEKFMKWKTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAMKQ 323



>gi|18408331|ref|NP_564858.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis
           thaliana]
 gi|2190550|gb|AAB60914.1| ESTs gb|T45673,gb|N37512 come from this gene [Arabidopsis thaliana]
 gi|17473568|gb|AAL38259.1| unknown protein [Arabidopsis thaliana]
 gi|21386929|gb|AAM47868.1| unknown protein [Arabidopsis thaliana]
 gi|332196286|gb|AEE34407.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis
           thaliana]
          Length = 330

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 11/120 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLL-- 58
           + RY+ +EIRFNLLA+IKNR+D+Y   + E+  +        N+      +E  + L+  
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQREQLLQQANTCVDKSEAEAVNALIAE 264

Query: 59  ---------QRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
                     +I ME+ KF ++  EN  RKHN+I F++N +++LAE+ +L+  IE A+K+
Sbjct: 265 VGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQ 324



>gi|15724238|gb|AAL06512.1|AF412059_1 F5I14.29/F5I14.29 [Arabidopsis thaliana]
          Length = 330

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 11/120 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLL-- 58
           + RY+ +EIRFNLLA+IKNR+D+Y   + E+  +        N+      +E  + L+  
Sbjct: 205 IERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQREQLLQQANTCVDKSEAEAVNALIAE 264

Query: 59  ---------QRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
                     +I ME+ KF ++  EN  RKHN+I F++N +++LAE+ +L+  IE A+K+
Sbjct: 265 VGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQ 324



>gi|470122784|ref|XP_004297418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Fragaria vesca subsp. vesca]
          Length = 334

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 76/124 (61%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER---------MRHASNTNNSSELMQLS 51
           + RY+ +EIRFNLLA+IKNR+++Y   + E+ ++         +  +   ++ S+   L+
Sbjct: 205 IERYSKSEIRFNLLAIIKNRKEMYTVELKELQKKRERILQQLSILQSERPDDGSKFQALN 264

Query: 52  EERDQL-------LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           +   ++        ++I +E+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KALSEVNAGIEGATEKILIEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|462419497|gb|EMJ23760.1| hypothetical protein PRUPE_ppa008376mg [Prunus persica]
          Length = 334

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 75/124 (60%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER---------MRHASNTNNSSELMQLS 51
           + RY+ +EIRFNLLA+IKNR+++Y   + E+ ++            +    +SS+   L+
Sbjct: 205 IERYSKSEIRFNLLAIIKNRKEMYTAELKELQKKRERILQQLSALQSERPADSSKFEALN 264

Query: 52  EERDQL-------LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           +   ++        ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KGLSEINAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|6686411|gb|AAF23845.1|AC007234_17 F1E22.3 [Arabidopsis thaliana]
          Length = 361

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 11/120 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLL-- 58
           + RY+ +EIRFNLLA+IKNR+D+Y   + E+  +        N+      +E  + L+  
Sbjct: 236 IERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQREQLLQQANTCVDKSEAEAVNALIAE 295

Query: 59  ---------QRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKE 109
                     +I ME+ KF ++  EN  RKHN+I F++N +++LAE+ +L+  IE A+K+
Sbjct: 296 VGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQ 355



>gi|460401489|ref|XP_004246256.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Solanum lycopersicum]
          Length = 318

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 77/127 (60%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER---------MRHASNTNNSSELMQLS 51
           + RY+ +EIRFNL+A++KNR++VY   + E+ +R            +    +SS++  L+
Sbjct: 189 IERYSQSEIRFNLMAVVKNRKEVYTAELKELQKRRERILQQLAASQSERVVDSSQVESLN 248

Query: 52  EERDQLLQRIEM-------EKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           +   ++   IE        E+ KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 249 KSLAEVNSGIEAVSDKILREEEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLRPLIE 308

Query: 105 YARKEMS 111
            A+++ +
Sbjct: 309 KAKQKTT 315



>gi|460401487|ref|XP_004246255.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Solanum lycopersicum]
          Length = 334

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 77/127 (60%), Gaps = 16/127 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER---------MRHASNTNNSSELMQLS 51
           + RY+ +EIRFNL+A++KNR++VY   + E+ +R            +    +SS++  L+
Sbjct: 205 IERYSQSEIRFNLMAVVKNRKEVYTAELKELQKRRERILQQLAASQSERVVDSSQVESLN 264

Query: 52  EERDQLLQRIEM-------EKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           +   ++   IE        E+ KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLAEVNSGIEAVSDKILREEEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLRPLIE 324

Query: 105 YARKEMS 111
            A+++ +
Sbjct: 325 KAKQKTT 331



>gi|224140903|ref|XP_002323817.1| predicted protein [Populus trichocarpa]
 gi|222866819|gb|EEF03950.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 76/124 (61%), Gaps = 16/124 (12%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEID---ERM----------RHASNTNNSSEL 47
           + R++++EIRFNLLA+IKNR+++Y   + ++    ER+          R   N+N  +  
Sbjct: 205 IERHSNSEIRFNLLAIIKNRKEMYTAELKDLQKKRERILQQLAAFQAERLVDNSNFEALN 264

Query: 48  MQLSEERDQL---LQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
             LSE    +    ++I ME+ KFK++  EN  RKHN+I F++N ++ILAE+ +L+  IE
Sbjct: 265 KSLSEVNGGIESATEKILMEEDKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIE 324

Query: 105 YARK 108
            A++
Sbjct: 325 KAKQ 328



>gi|330792465|ref|XP_003284309.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium
           purpureum]
 gi|325085762|gb|EGC39163.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium
           purpureum]
          Length = 333

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 67/115 (58%), Gaps = 11/115 (9%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQR 60
           + +Y+  EIRFNL+A+IKNR+   + +I E++++        ++ EL    +E DQLL  
Sbjct: 201 IEKYSQGEIRFNLMAVIKNRQTTLKEKISELEKKKEIIEKKLSTIELPNSKDELDQLLMD 260

Query: 61  IE-----------MEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 104
           I            ME+ KF+ ++ EN  RKHNF  FI N+++ LAE+ +LQ  I+
Sbjct: 261 INENIQDYNNDILMEQEKFRNWKDENIRRKHNFTPFILNLVKALAEKEQLQPLIQ 315



>gi|58177865|gb|AAH89167.1| LOC733154 protein [Xenopus laevis]
          Length = 325

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 10/127 (7%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSEL---MQLSEERD 55
           M +Y   EIRFNL+A++ +R+ +Y  +I ++  R+      +T+  S L   MQ    + 
Sbjct: 204 MQKYCEGEIRFNLMAIVSDRKKIYEQKIADLQRRIAEEEPMDTDQGSTLLSSMQSEIAKY 263

Query: 56  QLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKRIK 115
           QLL  IE EK K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+++ + R  
Sbjct: 264 QLL--IEEEKQKMKRYKVENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKHNTR-- 319

Query: 116 DRAEKKK 122
            RA++ K
Sbjct: 320 -RAQEAK 325



>gi|148237776|ref|NP_001089066.1| ubiquitin carboxyl-terminal hydrolase L5 [Xenopus laevis]
 gi|115292033|gb|AAI22496.1| LOC733154 protein [Xenopus laevis]
          Length = 329

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 10/127 (7%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSEL---MQLSEERD 55
           M +Y   EIRFNL+A++ +R+ +Y  +I ++  R+      +T+  S L   MQ    + 
Sbjct: 208 MQKYCEGEIRFNLMAIVSDRKKIYEQKIADLQRRIAEEEPMDTDQGSTLLSSMQSEIAKY 267

Query: 56  QLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKRIK 115
           QLL  IE EK K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+++ + R  
Sbjct: 268 QLL--IEEEKQKMKRYKVENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKHNTR-- 323

Query: 116 DRAEKKK 122
            RA++ K
Sbjct: 324 -RAQEAK 329



>gi|384249242|gb|EIE22724.1| ubiquitinyl hydrolase [Coccomyxa subellipsoidea C-169]
          Length = 332

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (55%), Gaps = 14/126 (11%)

Query: 1   MSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQL---SEERDQL 57
           + RY  +EIRFNL+A+I+NR DV    +  +++R     +T+   + MQ+     E  Q 
Sbjct: 204 IERYAQSEIRFNLMAVIRNRSDVIAEELASLEDRRAALLSTSEEGDQMQVDGKGSETPQD 263

Query: 58  LQRIEMEKVKF-----------KRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYA 106
           L  IE E V+            KR+  EN  RK N++ FI++ +++LAE+G+L+  IE A
Sbjct: 264 LASIENEIVRVQEGLHQEAAKKKRWHDENVRRKTNYVPFIFHFLKLLAEKGQLKPIIERA 323

Query: 107 RKEMSK 112
           +   +K
Sbjct: 324 KTMPAK 329