BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10041_c0_seq2-m.16 5prime_partial 81-1112(-) 344 (-)
         (343 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384483302|gb|EIE75482.1| hypothetical protein RO3G_00186 [Rhi...   345   8e-93   Rhizopus delemar RA 99-880
gi|449447631|ref|XP_004141571.1| PREDICTED: ubiquitin carboxyl-t...   334   2e-89   Cucumis sativus [cucumbers]
gi|296088487|emb|CBI37478.3| unnamed protein product [Vitis vini...   332   7e-89   Vitis vinifera
gi|511007514|gb|EPB88801.1| hypothetical protein HMPREF1544_0444...   328   2e-87   Mucor circinelloides f. circinelloides 1006PhL
gi|225431633|ref|XP_002262954.1| PREDICTED: ubiquitin carboxyl-t...   324   2e-86   Vitis vinifera
gi|115449807|ref|NP_001048557.1| Os02g0822200 [Oryza sativa Japo...   324   3e-86   
gi|15724238|gb|AAL06512.1|AF412059_1 F5I14.29/F5I14.29 [Arabidop...   323   3e-86   Arabidopsis thaliana [mouse-ear cress]
gi|18408331|ref|NP_564858.1| peptidase C12, ubiquitin carboxyl-t...   323   5e-86   Arabidopsis thaliana [mouse-ear cress]
gi|508717184|gb|EOY09081.1| Ubiquitin carboxyl-terminal hydrolas...   323   5e-86   Theobroma cacao [chocolate]
gi|357137681|ref|XP_003570428.1| PREDICTED: ubiquitin carboxyl-t...   323   5e-86   Brachypodium distachyon [annual false brome]
gi|297841111|ref|XP_002888437.1| ubiquitin carboxyl-terminal hyd...   323   6e-86   Arabidopsis lyrata subsp. lyrata
gi|356576644|ref|XP_003556440.1| PREDICTED: ubiquitin carboxyl-t...   322   1e-85   Glycine max [soybeans]
gi|482571250|gb|EOA35438.1| hypothetical protein CARUB_v10020640...   322   1e-85   Capsella rubella
gi|149058446|gb|EDM09603.1| rCG45997 [Rattus norvegicus]              322   1e-85   Rattus norvegicus [brown rat]
gi|354489912|ref|XP_003507104.1| PREDICTED: ubiquitin carboxyl-t...   322   1e-85   Cricetulus griseus [Chinese hamsters]
gi|148707562|gb|EDL39509.1| ubiquitin carboxyl-terminal esterase...   322   1e-85   Mus musculus [mouse]
gi|470122784|ref|XP_004297418.1| PREDICTED: ubiquitin carboxyl-t...   321   1e-85   Fragaria vesca subsp. vesca
gi|229577283|ref|NP_001153338.1| ubiquitin carboxyl-terminal hyd...   321   2e-85   Mus musculus [mouse]
gi|475605408|gb|EMT26052.1| Ubiquitin carboxyl-terminal hydrolas...   320   3e-85   Aegilops tauschii
gi|229577281|ref|NP_062508.2| ubiquitin carboxyl-terminal hydrol...   320   3e-85   Mus musculus [mouse]
gi|326497123|dbj|BAK02146.1| predicted protein [Hordeum vulgare ...   320   3e-85   Hordeum vulgare subsp. vulgare [barley]
gi|356535244|ref|XP_003536158.1| PREDICTED: ubiquitin carboxyl-t...   320   3e-85   Glycine max [soybeans]
gi|462419497|gb|EMJ23760.1| hypothetical protein PRUPE_ppa008376...   320   3e-85   Prunus persica
gi|502116664|ref|XP_004495540.1| PREDICTED: ubiquitin carboxyl-t...   320   4e-85   Cicer arietinum [garbanzo]
gi|504132496|ref|XP_004578864.1| PREDICTED: ubiquitin carboxyl-t...   319   7e-85   Ochotona princeps [southern American pika]
gi|512822432|ref|XP_004879875.1| PREDICTED: ubiquitin carboxyl-t...   319   7e-85   
gi|302774527|ref|XP_002970680.1| hypothetical protein SELMODRAFT...   319   7e-85   Selaginella moellendorffii
gi|507551546|ref|XP_004659572.1| PREDICTED: ubiquitin carboxyl-t...   319   8e-85   Jaculus jaculus
gi|74006052|ref|XP_536116.2| PREDICTED: ubiquitin carboxyl-termi...   319   8e-85   Canis lupus familiaris [dogs]
gi|504132494|ref|XP_004578863.1| PREDICTED: ubiquitin carboxyl-t...   319   9e-85   Ochotona princeps [southern American pika]
gi|507551544|ref|XP_004659571.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Jaculus jaculus
gi|507621225|ref|XP_004625354.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Octodon degus
gi|508717186|gb|EOY09083.1| Ubiquitin carboxyl-terminal hydrolas...   318   1e-84   Theobroma cacao [chocolate]
gi|189069388|dbj|BAG37054.1| unnamed protein product [Homo sapiens]   318   1e-84   Homo sapiens [man]
gi|460401487|ref|XP_004246255.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Solanum lycopersicum
gi|511855687|ref|XP_004751554.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Mustela putorius furo [black ferret]
gi|348532149|ref|XP_003453569.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Oreochromis niloticus
gi|466038827|ref|XP_004275889.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Orcinus orca [Orca]
gi|4878011|gb|AAD31534.1|AF148447_1 ubiquitin C-terminal hydrola...   318   1e-84   Mus musculus [mouse]
gi|168004205|ref|XP_001754802.1| predicted protein [Physcomitrel...   318   1e-84   Physcomitrella patens
gi|508717187|gb|EOY09084.1| Ubiquitin carboxyl-terminal hydrolas...   318   1e-84   Theobroma cacao [chocolate]
gi|301619448|ref|XP_002939132.1| PREDICTED: ubiquitin carboxyl-t...   318   1e-84   Xenopus tropicalis [western clawed frog]
gi|148237776|ref|NP_001089066.1| ubiquitin carboxyl-terminal hyd...   318   1e-84   Xenopus laevis [clawed frog]
gi|178056486|ref|NP_001116682.1| ubiquitin carboxyl-terminal hyd...   318   2e-84   Sus scrofa [pigs]
gi|488598800|ref|XP_004484543.1| PREDICTED: ubiquitin carboxyl-t...   318   2e-84   Dasypus novemcinctus
gi|488598798|ref|XP_004484542.1| PREDICTED: ubiquitin carboxyl-t...   318   2e-84   Dasypus novemcinctus
gi|58865870|ref|NP_001012149.1| ubiquitin carboxyl-terminal hydr...   318   2e-84   Rattus norvegicus [brown rat]
gi|472384047|ref|XP_004411397.1| PREDICTED: ubiquitin carboxyl-t...   318   2e-84   Odobenus rosmarus divergens
gi|126306373|ref|XP_001367376.1| PREDICTED: ubiquitin carboxyl-t...   318   2e-84   Monodelphis domestica
gi|312922359|ref|NP_001186190.1| ubiquitin carboxyl-terminal hyd...   317   2e-84   Homo sapiens [man]
gi|507956157|ref|XP_004685519.1| PREDICTED: ubiquitin carboxyl-t...   317   2e-84   Condylura cristata
gi|30584639|gb|AAP36572.1| Homo sapiens ubiquitin carboxyl-termi...   317   2e-84   synthetic construct
gi|76253713|ref|NP_776906.2| ubiquitin carboxyl-terminal hydrola...   317   2e-84   Bos taurus [bovine]
gi|395824824|ref|XP_003785652.1| PREDICTED: ubiquitin carboxyl-t...   317   2e-84   
gi|507662954|ref|XP_004706712.1| PREDICTED: ubiquitin carboxyl-t...   317   2e-84   Echinops telfairi [lesser hedgehog tenrec]
gi|505853079|ref|XP_004619973.1| PREDICTED: ubiquitin carboxyl-t...   317   2e-84   Sorex araneus [Eurasian shrew]
gi|507956154|ref|XP_004685518.1| PREDICTED: ubiquitin carboxyl-t...   317   3e-84   Condylura cristata
gi|505853077|ref|XP_004619972.1| PREDICTED: ubiquitin carboxyl-t...   317   3e-84   Sorex araneus [Eurasian shrew]
gi|7706753|ref|NP_057068.1| ubiquitin carboxyl-terminal hydrolas...   317   3e-84   Homo sapiens [man]
gi|507662950|ref|XP_004706711.1| PREDICTED: ubiquitin carboxyl-t...   317   3e-84   Echinops telfairi [lesser hedgehog tenrec]
gi|470326143|ref|XP_004364624.1| UCH2 [Capsaspora owczarzaki ATC...   317   3e-84   
gi|225706202|gb|ACO08947.1| Ubiquitin carboxyl-terminal hydrolas...   317   4e-84   Osmerus mordax
gi|397499842|ref|XP_003820644.1| PREDICTED: ubiquitin carboxyl-t...   317   4e-84   
gi|507551550|ref|XP_004659574.1| PREDICTED: ubiquitin carboxyl-t...   317   4e-84   Jaculus jaculus
gi|327280238|ref|XP_003224859.1| PREDICTED: ubiquitin carboxyl-t...   316   5e-84   Anolis carolinensis [Carolina anole]
gi|58177865|gb|AAH89167.1| LOC733154 protein [Xenopus laevis]         316   6e-84   Xenopus laevis [clawed frog]
gi|297281204|ref|XP_001112706.2| PREDICTED: ubiquitin carboxyl-t...   316   6e-84   Macaca mulatta [rhesus macaque]
gi|402857781|ref|XP_003893420.1| PREDICTED: ubiquitin carboxyl-t...   316   6e-84   Papio anubis [Doguera baboon]
gi|47085817|ref|NP_998249.1| ubiquitin carboxyl-terminal hydrola...   316   7e-84   Danio rerio [leopard danio]
gi|312922361|ref|NP_001186191.1| ubiquitin carboxyl-terminal hyd...   315   9e-84   Homo sapiens [man]
gi|471398997|ref|XP_004382615.1| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   
gi|209730448|gb|ACI66093.1| Ubiquitin carboxyl-terminal hydrolas...   315   1e-83   Salmo salar
gi|390477217|ref|XP_002760499.2| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   
gi|255918047|pdb|3IHR|A Chain A, Crystal Structure Of Uch37           315   1e-83   Homo sapiens [man]
gi|397499846|ref|XP_003820646.1| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   
gi|504132492|ref|XP_004578862.1| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   Ochotona princeps [southern American pika]
gi|410921990|ref|XP_003974466.1| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   Takifugu rubripes [tiger puffer]
gi|116787498|gb|ABK24529.1| unknown [Picea sitchensis] >gi|11678...   315   1e-83   Picea sitchensis
gi|222093470|gb|ACM43511.1| ubiquitin carboxyl-terminal hydrolas...   315   1e-83   Scylla paramamosain
gi|507551548|ref|XP_004659573.1| PREDICTED: ubiquitin carboxyl-t...   315   1e-83   Jaculus jaculus
gi|119611640|gb|EAW91234.1| ubiquitin carboxyl-terminal hydrolas...   315   2e-83   Homo sapiens [man]
gi|47217741|emb|CAG03693.1| unnamed protein product [Tetraodon n...   314   2e-83   Tetraodon nigroviridis
gi|312922364|ref|NP_001186192.1| ubiquitin carboxyl-terminal hyd...   314   3e-83   Homo sapiens [man]
gi|397499844|ref|XP_003820645.1| PREDICTED: ubiquitin carboxyl-t...   314   3e-83   
gi|7688691|gb|AAF67486.1|AF157320_1 AD-019 protein [Homo sapiens]     313   3e-83   Homo sapiens [man]
gi|297281206|ref|XP_001112676.2| PREDICTED: ubiquitin carboxyl-t...   313   3e-83   Macaca mulatta [rhesus macaque]
gi|426239451|ref|XP_004013634.1| PREDICTED: ubiquitin carboxyl-t...   313   4e-83   Ovis aries [domestic sheep]
gi|405957412|gb|EKC23624.1| Ubiquitin carboxyl-terminal hydrolas...   313   4e-83   Crassostrea gigas
gi|387915894|gb|AFK11556.1| ubiquitin carboxyl-terminal hydrolas...   313   4e-83   Callorhinchus milii [Australian ghost shark]
gi|499033482|ref|XP_004567431.1| PREDICTED: ubiquitin carboxyl-t...   313   5e-83   
gi|318054568|ref|NP_001187184.1| ubiquitin carboxy-terminal hydr...   313   5e-83   Ictalurus punctatus
gi|410034215|ref|XP_514069.4| PREDICTED: ubiquitin carboxyl-term...   312   7e-83   
gi|432855293|ref|XP_004068149.1| PREDICTED: ubiquitin carboxyl-t...   312   7e-83   Oryzias latipes [Japanese rice fish]
gi|255556663|ref|XP_002519365.1| ubiquitin carboxyl-terminal hyd...   312   1e-82   Ricinus communis
gi|441624414|ref|XP_003264537.2| PREDICTED: ubiquitin carboxyl-t...   311   1e-82   
gi|4929609|gb|AAD34065.1|AF151828_1 CGI-70 protein [Homo sapiens]     310   4e-82   Homo sapiens [man]
gi|224080017|ref|XP_002305992.1| predicted protein [Populus tric...   310   6e-82   Populus trichocarpa [western balsam poplar]
gi|224140903|ref|XP_002323817.1| predicted protein [Populus tric...   308   2e-81   
gi|302771858|ref|XP_002969347.1| hypothetical protein SELMODRAFT...   307   3e-81   Selaginella moellendorffii
gi|157127884|ref|XP_001655066.1| ubiquitin carboxyl-terminal hyd...   306   6e-81   
gi|221123773|ref|XP_002164730.1| PREDICTED: ubiquitin carboxyl-t...   306   6e-81   Hydra vulgaris
gi|125977168|ref|XP_001352617.1| GA17448 [Drosophila pseudoobscu...   305   9e-81   Drosophila pseudoobscura pseudoobscura
gi|431902403|gb|ELK08903.1| Ubiquitin carboxyl-terminal hydrolas...   305   1e-80   Pteropus alecto
gi|194747725|ref|XP_001956302.1| GF24661 [Drosophila ananassae] ...   305   2e-80   Drosophila ananassae
gi|498930888|ref|XP_004519004.1| PREDICTED: ubiquitin carboxyl-t...   305   2e-80   Ceratitis capitata
gi|17648095|ref|NP_524003.1| ubiquitin C-terminal hydrolase, iso...   303   4e-80   Drosophila melanogaster
gi|66499314|ref|XP_397252.2| PREDICTED: ubiquitin carboxyl-termi...   302   9e-80   Apis mellifera [European honey bee]
gi|440904743|gb|ELR55213.1| Ubiquitin carboxyl-terminal hydrolas...   301   1e-79   Bos mutus
gi|195326334|ref|XP_002029884.1| GM24867 [Drosophila sechellia] ...   301   1e-79   Drosophila sechellia
gi|384249242|gb|EIE22724.1| ubiquitinyl hydrolase [Coccomyxa sub...   301   1e-79   Coccomyxa subellipsoidea C-169
gi|195589056|ref|XP_002084272.1| GD12919 [Drosophila simulans] >...   301   1e-79   Drosophila simulans
gi|58387409|ref|XP_315540.2| AGAP005540-PA [Anopheles gambiae st...   301   2e-79   Anopheles gambiae str. PEST
gi|355746080|gb|EHH50705.1| hypothetical protein EGM_01573, part...   301   2e-79   Macaca fascicularis [crab eating macaque]
gi|195127477|ref|XP_002008195.1| GI13355 [Drosophila mojavensis]...   301   2e-79   Drosophila mojavensis
gi|91079883|ref|XP_967733.1| PREDICTED: similar to ubiquitin car...   301   2e-79   Tribolium castaneum [rust-red flour beetle]
gi|340720665|ref|XP_003398753.1| PREDICTED: ubiquitin carboxyl-t...   301   2e-79   Bombus terrestris [large earth bumblebee]
gi|197097950|ref|NP_001127557.1| ubiquitin carboxyl-terminal hyd...   301   2e-79   Pongo abelii [Orang-utan]
gi|350401284|ref|XP_003486108.1| PREDICTED: ubiquitin carboxyl-t...   301   2e-79   Bombus impatiens
gi|294846029|gb|ADF43187.1| UBCH1m [Chlamydomonas reinhardtii]        300   3e-79   Chlamydomonas reinhardtii
gi|302852920|ref|XP_002957978.1| hypothetical protein VOLCADRAFT...   300   3e-79   Volvox carteri f. nagariensis
gi|195490816|ref|XP_002093299.1| GE21236 [Drosophila yakuba] >gi...   300   3e-79   Drosophila yakuba
gi|46850173|gb|AAT02518.1| ubitquitin C-terminal hydrolase [Chla...   300   3e-79   Chlamydomonas reinhardtii
gi|281353215|gb|EFB28799.1| hypothetical protein PANDA_012567 [A...   300   3e-79   Ailuropoda melanoleuca
gi|255077900|ref|XP_002502530.1| predicted protein [Micromonas s...   300   4e-79   Micromonas commoda
gi|402589718|gb|EJW83649.1| ubiquitin carboxyl-terminal hydrolas...   300   6e-79   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|194867940|ref|XP_001972178.1| GG14033 [Drosophila erecta] >gi...   299   7e-79   Drosophila erecta
gi|195441613|ref|XP_002068599.1| GK20334 [Drosophila willistoni]...   299   9e-79   Drosophila willistoni
gi|383860406|ref|XP_003705680.1| PREDICTED: ubiquitin carboxyl-t...   298   2e-78   Megachile rotundata
gi|223945239|gb|ACN26703.1| unknown [Zea mays] >gi|413939542|gb|...   298   2e-78   Zea mays [maize]
gi|312381629|gb|EFR27337.1| hypothetical protein AND_06018 [Anop...   298   2e-78   
gi|170035816|ref|XP_001845763.1| ubiquitin carboxyl-terminal hyd...   297   3e-78   Culex quinquefasciatus
gi|307187674|gb|EFN72646.1| Ubiquitin carboxyl-terminal hydrolas...   296   7e-78   Camponotus floridanus
gi|449527357|ref|XP_004170678.1| PREDICTED: ubiquitin carboxyl-t...   295   1e-77   
gi|330792465|ref|XP_003284309.1| ubiquitin carboxyl-terminal hyd...   295   1e-77   Dictyostelium purpureum
gi|321477780|gb|EFX88738.1| hypothetical protein DAPPUDRAFT_1913...   295   2e-77   Daphnia pulex
gi|303276184|ref|XP_003057386.1| predicted protein [Micromonas p...   294   2e-77   Micromonas pusilla CCMP1545
gi|307195472|gb|EFN77358.1| Ubiquitin carboxyl-terminal hydrolas...   294   3e-77   Harpegnathos saltator
gi|156550354|ref|XP_001607168.1| PREDICTED: ubiquitin carboxyl-t...   294   3e-77   Nasonia vitripennis
gi|195014425|ref|XP_001984019.1| GH16209 [Drosophila grimshawi] ...   293   4e-77   Drosophila grimshawi
gi|351697057|gb|EHA99975.1| Ubiquitin carboxyl-terminal hydrolas...   293   4e-77   Heterocephalus glaber [naked mole rat]
gi|348577983|ref|XP_003474763.1| PREDICTED: ubiquitin carboxyl-t...   293   5e-77   
gi|312096876|ref|XP_003148804.1| ubiquitin C-terminal hydrolase ...   293   7e-77   Loa loa
gi|159476586|ref|XP_001696392.1| ubiquitin carboxyl-terminal hyd...   293   7e-77   Chlamydomonas reinhardtii
gi|478261817|gb|ENN80940.1| hypothetical protein YQE_02645, part...   291   2e-76   Dendroctonus ponderosae
gi|119611641|gb|EAW91235.1| ubiquitin carboxyl-terminal hydrolas...   290   3e-76   Homo sapiens [man]
gi|241087438|ref|XP_002409195.1| ubiquitin C-terminal hydrolase,...   290   5e-76   Ixodes scapularis [blacklegged tick]
gi|470401324|ref|XP_004335580.1| ubiquitin carboxylterminal hydr...   290   5e-76   Acanthamoeba castellanii str. Neff
gi|470250558|ref|XP_004358376.1| peptidase C12 family protein [D...   290   5e-76   Dictyostelium fasciculatum
gi|460401489|ref|XP_004246256.1| PREDICTED: ubiquitin carboxyl-t...   288   2e-75   
gi|426333099|ref|XP_004028123.1| PREDICTED: ubiquitin carboxyl-t...   288   2e-75   Gorilla gorilla gorilla [lowland gorilla]
gi|195376419|ref|XP_002046994.1| GJ13185 [Drosophila virilis] >g...   287   3e-75   
gi|66808765|ref|XP_638105.1| peptidase C12 family protein [Dicty...   285   1e-74   Dictyostelium discoideum AX4
gi|410921992|ref|XP_003974467.1| PREDICTED: ubiquitin carboxyl-t...   285   1e-74   
gi|170581201|ref|XP_001895580.1| ubiquitin C-terminal hydrolase ...   285   1e-74   Brugia malayi [agent of lymphatic filariasis]
gi|345325309|ref|XP_001516535.2| PREDICTED: ubiquitin carboxyl-t...   285   2e-74   
gi|325188055|emb|CCA22598.1| ubiquitin carboxylterminal hydrolas...   285   2e-74   Albugo laibachii Nc14
gi|449268149|gb|EMC79019.1| Ubiquitin carboxyl-terminal hydrolas...   284   2e-74   Columba livia [carrier pigeon]
gi|12841686|dbj|BAB25312.1| unnamed protein product [Mus musculus]    283   4e-74   Mus musculus [mouse]
gi|242023086|ref|XP_002431967.1| ubiquitin carboxyl-terminal hyd...   283   4e-74   Pediculus humanus corporis [human body lice]
gi|328708758|ref|XP_003243794.1| PREDICTED: ubiquitin carboxyl-t...   283   4e-74   
gi|340377116|ref|XP_003387076.1| PREDICTED: ubiquitin carboxyl-t...   283   5e-74   Amphimedon queenslandica
gi|322797446|gb|EFZ19517.1| hypothetical protein SINV_00678 [Sol...   283   5e-74   Solenopsis invicta [imported red fire ant]
gi|326924877|ref|XP_003208649.1| PREDICTED: ubiquitin carboxyl-t...   283   6e-74   
gi|465971743|gb|EMP32826.1| Ubiquitin carboxyl-terminal hydrolas...   281   1e-73   Chelonia mydas [green seaturtle]
gi|6686411|gb|AAF23845.1|AC007234_17 F1E22.3 [Arabidopsis thaliana]   281   1e-73   Arabidopsis thaliana [mouse-ear cress]
gi|57529689|ref|NP_001006530.1| ubiquitin carboxyl-terminal hydr...   281   2e-73   
gi|54287942|gb|AAV31418.1| ubiquitin c-terminal hydrolase UCH37-...   281   2e-73   Aphis citricidus
gi|356624468|pdb|3RIS|A Chain A, Crystal Structure Of The Cataly...   281   2e-73   Homo sapiens [man]
gi|443725376|gb|ELU12999.1| hypothetical protein CAPTEDRAFT_3656...   280   4e-73   Capitella teleta
gi|167525641|ref|XP_001747155.1| hypothetical protein [Monosiga ...   280   6e-73   Monosiga brevicollis MX1
gi|15237324|ref|NP_197135.1| ubiquitin thiolesterase UCH1 [Arabi...   280   6e-73   Arabidopsis thaliana [mouse-ear cress]
gi|68161114|gb|AAY86988.1| ubiquitin C-terminal hydrolase [Ictal...   279   7e-73   Ictalurus punctatus
gi|357609741|gb|EHJ66626.1| hypothetical protein KGM_08817 [Dana...   279   1e-72   Danaus plexippus [American monarch]
gi|194227370|ref|XP_001492151.2| PREDICTED: ubiquitin carboxyl-t...   278   1e-72   
gi|297811767|ref|XP_002873767.1| ubiquitin carboxyl-terminal hyd...   278   2e-72   Arabidopsis lyrata subsp. lyrata
gi|115444619|ref|NP_001046089.1| Os02g0180100 [Oryza sativa Japo...   278   2e-72   
gi|125581038|gb|EAZ21969.1| hypothetical protein OsJ_05623 [Oryz...   277   3e-72   Oryza sativa Japonica Group [Japonica rice]
gi|348532151|ref|XP_003453570.1| PREDICTED: ubiquitin carboxyl-t...   276   4e-72   
gi|350589239|ref|XP_003130528.2| PREDICTED: ubiquitin carboxyl-t...   276   5e-72   
gi|395531033|ref|XP_003767587.1| PREDICTED: ubiquitin carboxyl-t...   276   6e-72   
gi|403294478|ref|XP_003938212.1| PREDICTED: ubiquitin carboxyl-t...   276   8e-72   
gi|198433076|ref|XP_002119457.1| PREDICTED: ubiquitin carboxyl-t...   275   1e-71   Ciona intestinalis [sea vase]
gi|268529716|ref|XP_002629984.1| C. briggsae CBR-UBH-4 protein [...   275   1e-71   Caenorhabditis briggsae
gi|482556851|gb|EOA21043.1| hypothetical protein CARUB_v10001382...   275   2e-71   Capsella rubella
gi|225713540|gb|ACO12616.1| Ubiquitin carboxyl-terminal hydrolas...   273   5e-71   Lepeophtheirus salmonis
gi|308509802|ref|XP_003117084.1| CRE-UBH-4 protein [Caenorhabdit...   273   7e-71   Caenorhabditis remanei
gi|428180225|gb|EKX49093.1| hypothetical protein GUITHDRAFT_8587...   273   7e-71   Guillardia theta CCMP2712
gi|390333870|ref|XP_781862.3| PREDICTED: ubiquitin carboxyl-term...   272   8e-71   
gi|196014574|ref|XP_002117146.1| hypothetical protein TRIADDRAFT...   272   1e-70   Trichoplax adhaerens
gi|290562351|gb|ADD38572.1| Ubiquitin carboxyl-terminal hydrolas...   271   1e-70   Lepeophtheirus salmonis
gi|391328977|ref|XP_003738956.1| PREDICTED: ubiquitin carboxyl-t...   271   2e-70   Metaseiulus occidentalis
gi|348673764|gb|EGZ13583.1| hypothetical protein PHYSODRAFT_5141...   271   3e-70   Phytophthora sojae
gi|432855295|ref|XP_004068150.1| PREDICTED: ubiquitin carboxyl-t...   270   3e-70   
gi|297281200|ref|XP_002802054.1| PREDICTED: ubiquitin carboxyl-t...   270   3e-70   
gi|512934835|ref|XP_004933128.1| PREDICTED: ubiquitin carboxyl-t...   270   4e-70   
gi|262367853|pdb|3A7S|A Chain A, Catalytic Domain Of Uch37            270   5e-70   Homo sapiens [man]
gi|377656312|pdb|3TB3|A Chain A, Crystal Structure Of The Uch Do...   269   7e-70   Homo sapiens [man]
gi|341882703|gb|EGT38638.1| hypothetical protein CAEBREN_14335 [...   269   8e-70   Caenorhabditis brenneri
gi|281201627|gb|EFA75836.1| peptidase C12 family protein [Polysp...   269   1e-69   Polysphondylium pallidum PN500
gi|301108143|ref|XP_002903153.1| ubiquitin carboxyl-terminal hyd...   269   1e-69   Phytophthora infestans T30-4
gi|512934839|ref|XP_004933129.1| PREDICTED: ubiquitin carboxyl-t...   268   1e-69   
gi|403334786|gb|EJY66564.1| Ubiquitin carboxyl-terminal hydrolas...   268   1e-69   Oxytricha trifallax
gi|195439240|ref|XP_002067539.1| GK16481 [Drosophila willistoni]...   268   1e-69   Drosophila willistoni
gi|449508010|ref|XP_002191860.2| PREDICTED: ubiquitin carboxyl-t...   268   2e-69   
gi|183979268|dbj|BAG30795.1| similar to CG3431-PA [Papilio xuthus]    267   3e-69   Papilio xuthus [Chinese swallowtail]
gi|356624462|pdb|3RII|A Chain A, Crystal Structure Of The Cataly...   267   3e-69   Homo sapiens [man]
gi|213515214|ref|NP_001133540.1| ubiquitin carboxyl-terminal hyd...   266   5e-69   Salmo salar
gi|194768058|ref|XP_001966131.1| GF19511 [Drosophila ananassae] ...   265   1e-68   
gi|242041667|ref|XP_002468228.1| hypothetical protein SORBIDRAFT...   265   2e-68   Sorghum bicolor [broomcorn]
gi|242079609|ref|XP_002444573.1| hypothetical protein SORBIDRAFT...   264   2e-68   Sorghum bicolor [broomcorn]
gi|506968395|gb|AGM32541.1| cysteine peptidase C12 containing ub...   264   2e-68   Coptotermes formosanus
gi|313236010|emb|CBY11337.1| unnamed protein product [Oikopleura...   263   7e-68   Oikopleura dioica
gi|313236008|emb|CBY11335.1| unnamed protein product [Oikopleura...   262   9e-68   Oikopleura dioica
gi|195165099|ref|XP_002023383.1| GL20225 [Drosophila persimilis]...   258   2e-66   Drosophila persimilis
gi|195356117|ref|XP_002044528.1| GM13220 [Drosophila sechellia] ...   258   2e-66   Drosophila sechellia
gi|198468526|ref|XP_002134052.1| GA26899 [Drosophila pseudoobscu...   256   5e-66   Drosophila pseudoobscura pseudoobscura
gi|357138220|ref|XP_003570695.1| PREDICTED: ubiquitin carboxyl-t...   256   6e-66   Brachypodium distachyon [annual false brome]
gi|71981272|ref|NP_495684.2| Protein UBH-4 [Caenorhabditis elega...   255   1e-65   Caenorhabditis elegans [roundworm]
gi|483523929|gb|EOB08101.1| Ubiquitin carboxyl-terminal hydrolas...   255   1e-65   Anas platyrhynchos [duck]
gi|212274917|ref|NP_001130225.1| uncharacterized protein LOC1001...   254   2e-65   Zea mays [maize]
gi|229594443|ref|XP_001023490.3| Ubiquitin carboxyl-terminal hyd...   254   3e-65   Tetrahymena thermophila SB210
gi|326531148|dbj|BAK04925.1| predicted protein [Hordeum vulgare ...   254   4e-65   Hordeum vulgare subsp. vulgare [barley]
gi|194352964|emb|CAQ53274.1| CG1950-PA [Drosophila simulans]          253   7e-65   Drosophila simulans
gi|485610293|gb|EOD09063.1| hypothetical protein EMIHUDRAFT_6801...   252   9e-65   Emiliania huxleyi CCMP1516
gi|195566369|ref|XP_002106756.1| GD15942 [Drosophila simulans] >...   252   1e-64   
gi|290462191|gb|ADD24143.1| Ubiquitin carboxyl-terminal hydrolas...   251   2e-64   Lepeophtheirus salmonis
gi|260794993|ref|XP_002592491.1| hypothetical protein BRAFLDRAFT...   251   3e-64   Branchiostoma floridae
gi|410986481|ref|XP_003999538.1| PREDICTED: ubiquitin carboxyl-t...   250   4e-64   
gi|323449674|gb|EGB05560.1| hypothetical protein AURANDRAFT_6991...   249   7e-64   Aureococcus anophagefferens
gi|474246845|gb|EMS60015.1| Ubiquitin carboxyl-terminal hydrolas...   248   1e-63   Triticum urartu
gi|470634909|ref|XP_004322990.1| PREDICTED: ubiquitin carboxyl-t...   248   1e-63   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|145347079|ref|XP_001418005.1| predicted protein [Ostreococcus...   248   1e-63   Ostreococcus lucimarinus CCE9901
gi|508123789|pdb|4IG7|A Chain A, Crystal Structure Of Trichinell...   248   1e-63   Trichinella spiralis
gi|215697292|dbj|BAG91286.1| unnamed protein product [Oryza sati...   248   1e-63   Oryza sativa Japonica Group [Japonica rice]
gi|413921742|gb|AFW61674.1| hypothetical protein ZEAMMB73_636432...   248   2e-63   Zea mays [maize]
gi|307106323|gb|EFN54569.1| hypothetical protein CHLNCDRAFT_1011...   246   6e-63   Chlorella variabilis
gi|296413936|ref|XP_002836662.1| hypothetical protein [Tuber mel...   246   7e-63   Tuber melanosporum Mel28
gi|195469854|ref|XP_002099851.1| GE16722 [Drosophila yakuba] >gi...   246   8e-63   Drosophila yakuba
gi|472585169|gb|EMS22735.1| ubiquitin carboxyl-terminal hydrolas...   246   9e-63   Rhodotorula toruloides NP11
gi|293335145|ref|NP_001168238.1| uncharacterized protein LOC1003...   244   2e-62   Zea mays [maize]
gi|331233118|ref|XP_003329220.1| hypothetical protein PGTG_10272...   244   2e-62   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|145537161|ref|XP_001454297.1| hypothetical protein [Parameciu...   244   3e-62   Paramecium tetraurelia strain d4-2
gi|308804071|ref|XP_003079348.1| Ubiquitin C-terminal hydrolase ...   243   4e-62   Ostreococcus tauri
gi|475606717|gb|EMT26482.1| Ubiquitin carboxyl-terminal hydrolas...   240   3e-61   Aegilops tauschii
gi|145553351|ref|XP_001462350.1| hypothetical protein [Parameciu...   240   4e-61   Paramecium tetraurelia strain d4-2
gi|345563791|gb|EGX46775.1| hypothetical protein AOL_s00097g405 ...   240   4e-61   Arthrobotrys oligospora ATCC 24927
gi|125538335|gb|EAY84730.1| hypothetical protein OsI_06099 [Oryz...   240   4e-61   Oryza sativa Indica Group [Indian rice]
gi|507111422|emb|CDF35146.1| Ubiquitin carboxyl-terminal hydrola...   240   5e-61   Chondrus crispus [Irish moss]
gi|358055142|dbj|GAA98911.1| hypothetical protein E5Q_05599 [Mix...   240   5e-61   Mixia osmundae IAM 14324
gi|212531795|ref|XP_002146054.1| ubiquitin hydrolase, putative [...   240   5e-61   Talaromyces marneffei ATCC 18224
gi|194352962|emb|CAQ53273.1| CG1950-PA [Drosophila melanogaster]      239   7e-61   Drosophila melanogaster
gi|474241672|gb|EMS59823.1| Ubiquitin carboxyl-terminal hydrolas...   239   8e-61   Triticum urartu
gi|194352946|emb|CAQ53265.1| CG1950-PA [Drosophila melanogaster]      239   1e-60   Drosophila melanogaster
gi|194896000|ref|XP_001978392.1| GG19562 [Drosophila erecta] >gi...   238   2e-60   Drosophila erecta
gi|440639356|gb|ELR09275.1| hypothetical protein GMDG_03845 [Geo...   238   2e-60   Pseudogymnoascus destructans 20631-21
gi|194352954|emb|CAQ53269.1| CG1950-PA [Drosophila melanogaster]      238   2e-60   Drosophila melanogaster
gi|295664032|ref|XP_002792568.1| ubiquitin carboxyl-terminal hyd...   237   3e-60   Paracoccidioides lutzii Pb01
gi|194352956|emb|CAQ53270.1| CG1950-PA [Drosophila melanogaster]      237   3e-60   Drosophila melanogaster
gi|194352950|emb|CAQ53267.1| CG1950-PA [Drosophila melanogaster]      237   3e-60   Drosophila melanogaster
gi|302897379|ref|XP_003047568.1| predicted protein [Nectria haem...   237   3e-60   Nectria haematococca mpVI 77-13-4
gi|223968463|emb|CAR93962.1| CG1950-PA [Drosophila melanogaster]      237   4e-60   Drosophila melanogaster
gi|194352958|emb|CAQ53271.1| CG1950-PA [Drosophila melanogaster]...   237   4e-60   Drosophila melanogaster
gi|24641487|ref|NP_572781.1| CG1950 [Drosophila melanogaster] >g...   237   4e-60   Drosophila melanogaster
gi|223968469|emb|CAR93965.1| CG1950-PA [Drosophila melanogaster]      237   4e-60   Drosophila melanogaster
gi|19527853|gb|AAL90041.1| AT10439p [Drosophila melanogaster]         236   7e-60   Drosophila melanogaster
gi|194352944|emb|CAQ53264.1| CG1950-PA [Drosophila melanogaster]...   236   9e-60   Drosophila melanogaster
gi|378727904|gb|EHY54363.1| ubiquitin carboxyl-terminal hydrolas...   236   9e-60   Exophiala dermatitidis NIH/UT8656
gi|223968451|emb|CAR93956.1| CG1950-PA [Drosophila melanogaster]      236   1e-59   Drosophila melanogaster
gi|223968453|emb|CAR93957.1| CG1950-PA [Drosophila melanogaster]      236   1e-59   Drosophila melanogaster
gi|223968457|emb|CAR93959.1| CG1950-PA [Drosophila melanogaster]...   236   1e-59   Drosophila melanogaster
gi|512207290|gb|EPE36108.1| Cysteine proteinase [Glarea lozoyens...   235   1e-59   Glarea lozoyensis ATCC 20868
gi|223968467|emb|CAR93964.1| CG1950-PA [Drosophila melanogaster]      235   2e-59   Drosophila melanogaster
gi|194352952|emb|CAQ53268.1| CG1950-PA [Drosophila melanogaster]      235   2e-59   Drosophila melanogaster
gi|485923888|gb|EOD48874.1| putative ubiquitin carboxyl-terminal...   234   2e-59   Neofusicoccum parvum UCRNP2
gi|226295147|gb|EEH50567.1| ubiquitin carboxyl-terminal hydrolas...   234   4e-59   Paracoccidioides brasiliensis Pb18
gi|342886860|gb|EGU86557.1| hypothetical protein FOXB_02886 [Fus...   233   5e-59   Fusarium oxysporum Fo5176
gi|242773958|ref|XP_002478346.1| 26S proteasome-associated ubiqu...   233   5e-59   Talaromyces stipitatus ATCC 10500
gi|358377505|gb|EHK15189.1| hypothetical protein TRIVIDRAFT_2288...   233   5e-59   Trichoderma virens Gv29-8
gi|70996406|ref|XP_752958.1| 26S proteasome-associated ubiquitin...   233   7e-59   Aspergillus fumigatus Af293
gi|19112248|ref|NP_595456.1| ubiquitin C-terminal hydrolase Uch2...   233   8e-59   
gi|194352948|emb|CAQ53266.1| CG1950-PA [Drosophila melanogaster]      233   9e-59   
gi|119186069|ref|XP_001243641.1| hypothetical protein CIMG_03082...   232   9e-59   
gi|119494669|ref|XP_001264157.1| 26S proteasome-associated ubiqu...   232   1e-58   
gi|46109962|ref|XP_382039.1| hypothetical protein FG01863.1 [Fus...   232   1e-58   
gi|194352960|emb|CAQ53272.1| CG1950-PA [Drosophila melanogaster]      232   1e-58   
gi|408387765|gb|EKJ67474.1| hypothetical protein FPSE_12339 [Fus...   232   1e-58   
gi|494824973|gb|EON62191.1| ubiquitin carboxyl-terminal hydrolas...   232   1e-58   
gi|475668544|gb|EMT66331.1| Ubiquitin carboxyl-terminal hydrolas...   232   1e-58   
gi|500252281|gb|EON96127.1| putative ubiquitin carboxyl-terminal...   231   2e-58   
gi|303318052|ref|XP_003069028.1| Ubiquitin carboxyl-terminal hyd...   231   2e-58   
gi|169767206|ref|XP_001818074.1| ubiquitin carboxyl-terminal hyd...   230   4e-58   
gi|326471745|gb|EGD95754.1| ubiquitin carboxyl-terminal hydrolas...   229   6e-58   
gi|121700797|ref|XP_001268663.1| 26S proteasome-associated ubiqu...   229   8e-58   
gi|327293191|ref|XP_003231292.1| ubiquitin carboxyl-terminal hyd...   229   8e-58   
gi|145413779|gb|ABP68530.1| ENSANGG00000019219-like [Anopheles g...   229   9e-58   
gi|302499132|ref|XP_003011562.1| hypothetical protein ARB_02115 ...   229   9e-58   
gi|145413823|gb|ABP68552.1| ENSANGG00000019219-like [Anopheles q...   229   1e-57   
gi|145413803|gb|ABP68542.1| ENSANGG00000019219-like [Anopheles g...   229   1e-57   
gi|225561398|gb|EEH09678.1| ubiquitin carboxyl-terminal hydrolas...   229   1e-57   
gi|255639755|gb|ACU20171.1| unknown [Glycine max]                     228   1e-57   
gi|407919419|gb|EKG12666.1| Peptidase C12 ubiquitin carboxyl-ter...   228   1e-57   
gi|261191458|ref|XP_002622137.1| ubiquitin carboxyl-terminal hyd...   228   1e-57   
gi|340516199|gb|EGR46449.1| predicted protein [Trichoderma reese...   228   2e-57   
gi|255941980|ref|XP_002561759.1| Pc16g14620 [Penicillium chrysog...   228   2e-57   
gi|367025471|ref|XP_003662020.1| hypothetical protein MYCTH_2302...   228   2e-57   
gi|310790578|gb|EFQ26111.1| ubiquitin carboxyl-terminal hydrolas...   228   2e-57   
gi|452823139|gb|EME30152.1| ubiquitin carboxyl-terminal hydrolas...   227   3e-57   
gi|171694207|ref|XP_001912028.1| hypothetical protein [Podospora...   227   3e-57   
gi|296820580|ref|XP_002849964.1| ubiquitin carboxyl-terminal hyd...   227   4e-57   
gi|256086450|ref|XP_002579412.1| ubiquitinyl hydrolase-UCH37 (C1...   227   4e-57   
gi|412989183|emb|CCO15774.1| predicted protein [Bathycoccus pras...   227   4e-57   
gi|258578353|ref|XP_002543358.1| hypothetical protein UREG_02874...   227   4e-57   
gi|406868081|gb|EKD21118.1| ubiquitin carboxyl-terminal hydrolas...   226   5e-57   
gi|322693535|gb|EFY85392.1| ubiquitin carboxyl-terminal hydrolas...   226   6e-57   
gi|425770708|gb|EKV09173.1| 26S proteasome-associated ubiquitin ...   226   7e-57   
gi|325090843|gb|EGC44153.1| ubiquitin carboxyl-terminal hydrolas...   226   7e-57   
gi|399166405|emb|CCE32680.1| related to 26S proteasome-associate...   226   8e-57   
gi|347835057|emb|CCD49629.1| similar to ubiquitin carboxyl-termi...   226   9e-57   
gi|367038409|ref|XP_003649585.1| hypothetical protein THITE_2108...   225   1e-56   
gi|226488116|emb|CAX75723.1| Ubiquitin C-terminal hydrolase [Sch...   225   1e-56   
gi|358400356|gb|EHK49687.1| hypothetical protein TRIATDRAFT_2975...   225   1e-56   
gi|67517306|ref|XP_658531.1| hypothetical protein AN0927.2 [Aspe...   225   1e-56   
gi|340905101|gb|EGS17469.1| putative 26S proteasome-associated u...   224   2e-56   
gi|336473064|gb|EGO61224.1| hypothetical protein NEUTE1DRAFT_770...   224   2e-56   
gi|226488114|emb|CAX75722.1| Ubiquitin C-terminal hydrolase [Sch...   224   2e-56   
gi|393217933|gb|EJD03422.1| cysteine proteinase [Fomitiporia med...   224   2e-56   
gi|134055647|emb|CAK44021.1| unnamed protein product [Aspergillu...   224   2e-56   
gi|346321890|gb|EGX91489.1| ubiquitin carboxyl-terminal hydrolas...   224   2e-56   
gi|85103260|ref|XP_961480.1| hypothetical protein NCU03704 [Neur...   224   3e-56   
gi|315043526|ref|XP_003171139.1| ubiquitin carboxyl-terminal hyd...   224   3e-56   
gi|294892594|ref|XP_002774137.1| ubiquitin carboxyl-terminal hyd...   224   3e-56   
gi|317025665|ref|XP_001389529.2| ubiquitin carboxyl-terminal hyd...   224   3e-56   
gi|154282523|ref|XP_001542057.1| conserved hypothetical protein ...   224   4e-56   
gi|350638545|gb|EHA26901.1| hypothetical protein ASPNIDRAFT_4639...   223   4e-56   
gi|294949287|ref|XP_002786136.1| ubiquitin carboxyl-terminal hyd...   223   6e-56   
gi|358370740|dbj|GAA87350.1| 26S proteasome-associated ubiquitin...   223   7e-56   
gi|115397561|ref|XP_001214372.1| hypothetical protein ATEG_05194...   223   8e-56   
gi|326522100|dbj|BAK04178.1| predicted protein [Hordeum vulgare ...   223   8e-56   
gi|477529085|gb|ENH80854.1| ubiquitin carboxyl-terminal hydrolas...   223   9e-56   
gi|389624321|ref|XP_003709814.1| ubiquitin carboxyl-terminal hyd...   222   1e-55   
gi|290984099|ref|XP_002674765.1| predicted protein [Naegleria gr...   222   1e-55   
gi|256086452|ref|XP_002579413.1| ubiquitinyl hydrolase-UCH37 (C1...   220   4e-55   
gi|336274745|ref|XP_003352126.1| hypothetical protein SMAC_02561...   220   4e-55   
gi|401883419|gb|EJT47628.1| ubiquitin-specific protease [Trichos...   219   1e-54   
gi|390602701|gb|EIN12094.1| ubiquitin-specific protease [Punctul...   219   1e-54   
gi|322709525|gb|EFZ01101.1| ubiquitin carboxyl-terminal hydrolas...   219   1e-54   
gi|395325201|gb|EJF57627.1| hypothetical protein DICSQDRAFT_1632...   219   1e-54   
gi|213405555|ref|XP_002173549.1| ubiquitin carboxyl-terminal hyd...   219   1e-54   
gi|116198283|ref|XP_001224953.1| hypothetical protein CHGG_07297...   219   1e-54   
gi|225677692|gb|EEH15976.1| ubiquitin carboxyl-terminal hydrolas...   219   1e-54   
gi|398391544|ref|XP_003849232.1| hypothetical protein MYCGRDRAFT...   218   1e-54   
gi|401413058|ref|XP_003885976.1| hypothetical protein NCLIV_0637...   218   2e-54   
gi|392570029|gb|EIW63202.1| ubiquitin-specific protease [Tramete...   217   3e-54   
gi|224008604|ref|XP_002293261.1| predicted protein [Thalassiosir...   216   6e-54   
gi|508123781|pdb|4I6N|A Chain A, Crystal Structure Of Trichinell...   216   6e-54   
gi|396489466|ref|XP_003843111.1| hypothetical protein LEMA_P0887...   216   7e-54   
gi|403413149|emb|CCL99849.1| predicted protein [Fibroporia radic...   216   8e-54   
gi|219126291|ref|XP_002183394.1| predicted protein [Phaeodactylu...   216   1e-53   
gi|451845441|gb|EMD58754.1| hypothetical protein COCSADRAFT_1294...   215   1e-53   
gi|189209099|ref|XP_001940882.1| ubiquitin carboxyl-terminal hyd...   215   1e-53   
gi|482808320|gb|EOA85253.1| hypothetical protein SETTUDRAFT_1639...   214   2e-53   
gi|361126051|gb|EHK98067.1| putative Ubiquitin carboxyl-terminal...   213   4e-53   
gi|402075828|gb|EJT71251.1| ubiquitin carboxyl-terminal hydrolas...   213   7e-53   
gi|452845043|gb|EME46976.1| hypothetical protein DOTSEDRAFT_6908...   213   7e-53   
gi|237835587|ref|XP_002367091.1| ubiquitin carboxyl-terminal hyd...   212   1e-52   
gi|154299204|ref|XP_001550022.1| hypothetical protein BC1G_11780...   212   1e-52   
gi|221485373|gb|EEE23654.1| ubiquitin carboxyl-terminal hydrolas...   212   1e-52   
gi|302680909|ref|XP_003030136.1| hypothetical protein SCHCODRAFT...   212   1e-52   
gi|346979724|gb|EGY23176.1| ubiquitin carboxyl-terminal hydrolas...   211   2e-52   
gi|169599286|ref|XP_001793066.1| hypothetical protein SNOG_02461...   211   2e-52   
gi|302404690|ref|XP_003000182.1| ubiquitin carboxyl-terminal hyd...   211   3e-52   
gi|452985618|gb|EME85374.1| hypothetical protein MYCFIDRAFT_6520...   210   4e-52   
gi|508717188|gb|EOY09085.1| Ubiquitin carboxyl-terminal hydrolas...   209   7e-52   
gi|392575608|gb|EIW68741.1| hypothetical protein TREMEDRAFT_6320...   209   9e-52   
gi|58266276|ref|XP_570294.1| ubiquitin-specific protease [Crypto...   209   1e-51   
gi|405120387|gb|AFR95158.1| ubiquitin-specific protease [Cryptoc...   209   1e-51   
gi|321257142|ref|XP_003193484.1| ubiquitin-specific protease [Cr...   208   2e-51   
gi|512193929|gb|EPE09686.1| ubiquitin carboxyl-terminal hydrolas...   207   2e-51   
gi|402224056|gb|EJU04119.1| hypothetical protein DACRYDRAFT_2075...   207   3e-51   
gi|170097988|ref|XP_001880213.1| predicted protein [Laccaria bic...   207   3e-51   
gi|240274503|gb|EER38019.1| ubiquitin carboxyl-terminal hydrolas...   207   4e-51   
gi|242211849|ref|XP_002471761.1| predicted protein [Postia place...   206   1e-50   
gi|429855237|gb|ELA30204.1| ubiquitin carboxyl-terminal hydrolas...   206   1e-50   
gi|453087701|gb|EMF15742.1| ubiquitin carboxyl-terminal hydrolas...   206   1e-50   
gi|145413785|gb|ABP68533.1| ENSANGG00000019219-like [Anopheles g...   205   2e-50   
gi|400602400|gb|EJP70002.1| 26S proteasome-associated ubiquitin ...   204   3e-50   
gi|392593307|gb|EIW82632.1| hypothetical protein CONPUDRAFT_5207...   201   3e-49   
gi|332029139|gb|EGI69150.1| Ubiquitin carboxyl-terminal hydrolas...   201   3e-49   
gi|50547031|ref|XP_500985.1| YALI0B16698p [Yarrowia lipolytica] ...   201   3e-49   
gi|501751644|emb|CCG84177.1| protein of unknown function [Taphri...   200   4e-49   
gi|449542647|gb|EMD33625.1| hypothetical protein CERSUDRAFT_1177...   200   6e-49   
gi|407860329|gb|EKG07348.1| ubiquitin carboxyl-terminal hydrolas...   199   8e-49   
gi|409044684|gb|EKM54165.1| hypothetical protein PHACADRAFT_2578...   199   1e-48   
gi|354543333|emb|CCE40052.1| hypothetical protein CPAR2_100900 [...   199   1e-48   
gi|156359643|ref|XP_001624876.1| predicted protein [Nematostella...   198   2e-48   
gi|156051190|ref|XP_001591556.1| hypothetical protein SS1G_07002...   197   3e-48   
gi|71412224|ref|XP_808307.1| ubiquitin carboxyl-terminal hydrola...   196   6e-48   
gi|145413801|gb|ABP68541.1| ENSANGG00000019219-like [Anopheles g...   196   8e-48   
gi|448532568|ref|XP_003870455.1| Yuh2 ubiquitin C-terminal hydro...   196   1e-47   
gi|407425405|gb|EKF39403.1| ubiquitin carboxyl-terminal hydrolas...   196   1e-47   
gi|471574695|gb|EMR72482.1| putative ubiquitin carboxyl-terminal...   195   1e-47   
gi|389738819|gb|EIM80015.1| hypothetical protein STEHIDRAFT_1060...   195   2e-47   
gi|145413777|gb|ABP68529.1| ENSANGG00000019219-like [Anopheles a...   195   2e-47   
gi|342185636|emb|CCC95121.1| putative ubiquitin carboxyl-termina...   194   2e-47   
gi|320589048|gb|EFX01516.1| 26S proteasome-associated ubiquitin ...   194   2e-47   
gi|169847399|ref|XP_001830411.1| ubiquitin-specific protease [Co...   194   3e-47   
gi|37359880|dbj|BAC97918.1| mKIAA0272 protein [Mus musculus]          194   3e-47   
gi|28076917|ref|NP_081364.1| ubiquitin carboxyl-terminal hydrola...   194   3e-47   
gi|149632588|ref|XP_001505329.1| PREDICTED: ubiquitin carboxyl-t...   194   3e-47   
gi|148692855|gb|EDL24802.1| Brca1 associated protein 1, isoform ...   194   3e-47   
gi|409080426|gb|EKM80786.1| hypothetical protein AGABI1DRAFT_369...   194   3e-47   
gi|507700708|ref|XP_004715257.1| PREDICTED: ubiquitin carboxyl-t...   194   4e-47   
gi|4757836|ref|NP_004647.1| ubiquitin carboxyl-terminal hydrolas...   194   4e-47   
gi|507646736|ref|XP_004631719.1| PREDICTED: ubiquitin carboxyl-t...   194   5e-47   
gi|507929799|ref|XP_004676147.1| PREDICTED: ubiquitin carboxyl-t...   193   5e-47   
gi|334342449|ref|XP_001380338.2| PREDICTED: ubiquitin carboxyl-t...   193   5e-47   
gi|20521868|dbj|BAA13401.2| KIAA0272 [Homo sapiens]                   193   5e-47   
gi|335299154|ref|XP_001925271.3| PREDICTED: ubiquitin carboxyl-t...   193   5e-47   
gi|431899887|gb|ELK07834.1| Ubiquitin carboxyl-terminal hydrolas...   193   5e-47   
gi|426197326|gb|EKV47253.1| hypothetical protein AGABI2DRAFT_688...   193   6e-47   
gi|512904865|ref|XP_004900481.1| PREDICTED: ubiquitin carboxyl-t...   193   6e-47   
gi|344276633|ref|XP_003410112.1| PREDICTED: ubiquitin carboxyl-t...   193   6e-47   
gi|145413795|gb|ABP68538.1| ENSANGG00000019219-like [Anopheles g...   193   6e-47   
gi|73985316|ref|XP_541853.2| PREDICTED: ubiquitin carboxyl-termi...   193   6e-47   
gi|332216155|ref|XP_003257209.1| PREDICTED: LOW QUALITY PROTEIN:...   193   7e-47   
gi|403291095|ref|XP_003936635.1| PREDICTED: ubiquitin carboxyl-t...   193   7e-47   
gi|402859893|ref|XP_003894371.1| PREDICTED: ubiquitin carboxyl-t...   193   7e-47   
gi|296225385|ref|XP_002758462.1| PREDICTED: ubiquitin carboxyl-t...   193   7e-47   
gi|149728610|ref|XP_001493524.1| PREDICTED: ubiquitin carboxyl-t...   193   7e-47   
gi|386780900|ref|NP_001248307.1| ubiquitin carboxyl-terminal hyd...   193   8e-47   
gi|440904171|gb|ELR54717.1| Ubiquitin carboxyl-terminal hydrolas...   193   8e-47   
gi|426340823|ref|XP_004034326.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|301767198|ref|XP_002919017.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|470646155|ref|XP_004326940.1| PREDICTED: LOW QUALITY PROTEIN:...   192   8e-47   
gi|397495957|ref|XP_003818810.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|114587267|ref|XP_001171970.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|471356115|ref|XP_004368659.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|297671139|ref|XP_002813701.1| PREDICTED: ubiquitin carboxyl-t...   192   8e-47   
gi|354465751|ref|XP_003495340.1| PREDICTED: ubiquitin carboxyl-t...   192   9e-47   
gi|395733687|ref|XP_003776276.1| PREDICTED: ubiquitin carboxyl-t...   192   9e-47   
gi|507555125|ref|XP_004661334.1| PREDICTED: ubiquitin carboxyl-t...   192   9e-47   
gi|513005998|ref|XP_004864457.1| PREDICTED: ubiquitin carboxyl-t...   192   9e-47   
gi|472384341|ref|XP_004411542.1| PREDICTED: ubiquitin carboxyl-t...   192   9e-47   
gi|336371259|gb|EGN99598.1| hypothetical protein SERLA73DRAFT_10...   192   9e-47   
gi|511826852|ref|XP_004738191.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|465998405|ref|XP_004267937.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|444513533|gb|ELV10379.1| Ubiquitin carboxyl-terminal hydrolas...   192   1e-46   
gi|478490950|ref|XP_004419847.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|348588819|ref|XP_003480162.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|291393805|ref|XP_002713425.1| PREDICTED: BRCA1 associated pro...   192   1e-46   
gi|504138252|ref|XP_004581581.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|426249427|ref|XP_004018451.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|71895453|ref|NP_001025761.1| ubiquitin carboxyl-terminal hydr...   192   1e-46   
gi|511826850|ref|XP_004738190.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|512904861|ref|XP_004900480.1| PREDICTED: ubiquitin carboxyl-t...   192   1e-46   
gi|358339809|dbj|GAA47799.1| ubiquitin carboxyl-terminal hydrola...   192   2e-46   
gi|226294416|gb|EEH49836.1| ubiquitin carboxyl-terminal hydrolas...   192   2e-46   
gi|145413797|gb|ABP68539.1| ENSANGG00000019219-like [Anopheles g...   191   2e-46   
gi|300681020|sp|D3ZHS6.2|BAP1_RAT RecName: Full=Ubiquitin carbox...   191   3e-46   
gi|56118432|ref|NP_001008206.1| ubiquitin carboxyl-terminal hydr...   190   4e-46   
gi|89272870|emb|CAJ81966.1| Novel Ubiquitin carboxyl-terminal hy...   190   4e-46   
gi|145413821|gb|ABP68551.1| ENSANGG00000019219-like [Anopheles m...   190   6e-46   
gi|340058687|emb|CCC53047.1| putative ubiquitin carboxyl-termina...   190   7e-46   
gi|260781247|ref|XP_002585731.1| hypothetical protein BRAFLDRAFT...   189   7e-46   
gi|241955963|ref|XP_002420702.1| ubiquitin carboxyl-terminal hyd...   189   7e-46   
gi|328908727|gb|AEB61031.1| ubiquitin carboxyl-terminal hydrolas...   189   1e-45   
gi|120537825|gb|AAI29507.1| LOC558885 protein [Danio rerio]           189   1e-45   
gi|413939544|gb|AFW74095.1| hypothetical protein ZEAMMB73_281354...   188   2e-45   
gi|344229424|gb|EGV61310.1| ubiquitinyl hydrolase [Candida tenui...   188   2e-45   
gi|148231285|ref|NP_001089388.1| ubiquitin carboxyl-terminal hyd...   188   2e-45   
gi|344300746|gb|EGW31067.1| hypothetical protein SPAPADRAFT_1422...   187   3e-45   
gi|449300481|gb|EMC96493.1| hypothetical protein BAUCODRAFT_1310...   187   3e-45   
gi|302653840|ref|XP_003018737.1| hypothetical protein TRV_07242 ...   187   4e-45   
gi|261334469|emb|CBH17463.1| cysteine peptidase, Clan CA, family...   187   4e-45   
gi|261195795|ref|XP_002624301.1| ubiquitin carboxyl-terminal hyd...   187   4e-45   
gi|145413775|gb|ABP68528.1| ENSANGG00000019219-like [Anopheles a...   187   5e-45   
gi|300681019|sp|A1L2G3.2|BAP1_DANRE RecName: Full=Ubiquitin carb...   186   8e-45   
gi|255522786|ref|NP_001157309.1| ubiquitin carboxyl-terminal hyd...   186   8e-45   
gi|321465605|gb|EFX76605.1| hypothetical protein DAPPUDRAFT_5492...   186   1e-44   
gi|71755349|ref|XP_828589.1| ubiquitin carboxyl-terminal hydrola...   186   1e-44   
gi|432857177|ref|XP_004068567.1| PREDICTED: ubiquitin carboxyl-t...   186   1e-44   
gi|498975156|ref|XP_004548556.1| PREDICTED: LOW QUALITY PROTEIN:...   185   1e-44   
gi|148692856|gb|EDL24803.1| Brca1 associated protein 1, isoform ...   185   2e-44   
gi|66361994|ref|XP_627961.1| ubiquitin C-terminal hydrolase [Cry...   185   2e-44   
gi|351696823|gb|EHA99741.1| Ubiquitin carboxyl-terminal hydrolas...   184   2e-44   
gi|410919737|ref|XP_003973340.1| PREDICTED: ubiquitin carboxyl-t...   184   2e-44   
gi|354465753|ref|XP_003495341.1| PREDICTED: ubiquitin carboxyl-t...   184   3e-44   
gi|255945147|ref|XP_002563341.1| Pc20g08180 [Penicillium chrysog...   184   3e-44   
gi|190346793|gb|EDK38966.2| hypothetical protein PGUG_03064 [Mey...   184   4e-44   
gi|443682411|gb|ELT87019.1| hypothetical protein CAPTEDRAFT_1231...   183   5e-44   
gi|465974571|gb|EMP33878.1| Ubiquitin carboxyl-terminal hydrolas...   183   7e-44   
gi|406606518|emb|CCH42095.1| hypothetical protein BN7_1637 [Wick...   182   9e-44   
gi|146418739|ref|XP_001485335.1| hypothetical protein PGUG_03064...   182   1e-43   
gi|449274932|gb|EMC83959.1| Ubiquitin carboxyl-terminal hydrolas...   182   1e-43   
gi|348588821|ref|XP_003480163.1| PREDICTED: ubiquitin carboxyl-t...   182   1e-43   
gi|241758146|ref|XP_002401745.1| ubiquitin C-terminal hydrolase,...   182   1e-43   
gi|224065984|ref|XP_002191923.1| PREDICTED: ubiquitin carboxyl-t...   182   1e-43   
gi|390362864|ref|XP_793621.3| PREDICTED: ubiquitin carboxyl-term...   182   1e-43   
gi|157822067|ref|NP_001100762.1| ubiquitin carboxyl-terminal hyd...   182   2e-43   
gi|145413805|gb|ABP68543.1| ENSANGG00000019219-like [Anopheles g...   182   2e-43   


>gi|384483302|gb|EIE75482.1| hypothetical protein RO3G_00186 [Rhizopus delemar RA 99-880]
          Length = 325

 Score =  345 bits (886), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 170/315 (53%), Positives = 222/315 (70%), Gaps = 2/315 (0%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+D G WCLIESDPGVFTELI     QG QVEE+WSLD+ T+E LKP+YGLIFLFKWQ  
Sbjct: 1   MADEGNWCLIESDPGVFTELISNMGCQGVQVEEIWSLDEGTMENLKPIYGLIFLFKWQNN 60

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
                  P+ D + D +V+FA QVI NACATQAILSILLN   ID+G EL NFK+FT  F
Sbjct: 61  KAHKEELPQIDTNAD-HVFFANQVITNACATQAILSILLNRDDIDIGQELRNFKEFTEDF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P  KGLAI+NSELIR VHNSFARSDPF  +  D  + + +D++HFI+Y P+ GAL+ELD
Sbjct: 120 PPDMKGLAISNSELIRSVHNSFARSDPFVNEIVDPDAGKDQDVYHFIAYTPIHGALFELD 179

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GLS GPVNLG C  +NW+ K    I ERM +Y ++E+ F+L+AL K++ ++Y  +I E+D
Sbjct: 180 GLSRGPVNLGSCDENNWVIKANEAIMERMKQYGASELHFSLMALTKDQIELYEEQIEELD 239

Query: 247 ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRI 306
             +   S  +   E  +L+ ER  L  ++ +EK K +R+ REN+LRKHNFI  IYN+++ 
Sbjct: 240 GLILSLSE-DLVEERNRLNHERSMLTHKLHLEKEKRQRWHRENTLRKHNFIPLIYNLLKH 298

Query: 307 LAERGELQARIEYAR 321
           LAE+ +LQ  +  A+
Sbjct: 299 LAEKDQLQPLMAKAK 313



>gi|449447631|ref|XP_004141571.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Cucumis sativus]
          Length = 334

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 230/331 (69%), Gaps = 24/331 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  ++P+YGLIFLFKW+ G+   RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLHSLNNMRPIYGLIFLFKWRPGDKDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP ID+G EL   KDFT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKDFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +PF  D+  ++SS+ +D++HFISY+P++G LYELDGL +GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEPFVPDE-QKASSKDDDVYHFISYIPIEGVLYELDGLKDGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++ GPC G +    WL+ V+PVIQER+ RY+ +EIRFNL+A+IKNR+++Y   + E+ ++
Sbjct: 179 ISHGPCPGSHGDLEWLKMVQPVIQERIERYSKSEIRFNLMAIIKNRKEMYTVELKELQKK 238

Query: 249 ----------------MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
                           + H++N   +  L +++   +   ++I ME+ K K++  EN  R
Sbjct: 239 RERILQQLAALQSETLLEHSNNEFLNKSLSEVNAGIESATEKILMEEEKLKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKE 323
           KHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|296088487|emb|CBI37478.3| unnamed protein product [Vitis vinifera]
          Length = 313

 Score =  332 bits (852), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 163/315 (51%), Positives = 222/315 (70%), Gaps = 13/315 (4%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNHLRPVYGLIFLFKWRPGEKDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSMLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYLPVDGILYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G     +W+  V+PVIQER+ RY+ +EIRFNL+A+IKNR+D+Y   + E+ +R
Sbjct: 179 ISLGQCPGGQGDLDWVRMVQPVIQERIERYSRSEIRFNLMAIIKNRKDIYTGELKELQKR 238

Query: 249 MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILA 308
             H  +     +L  L  ER    ++I ME+ KFK++  EN  RKHN+I F++N ++ILA
Sbjct: 239 REHILH-----QLAALQSERMGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILA 293

Query: 309 ERGELQARIEYARKE 323
           E+ +L+  IE A+++
Sbjct: 294 EKKQLKPLIEKAKQK 308



>gi|511007514|gb|EPB88801.1| hypothetical protein HMPREF1544_04441 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 319

 Score =  328 bits (840), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 219/328 (66%), Gaps = 19/328 (5%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+DAG WCLIESDPGVFTELI     +G QVEE+WSLD +   +L  VYGLIFLFKWQ  
Sbjct: 1   MTDAGDWCLIESDPGVFTELISNMGCKGVQVEEIWSLDPEFTADLGQVYGLIFLFKWQ-- 58

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
            +     P AD + D +V+FA QVINNACATQAILSILLN   +DLG EL NFK+FT  F
Sbjct: 59  -NKKSYAPPADENAD-HVFFANQVINNACATQAILSILLNRDDLDLGEELRNFKEFTADF 116

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P  KGLAI+NSELIR VHNSFARSDPF  +  D ++ + +D++HFI++ P+ GALYELD
Sbjct: 117 PPDMKGLAISNSELIRSVHNSFARSDPFVNEMVDPNAGKDQDVYHFIAFTPIHGALYELD 176

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GLS GPVNLGPC   NW+EK    I++RM  Y SA + F+L+ALI+++ +     I E D
Sbjct: 177 GLSRGPVNLGPCDDSNWVEKANEAIKKRMESYGSAALHFSLMALIRDKVEQMEEMIEETD 236

Query: 247 -------ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                  E    A N  N   +M      +Q+LQ+   E+ K K++ REN LRKHNFI  
Sbjct: 237 GILLSLSEEDVEARNRANQDRMM-----YEQVLQQ---EQEKRKKWHRENVLRKHNFIPI 288

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           IYN++R LAE+ +L   +  A+++   R
Sbjct: 289 IYNLLRNLAEKDQLDPLVAQAKEKAKNR 316



>gi|225431633|ref|XP_002262954.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Vitis
           vinifera]
 gi|147766506|emb|CAN60599.1| hypothetical protein VITISV_027729 [Vitis vinifera]
          Length = 334

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/331 (49%), Positives = 224/331 (67%), Gaps = 24/331 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNHLRPVYGLIFLFKWRPGEKDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSMLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYLPVDGILYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G     +W+  V+PVIQER+ RY+ +EIRFNL+A+IKNR+D+Y   + E+ +R
Sbjct: 179 ISLGQCPGGQGDLDWVRMVQPVIQERIERYSRSEIRFNLMAIIKNRKDIYTGELKELQKR 238

Query: 249 MRH-------------ASNTNNSSELMQLSEERDQL---LQRIEMEKVKFKRYERENSLR 292
             H               N+N  +    LSE    +    ++I ME+ KFK++  EN  R
Sbjct: 239 REHILHQLAALQSERMVDNSNIEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKE 323
           KHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|115449807|ref|NP_001048557.1| Os02g0822200 [Oryza sativa Japonica Group]
 gi|48716277|dbj|BAD22892.1| putative ubitquitin C-terminal hydrolase [Oryza sativa Japonica
           Group]
 gi|48716519|dbj|BAD23124.1| putative ubiquitin C-terminal hydrolase [Oryza sativa Japonica
           Group]
 gi|113538088|dbj|BAF10471.1| Os02g0822200 [Oryza sativa Japonica Group]
 gi|125541669|gb|EAY88064.1| hypothetical protein OsI_09494 [Oryza sativa Indica Group]
 gi|125584190|gb|EAZ25121.1| hypothetical protein OsJ_08921 [Oryza sativa Japonica Group]
 gi|215764980|dbj|BAG86677.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 331

 Score =  324 bits (830), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 227/323 (70%), Gaps = 16/323 (4%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  ++ EL+PVYGLIFLFKW  G    R 
Sbjct: 3   WCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSISELRPVYGLIFLFKWMAGEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  KG
Sbjct: 62  --PVVKDPNPNLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NS+ IR  HNSFAR +PF  D+  +++ + ++++HFISY+P +G LYELDGL  GP
Sbjct: 120 LAINNSDSIRTAHNSFARPEPFVSDE-QRAAGKDDEVYHFISYLPFEGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C+G     +WL  V+PVIQ+R+ RY+ +EIRFNL+A+IKNR+DVY   + E+++R
Sbjct: 179 ISLGQCSGGPDDLDWLRMVQPVIQKRIERYSQSEIRFNLMAIIKNRKDVYTAELKELEKR 238

Query: 249 -------MRHASNTNN-SSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
                  M  +S   + +SEL +++   + + ++I ME+ KFK++  EN  RKHN+I F+
Sbjct: 239 RDQLLQEMNESSAAESLNSELAEVTSAIETVSEKIIMEEEKFKKWRTENIRRKHNYIPFL 298

Query: 301 YNIIRILAERGELQARIEYARKE 323
           +N +++LAE+ +L+  +E A+++
Sbjct: 299 FNFLKMLAEKKQLKPLVEKAKQQ 321



>gi|15724238|gb|AAL06512.1|AF412059_1 F5I14.29/F5I14.29 [Arabidopsis thaliana]
          Length = 330

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/329 (48%), Positives = 223/329 (67%), Gaps = 19/329 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKWQ G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPVYGLIFLFKWQAGEKDERP 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
             +  +S   N++FA QVINNACATQAIL+ILLN P +D+G EL   K+FT+ F    KG
Sbjct: 63  TIQDQVS---NLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NS+ IR  HNSFAR +P F+ +  +++++ +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSDSIRAAHNSFARPEP-FVPEEQKAATKDDDVYHFISYIPVDGVLYELDGLKKGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGPC GD     WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+D+Y   + E+  +
Sbjct: 179 ISLGPCPGDQTGIEWLQMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQ 238

Query: 249 MRHASNTNNSSELMQLSEERDQLLQ-----------RIEMEKVKFKRYERENSLRKHNFI 297
                   N+      +E  + L+            +I ME+ KF ++  EN  RKHN+I
Sbjct: 239 REQLLQQANTCVDKSEAEAVNALIAEVGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYI 298

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSK 326
            F++N +++LAE+ +L+  IE A+K+ ++
Sbjct: 299 PFLFNFLKLLAEKKQLKPLIEKAKKQKTE 327



>gi|18408331|ref|NP_564858.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis
           thaliana]
 gi|2190550|gb|AAB60914.1| ESTs gb|T45673,gb|N37512 come from this gene [Arabidopsis thaliana]
 gi|17473568|gb|AAL38259.1| unknown protein [Arabidopsis thaliana]
 gi|21386929|gb|AAM47868.1| unknown protein [Arabidopsis thaliana]
 gi|332196286|gb|AEE34407.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis
           thaliana]
          Length = 330

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 161/329 (48%), Positives = 223/329 (67%), Gaps = 19/329 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKWQ G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPVYGLIFLFKWQAGEKDERP 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
             +  +S   N++FA QVINNACATQAIL+ILLN P +D+G EL   K+FT+ F    KG
Sbjct: 63  TIQDQVS---NLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NS+ IR  HNSFAR +P F+ +  +++++ +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSDSIRAAHNSFARPEP-FVPEEQKAATKDDDVYHFISYIPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGPC GD     WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+D+Y   + E+  +
Sbjct: 179 ISLGPCPGDQTGIEWLQMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQ 238

Query: 249 MRHASNTNNSSELMQLSEERDQLLQ-----------RIEMEKVKFKRYERENSLRKHNFI 297
                   N+      +E  + L+            +I ME+ KF ++  EN  RKHN+I
Sbjct: 239 REQLLQQANTCVDKSEAEAVNALIAEVGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYI 298

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSK 326
            F++N +++LAE+ +L+  IE A+K+ ++
Sbjct: 299 PFLFNFLKLLAEKKQLKPLIEKAKKQKTE 327



>gi|508717184|gb|EOY09081.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1
           [Theobroma cacao]
 gi|508717185|gb|EOY09082.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1
           [Theobroma cacao]
          Length = 334

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 225/333 (67%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD   +  L+PVYGLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDAVNNLRPVYGLIFLFKWRPGEKDERL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP ID+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCT---GD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID-- 246
           ++LG C    GD  W++ V+PVIQER+ RY+ +EIRFNL+A+IKNR+++Y   + E+   
Sbjct: 179 ISLGQCPTGQGDMEWMKMVQPVIQERIERYSKSEIRFNLMAVIKNRKEMYTAELKELQKK 238

Query: 247 -ERMRHASNTNNSSELM----------QLSEERDQL---LQRIEMEKVKFKRYERENSLR 292
            ER+     T  S  L           QLSE    +    ++I ME+ KFK++  EN  R
Sbjct: 239 RERILQQLATIQSDRLADRSSFEALNKQLSEVNSGIEGATEKILMEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 331



>gi|357137681|ref|XP_003570428.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Brachypodium distachyon]
          Length = 329

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 225/323 (69%), Gaps = 16/323 (4%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L EL+PVYGLIFLFKW  G    R 
Sbjct: 3   WCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSELRPVYGLIFLFKWVAGGKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P  +   + N++FA+QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  KG
Sbjct: 62  -PVVN-DPNPNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NS+ IR  HNSFAR +PF  D+  + + + +D++HFISY+P +G LYELDGL  GP
Sbjct: 120 LAINNSDSIRAAHNSFARPEPFVSDE-QKVAGKDDDVYHFISYLPFEGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG  +G      WL+ V+PVIQER+ RY+ +EIRFNL+A+IKNR+DVY   + E++++
Sbjct: 179 ISLGQYSGGPNDLGWLQMVQPVIQERIERYSQSEIRFNLMAIIKNRKDVYTAELKELEKK 238

Query: 249 MRHASNTNN--------SSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
                   N        +SEL +++   + + ++I ME+ KF +++ EN  RKHN+I F+
Sbjct: 239 REQILQEMNKTTAAESLNSELSEVASAIETVGEKIMMEEEKFMKWKTENVRRKHNYIPFL 298

Query: 301 YNIIRILAERGELQARIEYARKE 323
           +N+++ LAE+ +L+  +E AR++
Sbjct: 299 FNLLKTLAEKKQLKPLVEKARQQ 321



>gi|297841111|ref|XP_002888437.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297334278|gb|EFH64696.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 330

 Score =  323 bits (827), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 224/329 (68%), Gaps = 19/329 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKWQ G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQVGEKDDRP 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
             +  +S   N++FA QVINNACATQAIL+ILLN P +D+G EL   K+FT+ F    KG
Sbjct: 63  TIQDQVS---NLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++++ +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRAAHNSFARPEP-FVPEEQKAATKDDDVYHFISYIPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGPC GD     WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+D+Y   + E+  +
Sbjct: 179 ISLGPCPGDQTGIEWLKMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQ 238

Query: 249 MRHASNTNNSSELMQLSEERDQLLQ-----------RIEMEKVKFKRYERENSLRKHNFI 297
                   N+      +E  + L++           +I ME+ KF ++  EN  RKHN+I
Sbjct: 239 REQLLQQANTCVDKSEAEAVNALIEEVGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYI 298

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSK 326
            F++N +++LAE+ +L+  IE A+K+ ++
Sbjct: 299 PFLFNFLKLLAEKKQLKPLIEKAKKQKTE 327



>gi|356576644|ref|XP_003556440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Glycine max]
          Length = 334

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 166/333 (49%), Positives = 228/333 (68%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    R+
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDDRV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+N P ID+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  + +S+ +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKVASKDDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C+G      WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+++Y   + E+ +R
Sbjct: 179 ISLGQCSGGQGDMEWLKMVQPVIQERIERYSQSEIRFNLLAVIKNRKEMYTAELKELQKR 238

Query: 249 MRH------ASNT----NNSS------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
                    AS +    +NSS       L +++   +   ++I ME+ KFK++  EN  R
Sbjct: 239 RERILQQLAASKSDRLVDNSSFEALNNSLSEVNAGIEAATEKILMEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 331



>gi|482571250|gb|EOA35438.1| hypothetical protein CARUB_v10020640mg [Capsella rubella]
          Length = 329

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 163/328 (49%), Positives = 224/328 (68%), Gaps = 18/328 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKWQ G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEEMYSLDLDSLNNLRPVYGLIFLFKWQAGEKDDRP 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
             +  +S   N++FA QVINNACATQAIL+ILLN P +D+G EL   K+F++ F    KG
Sbjct: 63  TIQDQVS---NLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFSKNFPSDLKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +S+++ +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKSATKDDDVYHFISYIPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGPC GD     WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+D+Y   + ++  +
Sbjct: 179 ISLGPCPGDQSGIEWLQMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKDLQRQ 238

Query: 249 MRHASNTNN------SSELMQLSEER----DQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
                   N      +  L  L EE     + +  +I ME+ KF +++ EN  RKHN+I 
Sbjct: 239 REQLLQQANGMDKTEAETLNPLIEEVSIGIEAVSDKIIMEEEKFMKWKTENIRRKHNYIP 298

Query: 299 FIYNIIRILAERGELQARIEYARKEMSK 326
           F++N +++LAE+ +L+  IE A K+ ++
Sbjct: 299 FLFNFLKLLAEKKQLKPLIEKAMKQKTE 326



>gi|149058446|gb|EDM09603.1| rCG45997 [Rattus norvegicus]
          Length = 329

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 228/330 (69%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|354489912|ref|XP_003507104.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Cricetulus griseus]
 gi|344243727|gb|EGV99830.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cricetulus
           griseus]
          Length = 329

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 228/330 (69%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTELIKGFGCRGVQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|148707562|gb|EDL39509.1| ubiquitin carboxyl-terminal esterase L5, isoform CRA_b [Mus
           musculus]
          Length = 353

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 229/332 (68%), Gaps = 18/332 (5%)

Query: 5   TKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQ 64
           T  S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ
Sbjct: 25  TMSSNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQ 84

Query: 65  GGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNF 119
            G +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  F
Sbjct: 85  PGEE-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEF 139

Query: 120 KDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQ 179
           K+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV 
Sbjct: 140 KEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTPAKEEDAFHFVSYVPVN 197

Query: 180 GALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
           G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y 
Sbjct: 198 GRLYELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYE 257

Query: 240 TRIGEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
            +I E+  ++     +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN
Sbjct: 258 QKIAELQRQLAEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHN 315

Query: 296 FIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           ++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 316 YLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 347



>gi|470122784|ref|XP_004297418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Fragaria vesca subsp. vesca]
          Length = 334

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 225/331 (67%), Gaps = 24/331 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDSLNSLRPVYGLIFLFKWRPGEKDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSILLNCP +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILLNCPDVDIGPELSKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRAAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL+ V+P IQER+ RY+ +EIRFNLLA+IKNR+++Y   + E+ ++
Sbjct: 179 ISLGQCPGGQGDMEWLQMVQPAIQERIERYSKSEIRFNLLAIIKNRKEMYTVELKELQKK 238

Query: 249 ---------MRHASNTNNSSELMQLSEERDQL-------LQRIEMEKVKFKRYERENSLR 292
                    +  +   ++ S+   L++   ++        ++I +E+ KFK++  EN  R
Sbjct: 239 RERILQQLSILQSERPDDGSKFQALNKALSEVNAGIEGATEKILIEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKE 323
           KHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|229577283|ref|NP_001153338.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 2 [Mus
           musculus]
 gi|5738242|gb|AAD50311.1|AF175903_1 ubiquitin C-terminal hydrolase UCH-L5 [Mus musculus]
 gi|12857422|dbj|BAB31005.1| unnamed protein product [Mus musculus]
 gi|13905192|gb|AAH06891.1| Ubiquitin carboxyl-terminal esterase L5 [Mus musculus]
          Length = 328

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/329 (48%), Positives = 228/329 (69%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTPAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|475605408|gb|EMT26052.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aegilops
           tauschii]
          Length = 335

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 227/328 (69%), Gaps = 22/328 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQ-GGNDSSR 71
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L +L+PVYGLIFLFKW  GGND   
Sbjct: 3   WCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSQLQPVYGLIFLFKWMPGGNDERP 62

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
           +  + +     N++FA+QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  K
Sbjct: 63  VVSDPN----PNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMK 118

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           GLAI NS+ IR  HNSFAR +PF  D+  +++++ ++++HFISY+P +G LYELDGL  G
Sbjct: 119 GLAINNSDSIRAAHNSFARPEPFVSDE-QKAATKDDEVYHFISYIPFEGVLYELDGLKEG 177

Query: 192 PVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           P++LG   G      WL+ V+PVIQER+ RY+ +EIRFNL+A+IKNR+DVY   + E+++
Sbjct: 178 PISLGQYPGGPEDLGWLQMVQPVIQERIERYSQSEIRFNLMAIIKNRKDVYTAELKELEK 237

Query: 248 RMRH------------ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
           +               A     +S L +++   + + ++I ME+ KF++++ EN  RKHN
Sbjct: 238 KREQILQELSSEATAAAEKEPLNSALAEVAVAGEAVGEKIAMEEEKFRKWKTENVRRKHN 297

Query: 296 FIQFIYNIIRILAERGELQARIEYARKE 323
           +I F++N+++ LAE+ +L   +E AR++
Sbjct: 298 YIPFLFNLLKALAEKKQLTPLVEKARQQ 325



>gi|229577281|ref|NP_062508.2| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Mus
           musculus]
 gi|18203574|sp|Q9WUP7.2|UCHL5_MOUSE RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5;
           Short=UCH-L5; AltName: Full=Ubiquitin C-terminal
           hydrolase UCH37; AltName: Full=Ubiquitin thioesterase L5
 gi|12847035|dbj|BAB27412.1| unnamed protein product [Mus musculus]
 gi|148707563|gb|EDL39510.1| ubiquitin carboxyl-terminal esterase L5, isoform CRA_c [Mus
           musculus]
          Length = 329

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 228/330 (69%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTPAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|326497123|dbj|BAK02146.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 339

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 229/328 (69%), Gaps = 22/328 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQ-GGNDSSR 71
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L +L+PVYGLIFLFKW  GGND   
Sbjct: 3   WCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSQLQPVYGLIFLFKWMPGGNDERP 62

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
           +  + +     N++FA+QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  K
Sbjct: 63  VVSDPN----PNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMK 118

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           GLAI NS+ IR  HNSFAR +PF  D+  +++++ ++++HFISY+P +G LYELDGL  G
Sbjct: 119 GLAINNSDSIRAAHNSFARPEPFVSDE-QKAATKDDEVYHFISYIPFEGVLYELDGLKEG 177

Query: 192 PVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           P++LG   G      WL+ V+PVIQER+ RY+ +EIRFNL+A+IKNR+DVY   + E+++
Sbjct: 178 PISLGQYLGGPEDLGWLQMVQPVIQERIERYSQSEIRFNLMAIIKNRKDVYTAELKELEK 237

Query: 248 R----MRHASNTNNSS--------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
           +    ++  SN   ++         L +++     + ++I ME+ KF++++ EN  RKHN
Sbjct: 238 KREQILQELSNEATAAAEKESLNGALAEVASAVASVGEKIVMEEEKFRKWKTENVRRKHN 297

Query: 296 FIQFIYNIIRILAERGELQARIEYARKE 323
           +I F++N+++ LAE+ +L   +E AR++
Sbjct: 298 YIPFLFNLLKALAEKKQLTPLVEKARQQ 325



>gi|356535244|ref|XP_003536158.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Glycine max]
          Length = 334

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 165/333 (49%), Positives = 228/333 (68%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    R+
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDDRV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+N P ID+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  + ++  +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKVATRDDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C+G      WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+++Y   + E+ +R
Sbjct: 179 ISLGQCSGGQGDIEWLKIVQPVIQERIERYSQSEIRFNLLAVIKNRKELYTAELKELQKR 238

Query: 249 MRH------ASNT----NNSS------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
                    AS +    +NSS       L +++   +   ++I ME+ KFK+++ EN  R
Sbjct: 239 RERILQQLAASKSDRLVDNSSFEALNNSLSEVNAGIEAATEKILMEEEKFKKWKTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 331



>gi|462419497|gb|EMJ23760.1| hypothetical protein PRUPE_ppa008376mg [Prunus persica]
          Length = 334

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 225/332 (67%), Gaps = 26/332 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGERDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK-EDIFHFISYVPVQGALYELDGLSNG 191
           LAI NS+ IR  HNSFAR +PF  +  +Q  +EK +D++HFISY+PV G LYELDGL  G
Sbjct: 120 LAINNSDAIRAAHNSFARPEPFIPE--EQKVAEKDDDVYHFISYLPVDGVLYELDGLKEG 177

Query: 192 PVNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           P++LG C G      WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+++Y   + E+ +
Sbjct: 178 PISLGQCPGGQGDMEWLQMVQPVIQERIERYSKSEIRFNLLAIIKNRKEMYTAELKELQK 237

Query: 248 RMR---------HASNTNNSSELMQLSEERDQL-------LQRIEMEKVKFKRYERENSL 291
           +            +    +SS+   L++   ++        ++I ME+ KFK++  EN  
Sbjct: 238 KRERILQQLSALQSERPADSSKFEALNKGLSEINAGIEGATEKILMEEEKFKKWRTENIR 297

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKE 323
           RKHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 298 RKHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|502116664|ref|XP_004495540.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Cicer arietinum]
          Length = 334

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 165/333 (49%), Positives = 227/333 (68%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L  L+PVYGLIFLFKW+ G    R+
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDERV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+N P I++G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILMNSPDIEVGPELTKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL +GP
Sbjct: 120 LAINNSEAIRSAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYLPVDGVLYELDGLKDGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL+ V+PVIQER+ RY+  EIRFNLLA+IKNR++VY + + E+ +R
Sbjct: 179 ISLGQCAGGQGDMEWLKLVQPVIQERIERYSQNEIRFNLLAIIKNRKEVYTSELKELQKR 238

Query: 249 MRH------ASN----TNNSS------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
                    AS      +NSS       L +++   +   ++I ME+ KFK++  EN  R
Sbjct: 239 RERILQQLAASKAERLVDNSSFDVLNNSLSEVNAGIEAATEKILMEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 331



>gi|504132496|ref|XP_004578864.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X3 [Ochotona princeps]
          Length = 328

 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 228/328 (69%), Gaps = 18/328 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           E+  ++     +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ F
Sbjct: 237 ELQRQLAEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPF 294

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ + +
Sbjct: 295 IMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|512822432|ref|XP_004879875.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Heterocephalus glaber]
 gi|513002644|ref|XP_004862818.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Heterocephalus glaber]
          Length = 328

 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 224/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|302774527|ref|XP_002970680.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
 gi|300161391|gb|EFJ28006.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
          Length = 324

 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 224/326 (68%), Gaps = 20/326 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD + L  L+PVYGLIFLFKW+ G   +R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLEALSLLRPVYGLIFLFKWRPGEKDTR- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                +  +++++FA QVINNACATQAILSIL+N   ID+G EL   ++F + F P  KG
Sbjct: 62  ---PTVKDNKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKG 118

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           L I NSE IR  HNSFAR +PF  D+  + + + +D++HFISY+PV G LYELDGL  GP
Sbjct: 119 LTINNSEAIRTAHNSFARPEPFVPDEQ-KFADKDDDVYHFISYLPVDGVLYELDGLKEGP 177

Query: 193 VNLGPC-TGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           ++LG C +GD     WL+ V+PVIQER+ +Y+ +EIRFNL+A+IKNR+D+Y  ++ E+D 
Sbjct: 178 ISLGECGSGDADSMEWLKMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDR 237

Query: 248 RMRHASNTN----------NSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
           R    S  +           + EL Q+  E  +L ++I  E  KFK+++ EN  RKHN+I
Sbjct: 238 RKNEISGDDGMDVDSKSGSGNEELAQIDAEIARLTEKITQEDEKFKKWKTENIRRKHNYI 297

Query: 298 QFIYNIIRILAERGELQARIEYARKE 323
            F++N ++ILAE+ +L+  IE AR++
Sbjct: 298 PFLFNFLKILAEKKQLKPLIEKARQK 323



>gi|507551546|ref|XP_004659572.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Jaculus jaculus]
          Length = 328

 Score =  319 bits (817), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 227/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGSTMLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|74006052|ref|XP_536116.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Canis
           lupus familiaris]
 gi|301776030|ref|XP_002923435.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Ailuropoda melanoleuca]
 gi|344278188|ref|XP_003410878.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Loxodonta africana]
 gi|471398994|ref|XP_004382614.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Trichechus manatus latirostris]
 gi|472384045|ref|XP_004411396.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Odobenus rosmarus divergens]
 gi|478529774|ref|XP_004439055.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Ceratotherium simum simum]
 gi|512822436|ref|XP_004879876.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Heterocephalus glaber]
 gi|513002646|ref|XP_004862819.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Heterocephalus glaber]
          Length = 329

 Score =  319 bits (817), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 224/330 (67%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+     +E        NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|504132494|ref|XP_004578863.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Ochotona princeps]
          Length = 329

 Score =  319 bits (817), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 228/329 (69%), Gaps = 19/329 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           E+  ++      +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 237 ELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 294

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 295 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|507551544|ref|XP_004659571.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Jaculus jaculus]
          Length = 329

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 227/330 (68%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTMLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|507621225|ref|XP_004625354.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Octodon degus]
          Length = 326

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 223/330 (67%), Gaps = 18/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKRI 328
           FI  +++ LAE  +L   +E   K  +K +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKFEKHFAKIV 323



>gi|508717186|gb|EOY09083.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 3
           [Theobroma cacao]
          Length = 335

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 225/334 (67%), Gaps = 25/334 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEEL-KPVYGLIFLFKWQGGNDSSR 71
           WC IESDPGVFTELI+   V+G QVEE++SLD   +  L +PVYGLIFLFKW+ G    R
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDAVNNLSRPVYGLIFLFKWRPGEKDER 62

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
           L        + N++FA QVINNACATQAILSIL+NCP ID+G EL   K+FT+ F P  K
Sbjct: 63  L---VIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELK 119

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           GLAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  G
Sbjct: 120 GLAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEG 178

Query: 192 PVNLGPCT---GD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID- 246
           P++LG C    GD  W++ V+PVIQER+ RY+ +EIRFNL+A+IKNR+++Y   + E+  
Sbjct: 179 PISLGQCPTGQGDMEWMKMVQPVIQERIERYSKSEIRFNLMAVIKNRKEMYTAELKELQK 238

Query: 247 --ERMRHASNTNNSSELM----------QLSEERDQL---LQRIEMEKVKFKRYERENSL 291
             ER+     T  S  L           QLSE    +    ++I ME+ KFK++  EN  
Sbjct: 239 KRERILQQLATIQSDRLADRSSFEALNKQLSEVNSGIEGATEKILMEEEKFKKWRTENIR 298

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           RKHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 RKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 332



>gi|189069388|dbj|BAG37054.1| unnamed protein product [Homo sapiens]
          Length = 329

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 224/327 (68%), Gaps = 13/327 (3%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRL 125
           + +   P    S  + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ 
Sbjct: 63  EPA--GPVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS 120

Query: 126 FDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYEL 185
           FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LYEL
Sbjct: 121 FDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLYEL 178

Query: 186 DGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           DGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+
Sbjct: 179 DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAEL 238

Query: 246 -----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
                +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI
Sbjct: 239 QRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFI 296

Query: 301 YNIIRILAERGELQARIEYARKEMSKR 327
             +++ LAE  +L   +E A+++ + +
Sbjct: 297 MELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|460401487|ref|XP_004246255.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Solanum lycopersicum]
          Length = 334

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 224/333 (67%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTEL++   V+G QVEE++SLD   L  L+PV+GLIFLFKW+ G    RL
Sbjct: 3   WCTIESDPGVFTELMQQMQVKGVQVEELYSLDLDELNSLRPVFGLIFLFKWRPGEKDDRL 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSILLN P +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VIKDPNPNLFFASQVINNACATQAILSILLNSPDVDIGPELSALKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGPC G      WL  V+PVIQER+ RY+ +EIRFNL+A++KNR++VY   + E+ +R
Sbjct: 179 ISLGPCPGGQGDIEWLRMVQPVIQERIERYSQSEIRFNLMAVVKNRKEVYTAELKELQKR 238

Query: 249 ---------MRHASNTNNSSELMQLSEERDQLLQRIEM-------EKVKFKRYERENSLR 292
                       +    +SS++  L++   ++   IE        E+ KFK+++ EN  R
Sbjct: 239 RERILQQLAASQSERVVDSSQVESLNKSLAEVNSGIEAVSDKILREEEKFKKWKTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ +
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLRPLIEKAKQKTT 331



>gi|511855687|ref|XP_004751554.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Mustela putorius furo]
 gi|511938997|ref|XP_004788329.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Mustela putorius furo]
          Length = 328

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 227/328 (69%), Gaps = 18/328 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           E+  ++     +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ F
Sbjct: 237 ELQRQLAEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPF 294

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ + +
Sbjct: 295 IMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|348532149|ref|XP_003453569.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Oreochromis niloticus]
 gi|499033484|ref|XP_004567432.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform X2 [Maylandia zebra]
          Length = 329

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 225/328 (68%), Gaps = 19/328 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   ++++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDHIFFAKQVINNACATQAIISVLLNCSHPDMLLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERMR--HASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQAQLTEDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ S +
Sbjct: 296 IMELLKTLAEYQQLIPLVEKAKEKQSAK 323



>gi|466038827|ref|XP_004275889.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Orcinus orca]
          Length = 329

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 224/330 (67%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGDTLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+     +E        NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|4878011|gb|AAD31534.1|AF148447_1 ubiquitin C-terminal hydrolase UCH37 [Mus musculus]
          Length = 329

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 228/330 (69%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFT+LI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTKLIKRFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTPAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|168004205|ref|XP_001754802.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693906|gb|EDQ80256.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 323

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 225/326 (69%), Gaps = 21/326 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SL+ ++L +L+PVYGL+FLFKW+ G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLELESLSQLRPVYGLVFLFKWRAGEKDGR- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+N P I++G EL   K+FTR F P  KG
Sbjct: 62  --PVLKDYNPNLFFASQVINNACATQAILSILMNRPEIEVGPELSTLKEFTRGFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR  HNSFAR +PF  ++  + + + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEAIRTAHNSFARPEPFVAEE-QKVADKDDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD-----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           ++LG C G+     +WL+ V+PVIQER+ +Y+ +EIRFNL+A+IKNR+D+Y   + +++ 
Sbjct: 179 ISLGECGGEGPDSMDWLQMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDIYNEEMTQLE- 237

Query: 248 RMRHA----------SNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            MR A             +++ +   +  E  ++  +I ME  KF++++ EN  RKHN+I
Sbjct: 238 -MRRARLWDRIEKLEGKRDDTMDFADVESELAKVQDKIAMEDEKFRKWKTENIRRKHNYI 296

Query: 298 QFIYNIIRILAERGELQARIEYARKE 323
            F++N ++ILAE+ +L+  IE AR++
Sbjct: 297 PFLFNFLKILAEKKQLRPLIEKARQK 322



>gi|508717187|gb|EOY09084.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 4
           [Theobroma cacao]
          Length = 335

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 225/334 (67%), Gaps = 25/334 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQV-EEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           WC IESDPGVFTELI+   V+G QV EE++SLD   +  L+PVYGLIFLFKW+ G    R
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVVEELYSLDLDAVNNLRPVYGLIFLFKWRPGEKDER 62

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
           L        + N++FA QVINNACATQAILSIL+NCP ID+G EL   K+FT+ F P  K
Sbjct: 63  L---VIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELK 119

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           GLAI NSE IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  G
Sbjct: 120 GLAINNSEAIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEG 178

Query: 192 PVNLGPCT---GD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID- 246
           P++LG C    GD  W++ V+PVIQER+ RY+ +EIRFNL+A+IKNR+++Y   + E+  
Sbjct: 179 PISLGQCPTGQGDMEWMKMVQPVIQERIERYSKSEIRFNLMAVIKNRKEMYTAELKELQK 238

Query: 247 --ERMRHASNTNNSSELM----------QLSEERDQL---LQRIEMEKVKFKRYERENSL 291
             ER+     T  S  L           QLSE    +    ++I ME+ KFK++  EN  
Sbjct: 239 KRERILQQLATIQSDRLADRSSFEALNKQLSEVNSGIEGATEKILMEEEKFKKWRTENIR 298

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           RKHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 RKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 332



>gi|301619448|ref|XP_002939132.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Xenopus (Silurana) tropicalis]
          Length = 329

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 226/337 (67%), Gaps = 22/337 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+L+PV GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+SILLN    D  LG  L  FK+FT+
Sbjct: 64  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +S+++ +D FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSTTKDDDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL +GP++LGPC  D W+   RPVI++RM +Y   EIRFNL+A++ +R+ +Y  +I +
Sbjct: 178 LDGLRDGPIDLGPCKEDEWISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKITD 237

Query: 245 IDERM--RHASNTNNSSEL---MQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  R+      +T+  S L   MQ    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQRRLAEEEPMDTDQGSTLMSSMQSEIAKYQLL--IEEENQKIKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           I  +++ LAE  +L   +E A+++ + R   RA++ K
Sbjct: 296 IMELLKTLAEHQQLIPLVEKAKEKHNTR---RAQEAK 329



>gi|148237776|ref|NP_001089066.1| ubiquitin carboxyl-terminal hydrolase L5 [Xenopus laevis]
 gi|115292033|gb|AAI22496.1| LOC733154 protein [Xenopus laevis]
          Length = 329

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/337 (48%), Positives = 227/337 (67%), Gaps = 22/337 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +   +L+PV GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFVDLQPVQGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+SILLN     + LG  L  FK+FT+
Sbjct: 64  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHNDVHLGETLSEFKEFTQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +S+++ +D FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSTTKDDDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL +GP++LGPC  D+W+   RPVI++RM +Y   EIRFNL+A++ +R+ +Y  +I +
Sbjct: 178 LDGLKDGPIDLGPCKEDDWISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKIAD 237

Query: 245 IDERM--RHASNTNNSSEL---MQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  R+      +T+  S L   MQ    + QLL  IE EK K KRY+ EN  RKHN++ F
Sbjct: 238 LQRRIAEEEPMDTDQGSTLLSSMQSEIAKYQLL--IEEEKQKMKRYKVENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           I  +++ LAE  +L   +E A+++ + R   RA++ K
Sbjct: 296 IMELLKTLAEHQQLIPLVEKAKEKHNTR---RAQEAK 329



>gi|178056486|ref|NP_001116682.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Sus scrofa]
 gi|291402726|ref|XP_002717737.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase L5 [Oryctolagus
           cuniculus]
 gi|511855683|ref|XP_004751553.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Mustela putorius furo]
 gi|511938995|ref|XP_004788328.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Mustela putorius furo]
 gi|122131872|sp|Q06AT3.1|UCHL5_PIG RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5;
           Short=UCH-L5; AltName: Full=Ubiquitin thioesterase L5
 gi|115394786|gb|ABI97187.1| UCHL5 [Sus scrofa]
          Length = 329

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 227/329 (68%), Gaps = 19/329 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           E+  ++      +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 237 ELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 294

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 295 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|488598800|ref|XP_004484543.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           2 [Dasypus novemcinctus]
          Length = 328

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 224/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGVCHQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|488598798|ref|XP_004484542.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Dasypus novemcinctus]
          Length = 329

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 224/330 (67%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGVCHQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+     +E        NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|58865870|ref|NP_001012149.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Rattus
           norvegicus]
 gi|57032796|gb|AAH88841.1| Ubiquitin carboxyl-terminal hydrolase L5 [Rattus norvegicus]
          Length = 324

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 222/321 (69%), Gaps = 19/321 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S+AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   SNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTVLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIE 318
            FI  +++ LAE  +L   +E
Sbjct: 294 PFIMELLKTLAEHQQLIPLVE 314



>gi|472384047|ref|XP_004411397.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           2 [Odobenus rosmarus divergens]
          Length = 326

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 220/328 (67%), Gaps = 18/328 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSK 326
           FI  +++ LAE  +L   +E   K   K
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKVSKHFEK 321



>gi|126306373|ref|XP_001367376.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Monodelphis domestica]
          Length = 329

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 226/328 (68%), Gaps = 19/328 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++
Sbjct: 64  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVSGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  ++W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGACNQEDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAE 237

Query: 245 IDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ S+ ++   Q    + Q+L  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQRQLAEEEPMDTDQSTNMLSTIQSEVAKHQML--IEEEIQKLKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ + +
Sbjct: 296 IMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|312922359|ref|NP_001186190.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 2 [Homo
           sapiens]
 gi|15930175|gb|AAH15521.1| Ubiquitin carboxyl-terminal hydrolase L5 [Homo sapiens]
 gi|30582419|gb|AAP35436.1| ubiquitin carboxyl-terminal hydrolase L5 [Homo sapiens]
 gi|61360019|gb|AAX41799.1| ubiquitin carboxyl-terminal hydrolase L5 [synthetic construct]
 gi|119611642|gb|EAW91236.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_d [Homo
           sapiens]
 gi|261861264|dbj|BAI47154.1| ubiquitin carboxyl-terminal hydrolase L5 [synthetic construct]
 gi|325464211|gb|ADZ15876.1| ubiquitin carboxyl-terminal hydrolase L5 [synthetic construct]
          Length = 328

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 224/328 (68%), Gaps = 18/328 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ F
Sbjct: 237 ELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPF 294

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ + +
Sbjct: 295 IMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|507956157|ref|XP_004685519.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Condylura cristata]
 gi|18203607|sp|Q9XSJ0.1|UCHL5_BOVIN RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5;
           Short=UCH-L5; AltName: Full=Ubiquitin C-terminal
           hydrolase UCH37; AltName: Full=Ubiquitin thioesterase L5
 gi|4878009|gb|AAD31533.1|AF148446_1 ubiquitin C-terminal hydrolase UCH37 [Bos taurus]
 gi|296479340|tpg|DAA21455.1| TPA: ubiquitin carboxyl-terminal hydrolase L5 [Bos taurus]
          Length = 328

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 227/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|30584639|gb|AAP36572.1| Homo sapiens ubiquitin carboxyl-terminal hydrolase L5 [synthetic
           construct]
 gi|61369961|gb|AAX43419.1| ubiquitin carboxyl-terminal hydrolase L5 [synthetic construct]
          Length = 329

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 224/328 (68%), Gaps = 18/328 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ F
Sbjct: 237 ELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPF 294

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ + +
Sbjct: 295 IMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|76253713|ref|NP_776906.2| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Bos taurus]
 gi|75773502|gb|AAI05167.1| Ubiquitin carboxyl-terminal hydrolase L5 [Bos taurus]
          Length = 328

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 227/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHKQLIPLVEKAKEKQNAK 322



>gi|395824824|ref|XP_003785652.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Otolemur garnettii]
          Length = 329

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 225/329 (68%), Gaps = 19/329 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EIDERMRH-----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           E+ +++           N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 237 ELQKQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 294

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 295 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|507662954|ref|XP_004706712.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Echinops telfairi]
          Length = 328

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 228/329 (69%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           ++AG+WCL+ESDPGVFTELI+ F  +GTQVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   ANAGEWCLMESDPGVFTELIKGFGCRGTQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTPAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  + ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGTNMLTAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|505853079|ref|XP_004619973.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X2 [Sorex araneus]
          Length = 328

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 224/329 (68%), Gaps = 18/329 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTTAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWIGAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|507956154|ref|XP_004685518.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Condylura cristata]
          Length = 329

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 227/330 (68%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|505853077|ref|XP_004619972.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Sorex araneus]
          Length = 329

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 224/330 (67%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTTAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWIGAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+     +E        NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|7706753|ref|NP_057068.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Homo
           sapiens]
 gi|108936023|sp|Q9Y5K5.3|UCHL5_HUMAN RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5;
           Short=UCH-L5; AltName: Full=Ubiquitin C-terminal
           hydrolase UCH37; AltName: Full=Ubiquitin thioesterase L5
 gi|4877999|gb|AAD31528.1|AF147717_1 ubiquitin C-terminal hydrolase UCH37 [Homo sapiens]
          Length = 329

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 224/329 (68%), Gaps = 19/329 (5%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIA 236

Query: 244 EI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           E+     +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 237 ELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 294

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKR 327
           FI  +++ LAE  +L   +E A+++ + +
Sbjct: 295 FIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|507662950|ref|XP_004706711.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Echinops telfairi]
          Length = 329

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 228/330 (69%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           ++AG+WCL+ESDPGVFTELI+ F  +GTQVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   ANAGEWCLMESDPGVFTELIKGFGCRGTQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++ +++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTPAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  + ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGTNMLTAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|470326143|ref|XP_004364624.1| UCH2 [Capsaspora owczarzaki ATCC 30864]
 gi|320166813|gb|EFW43712.1| UCH2 [Capsaspora owczarzaki ATCC 30864]
          Length = 324

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 223/329 (67%), Gaps = 9/329 (2%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR+  VQG QVEE++SLD+ +L  L+PV+GLIFLFKWQ     
Sbjct: 3   AGNWCLIESDPGVFTELIRSIGVQGVQVEELYSLDEGSLSVLQPVHGLIFLFKWQKDLQE 62

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPY 129
            +    A      +V+FA QVINNACATQAILSILLN P ++LG EL NFK FT+ F P 
Sbjct: 63  RKTAENAS-----SVFFANQVINNACATQAILSILLNTPELNLGEELTNFKAFTQDFTPE 117

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
            +GLAI+NSE IR VHNSFAR + F ++  ++++++ +D+FHF++Y+   G L+ELDGL 
Sbjct: 118 LRGLAISNSEKIRTVHNSFARPETFSIE--EKNATDDDDVFHFVAYIHKDGRLWELDGLQ 175

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER- 248
            GP+NLG  + D+WL +  P+IQ R+ RY+S EIRFNL+A++ ++   Y   +  +DE+ 
Sbjct: 176 EGPINLGEASADDWLFRAAPIIQARIERYSSTEIRFNLMAVVADKTVQYTQELAAVDEQR 235

Query: 249 -MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRIL 307
            M  + +   S +L  L     +L   +  E+ K +RY  EN  R+HNF+ FI  ++R+L
Sbjct: 236 AMLMSQSDQVSGDLAALDARSSELQMLLATEQEKNERYRTENIRRRHNFVPFIVKLLRLL 295

Query: 308 AERGELQARIEYARKEMSKRIKDRAEKKK 336
           AE+ +LQ  I  A++ ++ + K  AE +K
Sbjct: 296 AEKHQLQPLIAKAKETVAAKNKANAESRK 324



>gi|225706202|gb|ACO08947.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Osmerus mordax]
          Length = 329

 Score =  317 bits (812), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 226/334 (67%), Gaps = 19/334 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   +N++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F+ 
Sbjct: 64  ----PAGSIVQDSRLDNIFFAKQVINNACATQAIVSVLLNCTHPDMLLGETLTEFREFSL 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGVCNQDDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKITE 237

Query: 245 IDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS L+   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQTQLTEEEPMDTDQSSTLLSSIQSEIAKYQLL--IEEENQKLKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAE 333
           I  +++ LA+  +L   +E A+++   +    A+
Sbjct: 296 IMELLKTLAQYQQLIPLVEKAKEKQGAKKAQEAK 329



>gi|397499842|ref|XP_003820644.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Pan paniscus]
 gi|119611639|gb|EAW91233.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_a [Homo
           sapiens]
          Length = 396

 Score =  317 bits (811), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 225/336 (66%), Gaps = 19/336 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           +Y  +I E+     +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  
Sbjct: 297 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIR 354

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 355 RKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 390



>gi|507551550|ref|XP_004659574.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X4 [Jaculus jaculus]
          Length = 326

 Score =  317 bits (811), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 224/330 (67%), Gaps = 18/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEQKI 235

Query: 243 GEIDERM-RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++     +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGSTMLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKRI 328
           FI  +++ LAE  +L   +E   K   K +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKFEKYFEKTL 323



>gi|327280238|ref|XP_003224859.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Anolis carolinensis]
          Length = 331

 Score =  316 bits (810), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 224/326 (68%), Gaps = 15/326 (4%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G + 
Sbjct: 7   AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE- 65

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F++
Sbjct: 66  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFREFSQ 121

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +S++++ED FHF+SYVPV G LYE
Sbjct: 122 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSTAKEEDAFHFVSYVPVNGRLYE 179

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 180 LDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIVE 239

Query: 245 IDERM--RHASNTNNSSELM-QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           +  ++      +T+ SS ++  +  E  +    IE E  K KRY+ EN  RKHN++ FI 
Sbjct: 240 LQAQLAEEEPMDTDQSSNILSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIM 299

Query: 302 NIIRILAERGELQARIEYARKEMSKR 327
            +++ LAE  +L   +E A+++ + +
Sbjct: 300 ELLKTLAEHQQLIPLVEKAKEKQNAK 325



>gi|58177865|gb|AAH89167.1| LOC733154 protein [Xenopus laevis]
          Length = 325

 Score =  316 bits (810), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/337 (48%), Positives = 227/337 (67%), Gaps = 22/337 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +   +L+PV GLIFLFKWQ G + 
Sbjct: 1   AGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFVDLQPVQGLIFLFKWQPGEE- 59

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+SILLN     + LG  L  FK+FT+
Sbjct: 60  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHNDVHLGETLSEFKEFTQ 115

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +S+++ +D FHF+SYVPV G LYE
Sbjct: 116 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSTTKDDDAFHFVSYVPVNGRLYE 173

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL +GP++LGPC  ++W+   RPVI++RM +Y   EIRFNL+A++ +R+ +Y  +I +
Sbjct: 174 LDGLKDGPIDLGPCKEEDWISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKIAD 233

Query: 245 IDERM--RHASNTNNSSEL---MQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  R+      +T+  S L   MQ    + QLL  IE EK K KRY+ EN  RKHN++ F
Sbjct: 234 LQRRIAEEEPMDTDQGSTLLSSMQSEIAKYQLL--IEEEKQKMKRYKVENIRRKHNYLPF 291

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           I  +++ LAE  +L   +E A+++ + R   RA++ K
Sbjct: 292 IMELLKTLAEHQQLIPLVEKAKEKHNTR---RAQEAK 325



>gi|297281204|ref|XP_001112706.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Macaca mulatta]
          Length = 396

 Score =  316 bits (810), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 225/336 (66%), Gaps = 19/336 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEIDERMRH-----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           +Y  +I E+  ++           N+    +Q    ++Q+L  IE E  K KRY+ EN  
Sbjct: 297 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIR 354

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 355 RKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 390



>gi|402857781|ref|XP_003893420.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Papio
           anubis]
          Length = 396

 Score =  316 bits (809), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 225/336 (66%), Gaps = 19/336 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           +Y  +I E+     +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  
Sbjct: 297 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIR 354

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 355 RKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 390



>gi|47085817|ref|NP_998249.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Danio rerio]
 gi|45709482|gb|AAH67545.1| Ubiquitin carboxyl-terminal hydrolase L5 [Danio rerio]
          Length = 329

 Score =  316 bits (809), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 224/332 (67%), Gaps = 20/332 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC  P + LG  L  FK+F+ 
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSN 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHN FAR   F  D   +S++++ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDA--KSTAKEEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKIVE 237

Query: 245 I-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +     +E       + N    +Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQAQLTEEEPMDTDQSGNHLSSIQSEIAKYQLL--IEEENQKLKRYKVENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYAR-KEMSKRIKD 330
           I  +++ LAE  +L   +E A+ K+ +K+I++
Sbjct: 296 IMELLKTLAEYQQLIPLVEKAKEKQSAKKIQE 327



>gi|312922361|ref|NP_001186191.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 3 [Homo
           sapiens]
 gi|19263475|gb|AAH25369.1| UCHL5 protein [Homo sapiens]
 gi|119611643|gb|EAW91237.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_e [Homo
           sapiens]
          Length = 326

 Score =  315 bits (808), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 221/330 (66%), Gaps = 18/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKRI 328
           FI  +++ LAE  +L   +E   K   K +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKFEKHFEKTL 323



>gi|471398997|ref|XP_004382615.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           2 [Trichechus manatus latirostris]
          Length = 315

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 218/320 (68%), Gaps = 18/320 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIE 318
           FI  +++ LAE  +L   +E
Sbjct: 294 FIMELLKTLAEHQQLIPLVE 313



>gi|209730448|gb|ACI66093.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Salmo salar]
          Length = 356

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 225/328 (68%), Gaps = 19/328 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   +N++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F+ 
Sbjct: 64  ----PGGSIVQDSRLDNIFFAKQVINNACATQAIVSVLLNCTHSDMLLGETLTEFREFSL 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y+ +I E
Sbjct: 178 LDGLREGPIDLGVCNQDDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYKRKIAE 237

Query: 245 IDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS L+   Q    + QLL  I+ E  K +RY+ EN  RKHN++ F
Sbjct: 238 LQIQLTEEEPMDTDQSSTLLSSIQSEIAKYQLL--IDEENQKLQRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ S +
Sbjct: 296 IMELLKTLAEYQQLIPLVEKAKEKQSAK 323



>gi|390477217|ref|XP_002760499.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Callithrix jacchus]
          Length = 467

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 225/336 (66%), Gaps = 19/336 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 135 VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 194

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           +WQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 195 QWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 249

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 250 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 307

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 308 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 367

Query: 237 VYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           +Y  +I E+     +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  
Sbjct: 368 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIR 425

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 426 RKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 461



>gi|255918047|pdb|3IHR|A Chain A, Crystal Structure Of Uch37
          Length = 328

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 219/326 (67%), Gaps = 14/326 (4%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLXESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAXKGLALSNSDVIRQVHNSFARQQXFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL A++ +R+ +Y  +I 
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLXAIVSDRKXIYEQKIA 236

Query: 244 EIDERMRH--ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           E+  ++          +S L  +  E  +    IE E  K KRY+ EN  RKHN++ FI 
Sbjct: 237 ELQRQLAEEPXDTDQGNSXLSAIQSEVAKNQXLIEEEVQKLKRYKIENIRRKHNYLPFIX 296

Query: 302 NIIRILAERGELQARIEYARKEMSKR 327
            +++ LAE  +L   +E A+++ + +
Sbjct: 297 ELLKTLAEHQQLIPLVEKAKEKQNAK 322



>gi|397499846|ref|XP_003820646.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           3 [Pan paniscus]
          Length = 393

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 222/336 (66%), Gaps = 18/336 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
           +Y  +I E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  R
Sbjct: 297 IYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRR 354

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMSKRI 328
           KHN++ FI  +++ LAE  +L   +E   K   K +
Sbjct: 355 KHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTL 390



>gi|504132492|ref|XP_004578862.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X1 [Ochotona princeps]
          Length = 331

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/321 (48%), Positives = 222/321 (69%), Gaps = 19/321 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIE 318
            FI  +++ LAE  +L   +E
Sbjct: 294 PFIMELLKTLAEHQQLIPLVE 314



>gi|410921990|ref|XP_003974466.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Takifugu rubripes]
          Length = 329

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 222/328 (67%), Gaps = 19/328 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  + LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFDNLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC    + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIVSVLLNCFHSDMSLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHN FAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERMRH--ASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQTQLTQDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKVENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ S +
Sbjct: 296 IMELLKTLAEHQQLMPLVEKAKEKQSAK 323



>gi|116787498|gb|ABK24529.1| unknown [Picea sitchensis]
 gi|116787872|gb|ABK24676.1| unknown [Picea sitchensis]
 gi|224284295|gb|ACN39883.1| unknown [Picea sitchensis]
          Length = 340

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/341 (48%), Positives = 222/341 (65%), Gaps = 38/341 (11%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG--NDSS 70
           WC IESDPGVFTELI+   V+G QVEE++SLD ++L  L PVYGLIFLFKW+ G  +D S
Sbjct: 3   WCTIESDPGVFTELIQQMQVRGVQVEELYSLDLESLNNLCPVYGLIFLFKWRPGEKDDRS 62

Query: 71  RLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYD 130
            L          N++FA QVINNACATQAILSIL+NC  ID+G EL N K+FT+ F P  
Sbjct: 63  VLK-----EYSPNLFFASQVINNACATQAILSILMNCSEIDIGPELSNLKEFTKNFPPEL 117

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           KGLAI NSE IR  HNSFAR +PF  D+   +  E +D++HFISY+PV G LYELDGL  
Sbjct: 118 KGLAINNSEAIRAAHNSFARPEPFVSDEQKVADKE-DDVYHFISYIPVDGTLYELDGLKE 176

Query: 191 GPVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GP++LG   G      WL+ V+PVIQER+ +Y+ +EIRFNL+A+IKNR D+Y+    +++
Sbjct: 177 GPISLGQYNGSRESLEWLKLVQPVIQERIEKYSKSEIRFNLMAIIKNRLDIYKAEQRDLE 236

Query: 247 ERMRH------ASNTNN--------------------SSELMQLSEERDQLLQRIEMEKV 280
            R +       AS  N                     +  L+++  E   + Q++ +EK 
Sbjct: 237 NRKKQIQQQLDASKCNGDDRMDVDNGSGRQSASVEGLNRSLVEIDFELANVEQKLSIEKD 296

Query: 281 KFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
           KFK+++ EN  RKHN+I F++N ++ILAE+ +L+  IE AR
Sbjct: 297 KFKKWKTENIRRKHNYIPFLFNFLKILAEKDQLKPLIEKAR 337



>gi|222093470|gb|ACM43511.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Scylla
           paramamosain]
          Length = 337

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 225/342 (65%), Gaps = 18/342 (5%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           +SDAG WCLIESDPGVFT+L++ F V+G QVEE+WSLD+++   LKPV+GLIFLFKWQ  
Sbjct: 3   VSDAGNWCLIESDPGVFTDLVQKFGVKGVQVEEIWSLDEESFSSLKPVHGLIFLFKWQ-- 60

Query: 67  NDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKD 121
                  P   +  D   + ++FAKQ+INNACATQAILS+LLN     I LG+ L  F++
Sbjct: 61  ---QEEQPSGSVVQDNRLDKIFFAKQMINNACATQAILSVLLNTKHQDIQLGSTLSEFRE 117

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGA 181
           FT+ FD + KGLA++NS+ IR VHNSFAR   F  D+  Q  SE ED+FHF+ Y+P++G 
Sbjct: 118 FTQTFDAHMKGLALSNSDTIRNVHNSFARQTLFEFDK--QQPSEDEDVFHFVGYIPIEGR 175

Query: 182 LYELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRT 240
           LYELDGL +GP++LGP + + +WL  V+PVIQ R+ +Y+  EI FNL+A++ +R+ V   
Sbjct: 176 LYELDGLKDGPIDLGPISPNTDWLSVVQPVIQRRIQKYSEGEIHFNLMAIVSDRKMVIEK 235

Query: 241 RIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
           +I ++ + M  +    +S E     EE  QL   +E E+ K  R+  EN  RKHN++  I
Sbjct: 236 KIAQLQKEMEESGMDTSSHE-----EELAQLRASLETEENKRARWRVENIRRKHNYLPLI 290

Query: 301 YNIIRILAERGELQARIEYARKEMSKRIKDRAEKKKGESGSK 342
            N+++ILAE G+L      AR++   R K +    K +  +K
Sbjct: 291 VNMMKILAEEGKLLPIYHTAREKAKAREKAKVRHDKAKDKNK 332



>gi|507551548|ref|XP_004659573.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           X3 [Jaculus jaculus]
          Length = 324

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 221/321 (68%), Gaps = 19/321 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSTMLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIE 318
            FI  +++ LAE  +L   +E
Sbjct: 294 PFIMELLKTLAEHQQLIPLVE 314



>gi|119611640|gb|EAW91234.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_b [Homo
           sapiens]
          Length = 394

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 222/337 (65%), Gaps = 19/337 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           +Y  +I E+     +E        N+    +Q    ++Q+L  IE E  K KRY+ EN  
Sbjct: 297 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIR 354

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMSKRI 328
           RKHN++ FI  +++ LAE  +L   +E   K   K +
Sbjct: 355 RKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTL 391



>gi|47217741|emb|CAG03693.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 330

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 225/337 (66%), Gaps = 21/337 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  + LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFDNLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIVSVLLNCSHSDMSLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHN FAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERMRH--ASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQTQLTQDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKVENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           I  +++ LAE  +L   +E   KE  K+   +A++ K
Sbjct: 296 IMELLKTLAEHQQLMPLVEKVAKE--KQSAKKAQEAK 330



>gi|312922364|ref|NP_001186192.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 4 [Homo
           sapiens]
          Length = 316

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 219/323 (67%), Gaps = 18/323 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYAR 321
           FI  +++ LAE  +L   +E  +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKGK 316



>gi|397499844|ref|XP_003820645.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           2 [Pan paniscus]
 gi|119611644|gb|EAW91238.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_f [Homo
           sapiens]
          Length = 383

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 220/329 (66%), Gaps = 18/329 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
           +Y  +I E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  R
Sbjct: 297 IYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRR 354

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYAR 321
           KHN++ FI  +++ LAE  +L   +E  +
Sbjct: 355 KHNYLPFIMELLKTLAEHQQLIPLVEKGK 383



>gi|7688691|gb|AAF67486.1|AF157320_1 AD-019 protein [Homo sapiens]
          Length = 316

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 218/323 (67%), Gaps = 18/323 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W   VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWFSAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYAR 321
           FI  +++ LAE  +L   +E  +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKGK 316



>gi|297281206|ref|XP_001112676.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Macaca mulatta]
          Length = 383

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 220/329 (66%), Gaps = 18/329 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 237 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 296

Query: 237 VYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
           +Y  +I E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  R
Sbjct: 297 IYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRR 354

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYAR 321
           KHN++ FI  +++ LAE  +L   +E  +
Sbjct: 355 KHNYLPFIMELLKTLAEHQQLIPLVEKGK 383



>gi|426239451|ref|XP_004013634.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Ovis
           aries]
          Length = 329

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 226/330 (68%), Gaps = 19/330 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AGQ CL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGQRCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+  ++      +T+  S ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 236 AELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 293

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 294 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323



>gi|405957412|gb|EKC23624.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Crassostrea
           gigas]
          Length = 318

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 215/312 (68%), Gaps = 22/312 (7%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           + AG WCLIESDPGVFTELIR F  +G QVEE+WSLD  + E LKPVYGLIFLFKWQ  +
Sbjct: 3   TSAGDWCLIESDPGVFTELIRGFGCEGLQVEELWSLDSTSFENLKPVYGLIFLFKWQPES 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     PE  +  D   E ++FAKQVINNACATQAILS+LLNCP  D  +G  L  FK+F
Sbjct: 63  E-----PEGTIVQDSRIEKIFFAKQVINNACATQAILSVLLNCPESDVKVGPTLAQFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            + FDP  +GL ++NS+ IR VHNSF+R   F  D+  +++ + +D+FHF+SY+P+ G L
Sbjct: 118 AQAFDPALRGLTLSNSDTIREVHNSFSRQQMFEFDE--KAAKKDDDVFHFVSYLPIDGRL 175

Query: 183 YELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL  GPV+LG    D +WL+ VRPV+++RM +Y++ EI FNL+A++ +R+ +Y+ R
Sbjct: 176 YELDGLKEGPVDLGAIPSDTDWLDVVRPVLEKRMQKYSTDEIHFNLMAIVSDRKAMYQKR 235

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           + E+  R           E+ +   E  QL+ +I+ E  K KRY+ EN  RKHN++ FI 
Sbjct: 236 LQELQSR---------GMEVEEDQLEMSQLMVKIQEEDAKMKRYKVENVRRKHNYLPFIM 286

Query: 302 NIIRILAERGEL 313
            +++ILAE+ +L
Sbjct: 287 ELLKILAEQKQL 298



>gi|387915894|gb|AFK11556.1| ubiquitin carboxyl-terminal hydrolase isozyme L5-like protein
           [Callorhinchus milii]
          Length = 329

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 224/334 (67%), Gaps = 15/334 (4%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  ++LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCKGVQVEEIWSLEPEHFDKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
           +     P   +  D   E ++FAKQVINNACATQAI+S+LLNC    I+LG  L  FK+F
Sbjct: 63  E-----PAGSIVQDSRLEKIFFAKQVINNACATQAIISVLLNCNHSDIELGETLGEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NSE+IR VHN FAR   F  D   +++ ++ED FHF+SY PV G L
Sbjct: 118 SQSFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDA--KTAGKEEDAFHFVSYFPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YE DGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I
Sbjct: 176 YEHDGLREGPIDLGTCNQDDWVSAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEKKI 235

Query: 243 GEIDERM--RHASNTNNSSELM-QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            E+  ++      +T+ SS L+  +  E  +    IE E  K KRY+ EN  RKHN++ F
Sbjct: 236 TELQRQLTEEEPMDTDQSSSLINSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAE 333
           I  +++ LAE  +L   +E A+++ + +    A+
Sbjct: 296 IMELLKTLAEHQQLIPLVEKAKEKQNAKKAQEAK 329



>gi|499033482|ref|XP_004567431.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform X1 [Maylandia zebra]
          Length = 366

 Score =  313 bits (802), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 159/319 (49%), Positives = 219/319 (68%), Gaps = 19/319 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   ++++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDHIFFAKQVINNACATQAIISVLLNCSHPDMLLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERMR--HASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 238 LQAQLTEDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIE 318
           I  +++ LAE  +L   +E
Sbjct: 296 IMELLKTLAEYQQLIPLVE 314



>gi|318054568|ref|NP_001187184.1| ubiquitin carboxy-terminal hydrolase L5 [Ictalurus punctatus]
 gi|209168633|gb|ACI42313.1| ubiquitin carboxy-terminal hydrolase L5 [Ictalurus punctatus]
          Length = 329

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 227/332 (68%), Gaps = 20/332 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  + L+PV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFQNLEPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIVSVLLNCSHPDMHLGETLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   + S++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQRMFEFDA--KPSAKDEDAFHFVSYVPVNGGLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  ++W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGTCNQEDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +   +      +T+ S+ L+   Q    + QLL  I+ E  K K+Y+ EN  RKHN++ F
Sbjct: 238 LQAHLTEEEPMDTDQSTNLLSSIQSEIAKYQLL--IDEENQKLKKYKIENIRRKHNYLPF 295

Query: 300 IYNIIRILAERGELQARIEYAR-KEMSKRIKD 330
           I  +++ LAE  +L   +E A+ K+ +K+I++
Sbjct: 296 IMELLKTLAEYQQLMPLVEKAKEKQSAKKIQE 327



>gi|410034215|ref|XP_514069.4| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           4 [Pan troglodytes]
          Length = 523

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 220/329 (66%), Gaps = 18/329 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 204 VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 263

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 264 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 318

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 319 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 376

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 377 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 436

Query: 237 VYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
           +Y  +I E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  R
Sbjct: 437 IYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRR 494

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYAR 321
           KHN++ FI  +++ LAE  +L   +E  +
Sbjct: 495 KHNYLPFIMELLKTLAEHQQLIPLVEKGK 523



>gi|432855293|ref|XP_004068149.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Oryzias latipes]
          Length = 329

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 220/326 (67%), Gaps = 15/326 (4%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   ++++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL++++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIDLGACNQDDWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAE 237

Query: 245 IDERMRHASNTNNSSELMQLSEERDQLLQR---IEMEKVKFKRYERENSLRKHNFIQFIY 301
           +  ++      +       LS  + ++ +    IE E  K KRY+ EN  RKHN++ FI 
Sbjct: 238 LQAQLTEDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIM 297

Query: 302 NIIRILAERGELQARIEYARKEMSKR 327
            +++ LAE  +L   +E A+++ S +
Sbjct: 298 ELLKTLAEYQQLMPLVEKAKEKQSAK 323



>gi|255556663|ref|XP_002519365.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus
           communis]
 gi|223541432|gb|EEF42982.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus
           communis]
          Length = 335

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/331 (49%), Positives = 228/331 (68%), Gaps = 24/331 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+  +V+G QVEE++SLD  +L+ L+P+YGLIFLFKW  G    R 
Sbjct: 3   WCTIESDPGVFTELIQHMHVKGVQVEELYSLDLDSLDSLRPIYGLIFLFKWHPGEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVINNACATQAILSIL+NCP I++G EL   K+FT+ F P  KG
Sbjct: 62  --PVMKDPNPNLFFASQVINNACATQAILSILMNCPDIEIGDELTKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE+IR  HNSFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNSEVIRTAHNSFARPEP-FVPEEQKAAGKDDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LGP TG     +WL  V+PVIQER+ RY++ EIRFNL+A+IKNR +VY   + E+  R
Sbjct: 179 ISLGPYTGGPNDLDWLRMVQPVIQERIERYSNNEIRFNLMAVIKNRREVYTAELKELQRR 238

Query: 249 MRH------ASNTN---NSSELMQLSEERDQL-------LQRIEMEKVKFKRYERENSLR 292
                    AS ++   +SS   QLS+   ++        ++I ME+ KFK++  EN  R
Sbjct: 239 RERILQQLAASQSDRLVDSSTSEQLSKSLSEVNSGIEAATEKILMEEEKFKKWRTENVRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKE 323
           KHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|441624414|ref|XP_003264537.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform
           1 [Nomascus leucogenys]
          Length = 538

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 219/329 (66%), Gaps = 18/329 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 219 VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 278

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 279 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 333

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS+ IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 334 SEFKEFSQSFDAAMKGLALSNSDSIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 391

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 392 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 451

Query: 237 VYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLR 292
           +Y  +I E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  R
Sbjct: 452 IYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRR 509

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYAR 321
           KHN++ FI  +++ LAE  +L   +E  +
Sbjct: 510 KHNYLPFIMELLKTLAEHQQLIPLVEKGK 538



>gi|4929609|gb|AAD34065.1|AF151828_1 CGI-70 protein [Homo sapiens]
          Length = 316

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 217/323 (67%), Gaps = 18/323 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +A +WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAVEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W   VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLGACNQDDWFSAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 235

Query: 243 GEIDERMRH----ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            E+  ++          N+    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ 
Sbjct: 236 AELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLP 293

Query: 299 FIYNIIRILAERGELQARIEYAR 321
           FI  +++ LAE  +L   +E  +
Sbjct: 294 FIMELLKTLAEHQQLIPLVEKGK 316



>gi|224080017|ref|XP_002305992.1| predicted protein [Populus trichocarpa]
 gi|222848956|gb|EEE86503.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 228/333 (68%), Gaps = 24/333 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+  +V+G QVEE++SLD  +L+ L+PVYGL+FLFKW+      R+
Sbjct: 3   WCTIESDPGVFTELIQQMHVKGVQVEELYSLDLDSLDSLRPVYGLVFLFKWRPEEKDERV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA+QVINNACA+QAILSIL+NCP +D+G EL   K+FT+ F P  KG
Sbjct: 63  ---VITDPNPNLFFARQVINNACASQAILSILMNCPDMDIGPELSKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N E IR  HNSFAR  P F+ +  +++S+++D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNCEAIRAAHNSFARLGP-FVPEEQKAASKEDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG CTG     +WL  V+PVIQER+ R++++EIRFNLLA++KNR+++Y   + E+ +R
Sbjct: 179 ISLGQCTGGHGDMDWLLMVQPVIQERIERHSNSEIRFNLLAIVKNRKEMYTAELKELQKR 238

Query: 249 M-------------RHASNTNNSSELMQLSEER---DQLLQRIEMEKVKFKRYERENSLR 292
                         R   N N  S    LSE     +   ++I ME+ KFK++  EN  R
Sbjct: 239 RERIVQQLAAFQAERLVDNGNYESLNKSLSEVNAAIESATEKILMEEEKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           KHN+I F++N ++ILAE+ +L+  IE A+++ S
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTS 331



>gi|224140903|ref|XP_002323817.1| predicted protein [Populus trichocarpa]
 gi|222866819|gb|EEF03950.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 228/331 (68%), Gaps = 24/331 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L+ L+PVYGLIFLFKW+      R+
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDSLRPVYGLIFLFKWRPEEKDERV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA+QVINNACA+QAILSIL+NCP ID+G EL   K+FT+ F P  KG
Sbjct: 63  ---VITDPNPNLFFARQVINNACASQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N E IR  HNSFAR +P F+ +  +++S+++D++HFISY+PV G LYELDGL  GP
Sbjct: 120 LAINNCEAIRVAHNSFARPEP-FIPEEQKAASQEDDVYHFISYLPVDGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG CTG     +WL  V+PVIQER+ R++++EIRFNLLA+IKNR+++Y   + ++ ++
Sbjct: 179 ISLGQCTGGHGDLDWLRMVQPVIQERIERHSNSEIRFNLLAIIKNRKEMYTAELKDLQKK 238

Query: 249 M-------------RHASNTNNSSELMQLSEER---DQLLQRIEMEKVKFKRYERENSLR 292
                         R   N+N  +    LSE     +   ++I ME+ KFK++  EN  R
Sbjct: 239 RERILQQLAAFQAERLVDNSNFEALNKSLSEVNGGIESATEKILMEEDKFKKWRTENIRR 298

Query: 293 KHNFIQFIYNIIRILAERGELQARIEYARKE 323
           KHN+I F++N ++ILAE+ +L+  IE A+++
Sbjct: 299 KHNYIPFLFNFLKILAEKKQLKPLIEKAKQK 329



>gi|302771858|ref|XP_002969347.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
 gi|300162823|gb|EFJ29435.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
          Length = 324

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 227/326 (69%), Gaps = 20/326 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD ++L  L+PVYGLIFLFKW+ G   +R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDLESLSLLRPVYGLIFLFKWRPGEKDTR- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                +  +++++FA QVINNACATQAILSIL+N   ID+G EL   ++F + F P  KG
Sbjct: 62  ---PTVKDNKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKG 118

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           L I NSE IR  HNSFAR +PF  D+  + + + +D++HFISY+PV G LYELDGL  GP
Sbjct: 119 LTINNSEAIRTAHNSFARPEPFVPDEQ-KFADKDDDVYHFISYLPVDGVLYELDGLKEGP 177

Query: 193 VNLGPC-TGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           ++LG C +GD     WL+ V+PVIQER+ +Y+ +EIRFNL+A+IKNR+D+Y  ++ E+D+
Sbjct: 178 ISLGECGSGDADSMEWLKMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDK 237

Query: 248 RMRHAS----------NTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
           R    S          + + + EL Q+  E  +L ++I  E  KFK+++ EN  RKHN+I
Sbjct: 238 RKTEISGDDGMDVDSKSGSGNEELAQIDAEIARLTEKITQEDEKFKKWKTENIRRKHNYI 297

Query: 298 QFIYNIIRILAERGELQARIEYARKE 323
            F++N ++ILAE+ +L+  IE AR++
Sbjct: 298 PFLFNFLKILAEKKQLKPLIEKARQK 323



>gi|157127884|ref|XP_001655066.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aedes aegypti]
 gi|157127886|ref|XP_001655067.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aedes aegypti]
 gi|157127888|ref|XP_001655068.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aedes aegypti]
 gi|108872768|gb|EAT36993.1| AAEL010966-PA [Aedes aegypti]
 gi|403183150|gb|EJY57889.1| AAEL010966-PB [Aedes aegypti]
 gi|403183151|gb|EJY57890.1| AAEL010966-PC [Aedes aegypti]
          Length = 326

 Score =  306 bits (784), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 222/328 (67%), Gaps = 19/328 (5%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG+WCLIESDPGVFTELIR F V+G QVEE+WSLD +  + L+PV+GLIFLFKW  
Sbjct: 1   MADSAGEWCLIESDPGVFTELIRGFGVEGVQVEELWSLDAEHFKNLEPVHGLIFLFKWVK 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFK 120
            ++     P   +  D   E ++FAKQVINNACATQAILSILLN     I LG+ L +FK
Sbjct: 61  DDE-----PAGSIVQDSRLEKIFFAKQVINNACATQAILSILLNAKHSDIQLGSTLSDFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           DF   FD Y+KGLA++N+  IR VHNSFAR   F LD  ++ +++ ED+FHF+ YVP++G
Sbjct: 116 DFCVSFDAYNKGLAMSNASQIRTVHNSFARQTLFELD--NKQANKDEDVFHFVGYVPIEG 173

Query: 181 ALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL  GP++LG    G++WL  VRP+I++R+ +Y+  EI FNL+AL+ +R+ +Y+
Sbjct: 174 RLYELDGLKEGPIDLGAVGAGEDWLNVVRPIIEKRIQKYSEGEIHFNLMALVSDRQMIYQ 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            +I    +++ HAS      E      E  +L   IE E  K KRY+ EN  RKHN++  
Sbjct: 234 RKI----DQLLHASG-EEEMETDTKQNEITRLRMLIEDEVAKRKRYKVENIRRKHNYLPL 288

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ILA+ G+L    E A++  ++R
Sbjct: 289 IVELLKILAQNGQLMPLYEKAKQRAAER 316



>gi|221123773|ref|XP_002164730.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Hydra magnipapillata]
          Length = 342

 Score =  306 bits (784), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 227/344 (65%), Gaps = 14/344 (4%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S  G WCLIESDPGVFTELIR F   G QVEE+WSLD   LE L PV+GLIFLFKW+ G 
Sbjct: 3   SSHGDWCLIESDPGVFTELIRGFGCSGVQVEELWSLDSDILETLSPVHGLIFLFKWRSGE 62

Query: 68  DSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRL 125
           ++       D  +DE ++FAKQVINNACATQAI+SILLNC  P + LG  L  FK+F++ 
Sbjct: 63  EADGAIVR-DSRIDE-IFFAKQVINNACATQAIISILLNCNHPDLQLGETLSAFKEFSKQ 120

Query: 126 FDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYEL 185
           FDP  KGL+++NS+ I+ VHNSFAR + F  D + +   E ++ +HF++Y+P+ G LYEL
Sbjct: 121 FDPALKGLSLSNSDTIKQVHNSFAREEMFQFDSSKK--DEDKEAYHFVAYIPINGRLYEL 178

Query: 186 DGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           DGL +GP++L   T D+WL   +P+I++RM +Y+S ++ FNL+A++ +R+ +Y   I ++
Sbjct: 179 DGLKDGPIDLASATTDSWLHVCKPIIEKRMQKYSSEDVHFNLMAVVTDRKLIYAREIEKL 238

Query: 246 D-------ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           +       + +  ++N   ++++  L  E D     +  E  K   Y+ EN  RKHN++ 
Sbjct: 239 NNQRAQLLKELSESANVELNAKVKALDAELDTYQSLMAAEDDKMAAYKIENIRRKHNYLP 298

Query: 299 FIYNIIRILAERGELQARIEYARK-EMSKRIKDRAEKKKGESGS 341
           FI  ++++LA++GEL   +E AR+   ++R  D+A KK+ E  +
Sbjct: 299 FIMELLKLLAKKGELVPLVEKARELTRTRRENDKARKKQKECSN 342



>gi|125977168|ref|XP_001352617.1| GA17448 [Drosophila pseudoobscura pseudoobscura]
 gi|195168071|ref|XP_002024855.1| GL17965 [Drosophila persimilis]
 gi|54641365|gb|EAL30115.1| GA17448 [Drosophila pseudoobscura pseudoobscura]
 gi|194108285|gb|EDW30328.1| GL17965 [Drosophila persimilis]
          Length = 324

 Score =  305 bits (782), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 223/331 (67%), Gaps = 18/331 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D E+++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDKEDIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLANFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +QS    ED++HF+ Y+P++G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQSKD--EDLYHFVGYIPIKGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    D NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y     +I
Sbjct: 178 GLREGPIDLGEIKPDQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEK---QI 234

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
           D+ +  A +  ++ E  Q   E   L   I+ E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 235 DKLLNPAPDAMDTEEDRQT--EISSLRSYIQYEVQKKKRYKVENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           +L E G+L    E A++   +R  ++A++KK
Sbjct: 293 MLGETGQLMPIYEKAKQRALER--EQAQRKK 321



>gi|431902403|gb|ELK08903.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Pteropus alecto]
          Length = 318

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 221/321 (68%), Gaps = 18/321 (5%)

Query: 16  IESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPE 75
           +ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P 
Sbjct: 1   MESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PA 55

Query: 76  ADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYD 130
             +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   
Sbjct: 56  GSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAM 115

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G LYELDGL  
Sbjct: 116 KGLALSNSDVIRQVHNSFARQQMFEFDA--KTTAKEEDAFHFVSYVPVNGRLYELDGLRE 173

Query: 191 GPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM- 249
           GP++LG CT D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ VY  +I E+  ++ 
Sbjct: 174 GPIDLGACTQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMVYEQKIAELQRQLA 233

Query: 250 -RHASNTNNSSELMQLSEE--RDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRI 306
                +T+  + L  +  E  ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ 
Sbjct: 234 EEEPMDTDQGNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKT 291

Query: 307 LAERGELQARIEYARKEMSKR 327
           LAE  +L   +E A+++ + +
Sbjct: 292 LAEHQQLIPLVEKAKEKQNAK 312



>gi|194747725|ref|XP_001956302.1| GF24661 [Drosophila ananassae]
 gi|190623584|gb|EDV39108.1| GF24661 [Drosophila ananassae]
          Length = 324

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 225/335 (67%), Gaps = 19/335 (5%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           MSD AG WCLIESDPGVFTELIR F  +G QVEE+WSLD ++ + L+P++GLIFLFKW  
Sbjct: 1   MSDGAGNWCLIESDPGVFTELIREFGCEGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
            ++     P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F
Sbjct: 61  EDE-----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEF 115

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            + FDPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G L
Sbjct: 116 CQCFDPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKD--EDVYHFVGYMPIGGRL 173

Query: 183 YELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y   
Sbjct: 174 YELDGLREGPIDLGEIRPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQ- 232

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
             +ID+ +    N   + E  Q   E + L   I+ E  K KRY+ EN  RKHN++ FI 
Sbjct: 233 --QIDKLLNPGPNAMETEEDRQT--EINNLRTYIQYEIQKKKRYKVENVRRKHNYLPFIV 288

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
            ++++L E G+L    E A++   +R  ++A++KK
Sbjct: 289 ELLKMLGETGQLMPIYEKAKQRALER--EQAQRKK 321



>gi|498930888|ref|XP_004519004.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Ceratitis capitata]
          Length = 325

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 221/327 (67%), Gaps = 17/327 (5%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           MSD AG WCLIESDPGVFTELIR F  +G QVEE+WSLD    ++L+P++GLIFLFKW  
Sbjct: 1   MSDGAGSWCLIESDPGVFTELIRDFGCEGVQVEEIWSLDPDLFKDLEPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFT 123
             +++    + D    +N++FAKQVINNACATQAILSILLNC    I LG  L  FK+F+
Sbjct: 61  DEETTGTVVKDDRL--DNIFFAKQVINNACATQAILSILLNCQHKDIKLGPTLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FDP++KGL ++N+  IR VHNSFAR   + LD  +Q+    +D+FHFI Y+P+ G LY
Sbjct: 119 QSFDPFNKGLTLSNAPKIRSVHNSFARQTLYELDTKNQNKD--DDVFHFIGYIPINGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           ELDGL  GPV+LG    + NW++ VRP+I++RM +Y+  EI FNL+A++ +R  +Y+ +I
Sbjct: 177 ELDGLKEGPVDLGAVEANQNWIDVVRPIIEKRMQKYSEGEIHFNLMAIVSDRLKIYQQKI 236

Query: 243 GEIDERMRHASNTNNSSELM--QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
            E+       +NT++ S      +  E  +L  +++ E  K KRY+ EN  RKHN++ FI
Sbjct: 237 DEL-------TNTDDDSMYTDEDMQAEVAKLRSKMDYEAEKRKRYKVENIRRKHNYLPFI 289

Query: 301 YNIIRILAERGELQARIEYARKEMSKR 327
             ++++L E+G+L    E A++   +R
Sbjct: 290 VELLKMLGEQGQLMPIYEKAKQRAVER 316



>gi|17648095|ref|NP_524003.1| ubiquitin C-terminal hydrolase, isoform A [Drosophila melanogaster]
 gi|442631329|ref|NP_001261632.1| ubiquitin C-terminal hydrolase, isoform B [Drosophila melanogaster]
 gi|4689358|gb|AAD27866.1|AF132567_1 LD24440p [Drosophila melanogaster]
 gi|6434962|gb|AAF08393.1|AF145312_1 26S proteasome regulatory complex subunit p37A [Drosophila
           melanogaster]
 gi|7294928|gb|AAF50257.1| ubiquitin C-terminal hydrolase, isoform A [Drosophila melanogaster]
 gi|25009750|gb|AAN71049.1| AT10619p [Drosophila melanogaster]
 gi|220943618|gb|ACL84352.1| Uch-L3-PA [synthetic construct]
 gi|220953582|gb|ACL89334.1| Uch-L3-PA [synthetic construct]
 gi|440215546|gb|AGB94327.1| ubiquitin C-terminal hydrolase, isoform B [Drosophila melanogaster]
          Length = 324

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 221/331 (66%), Gaps = 18/331 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q     +D++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKD--DDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
              +  A N  ++ E  Q   E   L   IE E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 238 ---LNPAPNAMDTEEDRQ--AEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           IL E G+L    E A++   +R  ++A++KK
Sbjct: 293 ILGENGQLMPIYEKAKQRALER--EQAQRKK 321



>gi|66499314|ref|XP_397252.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Apis
           mellifera]
          Length = 311

 Score =  302 bits (774), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 220/324 (67%), Gaps = 31/324 (9%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F VQG QVEE+WSLDD+  + LKP++GLIFLFKW  
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFK 120
            ++     P   + +D   + ++FAKQVINNACATQAILS+LLNC    I LG  L+ FK
Sbjct: 61  DDE-----PSGSIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +F + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +D+FHF+SYVP+ G
Sbjct: 116 NFCQSFDANMRGLALSNSDVIREVHNSFSRQTIFEYDS--KQASKDDDVFHFVSYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL +GP++LGPC  GD W++  +P+IQ+R+++Y   EI FNL+A++ +R+ VY 
Sbjct: 174 RLYELDGLKDGPMDLGPCPLGDQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTVYE 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                     R  +N  + +EL     ER Q L  IE E  K KRY+ EN  RKHN++  
Sbjct: 234 ----------RQIANVCDPTEL-----ERLQTL--IEKEIRKSKRYQIENIRRKHNYLPL 276

Query: 300 IYNIIRILAERGELQARIEYARKE 323
           I  ++++LA+ G+L    + A+++
Sbjct: 277 IMELLKMLAKEGKLVPLYQRAKEK 300



>gi|440904743|gb|ELR55213.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, partial [Bos
           grunniens mutus]
          Length = 339

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/342 (45%), Positives = 221/342 (64%), Gaps = 40/342 (11%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 6   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 65

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 66  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 120

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++++++ED FHF+SYVPV G L
Sbjct: 121 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTAAKEEDAFHFVSYVPVNGRL 178

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERM---------------------SRYTSA 221
           YELDGL  GP++LG C  D+W+  VRPVI++R+                      RY+  
Sbjct: 179 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQNLSVFPICIFVVQPKKSLPKPRYSEG 238

Query: 222 EIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM---QLSEERDQLLQRIE 276
           EIRFNL+A++ +R+ +Y  +I E+  ++      +T+  S ++   Q    ++Q+L  IE
Sbjct: 239 EIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQML--IE 296

Query: 277 MEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
            E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 297 EEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 338



>gi|195326334|ref|XP_002029884.1| GM24867 [Drosophila sechellia]
 gi|194118827|gb|EDW40870.1| GM24867 [Drosophila sechellia]
          Length = 324

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 222/331 (67%), Gaps = 18/331 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD   +S  + +D++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARPTLFELDT--KSQKKDDDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
              +  A N  ++ E  Q   E   L   IE E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 238 ---LNPADNAMDTEEDRQ--AEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           +L E G+L    E A++   +R  ++A++KK
Sbjct: 293 MLGENGQLMPIYEKAKQRALER--EQAQRKK 321



>gi|384249242|gb|EIE22724.1| ubiquitinyl hydrolase [Coccomyxa subellipsoidea C-169]
          Length = 332

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 210/328 (64%), Gaps = 17/328 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IESDPGVFTEL+    VQG Q+EE+++LD ++L  + PVYGLIFLFKW+   D+   
Sbjct: 5   WTTIESDPGVFTELMTEMGVQGVQMEELYALDSESLHAISPVYGLIFLFKWRSEQDNRPA 64

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
             EAD      V+FAKQVI NACATQAILS+LLN P I LGAEL N KDFT  F P  KG
Sbjct: 65  VSEADYL--GKVFFAKQVITNACATQAILSVLLNRPDIQLGAELTNLKDFTADFPPEYKG 122

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI+NSE IR  HNSF+   P   +++  +  + E ++HFISYVPV GALYELDGL  GP
Sbjct: 123 LAISNSESIRRAHNSFSPPQPIVPEESRLADKDDE-VYHFISYVPVDGALYELDGLKPGP 181

Query: 193 VNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRHA 252
           + L   T DNWLEKV P IQ R+ RY  +EIRFNL+A+I+NR DV    +  +++R    
Sbjct: 182 IRLCEATEDNWLEKVGPFIQSRIERYAQSEIRFNLMAVIRNRSDVIAEELASLEDRRAAL 241

Query: 253 SNTNNSSELMQL---SEERDQLLQRIEMEKV-----------KFKRYERENSLRKHNFIQ 298
            +T+   + MQ+     E  Q L  IE E V           K KR+  EN  RK N++ 
Sbjct: 242 LSTSEEGDQMQVDGKGSETPQDLASIENEIVRVQEGLHQEAAKKKRWHDENVRRKTNYVP 301

Query: 299 FIYNIIRILAERGELQARIEYARKEMSK 326
           FI++ +++LAE+G+L+  IE A+   +K
Sbjct: 302 FIFHFLKLLAEKGQLKPIIERAKTMPAK 329



>gi|195589056|ref|XP_002084272.1| GD12919 [Drosophila simulans]
 gi|194196281|gb|EDX09857.1| GD12919 [Drosophila simulans]
          Length = 324

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 222/331 (67%), Gaps = 18/331 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD   +S  + +D++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARPTLFELDT--KSQKKDDDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
              +  A N  ++ E  Q   E   L   IE E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 238 ---LNPAPNAMDTEEDRQ--AEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           +L E G+L    E A++   +R  ++A++KK
Sbjct: 293 MLGENGQLMPIYEKAKQRALER--EQAQRKK 321



>gi|58387409|ref|XP_315540.2| AGAP005540-PA [Anopheles gambiae str. PEST]
 gi|55238347|gb|EAA11802.2| AGAP005540-PA [Anopheles gambiae str. PEST]
          Length = 322

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 217/328 (66%), Gaps = 21/328 (6%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG+WCLIESDPGVFTELI+ F V G QVEE+WSLD+ + ++L+PV+GL+FLFKW  
Sbjct: 1   MADSAGEWCLIESDPGVFTELIKEFGVDGVQVEELWSLDENSFKDLEPVHGLVFLFKWVK 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFK 120
            ++     P   +  D   E ++FAKQVINNACATQAILSILLN   P I LG+ L +FK
Sbjct: 61  DDE-----PAGSIVQDSRLEKIFFAKQVINNACATQAILSILLNATHPDIKLGSTLTDFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +F   FD Y+KGLA++N+  IR VHNSFAR   F L   D  SS KED+FHF+ YVPV G
Sbjct: 116 EFACTFDAYNKGLALSNASQIRTVHNSFARQTLFEL---DNKSSGKEDVFHFVGYVPVDG 172

Query: 181 ALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL  GP++ G    G +WL+ VRP+I++RM +Y+  EI FNL+A++ +R+ +Y+
Sbjct: 173 RLYELDGLKEGPIDHGAVGPGQDWLQVVRPIIEKRMLKYSKGEIHFNLMAIVSDRQLIYQ 232

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            +I ++ +       T+   + +      + L   IE E  K K+Y  EN  RKHN++ F
Sbjct: 233 QQIDQLLQGDESEMETDAKQDKI------NHLRVLIEDEAAKRKQYRTENVRRKHNYLPF 286

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE G+L    E A++   +R
Sbjct: 287 IVELLKALAENGQLMPLYEKAKQRALER 314



>gi|355746080|gb|EHH50705.1| hypothetical protein EGM_01573, partial [Macaca fascicularis]
          Length = 368

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/363 (43%), Positives = 225/363 (61%), Gaps = 46/363 (12%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 9   VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 68

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 69  KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 123

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 124 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 181

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSR------------------- 217
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +                   
Sbjct: 182 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKDGFSPCCPGWSQTPELKPS 241

Query: 218 --------YTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHASNTNNSSELMQL 264
                   Y+  EIRFNL+A++ +R+ +Y  +I E+     +E        N+    +Q 
Sbjct: 242 ACLDLPKWYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQS 301

Query: 265 SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEM 324
              ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+++ 
Sbjct: 302 EVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQ 359

Query: 325 SKR 327
           + +
Sbjct: 360 NAK 362



>gi|195127477|ref|XP_002008195.1| GI13355 [Drosophila mojavensis]
 gi|193919804|gb|EDW18671.1| GI13355 [Drosophila mojavensis]
          Length = 324

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 223/334 (66%), Gaps = 24/334 (7%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ ++L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKDLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D ++++FAKQVINNACATQAILS+LLN     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRDHIFFAKQVINNACATQAILSLLLNLNHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKD--EDVYHFVGYMPIAGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    D NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKPDQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEKQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEER----DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
                     N +++ M  +E+R    + L   I+ E  K KRY+ EN  RKHN++ FI 
Sbjct: 238 ---------LNPAADAMDTAEDRQTEINSLRSYIQYEIEKKKRYKIENVRRKHNYLPFIV 288

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKK 335
            ++++L E G+L    E A++   +R +  ++K+
Sbjct: 289 ELLKMLGETGQLLPIYEKAKQRALEREQKMSKKE 322



>gi|91079883|ref|XP_967733.1| PREDICTED: similar to ubiquitin carboxyl-terminal hydrolase isozyme
           L5 [Tribolium castaneum]
 gi|270003278|gb|EEZ99725.1| hypothetical protein TcasGA2_TC002490 [Tribolium castaneum]
          Length = 323

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 218/328 (66%), Gaps = 18/328 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F V+G QVEE+WSL+ +  E+LKP++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGVKGVQVEELWSLEPEQFEKLKPIHGLIFLFKWTKDDE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   E ++FAKQVI NACATQAILS+LLNC   D  LG  L   KDF +
Sbjct: 64  ----PSGSIVQDSRLEKIFFAKQVIENACATQAILSVLLNCRHADLKLGHTLTELKDFCQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL I+NS +IR VHNSFAR   F  D +   +++ ED+FHF+SYVP+ G LYE
Sbjct: 120 GFDANMKGLTISNSPVIRSVHNSFARQQIFEFDPS--LANKNEDVFHFVSYVPIDGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL  GP++LGP T D +W + VRP+I++R+ RYT  EI FNL+A++ +R+ +Y+ +I 
Sbjct: 178 LDGLKTGPIDLGPLTADSDWTDVVRPIIEKRIQRYTEGEIHFNLMAIVSDRKMLYQRQID 237

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
            + +++  +    +S    Q    R +LL  IE E+ K ++Y  EN  RKHN++  I  I
Sbjct: 238 NLQKKLEESGMETDSQ---QAEIARLRLL--IEDEENKRRQYRVENIRRKHNYLPLIVEI 292

Query: 304 IRILAERGELQARIEYARKEMSKRIKDR 331
           ++ILA+ G+L    E A+++  K+ K +
Sbjct: 293 LKILAKEGKLMTLYEQAKQKTLKKQKAK 320



>gi|340720665|ref|XP_003398753.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Bombus terrestris]
          Length = 311

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 220/324 (67%), Gaps = 31/324 (9%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F VQG QVEE+WSLDD+  + LKP++GLIFLFKW  
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFK 120
            ++     P   + +D   + ++FAKQVINNACATQAILS+LLNC    I LG  L+ FK
Sbjct: 61  DDE-----PSGSIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +F + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +D+FHF+SYVP+ G
Sbjct: 116 NFCQSFDANMRGLALSNSDVIREVHNSFSRQTIFEYDS--KQASKDDDVFHFVSYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL +GP++LGPC  GD W++  +P+IQ+R+++Y   EI FNL+A++ +R+ VY 
Sbjct: 174 RLYELDGLKDGPMDLGPCPLGDQWVQSAKPIIQKRINKYNEGEIHFNLMAIVTDRKVVYE 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                     R  +N  + +EL     ER Q L  IE E  K KRY+ EN  RKHN++  
Sbjct: 234 ----------RQIANVCDPAEL-----ERLQTL--IEKEIRKSKRYQIENIRRKHNYLPL 276

Query: 300 IYNIIRILAERGELQARIEYARKE 323
           I  ++++LA+ G+L    + A+++
Sbjct: 277 IMELLKMLAKEGKLVPLYQRAKEK 300



>gi|197097950|ref|NP_001127557.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Pongo abelii]
 gi|55731563|emb|CAH92490.1| hypothetical protein [Pongo abelii]
          Length = 355

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/355 (44%), Positives = 224/355 (63%), Gaps = 45/355 (12%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +
Sbjct: 4   NAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE 63

Query: 69  SSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFT 123
                P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F+
Sbjct: 64  -----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LY
Sbjct: 119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLY 176

Query: 184 ELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSR-------------------------- 217
           ELDGL  GP++LG C  D+W+  VRPVI++R+ +                          
Sbjct: 177 ELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKDGFSPCCPGWSQTPELKPSACLDLPK 236

Query: 218 -YTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH----ASNTNNSSELMQLSEERDQLL 272
            Y+  EIRFNL+A++ +R+ +Y  +I E+  ++          N+    +Q    ++Q+L
Sbjct: 237 WYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQML 296

Query: 273 QRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
             IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 297 --IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 349



>gi|350401284|ref|XP_003486108.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Bombus impatiens]
          Length = 311

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 220/324 (67%), Gaps = 31/324 (9%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F VQG QVEE+WSLDD+  + LKP++GLIFLFKW  
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFK 120
            ++     P   + +D   + ++FAKQVINNACATQAILS+LLNC   D  LG  L+ FK
Sbjct: 61  DDE-----PSGSIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDVSLGPNLEEFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +F + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +D+FHF+SYVP+ G
Sbjct: 116 NFCQSFDANMRGLALSNSDVIREVHNSFSRQTIFEYDS--KQASKDDDVFHFVSYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL +GP++LGPC  GD W++  +P+IQ+R+++Y   EI FNL+A++ +R+ VY 
Sbjct: 174 RLYELDGLKDGPMDLGPCPLGDQWVQSAKPIIQKRINKYNEGEIHFNLMAIVTDRKVVYE 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                     R  +N  + +EL     ER Q L  IE E  K KRY+ EN  RKHN++  
Sbjct: 234 ----------RQIANVCDPAEL-----ERLQTL--IEKEIRKSKRYQIENIRRKHNYLPL 276

Query: 300 IYNIIRILAERGELQARIEYARKE 323
           I  ++++LA+ G+L    + A+++
Sbjct: 277 IMELLKMLAKEGKLVPLYQRAKEK 300



>gi|294846029|gb|ADF43187.1| UBCH1m [Chlamydomonas reinhardtii]
          Length = 331

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 210/334 (62%), Gaps = 33/334 (9%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           +W  IESDPGVFTELI    V+G QVEE+WSLD   L EL PV+GL+FLFKW+       
Sbjct: 2   EWTTIESDPGVFTELIENIGVKGVQVEELWSLDQ--LRELSPVFGLVFLFKWK----KEP 55

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLN--CPTIDLGAELDNFKDFTRLFDPY 129
           + P       + V+FAKQVI+NACATQAIL+ILLN   P +DLG EL NF++F   FDP 
Sbjct: 56  VRPATTTDAGQ-VFFAKQVISNACATQAILNILLNVKAPGLDLGTELANFREFVSDFDPT 114

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
            KGLAI+N +LIR  HNSFAR +P   D  D+   +  D +HFISYVPV G L+ELDGL 
Sbjct: 115 MKGLAISNCDLIRTAHNSFARPEPLVPD-NDKDDEKSGDAYHFISYVPVGGKLFELDGLQ 173

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI------- 242
            GP+ L  CT D+WL+KV P I  RM RY ++EIRFNL+AL+ NR D+YR+R+       
Sbjct: 174 EGPIELCDCTDDDWLDKVGPHITARMERYAASEIRFNLMALVGNRADIYRSRLAAATAQR 233

Query: 243 -----------GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
                      G  DE + HA      ++L++   E   L + +  E+ K + +  EN  
Sbjct: 234 DQLAAAAAAADGMSDEDLAHA-----QAKLLEAETEVANLQEALAAEQAKHRTWHEENVR 288

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           RKHN++ F++ +++++A RG++   +E AR+  +
Sbjct: 289 RKHNYVPFLFQLLKLMAARGQMGPLLERARRPAA 322



>gi|302852920|ref|XP_002957978.1| hypothetical protein VOLCADRAFT_84268 [Volvox carteri f.
           nagariensis]
 gi|297592104|gb|ADI46889.1| UBCH1f [Volvox carteri f. nagariensis]
 gi|297592177|gb|ADI46961.1| UBCH1m [Volvox carteri f. nagariensis]
 gi|300256744|gb|EFJ41004.1| hypothetical protein VOLCADRAFT_84268 [Volvox carteri f.
           nagariensis]
          Length = 316

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 210/322 (65%), Gaps = 19/322 (5%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           +W  IESDPGVFTELI    V+G QVEE+WSLD   L+EL PV+GLIFLFKW+      +
Sbjct: 2   EWTTIESDPGVFTELIAQIGVKGVQVEELWSLDQ--LKELSPVFGLIFLFKWRKEAGKRQ 59

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
             P       + V+FA+QVI NACATQAILSILLNCP +DLG EL NF++F   FDP  K
Sbjct: 60  TTPGGA----QGVFFARQVITNACATQAILSILLNCPGLDLGTELSNFREFVADFDPNMK 115

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           GLAI+NS+LIR VHNSFAR +P  + + D+   +  + +HFISYVP+ G LYELDGL  G
Sbjct: 116 GLAISNSDLIRTVHNSFARPEP-LVPEEDKDEEKGGEAYHFISYVPIGGKLYELDGLQEG 174

Query: 192 PVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH 251
           P+ L  CT  +WL++V P I ERM RY ++EIRFNL+AL+ NR ++Y +R+  +  R   
Sbjct: 175 PIELCECTTSDWLDRVGPHIAERMERYAASEIRFNLMALVGNRVELYGSRLAAVAARREE 234

Query: 252 ASNTNNSS------------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            +    ++            +L++   E   L + +  E+ K + +  EN  R+HN++ F
Sbjct: 235 LAAAVAAAAASVRVKVGLQVQLLETETEVANLQEALAAEEAKHRAWHDENVRRRHNYVPF 294

Query: 300 IYNIIRILAERGELQARIEYAR 321
           ++++++++A RGEL   +E AR
Sbjct: 295 LFHLLKLMAARGELGPLLERAR 316



>gi|195490816|ref|XP_002093299.1| GE21236 [Drosophila yakuba]
 gi|194179400|gb|EDW93011.1| GE21236 [Drosophila yakuba]
          Length = 324

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 220/335 (65%), Gaps = 26/335 (7%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKD--EDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEER----DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
                     N + + M   E+R      L   I+ E  K KRY+ EN  RKHN++ FI 
Sbjct: 238 ---------LNPAPDAMDTEEDRQTEISSLRTYIQYEIQKKKRYKVENVRRKHNYLPFIV 288

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
            ++++L E G+L    E A++    R  ++A++KK
Sbjct: 289 ELLKMLGETGQLMPIYEKAKQRALDR--EQAQRKK 321



>gi|46850173|gb|AAT02518.1| ubitquitin C-terminal hydrolase [Chlamydomonas reinhardtii]
          Length = 331

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 210/334 (62%), Gaps = 33/334 (9%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           +W  IESDPGVFTELI    V+G QVEE+WSLD   L EL PV+GL+FLFKW+       
Sbjct: 2   EWTTIESDPGVFTELIENIGVKGVQVEELWSLDQ--LRELSPVFGLVFLFKWK----KEP 55

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLN--CPTIDLGAELDNFKDFTRLFDPY 129
           + P       + V+FAKQVI+NACATQAIL+ILLN   P +DLG EL NF++F   FDP 
Sbjct: 56  VRPATTTDAGQ-VFFAKQVISNACATQAILNILLNVKAPGLDLGTELANFREFVSDFDPT 114

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
            KGLAI+NS+LIR  HNSFAR +P   D  D+   +  D +HFISYVPV G L+ELDGL 
Sbjct: 115 MKGLAISNSDLIRTAHNSFARPEPLVPD-NDKDDEKSGDAYHFISYVPVGGKLFELDGLQ 173

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI------- 242
            GP+ L  CT D+WL+KV P I  RM RY ++EIRFNL+AL+ NR D+Y +R+       
Sbjct: 174 EGPIELCDCTDDDWLDKVGPHITARMERYAASEIRFNLMALVGNRADIYSSRLAAATAQR 233

Query: 243 -----------GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
                      G  DE + HA      ++L++   E   L + +  E+ K + +  EN  
Sbjct: 234 DQLAAAAAAADGMSDEDLAHA-----QAKLLEAETEVANLQEALAAEQAKHRTWHEENVR 288

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           RKHN++ F++ +++++A RG++   +E AR+  +
Sbjct: 289 RKHNYVPFLFQLLKLMAARGQMGPLLERARRPAA 322



>gi|281353215|gb|EFB28799.1| hypothetical protein PANDA_012567 [Ailuropoda melanoleuca]
          Length = 352

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 219/354 (61%), Gaps = 46/354 (12%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 7   VAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 66

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 67  KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 121

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 122 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYV 179

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSR------------------- 217
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +                   
Sbjct: 180 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKHVACKYSLPVCSLSPNSPS 239

Query: 218 --------YTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHASNTNNSSELMQL 264
                   Y+  EIRFNL+A++ +R+ +Y  +I E+     +E        NN    +Q 
Sbjct: 240 IVFEEQKWYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNNMLSAIQS 299

Query: 265 SEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
              ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 300 EVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 351



>gi|255077900|ref|XP_002502530.1| predicted protein [Micromonas sp. RCC299]
 gi|226517795|gb|ACO63788.1| predicted protein [Micromonas sp. RCC299]
          Length = 337

 Score =  300 bits (768), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 211/341 (61%), Gaps = 38/341 (11%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           +W  IESDPGVFTELI+   V+G QVEE++SLD+ +L  + PVYGLIFLFK++ G     
Sbjct: 2   EWTTIESDPGVFTELIQEMGVKGVQVEELYSLDEGSLRAMAPVYGLIFLFKYRSGE---- 57

Query: 72  LHPEADLSVDEN---VYFAKQVINNACATQAILSILLNCP-TIDLGAELDNFKDFTRLFD 127
             P A +  D +   V+FA QVI NACATQAILSIL+NCP ++ LG EL N K FT  FD
Sbjct: 58  -APSAPVETDASSSGVFFASQVITNACATQAILSILMNCPASVQLGEELGNMKAFTAEFD 116

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
              KGLAI+NSE IR  HNSFAR +P   +Q DQ+ S+  D+FHFI+Y+PV G LYELDG
Sbjct: 117 ADLKGLAISNSETIRKAHNSFARPEPIMEEQRDQAPSD--DVFHFIAYMPVNGRLYELDG 174

Query: 188 LSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           L  GP+  G CT D+WL KV PVIQ R+ +Y S+EIRFNL+ALIK+ +     R+ +I+ 
Sbjct: 175 LKRGPIAHGECTDDDWLGKVCPVIQSRIEQYASSEIRFNLMALIKSPKQALEERLAKIEA 234

Query: 248 RMRHASNTNN---------------------------SSELMQLSEERDQLLQRIEMEKV 280
           R    +                               ++EL +L  E     + IE E  
Sbjct: 235 RKERCAKVAAGAAVDAGMDVDGGDDLDGPLPSGQDAVAAELARLEGEAAVAREGIEREAQ 294

Query: 281 KFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
           K +R+  EN  RKHN+I FI+N +++LAE+ +L+  I  AR
Sbjct: 295 KAQRWRDENIRRKHNYIPFIFNFLKVLAEKKKLEPLIAKAR 335



>gi|402589718|gb|EJW83649.1| ubiquitin carboxyl-terminal hydrolase [Wuchereria bancrofti]
          Length = 322

 Score =  300 bits (767), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 163/341 (47%), Positives = 223/341 (65%), Gaps = 25/341 (7%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSDAG WCLIESDPGVFTELIR F V G QVEE++SLD Q   +LKPV+GLIFLFKW+ G
Sbjct: 1   MSDAGNWCLIESDPGVFTELIRGFGVSGVQVEELYSLDKQLFSDLKPVHGLIFLFKWRAG 60

Query: 67  NDSSRLHPEADLSVDEN-VYFAKQVINNACATQAILSILLNCPT---IDLGAELDNFKDF 122
            +     P   L +D N V+FA+QVI NACATQA++++LLN  T   I LG  L+ FK F
Sbjct: 61  EE-----PCGSLVLDNNRVFFAQQVIQNACATQALINLLLNTKTESGIVLGPILEEFKSF 115

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           T+ FDP ++GL + NSE IR VHNSF+R   F   + D  + EKED +HFI+Y+PV G +
Sbjct: 116 TQNFDPMNRGLCLGNSEPIRKVHNSFSRQHLF---ELDIKAPEKEDNYHFITYIPVDGHI 172

Query: 183 YELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL   P++LG    G++WL+ VRP+I  R+ +Y++ EI FNL+A+I +R+  Y+ R
Sbjct: 173 YELDGLREAPLDLGAIREGEDWLDAVRPIINARIRKYSAGEIHFNLMAVISDRKVKYQKR 232

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           + E+ E    A  T+N        EE + L   I  E+ K K ++ EN  R+HN+I FI 
Sbjct: 233 LAELAES---AMETDNK------VEEMNHLQALIAAEEEKEKSFKAENIRRRHNYIPFIV 283

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKKKGESGSK 342
            ++++LA+ G L   ++ A++   K I+   EKK  +S  K
Sbjct: 284 EMLKVLAKEGRLVPLVQEAQE---KAIRKATEKKSEKSRVK 321



>gi|194867940|ref|XP_001972178.1| GG14033 [Drosophila erecta]
 gi|190653961|gb|EDV51204.1| GG14033 [Drosophila erecta]
          Length = 324

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 220/335 (65%), Gaps = 26/335 (7%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D EN++FAKQVINNACATQAILS+L+N     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDIKNQNKD--EDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y  +I ++
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKL 237

Query: 246 DERMRHASNTNNSSELMQLSEER----DQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
                     N + + M   E+R      L   I+ E  K KRY+ EN  RKHN++ FI 
Sbjct: 238 ---------LNPAPDAMDTEEDRQTEISSLRAYIQYEIQKKKRYKVENVRRKHNYLPFIV 288

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
            ++++L E G+L    E A++    R  ++A++KK
Sbjct: 289 ELLKMLGETGQLMPIYEKAKQRALDR--EQAQRKK 321



>gi|195441613|ref|XP_002068599.1| GK20334 [Drosophila willistoni]
 gi|194164684|gb|EDW79585.1| GK20334 [Drosophila willistoni]
          Length = 324

 Score =  299 bits (765), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 219/329 (66%), Gaps = 16/329 (4%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ + L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDGESFKNLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D +N++FAKQVI+NACATQAILS+L+N     I LG  L NFKDF + F
Sbjct: 64  ----PAGKVVLDKDNIFFAKQVISNACATQAILSLLMNLEHEDIKLGETLTNFKDFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY KGL ++N+  IR VHNSFAR   F LD   ++  + ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYTKGLTLSNASQIRTVHNSFARQTLFELDM--KNPQKDEDVYHFVGYMPIGGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    D NW++ VRP+I++RM RY + EI FNL+ALI +R+ +Y     +I
Sbjct: 178 GLREGPIDLGEIKPDQNWVDVVRPIIEKRMQRYCNGEIHFNLMALISDRQRIYEQ---QI 234

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
           D+ +  + N  ++ E  Q   E + L   I+ E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 235 DKLLNPSENAMDTEEDRQT--EINSLRSYIQYEIEKKKRYKLENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEK 334
           +L E G+L    E A++   +R + + +K
Sbjct: 293 MLGETGQLMPIYEKAKQRALEREQKQCKK 321



>gi|383860406|ref|XP_003705680.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Megachile rotundata]
          Length = 311

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 226/338 (66%), Gaps = 34/338 (10%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F V+G QVEE+WSLDD+  + LKP++GLIFLFKW  
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFK 120
            ++     P   + +D   + ++FAKQVINNACATQAILS+LLNC    I LG  L+ FK
Sbjct: 61  DDE-----PSGSIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +F + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +D+FHF+SYVP+ G
Sbjct: 116 NFCQSFDANMRGLALSNSDVIREVHNSFSRQTLFEYDS--KQASKDDDVFHFVSYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL +GP++LGPC  GD W++  +P+IQ+R+++Y   EI FNL+A++ +R+ +Y 
Sbjct: 174 RLYELDGLKDGPMDLGPCPPGDQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTLYE 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                     R  +  ++ +EL     ER Q L  IE E  K KRY+ EN  RKHN++  
Sbjct: 234 ----------RQKATVSDPAEL-----ERLQTL--IEKEIRKSKRYQIENIRRKHNYLPL 276

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKKG 337
           I  ++++LA+ G+L    + A++   K ++  ++K K 
Sbjct: 277 IMELLKMLAKEGKLVPLYQRAKE---KAVEKESKKNKA 311



>gi|223945239|gb|ACN26703.1| unknown [Zea mays]
 gi|413939542|gb|AFW74093.1| hypothetical protein ZEAMMB73_281354 [Zea mays]
          Length = 328

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 226/324 (69%), Gaps = 15/324 (4%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G QVEE++SLD  +L +L+PVYGLIFLFKW  G    R 
Sbjct: 3   WCTIESDPGVFTELIQQMQVKGVQVEELYSLDVGSLSQLRPVYGLIFLFKWIPGEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N++FA QVI NACATQAILS+L+N P ID+G EL   K+FT  F P  KG
Sbjct: 62  --PVVRDPNPNLFFAHQVITNACATQAILSVLMNRPEIDIGPELSQLKEFTGAFTPDLKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI+NSE IR  HNSFAR +PF  D+  +++++ +D++HFISY+P +G LYELDGL  GP
Sbjct: 120 LAISNSESIRTAHNSFARPEPFISDE-QRAATKDDDVYHFISYLPFEGVLYELDGLKEGP 178

Query: 193 VNLGPCTGD---NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM 249
           VNLG C G    +WL  V+PVIQER+ RY+ +EIRFNL+A+IKNR++VY   + E+++R 
Sbjct: 179 VNLGQCDGADDLDWLRMVQPVIQERIERYSQSEIRFNLMAIIKNRKEVYSAELEELEKRR 238

Query: 250 RHA-SNTNNSSELMQLSEERDQLLQRIE-------MEKVKFKRYERENSLRKHNFIQFIY 301
                  NN+S    LS    +++  IE       ME+ KFK++++EN  RKHN+I F++
Sbjct: 239 EQILQEMNNASSTESLSSSLTEVISAIETVTEKVIMEEEKFKKWKKENIRRKHNYIPFLF 298

Query: 302 NIIRILAERGELQARIEYARKEMS 325
           N++++LAE+ +L+  +E A+++ S
Sbjct: 299 NLLKMLAEKQQLKPLVEKAKQQKS 322



>gi|312381629|gb|EFR27337.1| hypothetical protein AND_06018 [Anopheles darlingi]
          Length = 324

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 226/328 (68%), Gaps = 20/328 (6%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG+WCLIESDPGVFTELI  F V+G QVEE+WSL+++  +EL+P++GLIFLFKW  
Sbjct: 1   MADSAGEWCLIESDPGVFTELINKFGVEGVQVEELWSLEEENFKELEPIHGLIFLFKWVK 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFK 120
            ++     P   +  D   E ++FAKQVINNACATQAILSILLN    D  LG+ L +F+
Sbjct: 61  DDE-----PAGSIVQDSRLEKIFFAKQVINNACATQAILSILLNVTHADIQLGSTLTDFR 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           DF   FD ++KGLA++N++ IR VHNSFAR   F LD  ++++++ +D+FHF+ YVP+ G
Sbjct: 116 DFVISFDAHNKGLAMSNADQIRTVHNSFARQTLFELD--NKNANKDDDVFHFVGYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL  GP++LG    G +WL+ VRP+I++R+ RY   EI FNL+AL+ +R+ +Y+
Sbjct: 174 RLYELDGLKEGPIDLGAVGPGQDWLKVVRPIIEKRIQRYNEGEIHFNLMALVSDRQLIYQ 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            +I E    +  +  +   +++ Q   +R +LL  IE E  K +RY+ EN  RKHN++ F
Sbjct: 234 RQIDE----LLKSDGSQMDTDVKQEEIQRLKLL--IEDEAAKRQRYKTENIRRKHNYLPF 287

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  ++++LA+ G+L    + A++   +R
Sbjct: 288 IVELLKLLAQNGQLMPLYDKAKQRALER 315



>gi|170035816|ref|XP_001845763.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Culex
           quinquefasciatus]
 gi|167878200|gb|EDS41583.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Culex
           quinquefasciatus]
          Length = 323

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 220/325 (67%), Gaps = 15/325 (4%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG+WCLIESDPGVFTELIR F V+G QVEE+WSLD++  +EL PV+GLIFLFKW  
Sbjct: 1   MADSAGEWCLIESDPGVFTELIREFGVEGVQVEELWSLDEERFKELDPVHGLIFLFKWVK 60

Query: 66  GNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFT 123
              +  +  ++ L   E ++FAKQVINNACATQAILSILLN     I LG+ L +FK+F 
Sbjct: 61  DEPAGSIVQDSRL---EKIFFAKQVINNACATQAILSILLNSKHSDIKLGSTLTDFKEFC 117

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
             FD  +KGLA++N+  IR VHNSFAR   F LD  ++ +++ +D+FHF+ Y+P+ G LY
Sbjct: 118 MSFDAQNKGLALSNASQIRTVHNSFARQTLFELD--NKQANKDDDVFHFVGYIPIDGRLY 175

Query: 184 ELDGLSNGPVNLGPCTG-DNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           ELDGL  GP++LG     ++W+  VRP+I++R+ +Y+  EI FNL+AL+ +R+ +Y+ +I
Sbjct: 176 ELDGLKEGPIDLGAVGPEEDWISVVRPIIEKRIQKYSEGEIHFNLMALVTDRQLIYQRQI 235

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
            ++ ++   A +T+         EE  +L   IE E  K KRY+ EN  RKHN++  I  
Sbjct: 236 DQLLQQADDAMDTDTK------QEEITRLRLHIEDEVAKRKRYKVENIRRKHNYLPLIVE 289

Query: 303 IIRILAERGELQARIEYARKEMSKR 327
           ++++LA  G+L    E A++   +R
Sbjct: 290 LLKVLAANGQLMPLYEKAKQRAIER 314



>gi|307187674|gb|EFN72646.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Camponotus
           floridanus]
          Length = 311

 Score =  296 bits (757), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 225/334 (67%), Gaps = 28/334 (8%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F V+G QVEE+WSLDD+  ++LKP++GLIFLFKW  
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDDLKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFT 123
            ++ S      D  +D+ ++FAKQVINNACATQAILS+LLNC  P I LG  L+ FK+F 
Sbjct: 61  DDELSGTIVR-DHRLDK-IFFAKQVINNACATQAILSVLLNCKHPDISLGPNLEEFKNFC 118

Query: 124 RLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALY 183
           + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +D+FHF+SY+P+ G LY
Sbjct: 119 QSFDANMRGLALSNSDVIREVHNSFSRQTLFEYDS--KQASKDDDVFHFVSYIPIDGHLY 176

Query: 184 ELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           ELDGL  GP++L PC  G+ W++  +P+IQ+R+++Y   EI FNL+A++ +R+ +Y    
Sbjct: 177 ELDGLKEGPIDLCPCPVGEQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTLYE--- 233

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
                  R  +N  + +EL     ER Q L  IE E  K KRY+ EN  RKHN++  I  
Sbjct: 234 -------RQKANVCDPAEL-----ERLQAL--IEEEIRKSKRYQIENIRRKHNYLPLIME 279

Query: 303 IIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           +++ILA+ G+L   +   +K   K ++  ++K K
Sbjct: 280 LLKILAKEGKL---VPLYQKAKDKALEKESKKNK 310



>gi|449527357|ref|XP_004170678.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like,
           partial [Cucumis sativus]
          Length = 308

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 211/307 (68%), Gaps = 24/307 (7%)

Query: 37  VEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVDENVYFAKQVINNACA 96
           VEE++SLD  +L  ++P+YGLIFLFKW+ G+   RL        + N++FA QVINNACA
Sbjct: 1   VEELYSLDLHSLNNMRPIYGLIFLFKWRPGDKDDRL---VIKDPNPNLFFASQVINNACA 57

Query: 97  TQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFL 156
           TQAILSIL+NCP ID+G EL   KDFT+ F P  KGLAI NSE IR  HNSFAR +PF  
Sbjct: 58  TQAILSILMNCPDIDIGPELSKLKDFTKNFPPELKGLAINNSEAIRTAHNSFARPEPFVP 117

Query: 157 DQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDN----WLEKVRPVIQ 212
           D+  ++SS+ +D++HFISY+P++G LYELDGL +GP++ GPC G +    WL+ V+PVIQ
Sbjct: 118 DE-QKASSKDDDVYHFISYIPIEGVLYELDGLKDGPISHGPCPGSHGDLEWLKMVQPVIQ 176

Query: 213 ERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER----------------MRHASNTN 256
           ER+ RY+ +EIRFNL+A+IKNR+++Y   + E+ ++                + H++N  
Sbjct: 177 ERIERYSKSEIRFNLMAIIKNRKEMYTVELKELQKKRERILQQLAALQSETLLEHSNNEF 236

Query: 257 NSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQAR 316
            +  L +++   +   ++I ME+ K K++  EN  RKHN+I F++N ++ILAE+ +L+  
Sbjct: 237 LNKSLSEVNAGIESATEKILMEEEKLKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPL 296

Query: 317 IEYARKE 323
           IE A+++
Sbjct: 297 IEKAKQK 303



>gi|330792465|ref|XP_003284309.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium
           purpureum]
 gi|325085762|gb|EGC39163.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium
           purpureum]
          Length = 333

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 204/326 (62%), Gaps = 19/326 (5%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M D   WC IESDPGVFTELI    V+  QVEE++SLD    + LKPV GLIFLFKW+  
Sbjct: 1   MGDNEGWCTIESDPGVFTELIDKIGVKDIQVEEIYSLDSSEYDRLKPVLGLIFLFKWEKD 60

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
           +D+ ++    DL      +FA QVI NACATQAILS+LLN   I+LG EL NFK F   F
Sbjct: 61  DDNRQISDNQDL------FFANQVIQNACATQAILSVLLNAEGIELGEELSNFKQFVGDF 114

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P  KG AI NS+LI+  HNSF   DPF   ++   S + +D FHFIS++P QG +YELD
Sbjct: 115 PPMMKGEAIGNSDLIKTTHNSFTVQDPFIFSKS--KSKKPQDAFHFISFIPFQGKVYELD 172

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GL  GP  LG CT +NWLE   P IQ+R+ +Y+  EIRFNL+A+IKNR+   + +I E++
Sbjct: 173 GLKEGPYCLGDCTPENWLEVATPFIQKRIEKYSQGEIRFNLMAVIKNRQTTLKEKISELE 232

Query: 247 ERMRHASNTNNSSELMQLSEERDQLLQRIE-----------MEKVKFKRYERENSLRKHN 295
           ++        ++ EL    +E DQLL  I            ME+ KF+ ++ EN  RKHN
Sbjct: 233 KKKEIIEKKLSTIELPNSKDELDQLLMDINENIQDYNNDILMEQEKFRNWKDENIRRKHN 292

Query: 296 FIQFIYNIIRILAERGELQARIEYAR 321
           F  FI N+++ LAE+ +LQ  I+  +
Sbjct: 293 FTPFILNLVKALAEKEQLQPLIQKTK 318



>gi|321477780|gb|EFX88738.1| hypothetical protein DAPPUDRAFT_191310 [Daphnia pulex]
          Length = 318

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 212/326 (65%), Gaps = 30/326 (9%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+DAG WCLIESDPGVF+ELIR F VQG QVEE+WSLD +  + LKP++GLIFLFKW   
Sbjct: 1   MADAGNWCLIESDPGVFSELIRDFEVQGVQVEELWSLDPEQFDNLKPIHGLIFLFKWVPN 60

Query: 67  ND-------SSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELD 117
            +        SRL         + ++FAKQVINNACATQAI+SILLNC  P + LG  L 
Sbjct: 61  EEVVGTVVQDSRL---------DKIFFAKQVINNACATQAIISILLNCKHPDLHLGPTLG 111

Query: 118 NFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVP 177
            FK+FT+ FD   KGLA++NS+ IR VHNSFAR   F  D   ++SS+ +D FHF+ YVP
Sbjct: 112 EFKEFTQAFDANMKGLALSNSDTIRSVHNSFARQTLFEFD--SKASSKDDDTFHFVGYVP 169

Query: 178 VQGALYELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           V G LYELDGL  GP++LG    + +W++ VRP+I++R+ RY+  EI FNL+A++ +R+ 
Sbjct: 170 VDGRLYELDGLKEGPIDLGAVPAETDWIDVVRPIIEKRIQRYSEGEIHFNLMAIVPDRKL 229

Query: 237 VYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNF 296
            ++  I    ER++     +       +  E  +LL   E E+ K KR + EN  RKHN+
Sbjct: 230 AWQKEI----ERLQSQPVVSTD-----MQTEIQRLLMLCEEEESKRKRQKIENVRRKHNY 280

Query: 297 IQFIYNIIRILAERGELQARIEYARK 322
           +  I  ++R+L E+G+L    E A++
Sbjct: 281 LPLIVQLLRMLGEKGQLLPLYEKAKQ 306



>gi|303276184|ref|XP_003057386.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461738|gb|EEH59031.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 339

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 213/340 (62%), Gaps = 38/340 (11%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IESDPGVFTELI+   V+G QVEE+++LD+  L+ + PVYGLIFLFKW+ G+     
Sbjct: 3   WTTIESDPGVFTELIQEMGVKGVQVEELYALDEDLLKSMAPVYGLIFLFKWRSGD----- 57

Query: 73  HPEADLSVDEN---VYFAKQVINNACATQAILSILLNCP-TIDLGAELDNFKDFTRLFDP 128
            P A +  D N   V+FA QVI NACATQAILSIL+NCP ++ LGAEL N K+FT  FD 
Sbjct: 58  PPSAPVETDANANGVFFASQVITNACATQAILSILMNCPPSVTLGAELANMKEFTAEFDA 117

Query: 129 YDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGL 188
             KGLAI+NSE IR  HNSFAR +P    + ++ + + +D+FHFI+Y+PV G LYELDGL
Sbjct: 118 DLKGLAISNSETIRKAHNSFARPEPIM--EPEREAKKDDDVFHFIAYMPVNGVLYELDGL 175

Query: 189 SNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
             GP++ G CT D+W+ K  PVIQ R+ +Y S+EIRFNL+ALIK++ D    R   ++ R
Sbjct: 176 KKGPISHGACTDDDWMGKACPVIQSRIEKYASSEIRFNLMALIKSKRDALEERAQTLEGR 235

Query: 249 MRHASNT------NNSSELMQLSEERDQL----------LQRIEMEKVKFK--------- 283
            +   +           E M + +    L          + RIE+E  + +         
Sbjct: 236 KQRCLSALGGGGGGGGGEGMDVDDPDGPLPVGDDALNAEVARIEVEIARSRGEVEAELER 295

Query: 284 --RYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
             R+  EN  RKHN+I FI+N +++LAE+ +L+  IE AR
Sbjct: 296 RGRWRDENIRRKHNYIPFIFNFLKVLAEKKKLEPLIEKAR 335



>gi|307195472|gb|EFN77358.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Harpegnathos
           saltator]
          Length = 311

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 221/322 (68%), Gaps = 27/322 (8%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKW-Q 64
           M+D AG WCLIESDPGVFTELI+ F V+G QVEE+WSLDD+  + LKP++GLIFLFKW Q
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQ 60

Query: 65  GGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
               S  +  ++ L   + ++FAKQ+INNACATQAILS+LLNC    I LG  L++FK+F
Sbjct: 61  DDELSGNIVQDSRL---DKIFFAKQIINNACATQAILSVLLNCKHADISLGPNLEDFKNF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            + FD   +GLA++NS++IR VHNSF+R   F  D   + +S+ +++FHF+SYVP+ G L
Sbjct: 118 CQSFDANMRGLALSNSDVIREVHNSFSRQTVFEYDS--RQASKDDNVFHFVSYVPIDGRL 175

Query: 183 YELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL +GP++LGPC  G+ W++  +P+IQ+R+++Y   EI FNL+A++ +R+ +Y   
Sbjct: 176 YELDGLKDGPMDLGPCPVGEQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTLYE-- 233

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
                   R  +N  + +E+     ER Q L  IE E  K KRY+ EN  RKHN++  I 
Sbjct: 234 --------RQKANICDPAEM-----ERLQAL--IEEEIRKSKRYQIENIRRKHNYLPLIM 278

Query: 302 NIIRILAERGELQARIEYARKE 323
            +++ILA+ G+L    + A+++
Sbjct: 279 ELLKILAKEGKLVPLYQKAKEK 300



>gi|156550354|ref|XP_001607168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Nasonia vitripennis]
          Length = 311

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 155/338 (45%), Positives = 219/338 (64%), Gaps = 34/338 (10%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG 65
           M+D AG WCLIESDPGVFTELI+ F V+G QVEE++SLDD   E +KP++GLIFLFKW  
Sbjct: 1   MADMAGNWCLIESDPGVFTELIKEFGVKGVQVEELYSLDDDQFENVKPIHGLIFLFKWVQ 60

Query: 66  GNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFK 120
            ++     P   +  D   + ++FAKQVINNACATQAILS+LLNC   D  LG  L+  K
Sbjct: 61  DDE-----PSGAIVQDNRLDKIFFAKQVINNACATQAILSVLLNCKHADMSLGPNLEELK 115

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
            F + FDP  KGLA++NS++IR VHNSFAR   F +D   + S++ ED+FHF+SYVP+ G
Sbjct: 116 TFCQCFDPKMKGLALSNSDVIREVHNSFARQTLFEIDS--KHSAKDEDVFHFVSYVPIDG 173

Query: 181 ALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
            LYELDGL  GP++LGPC +GD W++  +P I++R+ +Y   EI FNL+A++ +R+ +Y 
Sbjct: 174 RLYELDGLKEGPIDLGPCPSGDQWVQAAKPTIEKRIKKYNEGEIHFNLMAIVSDRKMLYE 233

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                     R  S T +  E+ +L          I+ E  K K+Y+ EN  RKHN++  
Sbjct: 234 ----------RQKSLTTDPGEIARLQ-------ALIDEEIWKSKKYKIENIRRKHNYLPL 276

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKKG 337
           I  +++ILA+ G+L   +   +K   + I+  ++K+K 
Sbjct: 277 IIELLKILAKEGKL---VPLYQKAKERAIEKESKKQKA 311



>gi|195014425|ref|XP_001984019.1| GH16209 [Drosophila grimshawi]
 gi|193897501|gb|EDV96367.1| GH16209 [Drosophila grimshawi]
          Length = 324

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 225/330 (68%), Gaps = 16/330 (4%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD+++ ++L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDNESFKDLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D ++++FAKQVINNACATQAILS+LLN     I LG  L NFK+F + F
Sbjct: 64  ----PAGKVVLDRDHIFFAKQVINNACATQAILSLLLNLNHEDIKLGDTLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKD--EDVYHFVGYMPIAGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y     +I
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQ---QI 234

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
           D+ +  A++  ++++  Q   E + L   I+ E  K KRY+ EN  RKHN++ FI  +++
Sbjct: 235 DKLLNPAADAMDTADDRQ--TEINSLRSYIQYEIEKKKRYKVENVRRKHNYLPFIVELLK 292

Query: 306 ILAERGELQARIEYARKEMSKRIKDRAEKK 335
           +L E G+L    E A++   +R +  ++K+
Sbjct: 293 MLGETGQLLPIYEKAKQRALEREQKLSKKE 322



>gi|351697057|gb|EHA99975.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, partial
           [Heterocephalus glaber]
          Length = 361

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 220/366 (60%), Gaps = 57/366 (15%)

Query: 1   RVYTTKMS-DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIF 59
           R  +  M+ +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIF
Sbjct: 4   RCVSGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIF 63

Query: 60  LFKWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGA 114
           LFKWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG 
Sbjct: 64  LFKWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGE 118

Query: 115 ELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFIS 174
            L  FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+S
Sbjct: 119 TLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVS 176

Query: 175 YVPVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSR----------------- 217
           YVPV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +                 
Sbjct: 177 YVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKKGGRNKCGREGTGLSSV 236

Query: 218 --------------------YTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHA 252
                                   EIRFNL+A++ +R+ +Y  +I E+     +E     
Sbjct: 237 PSAAPSVPAVFSLHDQVPLWAVEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDT 296

Query: 253 SNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGE 312
              NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +
Sbjct: 297 DQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQ 354

Query: 313 LQARIE 318
           L   +E
Sbjct: 355 LIPLVE 360



>gi|348577983|ref|XP_003474763.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Cavia porcellus]
          Length = 320

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 218/330 (66%), Gaps = 28/330 (8%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++L          ++RPVI++ + +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 176 YELDGLREGPIDLV---------QLRPVIEKWIQKYSEGEIRFNLMAIVSDRKMIYEQKI 226

Query: 243 GEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
            E+     +E        NN    +Q    ++Q+L  IE E  K KRY+ EN  RKHN++
Sbjct: 227 AELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYL 284

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 285 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 314



>gi|312096876|ref|XP_003148804.1| ubiquitin C-terminal hydrolase UCH-L5 [Loa loa]
 gi|307756031|gb|EFO15265.1| ubiquitin carboxy terminal hydrolase UCH-L5 [Loa loa]
          Length = 322

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 218/334 (65%), Gaps = 22/334 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSDAG WCLIESDPGVFTEL+R F V G QVEE++SLD +   +LKPV+GLIFLFKW+ G
Sbjct: 1   MSDAGNWCLIESDPGVFTELVRGFGVSGVQVEELYSLDKELFSDLKPVHGLIFLFKWRAG 60

Query: 67  NDSSRLHPEADLSVDEN-VYFAKQVINNACATQAILSILLNCPT---IDLGAELDNFKDF 122
            +     P   L +D N V+FA+QVI NACATQAI+++LLN      I LG  L+ FK F
Sbjct: 61  EE-----PCGSLVLDNNRVFFAQQVIQNACATQAIINLLLNTKPESGIALGPILEEFKSF 115

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           T+ FDP ++GL + NSE IR VHNSF+R   F   + D  + EKED +HFI+Y+PV G +
Sbjct: 116 TQNFDPMNRGLCLGNSEPIRKVHNSFSRQHLF---ELDIKAPEKEDNYHFITYIPVDGHI 172

Query: 183 YELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL   P++LG    G++WL+ VRP+I  R+ +Y++ EI FNL+A+I +R+  Y+ R
Sbjct: 173 YELDGLREAPLDLGAIREGEDWLDAVRPIINARIRKYSAGEIHFNLMAVISDRKMKYQKR 232

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           + E+ E      +           EE + L   I  E+ K K ++ EN  R+HN+I FI 
Sbjct: 233 LTELAELTMETDSK---------VEEMNHLQALIAAEEEKEKSFKAENIRRRHNYIPFIV 283

Query: 302 NIIRILAERGELQARIEYARKEMSKRIKDRAEKK 335
            ++++LA+ G L   ++ A+++ +++  ++  +K
Sbjct: 284 ELLKVLAKEGRLVPLVQEAQEKANRKATEKKSEK 317



>gi|159476586|ref|XP_001696392.1| ubiquitin carboxyl-terminal hydrolase [Chlamydomonas reinhardtii]
 gi|158282617|gb|EDP08369.1| ubiquitin carboxyl-terminal hydrolase [Chlamydomonas reinhardtii]
 gi|294845988|gb|ADF43147.1| UBCH1p [Chlamydomonas reinhardtii]
          Length = 331

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 208/334 (62%), Gaps = 33/334 (9%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
           +W  IESDPGVFTELI    V+G QVEE+WSLD   L EL PV+GL+FLFKW+       
Sbjct: 2   EWTTIESDPGVFTELIENIGVKGVQVEELWSLDQ--LRELSPVFGLVFLFKWK----KEP 55

Query: 72  LHPEADLSVDENVYFAKQVINNACATQAILSILLN--CPTIDLGAELDNFKDFTRLFDPY 129
           + P       + V+FAKQVI+NACATQAIL+ILLN   P +DLG EL N ++F   FDP 
Sbjct: 56  VRPATTTDAGQ-VFFAKQVISNACATQAILNILLNVKAPGLDLGTELANLREFVSDFDPT 114

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
            KGLAI+NS+LIR  HNSFAR +P   D  D+   +  D +HFISYVPV G L+ELDGL 
Sbjct: 115 MKGLAISNSDLIRTAHNSFARPEPLVPD-NDKDDEKSGDAYHFISYVPVGGKLFELDGLQ 173

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI------- 242
            GP+ L  CT D+WL+KV P I  RM RY ++EIRFNL+AL+ NR D++ +R+       
Sbjct: 174 EGPIELCDCTDDDWLDKVGPHITARMERYAASEIRFNLMALVGNRVDIFSSRLAAATAQR 233

Query: 243 -----------GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
                      G  DE + HA      ++L++   E   L + +  E+ K + +  EN  
Sbjct: 234 DQLAAAAAAADGMSDEDLAHA-----QAKLLEAETEVANLQEALAAEQAKHRTWHEENVR 288

Query: 292 RKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
           RKHN++  ++ +++++A RG++   +E AR+  +
Sbjct: 289 RKHNYVPCLFQLLKLMAARGQMGPLLERARRPAA 322



>gi|478261817|gb|ENN80940.1| hypothetical protein YQE_02645, partial [Dendroctonus ponderosae]
          Length = 323

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 212/326 (65%), Gaps = 18/326 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPG+F+ELIR F  +G QVEE+W+LD+QT E L PV+GLIFLFKW    DS
Sbjct: 5   AGDWCLIESDPGIFSELIREFGCKGVQVEELWTLDNQTFETLMPVHGLIFLFKWT--KDS 62

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
           S  +P   +  D   + ++FAKQVI NACATQAILSILLNC  P + +G  L   K+F +
Sbjct: 63  S--NPSGSIVQDSRLDKIFFAKQVIENACATQAILSILLNCRHPDVKIGPTLTELKEFCQ 120

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL I+NS++I  VHNSFAR   F  D    SS ++ED +HFISYVP+ G LYE
Sbjct: 121 GFDANMKGLTISNSQVISSVHNSFARQQIFEFDPN--SSKKQEDAYHFISYVPIDGRLYE 178

Query: 185 LDGLSNGPVNLGPCTGDN-WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL +GP++LG    D  W   V+P+I++RM RY+  EI FNL+A++ +R+ +Y  RI 
Sbjct: 179 LDGLKSGPIDLGVIPADTEWTSVVKPIIEQRMKRYSEGEIHFNLMAIVTDRKLLYERRIE 238

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           EI +++       ++  +++       LL  IE E+ K  +Y+ EN  RKHN++  I  I
Sbjct: 239 EIQKKIDAGVTDASTINMLR----HYNLL--IEEEEQKRNQYKIENIRRKHNYLPLIVEI 292

Query: 304 IRILAERGELQARIEYARKEMSKRIK 329
           ++ILA  G+L    E A++   K+ K
Sbjct: 293 MKILAREGKLMPLYEKAKERALKKQK 318



>gi|119611641|gb|EAW91235.1| ubiquitin carboxyl-terminal hydrolase L5, isoform CRA_c [Homo
           sapiens]
          Length = 405

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 219/345 (63%), Gaps = 28/345 (8%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 64  VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 123

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 124 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 178

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 179 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 236

Query: 177 PVQGALYELDGLSNGPVNLGPC---------TGDNWLEKVRPVIQERMSRYTSAEIRFNL 227
           PV G LYELDGL  GP++LG           TG+N L      +  + SRY+  EIRFNL
Sbjct: 237 PVNGRLYELDGLREGPIDLGNAVPVPDISLLTGENLLGIYPHSVLLKFSRYSEGEIRFNL 296

Query: 228 LALIKNREDVYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKF 282
           +A++ +R+ +Y  +I E+     +E        N+    +Q    ++Q+L  IE E  K 
Sbjct: 297 MAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQML--IEEEVQKL 354

Query: 283 KRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+++ + +
Sbjct: 355 KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 399



>gi|241087438|ref|XP_002409195.1| ubiquitin C-terminal hydrolase, putative [Ixodes scapularis]
 gi|215492664|gb|EEC02305.1| ubiquitin C-terminal hydrolase, putative [Ixodes scapularis]
          Length = 327

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 206/310 (66%), Gaps = 18/310 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELI+ F V+G QVEE+WSLD  + E+LKPV+GLIFLFKW    + 
Sbjct: 8   AGDWCLIESDPGVFTELIKGFGVKGVQVEELWSLDRDSFEKLKPVHGLIFLFKWYKNEE- 66

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAILS+LLN   P I LG  L +F+DF +
Sbjct: 67  ----PSGSVVQDNRLDKIFFAKQVINNACATQAILSVLLNVKHPDISLGETLLSFRDFCQ 122

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL ++NS++IR VHNSF+R   F  D   + SS+ +D++HFI YVP+ G LYE
Sbjct: 123 SFDATMKGLTLSNSDVIREVHNSFSRQQMFEFDV--KQSSKDDDVYHFIGYVPIDGRLYE 180

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL +GP++LGP     +W++ VRPVI+ R+ +Y   EI FNL+A+I +R+ VY+ ++ 
Sbjct: 181 LDGLKDGPIDLGPIPQQADWIDMVRPVIEGRIKQYNEGEIHFNLMAMITDRKLVYQKQLD 240

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
            +  R+        + E   L  E  +L   I+ E+ K KRY+ EN  RKHN++  I  I
Sbjct: 241 ALTSRL-----AAGAMETDDLHSEISKLHMLIQEEENKSKRYKVENIRRKHNYLPLIMEI 295

Query: 304 IRILAERGEL 313
           ++IL+E  +L
Sbjct: 296 LKILSEEKKL 305



>gi|470401324|ref|XP_004335580.1| ubiquitin carboxylterminal hydrolase L5, putative [Acanthamoeba
           castellanii str. Neff]
 gi|440792342|gb|ELR13567.1| ubiquitin carboxylterminal hydrolase L5, putative [Acanthamoeba
           castellanii str. Neff]
          Length = 316

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 155/337 (45%), Positives = 217/337 (64%), Gaps = 33/337 (9%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           A  WC IESDPGVFTELI    V+  QVEE++ LD + L+ LKPV+GLIFLFKW+     
Sbjct: 2   ADNWCTIESDPGVFTELIEEIGVKDCQVEELYVLDQENLQRLKPVHGLIFLFKWRADESD 61

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPY 129
           +R     +   D +V+FA QVINNACATQAILSILLN   +DLG EL  FK+F++ F P 
Sbjct: 62  NRA---TESPFDTDVFFANQVINNACATQAILSILLNASKVDLGEELAQFKEFSQEFPPE 118

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
            +GLAI+NS+LIR                 D+SS   ED++HFISY+P +G LYELDGL 
Sbjct: 119 MRGLAISNSDLIR----------------RDESS---EDVYHFISYLPYKGRLYELDGLK 159

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI------- 242
            GP+NLGPCT ++WLEKV P IQ+R+ +Y  +EIRFNL+A+IKNR  VY+ ++       
Sbjct: 160 KGPINLGPCTEEDWLEKVCPEIQKRIEKYARSEIRFNLMAIIKNRVTVYKEQVQDFENQK 219

Query: 243 GEIDERMRHASNTNNSSELMQ----LSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
            +++ R+    +   +  L Q    L+++     + I++E+ K K +  EN  RKHN+I 
Sbjct: 220 ADVNTRLMDLQDGPEADNLRQQLALLNDQISTCQEAIKLEEDKRKNWRLENIRRKHNYIP 279

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKRIKDRAEKK 335
           FI N+++ILAE+G+L   +E A+   ++  + R +K+
Sbjct: 280 FIMNMLKILAEKGQLVDLVERAKSREAEEKERRKDKQ 316



>gi|470250558|ref|XP_004358376.1| peptidase C12 family protein [Dictyostelium fasciculatum]
 gi|328872159|gb|EGG20526.1| peptidase C12 family protein [Dictyostelium fasciculatum]
          Length = 349

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 157/343 (45%), Positives = 208/343 (60%), Gaps = 35/343 (10%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MS    WC IESDPGVFTELI    V+  QVEE++SLD     +LKPVYGL+FLFKW G 
Sbjct: 1   MSGNDGWCTIESDPGVFTELIENMGVKDVQVEELYSLDASEFSKLKPVYGLVFLFKWDGK 60

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
           + SS   P      ++ ++FAKQVINNACATQAILSIL+N   I++  EL NFKDF +  
Sbjct: 61  HYSSSQEP----CDNQELFFAKQVINNACATQAILSILMNNKDIEMSDELTNFKDFCKFL 116

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P D+G AI N + I+  HNSFAR + F     +    +KED FHF+SY+P +G LYELD
Sbjct: 117 MPEDRGDAIGNCDAIKRAHNSFARPESF---DFESKGGKKEDAFHFVSYIPFEGKLYELD 173

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDV--------- 237
           GLS GP+  G C  + WLE V+P+IQ+R+++YTS EIRFNL+A++KNR+ +         
Sbjct: 174 GLSRGPICHGECDDETWLELVQPIIQQRIAKYTSDEIRFNLMAVVKNRKKILSNQKNYLE 233

Query: 238 ------------YRTRIG--EIDERMRHASNTNNSSE-----LMQLSEERDQLLQRIEME 278
                       + T +   +IDE      N   + E     L ++ E  + + Q I ME
Sbjct: 234 GKKNAILLKLSQFDTAVTAMDIDESAFIKYNLPTTKEELDLLLAEMDEHLETIDQNIMME 293

Query: 279 KVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
             KF+ +  EN  RKHN+I FI  +++ILAER EL   I  A+
Sbjct: 294 DEKFRNWREENIRRKHNYIPFIIKLLQILAERQELIPLINKAK 336



>gi|460401489|ref|XP_004246256.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Solanum lycopersicum]
          Length = 318

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 211/319 (66%), Gaps = 24/319 (7%)

Query: 27  IRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVDENVYF 86
           ++   V+G QVEE++SLD   L  L+PV+GLIFLFKW+ G    RL        + N++F
Sbjct: 1   MQQMQVKGVQVEELYSLDLDELNSLRPVFGLIFLFKWRPGEKDDRL---VIKDPNPNLFF 57

Query: 87  AKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHN 146
           A QVINNACATQAILSILLN P +D+G EL   K+FT+ F P  KGLAI NSE IR  HN
Sbjct: 58  ASQVINNACATQAILSILLNSPDVDIGPELSALKEFTKNFPPELKGLAINNSEAIRTAHN 117

Query: 147 SFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDN---- 202
           SFAR +P F+ +  +++ + +D++HFISY+PV G LYELDGL  GP++LGPC G      
Sbjct: 118 SFARPEP-FVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCPGGQGDIE 176

Query: 203 WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER---------MRHAS 253
           WL  V+PVIQER+ RY+ +EIRFNL+A++KNR++VY   + E+ +R            + 
Sbjct: 177 WLRMVQPVIQERIERYSQSEIRFNLMAVVKNRKEVYTAELKELQKRRERILQQLAASQSE 236

Query: 254 NTNNSSELMQLSEERDQLLQRIEM-------EKVKFKRYERENSLRKHNFIQFIYNIIRI 306
              +SS++  L++   ++   IE        E+ KFK+++ EN  RKHN+I F++N ++I
Sbjct: 237 RVVDSSQVESLNKSLAEVNSGIEAVSDKILREEEKFKKWKTENIRRKHNYIPFLFNFLKI 296

Query: 307 LAERGELQARIEYARKEMS 325
           LAE+ +L+  IE A+++ +
Sbjct: 297 LAEKKQLRPLIEKAKQKTT 315



>gi|426333099|ref|XP_004028123.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Gorilla gorilla gorilla]
          Length = 520

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 204/300 (68%), Gaps = 18/300 (6%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V      +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLF
Sbjct: 221 VARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLF 280

Query: 62  KWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAEL 116
           KWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L
Sbjct: 281 KWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETL 335

Query: 117 DNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYV 176
             FK+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYV
Sbjct: 336 SEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFD--TKTSAKEEDAFHFVSYV 393

Query: 177 PVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
           PV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ 
Sbjct: 394 PVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKM 453

Query: 237 VYRTRIGEI-----DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVK-FKRYERENS 290
           +Y  +I E+     +E        N+    +Q    ++Q+L   E++K+K +K  E++N+
Sbjct: 454 IYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKAKEKQNA 513



>gi|195376419|ref|XP_002046994.1| GJ13185 [Drosophila virilis]
 gi|194154152|gb|EDW69336.1| GJ13185 [Drosophila virilis]
          Length = 325

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 217/330 (65%), Gaps = 17/330 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F   G QVEE+WSLD ++ ++L+P++GLIFLFKW   ++ 
Sbjct: 5   AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKDLEPIHGLIFLFKWVQEDE- 63

Query: 70  SRLHPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
               P   + +D ++++FAKQVINNACATQAILS+LLN     I LG  L NFK+F + F
Sbjct: 64  ----PVGKVVLDRDHIFFAKQVINNACATQAILSLLLNLNHEDIKLGETLTNFKEFCQCF 119

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DPY+KGL ++N+  IR VHNSFAR   F LD  +Q+    ED++HF+ Y+P+ G LYELD
Sbjct: 120 DPYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKD--EDVYHFVGYMPIAGRLYELD 177

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL  GP++LG    + NW++ VRP+I++RM RY+  EI FNL+ALI +R+ +Y     +I
Sbjct: 178 GLREGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQ---QI 234

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEME-KVKFKRYERENSLRKHNFIQFIYNII 304
           D+ +  A+N  +++E  Q   E + L   I           + EN  RKHN++ FI  ++
Sbjct: 235 DKLLNPAANAMDTAEDRQ--TEINSLRSYIHFYINCNLLLLQVENVRRKHNYLPFIVELL 292

Query: 305 RILAERGELQARIEYARKEMSKRIKDRAEK 334
           ++L E G+L    E A++   +R +  ++K
Sbjct: 293 KMLGETGQLLPIYEKAKQRALEREQKMSKK 322



>gi|66808765|ref|XP_638105.1| peptidase C12 family protein [Dictyostelium discoideum AX4]
 gi|74853805|sp|Q54N38.1|UCHL5_DICDI RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5;
           Short=UCH-L5; AltName: Full=Ubiquitin thioesterase L5
 gi|60466549|gb|EAL64601.1| peptidase C12 family protein [Dictyostelium discoideum AX4]
          Length = 343

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 209/346 (60%), Gaps = 33/346 (9%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MS+   WC IESDPGVFTELI    V+  QVEE+++LD    + LKPV GLIFLFKW+  
Sbjct: 1   MSENEGWCTIESDPGVFTELITKIGVKDIQVEELYTLDSSEYDRLKPVLGLIFLFKWEKE 60

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
            ++  +      S +EN++FA QVI NACATQAILS+LLN   I+LG EL NFK F   F
Sbjct: 61  EENRTI------SDNENIFFANQVIQNACATQAILSVLLNSEGIELGEELSNFKSFVGDF 114

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P  KG AI NSELI+  HNSF   DPF    + + + +  D FHFIS++P QG +YELD
Sbjct: 115 PPMMKGEAIGNSELIKETHNSFTVQDPFIF--SKKKNRKPSDAFHFISFIPFQGKVYELD 172

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GL  GP  LG CT DNWLE   P IQ+RM +Y+  EIRFNL+A+IKNR+   + +I  ++
Sbjct: 173 GLKKGPYCLGDCTPDNWLEIATPFIQKRMEKYSQGEIRFNLMAVIKNRQTTLQEKILTLE 232

Query: 247 ER----------MRHASNTNNSSE---------------LMQLSEERDQLLQRIEMEKVK 281
           ++          +   S  +N  E               +  ++ + ++    I ME+ K
Sbjct: 233 KKKNDLEIKLSELNSGSGGDNKEESGGATPTTKEDLNFMINVVNNDIEEANNEILMEQEK 292

Query: 282 FKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           F+ ++ EN  RKHNF   I N+I+ LAE+  LQ  I+ A+ ++S++
Sbjct: 293 FRNWKDENIRRKHNFTPLILNLIKGLAEKDNLQPLIQKAKDQISQK 338



>gi|410921992|ref|XP_003974467.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Takifugu rubripes]
          Length = 307

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 149/334 (44%), Positives = 210/334 (62%), Gaps = 41/334 (12%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  + LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFDNLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC    + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIVSVLLNCFHSDMSLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHN FA                        SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNGFA------------------------SYVPVNGRLYE 155

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 156 LDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 215

Query: 245 IDERMRH--ASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 216 LQTQLTQDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKVENIRRKHNYLPF 273

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAE 333
           I  +++ LAE  +L   +E A+++ S +    A+
Sbjct: 274 IMELLKTLAEHQQLMPLVEKAKEKQSAKKAQEAK 307



>gi|170581201|ref|XP_001895580.1| ubiquitin C-terminal hydrolase UCH-L5 [Brugia malayi]
 gi|158597396|gb|EDP35553.1| ubiquitin C-terminal hydrolase UCH-L5, putative [Brugia malayi]
          Length = 301

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 208/317 (65%), Gaps = 22/317 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSDAG WCLIESDPGVFTELIR F V G QVEE++SLD Q   +LKPV+GLIFLFKW+ G
Sbjct: 1   MSDAGNWCLIESDPGVFTELIRGFGVSGVQVEELYSLDKQLFSDLKPVHGLIFLFKWRAG 60

Query: 67  NDSSRLHPEADLSVDEN-VYFAKQVINNACATQAILSILLNCPT---IDLGAELDNFKDF 122
            +     P   L +D N V+FA+QVI NACATQA++++LLN  T   I LG  L+ FK F
Sbjct: 61  EE-----PCGSLVLDNNRVFFAQQVIQNACATQALINLLLNTKTESGIVLGPILEEFKSF 115

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           T+ FDP ++GL + NSE IR VHNSF+R   F   + D  + EKED +HFI+Y+PV G +
Sbjct: 116 TQNFDPMNRGLCLGNSEPIRKVHNSFSRQHLF---ELDIKAPEKEDNYHFITYIPVDGHI 172

Query: 183 YELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL   P++LG    G++WL+ VRP+I  R+ +Y++ EI FNL+A+I +R+  Y+ R
Sbjct: 173 YELDGLREAPLDLGAIREGEDWLDAVRPIINARIRKYSAGEIHFNLMAVISDRKMKYQKR 232

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           + E+ E    A  T+N        EE + L   I  E+ K K ++ EN  R+HN+I+   
Sbjct: 233 LAELAES---AMETDNK------VEEMNHLQALIAAEEEKEKSFKAENIRRRHNYIKAQE 283

Query: 302 NIIRILAERGELQARIE 318
             IR   E+   ++R++
Sbjct: 284 KAIRKATEKKSEKSRVK 300



>gi|345325309|ref|XP_001516535.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Ornithorhynchus anatinus]
          Length = 339

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 212/319 (66%), Gaps = 19/319 (5%)

Query: 19  DPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADL 78
           +PG      RA   +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +
Sbjct: 24  EPGSVHGPSRARGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSV 78

Query: 79  SVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGL 133
             D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGL
Sbjct: 79  VQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEFSQSFDAAMKGL 138

Query: 134 AITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPV 193
           A++NSE+IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP+
Sbjct: 139 ALSNSEVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVSGRLYELDGLREGPI 196

Query: 194 NLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RH 251
           +LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+  ++    
Sbjct: 197 DLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEE 256

Query: 252 ASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILA 308
             +T+ SS ++   Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LA
Sbjct: 257 PMDTDQSSNMLSSIQSEVAKNQML--IEEEIQKLKRYKIENIRRKHNYLPFIMELLKTLA 314

Query: 309 ERGELQARIEYARKEMSKR 327
           E  +L   +E A+++ + +
Sbjct: 315 EHQQLIPLVEKAKEKQNAK 333



>gi|325188055|emb|CCA22598.1| ubiquitin carboxylterminal hydrolase putative [Albugo laibachii
           Nc14]
          Length = 317

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 208/316 (65%), Gaps = 21/316 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS--- 69
           WC IESDPGVFT L++   V+G Q+EE++SLD +  + + PVYGLIFLFKW+    +   
Sbjct: 3   WCTIESDPGVFTALLKDIGVKGAQMEELYSLDREQFQSMGPVYGLIFLFKWEKSQHTVPP 62

Query: 70  -SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDP 128
            +   P+      EN++FAKQVI+NACATQAILSI+LN   +D+G  L  FK FTR F P
Sbjct: 63  ETTCTPKGSTPPPENLFFAKQVISNACATQAILSIVLNAAELDIGDTLREFKSFTRDFPP 122

Query: 129 YDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGL 188
             KGLAI+NSELIR  HNSFAR DPF +++    + + E ++HFI+YVPV G +YELDGL
Sbjct: 123 DLKGLAISNSELIRQAHNSFARPDPFVMEERKHENDDDE-VYHFIAYVPVNGKVYELDGL 181

Query: 189 SNGPVNLG--PCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
              P+++G  P T ++    WL+   P IQ R+ +Y ++EIRFNLLALI+NR DVY+  +
Sbjct: 182 QEEPISIGNIPATSNSNNTAWLDIACPKIQARIEKYATSEIRFNLLALIRNRSDVYQHEV 241

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
            ++  + R      +   L  +++ +D + Q    E  K K++  EN+ RKHN+I F+  
Sbjct: 242 EKLQVQTR------SPESLSAIAQYQDMICQ----EGYKQKQWVLENARRKHNYIPFVVQ 291

Query: 303 IIRILAERGELQARIE 318
           +++ILAE+ +L+  I+
Sbjct: 292 LLKILAEKNQLEPLIQ 307



>gi|449268149|gb|EMC79019.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, partial [Columba
           livia]
          Length = 304

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 209/306 (68%), Gaps = 16/306 (5%)

Query: 34  GTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAKQV 90
           G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FAKQV
Sbjct: 4   GAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAKQV 58

Query: 91  INNACATQAILSILLNCPT--IDLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSF 148
           INNACATQAI+S+LLNC    I LG  L  FK+F++ FD   KGLA++NSE+IR VHNSF
Sbjct: 59  INNACATQAIVSVLLNCSHQDIHLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVHNSF 118

Query: 149 ARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEKVR 208
           AR   F  D   +SS+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+  VR
Sbjct: 119 ARQQMFEFDA--KSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVR 176

Query: 209 PVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM-QLS 265
           PVI++R+ +Y+  EIRFNL+A++ +R+ +Y  RI E+ +++      +T++SS ++  + 
Sbjct: 177 PVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQQQLAEEEPMDTDHSSNMLSSIQ 236

Query: 266 EERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR-KEM 324
            E  +    IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+ K+ 
Sbjct: 237 SEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN 296

Query: 325 SKRIKD 330
           +K++++
Sbjct: 297 AKKVQE 302



>gi|12841686|dbj|BAB25312.1| unnamed protein product [Mus musculus]
          Length = 307

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 209/310 (67%), Gaps = 18/310 (5%)

Query: 27  IRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---EN 83
           I+ F  +G QVEE+WSL+ ++ E+LKPV+GLIFLFKWQ G +     P   +  D   E 
Sbjct: 1   IKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLET 55

Query: 84  VYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTRLFDPYDKGLAITNSELI 141
           ++FAKQVINNACATQAI+S+LLNC    + LG  L  FK+F++ FD   KGLA++NS++I
Sbjct: 56  IFFAKQVINNACATQAIVSVLLNCTHQEVHLGETLSEFKEFSQSFDAAMKGLALSNSDVI 115

Query: 142 RGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGD 201
           R VHNSFAR   F  D   ++ +++ED FHF+SYVPV G LYELDGL  GP++LG C  D
Sbjct: 116 RQVHNSFARQQMFEFD--TKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD 173

Query: 202 NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM-RHASNTNNSSE 260
           +W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+  ++     +T+  S 
Sbjct: 174 DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGST 233

Query: 261 LM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARI 317
           ++   Q    R+Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +
Sbjct: 234 VLSAIQSEVARNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLV 291

Query: 318 EYARKEMSKR 327
           E A+++ + +
Sbjct: 292 EKAKEKQNAK 301



>gi|242023086|ref|XP_002431967.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative
           [Pediculus humanus corporis]
 gi|212517318|gb|EEB19229.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative
           [Pediculus humanus corporis]
          Length = 325

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 153/320 (47%), Positives = 208/320 (65%), Gaps = 20/320 (6%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELIR F V G QVEE+WSLD +  +ELKPV+GLIFLFKW   ND+
Sbjct: 5   AGNWCLIESDPGVFTELIREFGVTGAQVEELWSLDAEFFDELKPVHGLIFLFKW--FNDT 62

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FA QVINNACATQAILSILLN   P I LG  L  FKDF  
Sbjct: 63  E---PSGTIIADNRLDKIFFAMQVINNACATQAILSILLNTNHPDISLGPTLTEFKDFCH 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            F+ + KGLA++NSE IR VHNSF R   F  D   +  S+ ++++HF+SY+P+ G LYE
Sbjct: 120 SFNAHIKGLALSNSETIRRVHNSFGRQTLFEFDS--KMPSKDDNVYHFVSYIPIDGRLYE 177

Query: 185 LDGLSNGPVNLG--PCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           LDGL  GP++ G  P  GD WL+ VRP+I++R+ +Y+  EI FNL+A++ +R+ +Y  +I
Sbjct: 178 LDGLKTGPIDHGAIPQKGD-WLDVVRPIIEKRIKKYSEGEIHFNLMAIVSDRKMIYERKI 236

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
            E+ +++  +    +S        E  +L   IE E+ K K+Y+ EN  RKHN++  I  
Sbjct: 237 EELQKQLEESGMEVDSHH-----SEIARLKMLIEDEEKKRKQYQVENIRRKHNYLPLIVE 291

Query: 303 IIRILAERGELQARIEYARK 322
           +++ILA    L    E A++
Sbjct: 292 LLKILAREQRLVKIYERAKE 311



>gi|328708758|ref|XP_003243794.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Acyrthosiphon pisum]
 gi|328708760|ref|XP_001950588.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 1 [Acyrthosiphon pisum]
          Length = 322

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 149/337 (44%), Positives = 218/337 (64%), Gaps = 25/337 (7%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSD+  WCLIESDPGVFTELIR   V G QVEE+W+LD    + +KPV+GLIFLF+W G 
Sbjct: 1   MSDSVGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFDAIKPVHGLIFLFRWIGE 60

Query: 67  NDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKD 121
           +      P+  +  D   E ++FAKQVINNACATQAILS+L NC  P I+LG  L  FK+
Sbjct: 61  D-----QPDGPIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKE 115

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFF-LDQTDQSSSEKEDIFHFISYVPVQG 180
           F++ FD   KGLA++NS+ IR VHNSF RS+  F  D T +  S+ ++ +HF++ VP++G
Sbjct: 116 FSQKFDANMKGLALSNSQKIRSVHNSFGRSNSIFEFDDTAKPKSKDDEAYHFVAIVPIEG 175

Query: 181 ALYELDGLSNGPVNLG---PCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDV 237
            LYELDGL  GP++LG   P T  +W+E  +P I++R+++Y   E+ FNL+A++ +R+ +
Sbjct: 176 RLYELDGLKEGPIDLGLIKPNT--DWVEAAKPFIEKRINKYKEGEVHFNLMAVVSDRKLI 233

Query: 238 YRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
              R+  +         T    E  ++SEE + +  +I  E+ K KRY+ EN+ RKHN++
Sbjct: 234 LEQRLLSL--------KTEELDEATKISEESN-IRMKIADEEDKMKRYKIENARRKHNYL 284

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKRIKDRAEK 334
             I  I+++LA+ G+L    E A+ +  ++ K +  K
Sbjct: 285 PLIVEILKLLAKDGKLVPLYERAKAKTLEKEKQKIGK 321



>gi|340377116|ref|XP_003387076.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Amphimedon queenslandica]
          Length = 351

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 221/353 (62%), Gaps = 30/353 (8%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCLIESDPGVFTELIR F V G QVEEVWSLD+  L  LKPV+GLIFL+KW+  +D+
Sbjct: 3   AGEWCLIESDPGVFTELIRGFGVSGVQVEEVWSLDNDILLNLKPVHGLIFLYKWRP-DDN 61

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLFD 127
            +     D  +  +++FA+Q I NACATQA+LS+LLN     ++LG+ L +FK+F   F 
Sbjct: 62  VQGSIVEDSRI-RDIFFARQEIKNACATQAVLSVLLNVTHSDVELGSVLTDFKEFAASFS 120

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
           P D+GL++TNS+ IR VHNSFAR   F  D  D  S   ED+FHF+++VP+ G LYELDG
Sbjct: 121 PTDRGLSLTNSDQIRKVHNSFARQQMFEFD--DSLSKGGEDVFHFVAFVPINGRLYELDG 178

Query: 188 LSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           L  GP++ G     +WL  VRP++++RM  Y++ EI FNLLAL+ ++  VY+  I ++D 
Sbjct: 179 LKTGPIDHGATDSTDWLNTVRPILEKRMQSYSAGEIHFNLLALVSDKRAVYKKEIVKLDT 238

Query: 248 RMRHASN-------------------TNNSSELMQLSEERD----QLLQRIEMEKVKFKR 284
           R   A+                     ++  +L  + EE +    +L + I +E  K + 
Sbjct: 239 RKELAAKKIQSVLSGGGESMEDNSGLPDDPEQLQVIIEEAEGEVIRLNELIRIENDKMET 298

Query: 285 YERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK-EMSKRIKDRAEKKK 336
           Y  EN  R+HN++  I  +++ LA++G L +  E A+K + S+   D+A++ K
Sbjct: 299 YRLENIRRRHNYLPLIMELLKTLAKKGRLVSLCEEAKKRKKSQTTADKAKEVK 351



>gi|322797446|gb|EFZ19517.1| hypothetical protein SINV_00678 [Solenopsis invicta]
          Length = 332

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 159/355 (44%), Positives = 227/355 (63%), Gaps = 49/355 (13%)

Query: 7   MSD-AGQWCLIESDPGVFTELIR---------------------AFNVQGTQVEEVWSLD 44
           M+D AG WCLIESDPGVFTELI+                      F+V+G QVEE+WSLD
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGKYIYIPNFDLLQQWSACLVFSVKGAQVEELWSLD 60

Query: 45  DQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSIL 104
           ++   ELKP++GLIFLFKW   ++ S  +   D  +D+ ++FAKQVINNACATQAILS+L
Sbjct: 61  EEQFNELKPIHGLIFLFKWVQDDELSG-NIVQDNRLDK-IFFAKQVINNACATQAILSVL 118

Query: 105 LNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQS 162
           LNC   D  LG  L+ FK+F + FD   +GLA++NS++IR VHNSF+R + F  D   + 
Sbjct: 119 LNCKHTDISLGPNLEEFKNFCQSFDANMRGLALSNSDVIREVHNSFSRQNLFEYDS--KQ 176

Query: 163 SSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSA 221
           +S+ +D+FHF+SYVP+ G LYELDGL +GP++LGPC  G+ W++  +P+IQ+R+++Y   
Sbjct: 177 ASKDDDVFHFVSYVPIDGRLYELDGLKDGPIDLGPCPVGEQWVQAAKPIIQKRINKYNEG 236

Query: 222 EIRFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVK 281
           EI FNL+A++ +R+ +Y           R  +N  +  EL     ER Q L  IE E  K
Sbjct: 237 EIHFNLMAIVTDRKILYE----------RQKANVCDPEEL-----ERLQTL--IEEEIRK 279

Query: 282 FKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
            KRY+ EN  RKHN++  I  +++ILA+ G+L   +   +K   K ++  ++K K
Sbjct: 280 SKRYQIENIRRKHNYLPLIMELLKILAKEGKL---VPLYQKAKEKALEKESKKSK 331



>gi|326924877|ref|XP_003208649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Meleagris gallopavo]
          Length = 313

 Score =  283 bits (723), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 207/306 (67%), Gaps = 16/306 (5%)

Query: 34  GTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAKQV 90
           G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FAKQV
Sbjct: 13  GAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAKQV 67

Query: 91  INNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSF 148
           INNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NSE+IR VHNSF
Sbjct: 68  INNACATQAIVSVLLNCAHQDIRLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVHNSF 127

Query: 149 ARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEKVR 208
           AR   F  D   +SS+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+  VR
Sbjct: 128 ARQQMFEFDA--KSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGSCNQDDWISAVR 185

Query: 209 PVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM-QLS 265
           PVI++R+ +Y+  EIRFNL+A++ +R+ +Y  RI E+  ++      +T+ SS ++  + 
Sbjct: 186 PVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQRQLAEEEPMDTDQSSNMLSSIQ 245

Query: 266 EERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR-KEM 324
            E  +    IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+ K+ 
Sbjct: 246 SEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN 305

Query: 325 SKRIKD 330
           +K++++
Sbjct: 306 AKKVQE 311



>gi|465971743|gb|EMP32826.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Chelonia mydas]
          Length = 324

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 196/285 (68%), Gaps = 15/285 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+  L++SDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G + 
Sbjct: 7   AGERFLMDSDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE- 65

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC    I LG  L  FK+F++
Sbjct: 66  ----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCIHQDIHLGETLAEFKEFSQ 121

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS+++ED FHF+SYVPV G LYE
Sbjct: 122 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKEEDAFHFVSYVPVNGRLYE 179

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 180 LDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAE 239

Query: 245 IDERM--RHASNTNNSSELM-QLSEERDQLLQRIEMEKVKFKRYE 286
           + +++      +T+ S  ++  L  E  +    IE E  K KRY+
Sbjct: 240 LQQQLSEEEPMDTDQSGNMLSSLQSEVAKYQMLIEEENQKLKRYK 284



>gi|6686411|gb|AAF23845.1|AC007234_17 F1E22.3 [Arabidopsis thaliana]
          Length = 361

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/341 (44%), Positives = 216/341 (63%), Gaps = 34/341 (9%)

Query: 16  IESDPGVFTELIRAFNVQGTQV---EEVWSLD--------DQTLEEL----KPVYGLIFL 60
           I +  GVFTELI+   V+G QV    EV+ LD        D+    +    +PVYGLIFL
Sbjct: 22  IYASAGVFTELIQQMQVKGVQVINYLEVFELDFLLIYAFLDKCFSTVWLPCRPVYGLIFL 81

Query: 61  FKWQGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFK 120
           FKWQ G    R   +  +S   N++FA QVINNACATQAIL+ILLN P +D+G EL   K
Sbjct: 82  FKWQAGEKDERPTIQDQVS---NLFFANQVINNACATQAILAILLNSPEVDIGPELSALK 138

Query: 121 DFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQG 180
           +FT+ F    KGLAI NS+ IR  HNSFAR +P F+ +  +++++ +D++HFISY+PV G
Sbjct: 139 EFTKNFPSDLKGLAINNSDSIRAAHNSFARPEP-FVPEEQKAATKDDDVYHFISYIPVDG 197

Query: 181 ALYELDGLSNGPVNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED 236
            LYELDGL  GP++LGPC GD     WL+ V+PVIQER+ RY+ +EIRFNLLA+IKNR+D
Sbjct: 198 VLYELDGLKEGPISLGPCPGDQTGIEWLQMVQPVIQERIERYSQSEIRFNLLAVIKNRKD 257

Query: 237 VYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQ-----------RIEMEKVKFKRY 285
           +Y   + E+  +        N+      +E  + L+            +I ME+ KF ++
Sbjct: 258 IYTAELKELQRQREQLLQQANTCVDKSEAEAVNALIAEVGSGIEAASDKIVMEEEKFMKW 317

Query: 286 ERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSK 326
             EN  RKHN+I F++N +++LAE+ +L+  IE A+K+ ++
Sbjct: 318 RTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQKTE 358



>gi|57529689|ref|NP_001006530.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Gallus gallus]
 gi|53131115|emb|CAG31792.1| hypothetical protein RCJMB04_11d7 [Gallus gallus]
          Length = 297

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 209/329 (63%), Gaps = 44/329 (13%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           S AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKP++GLIFLFKWQ G 
Sbjct: 5   SSAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPIHGLIFLFKWQPGE 64

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 65  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIRLGETLSEFKEF 119

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NSE+IR VHNSFAR   F  D   +SS+++ED FHF+SYVPV G L
Sbjct: 120 SQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKEEDAFHFVSYVPVNGRL 177

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +                         
Sbjct: 178 YELDGLREGPIDLGSCNQDDWISAVRPVIEKRIQK------------------------- 212

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
              +E M    ++N  S + Q    + Q+L  IE E  K KRY+ EN  RKHN++ FI  
Sbjct: 213 ---EEPMETDQSSNMLSSI-QSEVAKYQML--IEEENQKLKRYKIENIRRKHNYLPFIME 266

Query: 303 IIRILAERGELQARIEYAR-KEMSKRIKD 330
           +++ LAE  +L   +E A+ K+ +K++++
Sbjct: 267 LLKTLAEHQQLIPLVEKAKEKQNAKKVQE 295



>gi|54287942|gb|AAV31418.1| ubiquitin c-terminal hydrolase UCH37-like protein [Toxoptera
           citricida]
          Length = 322

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 148/337 (43%), Positives = 217/337 (64%), Gaps = 25/337 (7%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSD+  WCLIESDPGVFTELIR   V G QVEE+W+LD    E +KPV+GLIFLF+W G 
Sbjct: 1   MSDSVGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFEAIKPVHGLIFLFRWIGE 60

Query: 67  NDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKD 121
           +      P+  +  D   E ++FAKQVINNACATQAILS+L NC  P I+LG  L  FK+
Sbjct: 61  D-----QPDGQIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKE 115

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFF-LDQTDQSSSEKEDIFHFISYVPVQG 180
           F++ FD   KGLA++NS+ IR VHNSF RS+  F  + + +  S+ ++ +HF++ VP+ G
Sbjct: 116 FSQKFDANMKGLALSNSQKIRSVHNSFGRSNSIFEFEDSAKPKSKDDEAYHFVAIVPIDG 175

Query: 181 ALYELDGLSNGPVNLG---PCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDV 237
            LYELDGL  GP++LG   P T  +W+E  +P I++R+++Y   E+ FNL+A++ +R+ +
Sbjct: 176 RLYELDGLKEGPIDLGLIKPNT--DWVEAAKPFIEKRINKYKEGEVHFNLMAVVSDRKLI 233

Query: 238 YRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
              R+  +         T    E  ++SEE + +  +I  E+ K KRY+ EN+ RKHN++
Sbjct: 234 LEQRLLSL--------KTEELDEATKISEESN-IRMKIADEEDKMKRYKIENARRKHNYL 284

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKRIKDRAEK 334
             I  I+++LA+ G+L    E A+ +  ++ K +  K
Sbjct: 285 PLIVEILKLLAKDGKLVPLYERAKAKTLEKEKQKIGK 321



>gi|356624468|pdb|3RIS|A Chain A, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
 gi|356624469|pdb|3RIS|B Chain B, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
 gi|356624470|pdb|3RIS|C Chain C, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
 gi|356624471|pdb|3RIS|D Chain D, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
          Length = 245

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 179/243 (73%), Gaps = 12/243 (4%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 8   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 67

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 68  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 122

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 123 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDT--KTSAKEEDAFHFVSYVPVNGRL 180

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I
Sbjct: 181 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI 240

Query: 243 GEI 245
            E+
Sbjct: 241 AEL 243



>gi|443725376|gb|ELU12999.1| hypothetical protein CAPTEDRAFT_3656 [Capitella teleta]
          Length = 344

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 220/339 (64%), Gaps = 37/339 (10%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           + AG WCLIESDPGVFTE+I+ F V+G QVEE+WSLD +    L+PV+GLIFLFKW   +
Sbjct: 3   ASAGDWCLIESDPGVFTEVIKGFGVKGVQVEELWSLDSENFANLRPVHGLIFLFKWMAND 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
           +     P+  +  D   + ++FAKQVINNACATQAILSIL+NC  P + LG  L +FK+F
Sbjct: 63  E-----PQGSIVQDSRLDKIFFAKQVINNACATQAILSILVNCKHPDVQLGDNLSSFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           T+ FDP  KGLA++NS++IR VHNSFAR   F  +  D+++ + +D++HF+ Y+P+ G L
Sbjct: 118 TQGFDPATKGLALSNSDVIRTVHNSFARQQMF--EFDDKAAPKDDDVYHFVGYIPIDGRL 175

Query: 183 YELDGLSNGPVNLG-------------------PCTGDNWLEKVRPVIQERMSRYTSAEI 223
           YELDGL +GP++LG                   P + D W++ VRP++++RM +Y++ EI
Sbjct: 176 YELDGLKDGPIDLGVQYSMFPVCNLEISLAGAIPESTD-WIDVVRPILEKRMQKYSADEI 234

Query: 224 RFNLLALIKNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFK 283
            FNL+A++ +R+   + +I E+ + M+      +       + E  +L   I+ E  K  
Sbjct: 235 HFNLMAVVSDRKMTLQRKIDEVTKVMQEGGMETDEQ-----TAEIARLQMLIKDEDHKIH 289

Query: 284 RYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARK 322
           +Y+ EN  R+HN++ FI  +++ILA+ G+L   ++ A++
Sbjct: 290 KYKVENVRRRHNYLPFIMELLKILAQEGKLSDLVDKAKE 328



>gi|167525641|ref|XP_001747155.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774450|gb|EDQ88079.1| predicted protein [Monosiga brevicollis MX1]
          Length = 328

 Score =  280 bits (715), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 204/319 (63%), Gaps = 7/319 (2%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFT+LI    V+G QVEE+W+LD   L++L PVYGL+FLFK+      
Sbjct: 2   AGRWCLMESDPGVFTDLIEGVGVKGVQVEELWALDVDALKQLAPVYGLVFLFKFTPEAHK 61

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPY 129
           S   P  D  +   ++FA QVINNACATQAILSILLN P I+LG  L  FK F    DP 
Sbjct: 62  SETQP-IDYKIP-GLFFAHQVINNACATQAILSILLNAPDIELGEHLTGFKSFANELDPE 119

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
             GLAI+NSE +R VHNSF+R + F ++  ++ + + +D++HFI+YVP  G LYELDGL 
Sbjct: 120 TAGLAISNSEELRTVHNSFSRQETFTME--EKVADKDDDVYHFIAYVPHGGRLYELDGLQ 177

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM 249
            GP++ GP  G+ W+E V PV+Q+R+ RYTS EIRFNL+A+ ++R +       E  E M
Sbjct: 178 RGPIDHGP-VGEEWVETVVPVLQKRIERYTSTEIRFNLMAVCRDRREALEEE-KENAESM 235

Query: 250 RHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAE 309
              S    S E  +   +  +   +++ E  K + ++ EN  RKHN+I FI  ++R LA 
Sbjct: 236 A-LSLPEASPEAAEWQAKAAEFEAQLQQEHAKRQNWKDENRRRKHNYIPFILELMRSLAR 294

Query: 310 RGELQARIEYARKEMSKRI 328
              LQ  +  A+++  +R+
Sbjct: 295 EKRLQPLVAEAKRKAVERL 313



>gi|15237324|ref|NP_197135.1| ubiquitin thiolesterase UCH1 [Arabidopsis thaliana]
 gi|9759113|dbj|BAB09598.1| ubiquitin C-terminal hydrolase-like protein [Arabidopsis thaliana]
 gi|26451061|dbj|BAC42635.1| putative ubiquitin C-terminal hydrolase [Arabidopsis thaliana]
 gi|28950905|gb|AAO63376.1| At5g16310 [Arabidopsis thaliana]
 gi|332004895|gb|AED92278.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 [Arabidopsis
           thaliana]
          Length = 334

 Score =  280 bits (715), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 214/330 (64%), Gaps = 28/330 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  +ESDPG+FTE+I+   V+G QVEE++SLD  +L+E++PVYGLI L+KW+     +R+
Sbjct: 3   WLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKENRV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N +FA Q+INNACATQAILS+L+N  +ID+G+EL   K F + F P  KG
Sbjct: 63  ---VITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK-----EDIFHFISYVPVQGALYELDG 187
           LAI N+E IR  HN+FAR DP  + + ++ ++ K     +D++H+ISY+PV G LYELDG
Sbjct: 120 LAINNNEAIRAAHNTFARPDPSSIMEDEELAAAKNLDEDDDVYHYISYLPVDGILYELDG 179

Query: 188 LSNGPVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           L  GP++LG C G+     WL  V+PV+QE++ RY+  EIRF+LLA++KNR+++Y   + 
Sbjct: 180 LKEGPISLGQCLGEPEGIEWLRMVQPVVQEQIDRYSQNEIRFSLLAVVKNRKEMYVAELK 239

Query: 244 E----------------IDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYER 287
           E                 D+    +S      EL +++   + + Q+I ME+ K K +++
Sbjct: 240 EYQRKRERVLQQLGALQADKYAEKSSYEALDRELSEVNIGIETVSQKIVMEEEKSKNWKK 299

Query: 288 ENSLRKHNFIQFIYNIIRILAERGELQARI 317
           EN  RKHN++ F++N ++ILA++ +L+  I
Sbjct: 300 ENMRRKHNYVPFLFNFLKILADKKKLKPLI 329



>gi|68161114|gb|AAY86988.1| ubiquitin C-terminal hydrolase [Ictalurus punctatus]
          Length = 265

 Score =  279 bits (714), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 129/245 (52%), Positives = 177/245 (72%), Gaps = 12/245 (4%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL++SDPGVFTELI+ F  +G QVEE+WS++ +  + LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMKSDPGVFTELIKGFGCKGAQVEEIWSMEPENFQNLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   + ++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDQIFFAKQVINNACATQAIVSVLLNCFHPDMHLGETLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR   F  D   +SS++ ED FHF+SYVPV G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKDEDAFHFVSYVPVNGRLYE 177

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP+ LG C  ++W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 178 LDGLREGPIGLGTCNQEDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 237

Query: 245 IDERM 249
           +   +
Sbjct: 238 LQAHL 242



>gi|357609741|gb|EHJ66626.1| hypothetical protein KGM_08817 [Danaus plexippus]
          Length = 322

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 204/324 (62%), Gaps = 12/324 (3%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M  AG WCLIESDPGVFT+LI+ F V+G QVEE+W+ DD   + L+PV+GLIFLFK+   
Sbjct: 1   MESAGDWCLIESDPGVFTQLIKKFGVKGVQVEEMWTFDDSIFDNLRPVHGLIFLFKYLQH 60

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
           ++    HP    +  E +YFAKQVINNACATQA++S+LLNC  P + LG EL   K+F+ 
Sbjct: 61  DEPP--HPVVKDNRLEKIYFAKQVINNACATQAVVSLLLNCNHPDVILGPELTKLKEFSM 118

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FDP  +GL ++NS+ IR  HNS ++   F  D   +  ++ ED +HFI Y+P+ G LYE
Sbjct: 119 SFDPRMRGLTLSNSQTIRSAHNSMSQQALFEFDP--KVPTKDEDAYHFIGYMPIDGRLYE 176

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL  GP++ GP   + +WL+ VRP+I  R++ YT  EI FNL+AL+ +R+ +Y  +I 
Sbjct: 177 LDGLREGPIDHGPIAPEQDWLDVVRPIIVSRINVYTEGEIHFNLMALVSDRKMIYERQIQ 236

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
            +    R      +  ++     E  +L   IE E  K  RY +E   R+HN++ FI  +
Sbjct: 237 ALMSETRMLGMETDDVDV-----EIRRLRMLIEYEDAKMLRYNQEMLRRRHNYLPFIITL 291

Query: 304 IRILAERGELQARIEYARKEMSKR 327
           ++ILAE  +L   +E A++   K+
Sbjct: 292 LKILAEEKKLSPLLEKAKERALKK 315



>gi|194227370|ref|XP_001492151.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Equus caballus]
          Length = 307

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 203/309 (65%), Gaps = 19/309 (6%)

Query: 29  AFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVY 85
               +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++
Sbjct: 2   GLGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIF 56

Query: 86  FAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRG 143
           FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NS++IR 
Sbjct: 57  FAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQ 116

Query: 144 VHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNW 203
           VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W
Sbjct: 117 VHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDW 174

Query: 204 LEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHASNTNNS 258
           +  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+     +E        NN 
Sbjct: 175 ISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNNM 234

Query: 259 SELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
              +Q    ++QLL  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 235 LSAIQSEVAKNQLL--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 292

Query: 319 YARKEMSKR 327
            A+++ + +
Sbjct: 293 KAKEKQNAK 301



>gi|297811767|ref|XP_002873767.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297319604|gb|EFH50026.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 334

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 217/330 (65%), Gaps = 28/330 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  +ESDPG+FTE+I+   V+G QVEE++SLD  +L+E++PVYGLI L+KW+     +R+
Sbjct: 3   WLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKENRV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                   + N +FA Q+INNACATQAILS+L+N  +ID+G+EL   K F + F P  KG
Sbjct: 63  ---VITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK-----EDIFHFISYVPVQGALYELDG 187
           LAI+N+E IR  HN+FARSDP    + ++ ++ K     +D++H+ISY+PV G LYELDG
Sbjct: 120 LAISNNEAIRAAHNTFARSDPSSTMEEEELAAAKNLDEDDDVYHYISYLPVDGILYELDG 179

Query: 188 LSNGPVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           L  GP++LG C G+     WL  V+PV+QER+  Y+  EIRF+LLA++KNR+++Y   + 
Sbjct: 180 LKEGPISLGQCLGEPEGTEWLRMVQPVVQERIDWYSQNEIRFSLLAVVKNRKEMYVAELK 239

Query: 244 EID---ERM----------RHASNTNNSSELMQLSEER---DQLLQRIEMEKVKFKRYER 287
           E     ER+          ++A  ++  +    LSE     + + Q+I +E+ K K +++
Sbjct: 240 EYQRKRERILQQLGALQADKYAEKSSYEALDRSLSEVNIGIETVSQKIVLEEEKSKNWKK 299

Query: 288 ENSLRKHNFIQFIYNIIRILAERGELQARI 317
           EN  RKHN++ F++N ++ILA++ +L+  I
Sbjct: 300 ENMRRKHNYVPFLFNFLKILADKKKLKPLI 329



>gi|115444619|ref|NP_001046089.1| Os02g0180100 [Oryza sativa Japonica Group]
 gi|50252088|dbj|BAD28018.1| putative ubitquitin C-terminal hydrolase [Oryza sativa Japonica
           Group]
 gi|113535620|dbj|BAF08003.1| Os02g0180100 [Oryza sativa Japonica Group]
 gi|215695193|dbj|BAG90384.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215737760|dbj|BAG96890.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 329

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 212/328 (64%), Gaps = 26/328 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPG+FTEL++   ++G QV+E++SLD   L +L+PVYGLI L+KWQ      R 
Sbjct: 3   WAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P  D     N++FAKQ+INNACATQAI+S+LLN P I L  EL   K+F +   P  KG
Sbjct: 62  -PIKDPI--PNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKG 118

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR   NSFAR +   + +  +SS + +D++HFISYVPV G LYELDGL  GP
Sbjct: 119 LAIVNSESIRLASNSFARPE---VPEEQKSSVKDDDVYHFISYVPVDGVLYELDGLKEGP 175

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL  V+PVIQER+ R++  EIRF+++A++KNR + +   + E+  +
Sbjct: 176 ISLGKCPGGVGDIGWLRMVQPVIQERIDRFSQNEIRFSVMAILKNRREKFTLELKELQRK 235

Query: 249 M-------------RHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
                         RHA +  +S  L +++   + + ++I ME+ K+K+++ EN  RKHN
Sbjct: 236 RENLLAQMGDPSANRHAPSVEHS--LAEVAAHIEAVTEKIIMEEEKWKKWKTENIRRKHN 293

Query: 296 FIQFIYNIIRILAERGELQARIEYARKE 323
           ++ F++N ++IL ER +L+  IE A+++
Sbjct: 294 YVPFLFNFLKILEERQQLKPLIEKAKQK 321



>gi|125581038|gb|EAZ21969.1| hypothetical protein OsJ_05623 [Oryza sativa Japonica Group]
          Length = 358

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 212/328 (64%), Gaps = 26/328 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPG+FTEL++   ++G QV+E++SLD   L +L+PVYGLI L+KWQ      R 
Sbjct: 32  WAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDER- 90

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P  D     N++FAKQ+INNACATQAI+S+LLN P I L  EL   K+F +   P  KG
Sbjct: 91  -PIKDPI--PNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKG 147

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR   NSFAR +   + +  +SS + +D++HFISYVPV G LYELDGL  GP
Sbjct: 148 LAIVNSESIRLASNSFARPE---VPEEQKSSVKDDDVYHFISYVPVDGVLYELDGLKEGP 204

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL  V+PVIQER+ R++  EIRF+++A++KNR + +   + E+  +
Sbjct: 205 ISLGKCPGGVGDIGWLRMVQPVIQERIDRFSQNEIRFSVMAILKNRREKFTLELKELQRK 264

Query: 249 M-------------RHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
                         RHA +  +S  L +++   + + ++I ME+ K+K+++ EN  RKHN
Sbjct: 265 RENLLAQMGDPSANRHAPSVEHS--LAEVAAHIEAVTEKIIMEEEKWKKWKTENIRRKHN 322

Query: 296 FIQFIYNIIRILAERGELQARIEYARKE 323
           ++ F++N ++IL ER +L+  IE A+++
Sbjct: 323 YVPFLFNFLKILEERQQLKPLIEKAKQK 350



>gi|348532151|ref|XP_003453570.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Oreochromis niloticus]
          Length = 300

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 206/328 (62%), Gaps = 48/328 (14%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P   +  D   ++++FAKQVINNACATQAI+S+LLNC  P + LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDHIFFAKQVINNACATQAIISVLLNCSHPDMLLGDTLTEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR                               LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFAR-------------------------------LYE 148

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 149 LDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 208

Query: 245 IDERMR--HASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS  +   Q    + QLL  IE E  K KRY+ EN  RKHN++ F
Sbjct: 209 LQAQLTEDEPMDTDQSSTFLSSIQSEIAKYQLL--IEEENQKLKRYKIENIRRKHNYLPF 266

Query: 300 IYNIIRILAERGELQARIEYARKEMSKR 327
           I  +++ LAE  +L   +E A+++ S +
Sbjct: 267 IMELLKTLAEYQQLIPLVEKAKEKQSAK 294



>gi|350589239|ref|XP_003130528.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like,
           partial [Sus scrofa]
          Length = 379

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 206/307 (67%), Gaps = 19/307 (6%)

Query: 31  NVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFA 87
             +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FA
Sbjct: 76  GCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFA 130

Query: 88  KQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVH 145
           KQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NS++IR VH
Sbjct: 131 KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH 190

Query: 146 NSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLE 205
           NSFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+ 
Sbjct: 191 NSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWIS 248

Query: 206 KVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM- 262
            VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+  ++      +T+  S ++ 
Sbjct: 249 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNMLS 308

Query: 263 --QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYA 320
             Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A
Sbjct: 309 AIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA 366

Query: 321 RKEMSKR 327
           +++ + +
Sbjct: 367 KEKQNAK 373



>gi|395531033|ref|XP_003767587.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Sarcophilus harrisii]
          Length = 489

 Score =  276 bits (706), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 206/306 (67%), Gaps = 19/306 (6%)

Query: 32  VQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAK 88
            +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FAK
Sbjct: 187 CRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAK 241

Query: 89  QVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHN 146
           QVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NSE+IR VHN
Sbjct: 242 QVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVHN 301

Query: 147 SFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEK 206
           SFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  ++W+  
Sbjct: 302 SFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQEDWINA 359

Query: 207 VRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM-- 262
           VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+  ++      +T+ SS ++  
Sbjct: 360 VRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQSSNMLST 419

Query: 263 -QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
            Q    + Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E A+
Sbjct: 420 IQSEVAKHQML--IEEEIQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAK 477

Query: 322 KEMSKR 327
           ++ + +
Sbjct: 478 EKQNAK 483



>gi|403294478|ref|XP_003938212.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Saimiri boliviensis boliviensis]
          Length = 314

 Score =  276 bits (705), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 141/309 (45%), Positives = 203/309 (65%), Gaps = 19/309 (6%)

Query: 29  AFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVY 85
               +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++
Sbjct: 9   VLGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIF 63

Query: 86  FAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRG 143
           FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NS++IR 
Sbjct: 64  FAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQ 123

Query: 144 VHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNW 203
           VHNSFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W
Sbjct: 124 VHNSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDW 181

Query: 204 LEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHASNTNNS 258
           +  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+     +E        N+ 
Sbjct: 182 ISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSM 241

Query: 259 SELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
              +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 242 LSAIQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 299

Query: 319 YARKEMSKR 327
            A+++ + +
Sbjct: 300 KAKEKQNAK 308



>gi|198433076|ref|XP_002119457.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Ciona intestinalis]
          Length = 328

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 214/324 (66%), Gaps = 11/324 (3%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MS AG+WCLIESDPGVF+ LI+ F V G QVEE+ SLD  + ++LKPV+GLIFLFK+   
Sbjct: 1   MSSAGEWCLIESDPGVFSALIKDFGVLGIQVEEICSLDSDSFKDLKPVHGLIFLFKYD-- 58

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
            D        D +   +++FAKQVI+NACATQAI++ILLN    D  LG+ L++F++FT+
Sbjct: 59  QDMKTEGTILDQTTQSDIFFAKQVISNACATQAIINILLNTKHKDVVLGSTLEDFRNFTQ 118

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   +GLA++NS++I+ VHNSF+R   F   + D+ +++ ED +HF+ YV V G + E
Sbjct: 119 CFDASMRGLALSNSKVIQQVHNSFSRQQVF---EYDEKATKSEDSYHFVGYVQVNGRVLE 175

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL +GPV+ GP  GD+W+E VRP+IQ R+ RYTS EI FNL+A++ +++ +   +I +
Sbjct: 176 LDGLKSGPVDHGPVEGDDWIETVRPIIQRRIQRYTSDEIHFNLMAVVGDKKMMLEKKIEK 235

Query: 245 IDERMRHASNTNNSSE----LMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
           +   +   ++     E    L  L E  +Q    +  E  K +R + EN  RKHN++ FI
Sbjct: 236 LTTLIDGYNDAMEEEEQRVPLAILMESLEQCKCLLNDETQKRQRNQVENIRRKHNYLPFI 295

Query: 301 YNIIRILAERGELQARIEYARKEM 324
             +IRILA   +L   IE+A++++
Sbjct: 296 IEMIRILAAEEKLLPLIEHAKEKV 319



>gi|268529716|ref|XP_002629984.1| C. briggsae CBR-UBH-4 protein [Caenorhabditis briggsae]
          Length = 326

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 206/329 (62%), Gaps = 22/329 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+DAG WCLIESDPGVFTE++R F V G QVEE+WSLDD     +KPVYGLIFLFKW+ G
Sbjct: 1   MADAGNWCLIESDPGVFTEMLRGFAVDGLQVEELWSLDDDK-ALMKPVYGLIFLFKWRQG 59

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
           ++ + +      S  EN++FA+QVI NACATQA++++L+N   P + LG  L  +K+F  
Sbjct: 60  DEGAGVP-----STKENIFFAQQVIQNACATQALINLLMNVSDPAVKLGPILTQYKEFAI 114

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
             DP  +GL ++N E IR VHNSF+R   F L   D    + ED +HF++YVP+   ++E
Sbjct: 115 DMDPATRGLCLSNCEDIRTVHNSFSRQTLFEL---DVKGGDSEDNYHFVTYVPIGDKVFE 171

Query: 185 LDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL   P+ +     G +W+E VRP+IQERM++Y+  EI FNL+AL+ NR+  Y+    
Sbjct: 172 LDGLREAPLEVSDLPDGKDWVEAVRPIIQERMAKYSQGEITFNLMALVPNRQQKYQ---- 227

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
              E +   +  N + E   L E+   +   I+ E+ K   Y +EN+ R+HN+  F+  +
Sbjct: 228 ---EMLDALTQANENGE---LDEQITDITINIQEEERKMTTYRKENARRRHNYTPFVIQL 281

Query: 304 IRILAERGELQARIEYARKEMSKRIKDRA 332
           ++ILA+ G+L   I  A ++   R K  A
Sbjct: 282 LKILAKEGKLVGLINDAYQKAEARAKKPA 310



>gi|482556851|gb|EOA21043.1| hypothetical protein CARUB_v10001382mg [Capsella rubella]
          Length = 336

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 221/334 (66%), Gaps = 28/334 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  +ESDPGVFTE+I+   V+G QVEE++SLD  +L+E++PVYGLI L+KW+     +R+
Sbjct: 3   WLPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPDEKENRV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                +  + N +FA Q+INNACATQA+LS+L+N  +ID+G+EL   K+F + F P  KG
Sbjct: 63  ---VIMEPNPNFFFASQIINNACATQALLSVLMNSSSIDIGSELSELKEFAKEFPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK---ED--IFHFISYVPVQGALYELDG 187
           LAI N+E IR  HNSFAR DP    + ++ ++ K   ED  ++H+ISY+PV G +YELDG
Sbjct: 120 LAINNNEAIRAAHNSFARPDPSSNMEEEELAAAKNVDEDDYLYHYISYLPVDGIIYELDG 179

Query: 188 LSNGPVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           L  GP++LG C G+     WL  V+PV+QER++RY+   IRF+LLA++KNR+++Y   + 
Sbjct: 180 LKEGPISLGQCLGEPEGIEWLRMVQPVVQERINRYSQNGIRFSLLAVVKNRKELYVAELK 239

Query: 244 EID---ERM----------RHASNTNNSSELMQLSEER---DQLLQRIEMEKVKFKRYER 287
           E     ER+          ++A  ++  +    LSE     + + Q+I ME+ K K +++
Sbjct: 240 EYQRQRERILQQLGGLQADKYAEKSSYEALDRSLSEVNIGIETVSQKIVMEEEKSKNWKK 299

Query: 288 ENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
           EN  RKH+++ F++N ++ILA++ +L+  I+ A+
Sbjct: 300 ENMRRKHDYVPFLFNFLKILADKKKLKPLIDKAK 333



>gi|225713540|gb|ACO12616.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Lepeophtheirus
           salmonis]
          Length = 314

 Score =  273 bits (698), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 210/324 (64%), Gaps = 26/324 (8%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELI  F  +G QVEE+WSLD +   +LKPV+GLIFLFK    ++ 
Sbjct: 3   AGNWCLIESDPGVFTELIHKFGTKGVQVEELWSLDKEQFVDLKPVHGLIFLFKMVPDHN- 61

Query: 70  SRLHPEADLSVDENV---YFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P+  + +D  V   +FAKQVINNACATQAILS+LLN   P ++LG  L NFK+F  
Sbjct: 62  ----PQGTVVLDSRVDKMFFAKQVINNACATQAILSVLLNVDHPELELGTTLSNFKEFCS 117

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL+++NS+ IR VHNSFA+   F  D   + +S+ +D++HF+SY+P+ G LYE
Sbjct: 118 SFDSAMKGLSLSNSDEIRSVHNSFAKQTLFEFDS--KMASKDDDVYHFVSYIPMNGRLYE 175

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL  GPV+ GP + D +WL+ VRP+I++RM++Y + EI FNL+A+++++      ++ 
Sbjct: 176 LDGLKEGPVDHGPVSEDVDWLDVVRPIIEQRMAKYQAGEIHFNLMAIVRDQLMHLEKQLA 235

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           E  +        NNS+E +++        Q I  E  +  ++  EN  R+HN++ FI  +
Sbjct: 236 ECQKE------ENNSAEELRIQ-------QLINHESDRRSKWRLENIRRRHNYLPFIIEL 282

Query: 304 IRILAERGELQARIEYARKEMSKR 327
           ++ LA +G+L    + A+ +  +R
Sbjct: 283 LKTLANQGQLLPLYQKAKDKALER 306



>gi|308509802|ref|XP_003117084.1| CRE-UBH-4 protein [Caenorhabditis remanei]
 gi|308241998|gb|EFO85950.1| CRE-UBH-4 protein [Caenorhabditis remanei]
          Length = 326

 Score =  273 bits (697), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 205/317 (64%), Gaps = 22/317 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+DAG WCLIESDPGVFTE++R F V G QVEE++SLDD     +KPVYGLIFLFKW+ G
Sbjct: 1   MTDAGNWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDK-ALMKPVYGLIFLFKWRQG 59

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
           +D +        S   N++FA+QVI NACATQA++++L+N   P + LG  L  +K+F  
Sbjct: 60  DDGNGTQ-----SSKPNIFFAQQVIQNACATQALINMLMNVEDPGVKLGPLLSQYKEFAI 114

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
             DP  +GL ++NSE IR VHNSF+R   F L   D    E ED +HF++YVP+   +YE
Sbjct: 115 DMDPSTRGLCLSNSEEIRTVHNSFSRQTLFEL---DIKGGEAEDNYHFVTYVPIGDKVYE 171

Query: 185 LDGLSNGPVNLGP-CTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL + P+ +     G +W+E V+P+IQ+RM +++  EI FNL+AL+ NR+  Y+    
Sbjct: 172 LDGLRDLPLEVADRPEGSDWVEAVKPIIQQRMQKFSEGEITFNLMALVPNRKQQYQ---- 227

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           E+ E ++ A+  N      +L E+   L   I+ E+ K + Y++ENS R+HN+  F+  +
Sbjct: 228 EMLENLKQANENN------ELGEQIGDLENAIKDEESKMEMYKKENSRRRHNYTPFVMEL 281

Query: 304 IRILAERGELQARIEYA 320
           ++ILA  G+L   + +A
Sbjct: 282 MKILAREGKLVGLVNHA 298



>gi|428180225|gb|EKX49093.1| hypothetical protein GUITHDRAFT_85879 [Guillardia theta CCMP2712]
          Length = 362

 Score =  273 bits (697), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 144/343 (41%), Positives = 211/343 (61%), Gaps = 41/343 (11%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IESDP VFT L R F ++GTQVEE+ +++D     L P+YGLIFLFKW    D +  
Sbjct: 5   WSTIESDPAVFTSLARDFGIRGTQVEEIVTMEDAEFSNLAPIYGLIFLFKWT--QDMAST 62

Query: 73  HPEADLSV-DENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDK 131
           H  +   V + N+YFAKQVI+NAC TQA+L+I++N   I+LG EL  FK FT  F P  K
Sbjct: 63  HRASSTCVQNHNLYFAKQVIHNACGTQALLNIMMNAEGINLGKELTEFKTFTADFPPDLK 122

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           G A++NSE++R  HNSFAR +PF +++    S +  D +HF +Y+P+ G L+ELDGL  G
Sbjct: 123 GEAMSNSEMMRSCHNSFARPEPFEMEE--DKSRKDGDAYHFTAYMPIGGKLWELDGLQEG 180

Query: 192 PVNLGPCTGDN-WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI--DER 248
           P+ LG CT  + W ++VRP++Q+R+ +Y+S EIRFNLLA+  N++D+Y   + ++  D +
Sbjct: 181 PILLGDCTDTSQWWKQVRPILQDRIEKYSSNEIRFNLLAVCANKKDMYMQELCKLQTDSQ 240

Query: 249 MRHASNTNNSSELMQLSEERD---------------------------------QLLQRI 275
           +  A+  ++  E+  + E+ D                                 +L Q +
Sbjct: 241 LISAALLSHGEEVEDMMEDVDTEGYDSKEAPVDVTDKSVEQLKSMLNRFKYRASELRQLL 300

Query: 276 EMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
           +ME  KF+RY REN+ R+HNFI FI N+++ LAE+ +L   IE
Sbjct: 301 DMEDEKFQRYARENARRRHNFIPFIMNLLQGLAEKQKLGPLIE 343



>gi|390333870|ref|XP_781862.3| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Strongylocentrotus purpuratus]
          Length = 318

 Score =  272 bits (696), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 208/324 (64%), Gaps = 34/324 (10%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           + AG WCLIESDPGVFTELIR F +                    PV+GLIFLFKWQ G 
Sbjct: 4   ASAGDWCLIESDPGVFTELIRGFGM--------------------PVHGLIFLFKWQPGM 43

Query: 68  DSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRL 125
           DSS    + D  +D+ ++FAKQVINNACATQAILS+L+NC   D  LG +L  FK+FT  
Sbjct: 44  DSSGTIVQ-DSRLDD-IFFAKQVINNACATQAILSVLMNCHHGDMTLGNQLKEFKEFTST 101

Query: 126 FDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYEL 185
           FDP  KGL I+NSE+I+ VHNSFAR   F  D   + +++ +D++HF+SY+P+QG LYEL
Sbjct: 102 FDPTMKGLTISNSEVIKDVHNSFARQQMFEFDS--RQANKDDDVYHFVSYMPIQGRLYEL 159

Query: 186 DGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           DGL +GPV+LG     +WL+ V+PVI+ER+ +Y++ EI FNL+ALI +R  ++   I  +
Sbjct: 160 DGLKDGPVDLGRADDGDWLKTVKPVIEERIRKYSANEIHFNLMALISDRRMIFNKEISRL 219

Query: 246 ------DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
                 +E M    +   S++ +Q    R +LLQ  E E  K K ++ EN  RKHN++  
Sbjct: 220 QNQLKAEELMDTDQSGPVSADAIQSELSRYRLLQ--EDEDRKIKTFKVENVRRKHNYLPL 277

Query: 300 IYNIIRILAERGELQARIEYARKE 323
           I  +++ILA +GEL   ++ A+++
Sbjct: 278 IMELLKILASKGELVPLVKEAKEK 301



>gi|196014574|ref|XP_002117146.1| hypothetical protein TRIADDRAFT_50992 [Trichoplax adhaerens]
 gi|190580368|gb|EDV20452.1| hypothetical protein TRIADDRAFT_50992 [Trichoplax adhaerens]
          Length = 358

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 227/354 (64%), Gaps = 30/354 (8%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLI+SDP +FTELI+ F V G QVEE+WSL+ +  E+LKP++GL+FLFKW+ G ++
Sbjct: 7   AGNWCLIDSDPRIFTELIKGFGVTGVQVEELWSLEKEEFEKLKPIHGLVFLFKWRPGEET 66

Query: 70  SRLHPEADLSVDE-NVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
                   L  D   +YFAKQVINNACATQA+LS+LLNC    + LG  L  FK+F+  F
Sbjct: 67  V-----GSLVQDSRQIYFAKQVINNACATQAVLSVLLNCNHKDVQLGEMLYKFKEFSADF 121

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           DP  +GL+++N ++IR VHNSFAR   F   + + SS++ E+ FHF++YVP+ G LYELD
Sbjct: 122 DPTMRGLSLSNMDIIRQVHNSFARQQMF---EFENSSNKSEEAFHFVAYVPINGRLYELD 178

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRE-------DVYR 239
           GL +GP++LG C G++W+  V+P+++ RM+ Y + EIRFNL+A++ + +       +  +
Sbjct: 179 GLKDGPIDLGKC-GEDWITAVKPILESRMTSYATGEIRFNLMAVVSDHKMKLEADLEKLQ 237

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEE-------RDQLLQRIEMEKVKFKRYERENSLR 292
           + + +++ ++       ++   ++L  E        ++   ++ +E+ K  RY+ E++ R
Sbjct: 238 SNLSDLEGKLSKLDTKKDTEAYLKLKNEYATVELKMNEANHQLRVEEEKRLRYKIEHAKR 297

Query: 293 KHNFIQFIYNIIRILAERG---ELQARIEYARKEMSKRIKDRAEKKKGESGSKN 343
            HN++  I  +++ LA+ G   EL  + E  +K ++    +R  K+K +SG ++
Sbjct: 298 DHNYLPMIVQLLKCLAKDGRLVELTEKAEQRQKAVTAAALER-RKRKLDSGKES 350



>gi|290562351|gb|ADD38572.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Lepeophtheirus
           salmonis]
          Length = 314

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 209/324 (64%), Gaps = 26/324 (8%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELI  F  +G QVEE+WSLD +   +LKPV+GLIFLFK    ++ 
Sbjct: 3   AGNWCLIESDPGVFTELIHKFGTKGVQVEELWSLDKEQFVDLKPVHGLIFLFKMVPDHN- 61

Query: 70  SRLHPEADLSVDENV---YFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P+  + +D  V   +FAKQVINNACATQAILS+LLN   P ++LG  L NFK+F  
Sbjct: 62  ----PQGTVVLDSRVDKMFFAKQVINNACATQAILSVLLNVDHPELELGTTLSNFKEFCS 117

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL+++NS+ IR VHNSFA+   F  D   + +S+ +D++HF+SY+P+ G LYE
Sbjct: 118 SFDSAMKGLSLSNSDEIRSVHNSFAKQTLFEFDS--KMASKDDDVYHFVSYIPMNGRLYE 175

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL  GPV+ GP + D +WL+ VRP+I++RM++Y + EI FNL+A ++++      ++ 
Sbjct: 176 LDGLKEGPVDHGPVSEDVDWLDVVRPIIEQRMAKYQAGEIHFNLMAPVRDQLMHLEKQLA 235

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           E  +        NNS+E +++        Q I  E  +  ++  EN  R+HN++ FI  +
Sbjct: 236 ECQKE------ENNSAEELRIQ-------QLINHESDRRSKWRLENIRRRHNYLPFIIEL 282

Query: 304 IRILAERGELQARIEYARKEMSKR 327
           ++ LA +G+L    + A+ +  +R
Sbjct: 283 LKTLANQGQLLPLYQKAKDKALER 306



>gi|391328977|ref|XP_003738956.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Metaseiulus occidentalis]
          Length = 323

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/333 (43%), Positives = 216/333 (64%), Gaps = 17/333 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVF+ELIR F V G QVEE++SL+D++  +++PV+GLIFLFK+    D 
Sbjct: 3   AGDWCLIESDPGVFSELIRGFGVSGVQVEEIFSLEDESFVDMRPVFGLIFLFKY---TDK 59

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLFD 127
           S L     +  + +++FAKQVINNACATQAIL++L+N   P ++LG  L   K+FT+ FD
Sbjct: 60  S-LATSGKVVTNPDIFFAKQVINNACATQAILAVLMNLQNPDVNLGENLAQLKEFTKEFD 118

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
              KGL  +NS++IR VHNSF+R      DQ  ++S + +D++HFISYVP+ G LYELDG
Sbjct: 119 SQMKGLTFSNSDVIREVHNSFSRPQIVEFDQ--KASKQDDDVYHFISYVPINGKLYELDG 176

Query: 188 LSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           L  GP+       + +WLE  R VI++R+++Y+ +EI FNL+A++K+R  V + +I E  
Sbjct: 177 LREGPIEHCEIPANKDWLESARQVIEQRIAQYSKSEIHFNLMAVVKDRRLVCQRQIEEF- 235

Query: 247 ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRI 306
           ++M     T      +       +L + I+ E  K   Y++EN  R+HN+I  I  +++I
Sbjct: 236 QKMGDGKPTETVRRGIA------RLQKVIKDENAKIAMYQKENIRRRHNYIPLIMELLKI 289

Query: 307 LAERGELQARIEYARKEMSKRIKDRAEKKKGES 339
            AE G+L    E A+   +++ K +AEK+K  +
Sbjct: 290 TAESGKLGVFWENAKSRQAEQAK-KAEKRKASA 321



>gi|348673764|gb|EGZ13583.1| hypothetical protein PHYSODRAFT_514191 [Phytophthora sojae]
          Length = 317

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 200/310 (64%), Gaps = 20/310 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFT LI    V+G QVEE+++LD+Q   +L PVYGL+FLFK++  N     
Sbjct: 3   WCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFADLSPVYGLVFLFKYES-NHGEDA 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    S ++ ++FAKQVI+NACATQAILSILLNC  I+LG  L  FK FT  F    KG
Sbjct: 62  EPPVFASEEDGLFFAKQVISNACATQAILSILLNCQDIELGETLSEFKAFTGDFPSDLKG 121

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI+NS+ IR  HNSFAR++PF ++  ++  +E +D++HF++YVPV G +YELDGL  GP
Sbjct: 122 LAISNSDKIRLAHNSFARAEPFVVE--ERKDTEDDDVYHFVAYVPVNGKVYELDGLREGP 179

Query: 193 VNLG----PCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           + LG        D+WL+   PVIQ+R+ +Y ++EIRFNLLAL++NR   Y  ++  I E 
Sbjct: 180 ICLGEVPDAANRDSWLQVACPVIQKRIEKYAASEIRFNLLALVRNRIQTYEEQLQAIIEA 239

Query: 249 MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILA 308
                     SE     ++  Q+   +  E+ K + +  EN  RKHN+I FI  +++ LA
Sbjct: 240 --------GGSE-----QQAAQIQADLGFEQQKRENWALENKRRKHNYIPFIIQLLKTLA 286

Query: 309 ERGELQARIE 318
           E+ +L+  I+
Sbjct: 287 EKKQLEPLIK 296



>gi|432855295|ref|XP_004068150.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform 2 [Oryzias latipes]
          Length = 300

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 201/326 (61%), Gaps = 44/326 (13%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G + 
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEE- 63

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   ++++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F++
Sbjct: 64  ----PAGSIVQDSRLDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQ 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHNSFAR                               LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHNSFAR-------------------------------LYE 148

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL++++ +R+ +Y  +I E
Sbjct: 149 LDGLREGPIDLGACNQDDWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAE 208

Query: 245 IDERMRHASNTNNSSELMQLSEERDQLLQR---IEMEKVKFKRYERENSLRKHNFIQFIY 301
           +  ++      +       LS  + ++ +    IE E  K KRY+ EN  RKHN++ FI 
Sbjct: 209 LQAQLTEDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIM 268

Query: 302 NIIRILAERGELQARIEYARKEMSKR 327
            +++ LAE  +L   +E A+++ S +
Sbjct: 269 ELLKTLAEYQQLMPLVEKAKEKQSAK 294



>gi|297281200|ref|XP_002802054.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Macaca mulatta]
          Length = 432

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/297 (46%), Positives = 197/297 (66%), Gaps = 18/297 (6%)

Query: 31  NVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFA 87
             +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FA
Sbjct: 142 GCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFA 196

Query: 88  KQVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVH 145
           KQVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NS++IR VH
Sbjct: 197 KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH 256

Query: 146 NSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLE 205
           NSFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+ 
Sbjct: 257 NSFARQQMFEFD--TKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWIS 314

Query: 206 KVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH----ASNTNNSSEL 261
            VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+  ++          N+    
Sbjct: 315 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSA 374

Query: 262 MQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
           +Q    ++Q+L  IE E  K KRY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 375 IQSEVAKNQML--IEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 429



>gi|512934835|ref|XP_004933128.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform X1 [Bombyx mori]
          Length = 393

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 209/333 (62%), Gaps = 29/333 (8%)

Query: 1   RVYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFL 60
           +    KM  AG WCL+ESDPGVFT+LI  F  +G QVEE+W+++D   E L+PV+GLIFL
Sbjct: 17  KAKAPKMDSAGDWCLLESDPGVFTQLIHKFGAKGVQVEELWTIEDSMFENLRPVHGLIFL 76

Query: 61  FKWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAE 115
           FK+    +     P   +  D   + ++FAKQVINNACATQA++S+LLNC  P ++LG E
Sbjct: 77  FKYVNYEE-----PAGPIVSDDRLDKIFFAKQVINNACATQAVISLLLNCKHPDLELGPE 131

Query: 116 LDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISY 175
           L   K+F+  FD   +GL+++NS+ IR  HNS A+   F +D   +  ++ ED +HFI Y
Sbjct: 132 LTKLKEFSMTFDSRMRGLSLSNSQTIRSAHNSMAQQPLFEVDP--KMPAKDEDAYHFIGY 189

Query: 176 VPVQGALYELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNR 234
           +P+ G LYELDGL  GP++ G    + +WL+ VRP+I  R++ YT  EI FNL+AL+ +R
Sbjct: 190 MPIDGRLYELDGLQEGPIDHGAVAPEQDWLDVVRPIIMRRINVYTEGEIHFNLMALVSDR 249

Query: 235 EDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKH 294
           + +Y+          R      N ++L+       +L   I+ E++K  +Y++E   R+H
Sbjct: 250 KMIYQ----------RQLDTLLNETQLLA------RLRMLIDYEEIKMAKYKQELVRRRH 293

Query: 295 NFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           N++ FI N+++ILA+  +L   +E A++  +KR
Sbjct: 294 NYMPFIINLLQILAKEKKLMPLLEKAKERATKR 326



>gi|262367853|pdb|3A7S|A Chain A, Catalytic Domain Of Uch37
          Length = 228

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 128/233 (54%), Positives = 172/233 (73%), Gaps = 12/233 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNA ATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDT--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRE 235
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK 228



>gi|377656312|pdb|3TB3|A Chain A, Crystal Structure Of The Uch Domain Of Uch-L5 With 6
           Residues Deleted
 gi|377656313|pdb|3TB3|B Chain B, Crystal Structure Of The Uch Domain Of Uch-L5 With 6
           Residues Deleted
          Length = 229

 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 171/232 (73%), Gaps = 12/232 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 5   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 64

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNA ATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 65  E-----PAGSVVQDSRLDTIFFAKQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEF 119

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 120 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDT--KTSAKEEDAFHFVSYVPVNGRL 177

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNR 234
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R
Sbjct: 178 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDR 229



>gi|341882703|gb|EGT38638.1| hypothetical protein CAEBREN_14335 [Caenorhabditis brenneri]
          Length = 319

 Score =  269 bits (688), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 207/331 (62%), Gaps = 22/331 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M DAG WCLIESDPGVFTE++R F V G QVEE++SLDD     +KPVYGLIFLFKW+ G
Sbjct: 1   MGDAGNWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDK-ALMKPVYGLIFLFKWRQG 59

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
           +     H     S D  ++FA+QVI NACATQAI+++++N     +++G  L  +K+F  
Sbjct: 60  D-----HGNGTSSPDPTIFFAQQVIQNACATQAIINLIMNLEDKNVNIGPLLTQYKEFAV 114

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
             DP  +GL ++NS+ IR VHNSFAR     L + D    E ED +HF++YVP+ G +YE
Sbjct: 115 EMDPATRGLVLSNSDEIRSVHNSFARQT---LYELDIKGGEAEDNYHFVTYVPIGGKVYE 171

Query: 185 LDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL + P+ L     G +W+E VRP+IQERM++Y+  EI FNL+A++ NR+  Y+    
Sbjct: 172 LDGLRDYPLELAAIPEGGDWVEVVRPIIQERMAKYSEGEITFNLMAMVPNRKQKYQ---- 227

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           E+ E ++ A+  N      +L E+   + + I  E  K   Y +EN+ R+HN+  FI  +
Sbjct: 228 EMLESLQQANENN------ELDEQIADISRSIAEEDHKMAMYSKENARRRHNYTPFIVQL 281

Query: 304 IRILAERGELQARIEYARKEMSKRIKDRAEK 334
           ++ILA+  +    +E + +   ++ +   +K
Sbjct: 282 MKILAKESKFVPLVENSYQAAKQKAQMNTDK 312



>gi|281201627|gb|EFA75836.1| peptidase C12 family protein [Polysphondylium pallidum PN500]
          Length = 333

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/258 (51%), Positives = 176/258 (68%), Gaps = 13/258 (5%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSD+G WC IESDPGVFTELI    V+  QVEE++ L+     ++KP+YGLIFLFKWQ  
Sbjct: 1   MSDSG-WCTIESDPGVFTELIEKIGVKDVQVEELYMLEPSEFNKIKPIYGLIFLFKWQST 59

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLF 126
            +  R   E     +EN++FA QVINNACATQAILSILLN P ID+G +L+N K FT  F
Sbjct: 60  TED-RTPAE-----NENLFFANQVINNACATQAILSILLNSPDIDIGDDLNNLKQFTAGF 113

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
            P  KG AI    ++R  HNSFAR +PF      + + + +D+FHFISY+P +G +YELD
Sbjct: 114 PPMMKGEAIGELNILRDTHNSFARPEPFIFGS--KPAKKDDDVFHFISYIPFEGKIYELD 171

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GL  GP  LG CT D+WLEKV P+IQ+R+ +Y+  EIRFNL+A+IKNR+ +YR ++   +
Sbjct: 172 GLKKGPFCLGECTDDDWLEKVSPIIQQRIEKYSQTEIRFNLMAVIKNRQTIYREQLAHFE 231

Query: 247 ERMR----HASNTNNSSE 260
           ++ +      SN + S E
Sbjct: 232 KKKKAILLSLSNIDTSVE 249



>gi|301108143|ref|XP_002903153.1| ubiquitin carboxyl-terminal hydrolase, putative [Phytophthora
           infestans T30-4]
 gi|262097525|gb|EEY55577.1| ubiquitin carboxyl-terminal hydrolase, putative [Phytophthora
           infestans T30-4]
          Length = 316

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 199/310 (64%), Gaps = 20/310 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFT LI    V+G QVEE+++LD+Q   +L PV+GL+FLFK++  N     
Sbjct: 3   WCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFSDLSPVFGLVFLFKYES-NHGEDA 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    S  + V+FAKQVI+NACATQAILSILLN   ++LG  L  FK FT  F    KG
Sbjct: 62  EPPVFASEGDGVFFAKQVISNACATQAILSILLNAQDVELGETLLEFKAFTGDFPSDLKG 121

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI+NS+ IR  HNSFAR++PF +++  + ++E +D++HF++YVPV G +YELDGL  GP
Sbjct: 122 LAISNSDKIRLAHNSFARAEPFVVEE--RKATEDDDVYHFVAYVPVNGKVYELDGLREGP 179

Query: 193 VNLG----PCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           + LG        D+WL+   PVIQ+R+ +Y++ EIRFNLLAL+KNR   Y  ++  + E 
Sbjct: 180 ICLGDVPDAANRDSWLQVACPVIQKRIEKYSATEIRFNLLALVKNRIQTYEEQLQAVIE- 238

Query: 249 MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILA 308
                     SE     ++  Q+   +  E+ K + +  EN  RKHN+I FI  ++R LA
Sbjct: 239 -------GGGSE-----QQAAQIQADLAAEQQKRENWALENKRRKHNYIPFIMQLLRTLA 286

Query: 309 ERGELQARIE 318
           E+ +L+  I+
Sbjct: 287 EKKQLEPLIK 296



>gi|512934839|ref|XP_004933129.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           isoform X2 [Bombyx mori]
          Length = 371

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/327 (41%), Positives = 207/327 (63%), Gaps = 29/327 (8%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M  AG WCL+ESDPGVFT+LI  F  +G QVEE+W+++D   E L+PV+GLIFLFK+   
Sbjct: 1   MDSAGDWCLLESDPGVFTQLIHKFGAKGVQVEELWTIEDSMFENLRPVHGLIFLFKYVNY 60

Query: 67  NDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKD 121
            +     P   +  D   + ++FAKQVINNACATQA++S+LLNC  P ++LG EL   K+
Sbjct: 61  EE-----PAGPIVSDDRLDKIFFAKQVINNACATQAVISLLLNCKHPDLELGPELTKLKE 115

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGA 181
           F+  FD   +GL+++NS+ IR  HNS A+   F +D   +  ++ ED +HFI Y+P+ G 
Sbjct: 116 FSMTFDSRMRGLSLSNSQTIRSAHNSMAQQPLFEVDP--KMPAKDEDAYHFIGYMPIDGR 173

Query: 182 LYELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRT 240
           LYELDGL  GP++ G    + +WL+ VRP+I  R++ YT  EI FNL+AL+ +R+ +Y+ 
Sbjct: 174 LYELDGLQEGPIDHGAVAPEQDWLDVVRPIIMRRINVYTEGEIHFNLMALVSDRKMIYQ- 232

Query: 241 RIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFI 300
                    R      N ++L+       +L   I+ E++K  +Y++E   R+HN++ FI
Sbjct: 233 ---------RQLDTLLNETQLLA------RLRMLIDYEEIKMAKYKQELVRRRHNYMPFI 277

Query: 301 YNIIRILAERGELQARIEYARKEMSKR 327
            N+++ILA+  +L   +E A++  +KR
Sbjct: 278 INLLQILAKEKKLMPLLEKAKERATKR 304



>gi|403334786|gb|EJY66564.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, putative
           [Oxytricha trifallax]
 gi|403351325|gb|EJY75152.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, putative
           [Oxytricha trifallax]
          Length = 353

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 208/333 (62%), Gaps = 37/333 (11%)

Query: 11  GQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSS 70
            +WC IESDPGVFTEL+R   V+G QVEE+ +LDD+ L ++KP+YGLIFLFKW    D  
Sbjct: 2   SKWCTIESDPGVFTELMRQVGVKGVQVEELLTLDDEELNQIKPIYGLIFLFKW--VQDPE 59

Query: 71  RLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYD 130
           +     D   D+ ++FA QVINNACATQAI SIL+N   ID+G EL N +DF+      D
Sbjct: 60  KRDTLTD--YDQELFFANQVINNACATQAICSILMNRKDIDIGDELRNLRDFSIEMTAKD 117

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           KG AI NSE+IR  HNSFAR +PF ++    SS ++ED+FHFISY+P  G LYELDGL  
Sbjct: 118 KGWAIGNSEVIRLSHNSFARQEPFEIEHGP-SSGKEEDVFHFISYMPFNGQLYELDGLQP 176

Query: 191 GPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRED-------------- 236
           GP++ G CT +NWL   R  I +R+ +Y ++E+RFNL+A++ +++D              
Sbjct: 177 GPISFGACTEENWLSLAREQIMKRIQKYENSELRFNLMAVVADKKDQAEKEWNRLKLIRN 236

Query: 237 VYRTRIG-EIDERMRHASNTNNSSELMQLSEERDQLLQ---------------RIEMEKV 280
               ++G E DE M   S+  N  E+ +LS++  + +Q               +++ E  
Sbjct: 237 FLSKQLGIETDESMEDYSSVQN--EIDELSKQNQETMQASLTEINQSIINQEMKVQQEIE 294

Query: 281 KFKRYERENSLRKHNFIQFIYNIIRILAERGEL 313
           + +R++ EN  RKHN++ FI+ +++ LA++  L
Sbjct: 295 RNQRWKTENERRKHNYVPFIFELLQQLAKKNML 327



>gi|195439240|ref|XP_002067539.1| GK16481 [Drosophila willistoni]
 gi|194163624|gb|EDW78525.1| GK16481 [Drosophila willistoni]
          Length = 376

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 198/320 (61%), Gaps = 7/320 (2%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           + + +WCLIESDPGVFTELIR F   G +VEE+W+LD      L+P++GLIFLFKW   +
Sbjct: 25  ATSNEWCLIESDPGVFTELIRGFGCVGAEVEEIWTLDAGAFYHLEPIHGLIFLFKWIEND 84

Query: 68  DSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRL 125
           + +      D    + ++FAKQ++ NACATQAILS+LLN     I+LG  L  FK   + 
Sbjct: 85  EPAGRVVLPDSEEGKGIFFAKQMVTNACATQAILSLLLNLQHEDIELGETLIQFKQMCQE 144

Query: 126 FDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKE-DIFHFISYVPVQGALYE 184
            DPY +G  + NS  IR VHNSFAR + F LD   Q SS  E D +HF+ Y+P+   LYE
Sbjct: 145 CDPYKRGQNLGNSLQIRQVHNSFARPEIFDLDTIKQQSSLTEDDFYHFVGYMPIGNHLYE 204

Query: 185 LDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDG+  GP+ LG    G NWL+ VRP+I+ RM RY   EI FNL++L+ +R+  Y  +I 
Sbjct: 205 LDGMQEGPIELGEIKPGQNWLDVVRPIIEARMKRYCVGEIHFNLMSLVSDRQRAYERQIA 264

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQR-IEMEKVKFKRYERENSLRKHNFIQFIYN 302
            + +        +N SE  ++ E  D  LQR +E E  K +RY +ENS R+HN++ FI  
Sbjct: 265 TLQKPGNDMLLDSNLSEAERMIEIAD--LQRLLEFEMEKKRRYHKENSRRRHNYLPFILE 322

Query: 303 IIRILAERGELQARIEYARK 322
           +++ L E G+L    E A++
Sbjct: 323 LLKQLGETGQLMPIYEKAKE 342



>gi|449508010|ref|XP_002191860.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5
           [Taeniopygia guttata]
          Length = 333

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 205/330 (62%), Gaps = 41/330 (12%)

Query: 32  VQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAK 88
            +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FAK
Sbjct: 5   CRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAK 59

Query: 89  QVINNACATQAILSILLNCPT--IDLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHN 146
           QVINNACATQAI+S+LLNC    I LG  L  FK+F++ FD   KGLA++NSE+IR VHN
Sbjct: 60  QVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVHN 119

Query: 147 SFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEK 206
           SFAR   F  D   +SS+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+  
Sbjct: 120 SFARQQMFEFDA--KSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACHQDDWISA 177

Query: 207 VRPVIQERMSR--------------------------YTSAEIRFNLLALIKNREDVYRT 240
           VRPVI++R+ +                          Y+  EIRFNL+A++ +R+ +Y  
Sbjct: 178 VRPVIEKRIQKCLCSEERSYECSGKEDCYLLHSCGSLYSEGEIRFNLMAIVSDRKMIYEQ 237

Query: 241 RIGEIDERMRHAS--NTNNSSELM-QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
           RI E+ +++      +T+ SS ++  +  E  +    IE E  K KRY+ EN  RKHN++
Sbjct: 238 RIAELQQQLAQEEPMDTDQSSNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYL 297

Query: 298 QFIYNIIRILAERGELQARIEYARKEMSKR 327
            FI  +++ LAE  +L   +E A+++ + +
Sbjct: 298 PFIMELLKTLAEHQQLIPLVEKAKEKQNAK 327



>gi|183979268|dbj|BAG30795.1| similar to CG3431-PA [Papilio xuthus]
          Length = 322

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 203/326 (62%), Gaps = 16/326 (4%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M  AG WC IESDPGVFT+LIRAF  +G QVEE+W++D    E LKPV+GLIFLFK+   
Sbjct: 1   MPAAGNWCQIESDPGVFTQLIRAFGTKGVQVEELWTIDGGIFENLKPVHGLIFLFKYVQD 60

Query: 67  NDSSRLHPEADLSVDE--NVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
           N+     P+  ++ D    +YFAKQVINNACATQAI+SILLN   P +DLG EL   K+F
Sbjct: 61  NEP----PKPVITDDRINKIYFAKQVINNACATQAIISILLNVTIPDVDLGPELTQLKEF 116

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           +  FDP  +GL ++NS  IR  HNS  +  P F    D +S + ED +HFI Y+ + G +
Sbjct: 117 SMCFDPQMRGLTLSNSNTIRTAHNSMVQL-PLFETDPDIASKD-EDAYHFIGYMAIDGRI 174

Query: 183 YELDGLSNGPVNLGPCTG-DNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL  GP++ G  T  ++WL+ VRPVI +R++ YT  EI FNL+A++ +R+ +Y  +
Sbjct: 175 YELDGLREGPIDHGEVTAEEDWLDAVRPVIMQRINAYTEGEIHFNLMAVVSDRKMIYERQ 234

Query: 242 IGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIY 301
           I ++ E  +     N   E      E   L   IE E  K  +Y+ +   R+HN++ FI 
Sbjct: 235 IDDLLEASQLIPMDNEYVE-----NEIRNLKMLIEDEDEKMAKYQDDMIRRRHNYLPFII 289

Query: 302 NIIRILAERGELQARIEYARKEMSKR 327
            +++ILAE  +L    + A++  S++
Sbjct: 290 TLLKILAEEKKLMRVYQKAKERASRK 315



>gi|356624462|pdb|3RII|A Chain A, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
 gi|356624463|pdb|3RII|B Chain B, Crystal Structure Of The Catalytic Domain Of Uchl5, A
           Proteasome- Associated Human Deubiquitinating Enzyme,
           Reveals An Unproductive Form Of The Enzyme
          Length = 233

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 171/236 (72%), Gaps = 12/236 (5%)

Query: 5   TKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQ 64
           +   +AG+WCL ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ
Sbjct: 5   SXTGNAGEWCLXESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQ 64

Query: 65  GGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNF 119
            G +     P   +  D   + ++FAKQVINNA ATQAI+S+LLNC   D  LG  L  F
Sbjct: 65  PGEE-----PAGSVVQDSRLDTIFFAKQVINNASATQAIVSVLLNCTHQDVHLGETLSEF 119

Query: 120 KDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQ 179
           K+F++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV 
Sbjct: 120 KEFSQSFDAAXKGLALSNSDVIRQVHNSFARQQXFEFDT--KTSAKEEDAFHFVSYVPVN 177

Query: 180 GALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRE 235
           G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL A++ +R+
Sbjct: 178 GRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLXAIVSDRK 233



>gi|213515214|ref|NP_001133540.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Salmo salar]
 gi|209154410|gb|ACI33437.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Salmo salar]
          Length = 298

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 205/332 (61%), Gaps = 51/332 (15%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG+WCL+ESDPGVFTELI+ F  +G QVEE+WS++ +  E LKPV+GLIFLFKWQ G   
Sbjct: 5   AGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGE-- 62

Query: 70  SRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
               P   +  D   +N++FAKQVINNACATQAI+S+LLNC   D  LG  L  F++F+ 
Sbjct: 63  ---APAGSIVQDSRLDNIFFAKQVINNACATQAIVSVLLNCTHSDMLLGETLTEFREFSL 119

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGLA++NSE+IR VHN                                 G LYE
Sbjct: 120 SFDAAMKGLALSNSEVIRQVHN---------------------------------GRLYE 146

Query: 185 LDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
           LDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E
Sbjct: 147 LDGLREGPIDLGVCNQDDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAE 206

Query: 245 IDERM--RHASNTNNSSELM---QLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           +  ++      +T+ SS L+   Q    + QLL  I+ E  K KRY+ EN  RKHN++ F
Sbjct: 207 LQIQLAEEEPMDTDQSSTLLSSIQSEIAKYQLL--IDEENQKLKRYKIENIRRKHNYLPF 264

Query: 300 IYNIIRILAERGELQARIEYAR-KEMSKRIKD 330
           I  +++ LAE  +L   +E A+ K+ +K++++
Sbjct: 265 IMELLKTLAEYQQLIPLVEKAKEKQSAKKVQE 296



>gi|194768058|ref|XP_001966131.1| GF19511 [Drosophila ananassae]
 gi|190623016|gb|EDV38540.1| GF19511 [Drosophila ananassae]
          Length = 413

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 198/325 (60%), Gaps = 18/325 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V   K    G WCLIESDPGVFTELIR F   G QVEE+W+LD +    L+P++GLIFLF
Sbjct: 16  VIGPKEGADGSWCLIESDPGVFTELIRGFGCTGAQVEEIWTLDAEAFHHLEPIHGLIFLF 75

Query: 62  KW-QGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDN 118
           KW Q      R+     +    +V+F +QVI NACATQA+L +L+N   P IDLG  L +
Sbjct: 76  KWVQDDKPIGRV-----VKDRSDVFFVRQVITNACATQALLCLLMNLQHPDIDLGETLTS 130

Query: 119 FKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPV 178
           FK   +  DP  +GL ++    IR VHNSFAR  P   +   + ++ +ED++HF+ ++P+
Sbjct: 131 FKSVCQDLDPVVRGLCLSRESKIRSVHNSFAR--PVLFEVDMRQATVEEDVYHFVGFMPI 188

Query: 179 QGALYELDGLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDV 237
           +G LYELDG+  GP+ L   + G NWL+ VRP+I+ RM RY+  EI FNL+AL+ +R+  
Sbjct: 189 KGRLYELDGMQEGPIELAEISKGQNWLDVVRPIIEARMQRYSVGEIHFNLMALVSDRQRC 248

Query: 238 YRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
           Y  +I    + + H  +  + +E     EE   L   ++ E+ K +RY +EN  R+HN++
Sbjct: 249 YERQI----QLLVHQPSPLSHAE---RQEEIANLRTYVKFEQEKKRRYRQENQRRRHNYL 301

Query: 298 QFIYNIIRILAERGELQARIEYARK 322
            FI  +++ L E G+L    E A+K
Sbjct: 302 PFIVELLKQLGETGQLMPIFEKAKK 326



>gi|242041667|ref|XP_002468228.1| hypothetical protein SORBIDRAFT_01g042110 [Sorghum bicolor]
 gi|241922082|gb|EER95226.1| hypothetical protein SORBIDRAFT_01g042110 [Sorghum bicolor]
          Length = 331

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/326 (40%), Positives = 209/326 (64%), Gaps = 25/326 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  +E+DPGVFTE+++   ++G QV+E++SLD   L +L+P+YGLI L+KW+      R 
Sbjct: 3   WAAVENDPGVFTEMLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPSEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    ++ +N++FA Q+INNACATQAILS+LLN P I L  EL   K+F +   P  KG
Sbjct: 62  -PVIKDAI-QNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N   IR ++NSFARS+   + +  +  S+ +D++HFISYVPV G LYELDGL  GP
Sbjct: 120 LAIVNCASIRMLNNSFARSE---VSEEQKPPSKDDDVYHFISYVPVDGVLYELDGLKEGP 176

Query: 193 VNLGPCTG----DNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WLE  +PVI+E +  ++  EIRF+++A++KNR+++Y   + ++  +
Sbjct: 177 ISLGKCPGGVGDTGWLELAQPVIKEHIDLFSQNEIRFSVMAILKNRKEMYTVELKDLQRK 236

Query: 249 -------------MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
                        +RH  +   S  L +++ + + + ++I ME+ K K+++ EN  RKHN
Sbjct: 237 RESLLQQMGDPSAIRHVPSVELS--LAEVAAQIESVTEKIIMEEEKMKKWKMENLRRKHN 294

Query: 296 FIQFIYNIIRILAERGELQARIEYAR 321
           +  F++N ++IL E+ +L+  IE A+
Sbjct: 295 YAPFLFNFLKILEEKQQLKPLIEKAK 320



>gi|242079609|ref|XP_002444573.1| hypothetical protein SORBIDRAFT_07g023880 [Sorghum bicolor]
 gi|241940923|gb|EES14068.1| hypothetical protein SORBIDRAFT_07g023880 [Sorghum bicolor]
          Length = 331

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 209/326 (64%), Gaps = 25/326 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPGVFTEL++   ++G QV+E++SLD   L +L+P+YGLI L+KW+      R 
Sbjct: 3   WAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALSDLQPIYGLIVLYKWRPPEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    ++  N++FA Q+INNACATQAILS+LLN P I L  EL   K+F +   P  KG
Sbjct: 62  -PVIKDAIP-NLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N   IR ++NSFARS+   + +  +  S+ +D++HFISYVPV G LYELDGL  GP
Sbjct: 120 LAIVNCASIRMLNNSFARSE---VSEEQKPHSKDDDVYHFISYVPVDGVLYELDGLKEGP 176

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL  V+PVI+E +  ++  EIRF+++A++KNR++++   + ++  +
Sbjct: 177 ISLGKCPGGIGDAGWLRLVQPVIKEHIDMFSQNEIRFSVMAILKNRKEMFTVELKDLQRK 236

Query: 249 -------------MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
                        +RH  +   S  L +++ + + + ++I ME+ K K+++ EN  RKHN
Sbjct: 237 RESLLQQMGDPSAIRHVPSVEQS--LAEVAAQIESVTEKIIMEEEKSKKWKTENLRRKHN 294

Query: 296 FIQFIYNIIRILAERGELQARIEYAR 321
           ++ F++N ++IL E+ +L+  IE A+
Sbjct: 295 YVPFLFNFLKILEEKQQLKPLIEKAK 320



>gi|506968395|gb|AGM32541.1| cysteine peptidase C12 containing ubiquitin carboxyl-terminal
           hydrolase (UCH) [Coptotermes formosanus]
          Length = 283

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 177/252 (70%), Gaps = 10/252 (3%)

Query: 7   MSD-AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKW-Q 64
           M+D AG WCLIESDPGVFTELI+ F V+G QVEE+WSLD +  E LKP++GLIFLFKW Q
Sbjct: 1   MADSAGNWCLIESDPGVFTELIKEFGVKGVQVEELWSLDAEQFENLKPIHGLIFLFKWVQ 60

Query: 65  GGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
               +  +  +A L   + ++FAKQVINNACATQAILSILLNC  P + LG  L  FK+F
Sbjct: 61  DDEPTGSVVQDARL---DKIFFAKQVINNACATQAILSILLNCKHPDLTLGPTLTEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            + FD   KGL ++NS+ IR VHNSFAR   F  +   + +S+ +D++HF+ Y+P+ G L
Sbjct: 118 CQSFDANMKGLTLSNSQTIRSVHNSFARQTLFEFES--KLASKDDDVYHFVGYIPIDGRL 175

Query: 183 YELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           YELDGL  GP++LG  T D +WL+ VRP+I++R+ +Y   EI FNL+A++ +R+  Y  +
Sbjct: 176 YELDGLKEGPIDLGAVTPDADWLDVVRPIIEKRIKKYNDGEIHFNLMAIVSDRKMTYEKK 235

Query: 242 IGEIDERMRHAS 253
           I  I ++M  + 
Sbjct: 236 ITLIQKQMEESG 247



>gi|313236010|emb|CBY11337.1| unnamed protein product [Oikopleura dioica]
          Length = 315

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 211/336 (62%), Gaps = 25/336 (7%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           DAG+WCL+ESDPGVF+ LIR F   G QV+E+WSLD +  E L  V+GLIFLFKW G  +
Sbjct: 2   DAGEWCLLESDPGVFSALIREFGCSGAQVDEIWSLDAENFEPLGEVFGLIFLFKWDGKKE 61

Query: 69  SSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTRLF 126
           ++           EN+++A+QVINNAC TQA++SILLN     I LG EL+NF++FT   
Sbjct: 62  TASKGKVVSDMEHENLFWAQQVINNACGTQALISILLNIEGNKIKLGEELENFQNFTIGI 121

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           D   KG A++N+E IR VHNSF++   F L++    + EKE  +HF+S+VPV G L+E+D
Sbjct: 122 DGESKGFALSNAEGIRKVHNSFSKQQLFELEEP--KNQEKELPYHFVSFVPVNGRLWEID 179

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GL  GP++ G  +  NW++  RPV+Q RM++Y   E+ FNL+A  ++       ++  ++
Sbjct: 180 GLQKGPIDHGEISCSNWIDAARPVLQTRMAQYQEGEVHFNLMACCED-------KLIRLE 232

Query: 247 ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRI 306
           +++          E   L   + Q+  +IE EK K   ++++N+ RKHNF+  +  +++ 
Sbjct: 233 KKL----------EAETLDYPKTQIQMQIEAEKEKRLNWDKDNARRKHNFMPMVVELLKQ 282

Query: 307 LAERGELQARIEYARKEMSKRIKDRAEKKKGESGSK 342
           +A +G L +++E A+    +R K+  E++K   G+K
Sbjct: 283 MATKGTLVSQVEKAQ----ERTKEAIERRKKLKGAK 314



>gi|313236008|emb|CBY11335.1| unnamed protein product [Oikopleura dioica]
          Length = 315

 Score =  262 bits (670), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 211/336 (62%), Gaps = 25/336 (7%)

Query: 9   DAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGND 68
           DAG+WCL+ESDPGVF+ LIR F   G QV+E+WSLD +  E L  V+GLIFLFKW G  +
Sbjct: 2   DAGEWCLLESDPGVFSALIREFGCSGAQVDEIWSLDAENFEPLGEVFGLIFLFKWDGKKE 61

Query: 69  SSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTRLF 126
           ++           EN+++A+QVINNAC TQA++SILLN     I LG EL+NF++FT   
Sbjct: 62  TASKGKVVSDMEHENLFWAQQVINNACGTQALISILLNIEGNKIKLGEELENFQNFTIGI 121

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           D   KG A++N+E IR VHNSF++   F L++    + EKE  +HF+S+VPV G L+E+D
Sbjct: 122 DGESKGFALSNAEGIRKVHNSFSKQQLFELEEP--KNQEKELPYHFVSFVPVNGRLWEID 179

Query: 187 GLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID 246
           GL  GP++ G  +  NW++  RPV+Q RM++Y   E+ FNL+A  ++       ++  ++
Sbjct: 180 GLQKGPIDHGEISCSNWIDAARPVLQTRMAQYQEGEVHFNLMACCED-------KLIRLE 232

Query: 247 ERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRI 306
           +++          E   L   + Q+  +IE EK K   ++++N+ RKHNF+  +  +++ 
Sbjct: 233 KKL----------EAETLDYPKTQIQMQIEAEKEKRLDWDKDNARRKHNFMPMVVELLKQ 282

Query: 307 LAERGELQARIEYARKEMSKRIKDRAEKKKGESGSK 342
           +A +G L +++E A+    +R K+  E++K   G+K
Sbjct: 283 MATKGTLVSQVEKAQ----ERTKEAIERRKKLKGAK 314



>gi|195165099|ref|XP_002023383.1| GL20225 [Drosophila persimilis]
 gi|194105488|gb|EDW27531.1| GL20225 [Drosophila persimilis]
          Length = 351

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 191/314 (60%), Gaps = 28/314 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFT+LIR F   G Q+EE+WSLD  T + L+P++GLIFL KW         
Sbjct: 26  WCQIESDPGVFTQLIRDFGCVGAQMEEIWSLDPDTFKSLEPIHGLIFLVKWLADE----- 80

Query: 73  HPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLFDPY 129
            P   +  D  N+YFA+QV+ N+CATQAI+S+LLN   P I+LG  L  FK  TR  DP 
Sbjct: 81  QPTGRVVSDLGNIYFAQQVVRNSCATQAIISLLLNLSHPDIELGETLTRFKHVTRELDPL 140

Query: 130 DKGLAITNSELIRGVHNSFARS-------DPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            +G  ++N   IR  HNSFAR          F +D+  Q  S+  D++HF+ Y+P+   L
Sbjct: 141 SRGYCLSNEGKIRTAHNSFARPRISLQPRSTFVVDEPQQDESDA-DVYHFVGYMPIGEKL 199

Query: 183 YELDGLSNGPVNL---GPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
           YELDGL  GP  L   GP  G NWL+ VRP+I+ERM RY++ ++ FNL+AL+ +R+  Y 
Sbjct: 200 YELDGLRMGPTELAEIGP--GQNWLDIVRPIIEERMQRYSADDLNFNLMALVSDRQSFYE 257

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           ++I +   R      +   SE+       + LL R+ +EK K ++Y  EN+ R+HN++ F
Sbjct: 258 SQIEQFQRRSLQMPKSQRESEM-------NHLLDRLRIEKEKNRQYRIENTRRRHNYLPF 310

Query: 300 IYNIIRILAERGEL 313
           I  +++ + + G+L
Sbjct: 311 IVELLKQMGKNGQL 324



>gi|195356117|ref|XP_002044528.1| GM13220 [Drosophila sechellia]
 gi|194131830|gb|EDW53764.1| GM13220 [Drosophila sechellia]
          Length = 340

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 136/339 (40%), Positives = 202/339 (59%), Gaps = 19/339 (5%)

Query: 2   VYTTKMSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLF 61
           V     + A  WCLIESDPGVFTE+I  F   G QVEE+WS++      L+P++GLIFLF
Sbjct: 14  VTAKGATAANNWCLIESDPGVFTEMISGFGCTGAQVEEIWSMNADAFRHLEPIHGLIFLF 73

Query: 62  KWQGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNF 119
           KW     + R+     ++   +++FA+QV+ NACATQA++ +LLN     IDLG  L   
Sbjct: 74  KWLDNMPAGRV-----VTDRSDIFFARQVVTNACATQALICLLLNLQHEDIDLGPILSEL 128

Query: 120 KDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQ 179
           K F +   P  +G  +   E IR VHNSFAR + F ++  D + SE  D +HF+ ++P++
Sbjct: 129 KIFCQDLCPESRGQCLAKEEKIRKVHNSFARPELFVVE--DSADSEDVDCYHFVGFMPIK 186

Query: 180 GALYELDGLSNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVY 238
           G LYELDG+  GP+ LG      NWL+ VRP+I+ERM RY+  EI FNL+AL+ +R+  Y
Sbjct: 187 GKLYELDGMKEGPIELGEIGQQQNWLDVVRPIIEERMKRYSVGEIHFNLMALVSDRQRCY 246

Query: 239 RTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
             +I  + E     S  +  +E+         L+  +++EK K +RY +EN+ R+HN++ 
Sbjct: 247 ERQIQMLVELSSPLSYADCQAEIA-------TLIYFVKLEKEKKRRYRKENNRRRHNYLP 299

Query: 299 FIYNIIRILAERGELQARIEYA--RKEMSKRIKDRAEKK 335
           FI  +++ L E G+L A  + A  R   SK  KD  +++
Sbjct: 300 FIVELLKQLGETGQLMAICDKAKDRSCPSKSNKDAMDQQ 338



>gi|198468526|ref|XP_002134052.1| GA26899 [Drosophila pseudoobscura pseudoobscura]
 gi|198146456|gb|EDY72679.1| GA26899 [Drosophila pseudoobscura pseudoobscura]
          Length = 351

 Score =  256 bits (655), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 190/314 (60%), Gaps = 28/314 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFT+LIR F   G Q+EE+WSLD  T + L+P++GLIFL KW         
Sbjct: 26  WCQIESDPGVFTQLIRDFGCVGAQMEEIWSLDPDTFKSLEPIHGLIFLVKWLADE----- 80

Query: 73  HPEADLSVD-ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLFDPY 129
            P   +  D  N+YFA+QV+ N+CATQAI+S+LLN   P I+LG  L  FK  TR  DP 
Sbjct: 81  QPTGRVVSDLGNIYFAQQVVRNSCATQAIISLLLNLSHPDIELGETLTRFKHVTRELDPL 140

Query: 130 DKGLAITNSELIRGVHNSFARS-------DPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
            +G  ++N   IR  HNSFAR          F +D+  Q  S+  D++HF+ Y+P+   L
Sbjct: 141 SRGYCLSNEAKIRTAHNSFARPRISVQPRSTFVVDEPQQDESDA-DVYHFVGYMPIGEKL 199

Query: 183 YELDGLSNGPVNL---GPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
           YELDGL  GP  L   GP  G NWL+ VRP+I+ERM RY+S ++ FNL+AL+ +R+  Y 
Sbjct: 200 YELDGLRMGPTELAEIGP--GQNWLDIVRPIIEERMQRYSSDDLNFNLMALVSDRQSFYE 257

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
           ++I +          +   SE+       + LL R+ +EK K ++Y  EN+ R+HN++ F
Sbjct: 258 SQIEQFQRSSLQMPKSQRESEM-------NDLLDRLRIEKEKNRQYRIENTRRRHNYLPF 310

Query: 300 IYNIIRILAERGEL 313
           I  +++ + + G+L
Sbjct: 311 IVELLKQMGKNGQL 324



>gi|357138220|ref|XP_003570695.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Brachypodium distachyon]
          Length = 327

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 136/327 (41%), Positives = 211/327 (64%), Gaps = 23/327 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  +E+DPGVFTEL++   ++G QV+E++SLD   L++++PVYGLI L+KW+      R 
Sbjct: 3   WAAVENDPGVFTELLQQMQLKGLQVDELYSLDLDALKDIQPVYGLIILYKWRPPEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    +V  N++FA Q+IN+ACATQA++S+LLN   I L  +L   K+F +   P  KG
Sbjct: 62  -PVIKDAV-PNLFFANQIINSACATQALVSVLLNSSGITLSDDLRKLKEFAKDLPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK-EDIFHFISYVPVQGALYELDGLSNG 191
           LAI N E IR   NSFARS+    D  +Q +S K +D++HFISYVPV G LYELDGL +G
Sbjct: 120 LAIVNCESIRVTSNSFARSE----DSEEQKASSKDDDVYHFISYVPVDGVLYELDGLKDG 175

Query: 192 PVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID- 246
           P++LG   G      WL  V+PVIQER+ +++  EIRF+++A+ KNR+++Y   + E+  
Sbjct: 176 PISLGKTPGGAGDIGWLRMVQPVIQERIDQFSQNEIRFSVMAITKNRKEMYIVELKELQR 235

Query: 247 ERMRHASNTNNSS----------ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNF 296
           +R    S   + S           L +++ + + + ++I ME+ K K+++ EN  RKHN+
Sbjct: 236 KRENLLSQMGDPSVNRQRQSVERSLAEVAAQIEAVTEKIIMEEEKSKKWKTENIRRKHNY 295

Query: 297 IQFIYNIIRILAERGELQARIEYARKE 323
           + F++N ++IL E+ +L+  IE A+++
Sbjct: 296 VPFLFNFLKILEEKKQLKPLIEKAKQK 322



>gi|71981272|ref|NP_495684.2| Protein UBH-4 [Caenorhabditis elegans]
 gi|56757651|sp|Q09444.2|UBH4_CAEEL RecName: Full=Probable ubiquitin carboxyl-terminal hydrolase ubh-4;
           AltName: Full=Ubiquitin C-terminal hydrolase family 1
           member 4; AltName: Full=Ubiquitin thioesterase 4
 gi|50511897|emb|CAA86665.2| Protein UBH-4 [Caenorhabditis elegans]
          Length = 321

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 204/326 (62%), Gaps = 25/326 (7%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+DAG WCLIESDPGVFTE++R F V G QVEE++SLDD      +P YGLIFLFKW+ G
Sbjct: 1   MTDAGSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDK-AMTRPTYGLIFLFKWRQG 59

Query: 67  NDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDFTR 124
           ++++ +      S  +N++FA Q I NACATQA++++L+N    D  LG  L+ +K+F  
Sbjct: 60  DETTGIP-----SDKQNIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAI 114

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
             DP  +G  ++NSE IR VHNSF+R   F L   D    E ED +HF++YVP+   +YE
Sbjct: 115 DLDPNTRGHCLSNSEEIRTVHNSFSRQTLFEL---DIKGGESEDNYHFVTYVPIGNKVYE 171

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIG 243
           LDGL   P+ +     + +W+E ++PVIQ+RM +Y+  EI FNL+AL+ NR    + ++ 
Sbjct: 172 LDGLRELPLEVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNR----KQKLQ 227

Query: 244 EIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNI 303
           E+ E +  A+  N      +L E+   L + I  E  K + Y +EN+ R+HN+  F+  +
Sbjct: 228 EMMENLIQANENN------ELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIEL 281

Query: 304 IRILAERGELQARIE---YARKEMSK 326
           ++ILA+ G+L   ++    A KE SK
Sbjct: 282 MKILAKEGKLVGLVDNAYQAAKEKSK 307



>gi|483523929|gb|EOB08101.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, partial [Anas
           platyrhynchos]
          Length = 269

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 183/275 (66%), Gaps = 15/275 (5%)

Query: 52  KPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCP 108
           +PV+GLIFLFKWQ G +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC 
Sbjct: 1   RPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCA 55

Query: 109 T--IDLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEK 166
              I LG  L  FK+F++ FD   KGLA++NSE+IR VHNSFAR   F  D   +SS+++
Sbjct: 56  HQDIHLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDA--KSSAKE 113

Query: 167 EDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFN 226
           ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+  VRPVI++R+ +Y+  EIRFN
Sbjct: 114 EDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFN 173

Query: 227 LLALIKNREDVYRTRIGEIDERM--RHASNTNNSSELM-QLSEERDQLLQRIEMEKVKFK 283
           L+A++ +R+ +Y  RI E+  ++      +T+ SS ++  +  E  +    IE E  K K
Sbjct: 174 LMAIVSDRKMIYEQRIAELQRQLAEEEPMDTDQSSNMLSSIQSEVAKYQMLIEEENQKLK 233

Query: 284 RYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
           RY+ EN  RKHN++ FI  +++ LAE  +L   +E
Sbjct: 234 RYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVE 268



>gi|212274917|ref|NP_001130225.1| uncharacterized protein LOC100191319 [Zea mays]
 gi|194688594|gb|ACF78381.1| unknown [Zea mays]
 gi|238015384|gb|ACR38727.1| unknown [Zea mays]
 gi|414870013|tpg|DAA48570.1| TPA: hypothetical protein ZEAMMB73_626126 [Zea mays]
          Length = 327

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 204/327 (62%), Gaps = 29/327 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPGVFTEL++   ++G QV+E++SLD   L +L+P+YGLI L+KW+        
Sbjct: 3   WAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWR-------- 54

Query: 73  HPEAD-----LSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFD 127
            PE D          N++FA Q+IN ACATQAI+S+LLN P I L  EL   K+F +   
Sbjct: 55  PPEKDEGPVIKDAIPNLFFANQIINKACATQAIVSVLLNSPGITLSDELKKLKEFAKDLP 114

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
           P  KGLAI N   IR ++NSFARS+     +  +  S  +D++HFI+YVPV G LYELDG
Sbjct: 115 PELKGLAIVNCASIRMLNNSFARSE---ASEEQKPPSGDDDVYHFINYVPVDGVLYELDG 171

Query: 188 LSNGPVNLGPCTGDN-----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           L  GP++LG C G       WL   +PVI+E +  ++  EIRF+++A++KNR++++   I
Sbjct: 172 LKEGPISLGKCPGGVGDAGWWLRLAQPVIKEHIDLFSQNEIRFSVMAILKNRKEMFTVEI 231

Query: 243 GEIDER----MRHASNTNNS----SELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKH 294
            E+  +    ++   + N S      L +++ + + + ++I ME+ K K+++ EN  RKH
Sbjct: 232 KELQRKREGLLQQMGDPNASRHVEQSLAEVAAQIESVTEKIIMEEEKVKKWKAENLRRKH 291

Query: 295 NFIQFIYNIIRILAERGELQARIEYAR 321
           N++ F++N ++IL E+ +L+  IE A+
Sbjct: 292 NYVPFLFNFLKILEEKQQLKPLIEKAK 318



>gi|229594443|ref|XP_001023490.3| Ubiquitin carboxyl-terminal hydrolase, family 1 protein
           [Tetrahymena thermophila]
 gi|225566849|gb|EAS03245.3| Ubiquitin carboxyl-terminal hydrolase, family 1 protein
           [Tetrahymena thermophila SB210]
          Length = 367

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 205/350 (58%), Gaps = 48/350 (13%)

Query: 11  GQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPV-YGLIFLFKWQGGNDS 69
           G WC IESDPGVFTELIR   V+G QVEEV+SL+DQ L +     YGL+FLFKW     +
Sbjct: 2   GDWCTIESDPGVFTELIRGIGVKGVQVEEVYSLEDQQLIQQIQPIYGLVFLFKW-----T 56

Query: 70  SRLHP-EADLSVDENVYFAKQVINNACATQAILSILLNCP-TIDLGAELDNFKDFTRLFD 127
            +L   E  L+ D  ++FA QVI NACATQA+L+ILLN    ID+G +L NFK FT   D
Sbjct: 57  DKLEKRECLLNYDNELFFANQVIQNACATQALLAILLNKDDQIDIGEDLKNFKTFTATLD 116

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
           P  KGLAI+N E I+ VHNSF+R +PF   Q+ + ++E +D+FHF+S+VP +G LYELDG
Sbjct: 117 PQMKGLAISNQENIQRVHNSFSRPEPFIFTQSKKKATENDDVFHFVSFVPHKGKLYELDG 176

Query: 188 LSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEID- 246
           L  GP+ LG    D+WL      I  R+ +Y+  E+RFNLLAL  ++    +  I +++ 
Sbjct: 177 LQQGPILLGSYENDDWLTLATQEINARILKYSQDEVRFNLLALTIDKRYQCQNNIKQLEL 236

Query: 247 ----------------ERMRHA--------------------SNTNNSSELMQLSEERDQ 270
                           + M+ +                    +  N    L+++++  DQ
Sbjct: 237 QKLGLYQYAKDNQVELDAMQESDFADLNAKLSEQEKLATQVDAQVNKDIVLVKIADINDQ 296

Query: 271 LLQR---IEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARI 317
           + Q+   IE E+ KFK+YE EN  R+HN+I FI  + R  A++G+L   I
Sbjct: 297 IAQQKIIIEEEEYKFKKYEVENVRRRHNYIPFIVELFRQTAKKGKLAELI 346



>gi|326531148|dbj|BAK04925.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 328

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 211/325 (64%), Gaps = 22/325 (6%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPGVFTEL++   ++G QV+E++SLD   L +L+P+YGLI L+KW+      R 
Sbjct: 3   WAPIENDPGVFTELLQQLQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWRPPEKDER- 61

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    +V  NV+FA Q+IN+ACATQAI+S+LLN   I L  +L   K+F +   P  KG
Sbjct: 62  -PVIKDAVP-NVFFANQIINSACATQAIVSVLLNSSGITLSEDLKKLKEFAKDMPPELKG 119

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N E IR   NSFARSD    D +++  S+ +D++HFISYVPV G LYELDGL  GP
Sbjct: 120 LAIVNCESIRITSNSFARSD----DYSEEQKSKDDDVYHFISYVPVDGVLYELDGLKEGP 175

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL+ V+PVIQER+ +++  EIRF+++A+ KNR++++   + E+  +
Sbjct: 176 ISLGKCPGGIGEMGWLKMVQPVIQERIDKFSQNEIRFSVMAITKNRKEIFIMELKELQRK 235

Query: 249 MRH--------ASNTNNSS---ELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFI 297
             +        ++N    S    L +++ + + + ++I ME+ K K+++ EN  RKHN++
Sbjct: 236 RENLLSQMGDPSANRQRPSVERSLAEVAAQIEAVTEKIIMEEEKAKKWKTENIRRKHNYV 295

Query: 298 QFIYNIIRILAERGELQARIEYARK 322
            F++N ++IL E+ +L+  IE A++
Sbjct: 296 PFLFNFLKILEEKQQLKPLIEKAKQ 320



>gi|194352964|emb|CAQ53274.1| CG1950-PA [Drosophila simulans]
          Length = 340

 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 190/312 (60%), Gaps = 17/312 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WCLIESDPGVFTE+I  F   G QVEE+WS++      L+P++GLIFLFKW     + R+
Sbjct: 25  WCLIESDPGVFTEMISGFGCTGAQVEEIWSMNADAFRHLEPIHGLIFLFKWMDNKPAGRV 84

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCP--TIDLGAELDNFKDFTRLFDPYD 130
                ++   +++FA+QV+ NACATQA++ +LLN     IDLG  L   K F +   P  
Sbjct: 85  -----VTDRSDIFFARQVVTNACATQALICLLLNLQHEDIDLGPILSELKIFCQDLCPDC 139

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           +G  +   E IR VHNSFAR + F ++  D + SE  D +HF+ ++P++G LYELDG+  
Sbjct: 140 RGQCLAKEERIRKVHNSFARPELFVVE--DSADSEDVDCYHFVGFMPIKGKLYELDGMKE 197

Query: 191 GPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM 249
           GP+ LG      NWL+ VRP+I+ RM RY+  EI FNL+AL+ +R+  Y  +I  + E  
Sbjct: 198 GPIELGEIGQHQNWLDVVRPIIEGRMKRYSVGEIHFNLMALVSDRQRCYERQIQMLVELP 257

Query: 250 RHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAE 309
              S  +  +E+         L+  +++EK K +RY +EN  R+HN++ FI  +++ L E
Sbjct: 258 SPLSYADCQAEIA-------TLISFVKLEKEKKRRYRKENIRRRHNYLPFIVELLKQLGE 310

Query: 310 RGELQARIEYAR 321
            G+L A  + A+
Sbjct: 311 TGQLLAICDKAK 322



>gi|485610293|gb|EOD09063.1| hypothetical protein EMIHUDRAFT_68017 [Emiliania huxleyi CCMP1516]
          Length = 362

 Score =  252 bits (644), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 146/369 (39%), Positives = 209/369 (56%), Gaps = 69/369 (18%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQ--VEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
           A  WC IESDPGVF+ELI    V+G Q  V E+WSLD +++ E+ PV+GLIFLF+W+G  
Sbjct: 2   ASGWCTIESDPGVFSELITELGVKGVQAGVHELWSLDKESMAEVGPVHGLIFLFRWRGEK 61

Query: 68  DSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFD 127
           D       A ++    V+FA Q+I NACATQAILS+L+NCP+I LG E+  FK FT+ F 
Sbjct: 62  DD-----RATVTPGPGVFFASQMIPNACATQAILSVLMNCPSISLGEEMTAFKAFTKDFP 116

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
           P  KGLAI+NS+L+R VHNSFAR++P  + +  ++S E+++++HFISYVPV G LYELDG
Sbjct: 117 PDVKGLAISNSDLLRRVHNSFARAEP-TVSEERRASKEEDEVYHFISYVPVDGKLYELDG 175

Query: 188 LSNGPVNLGPC-TGDNWLEKVRPVIQER-----MSRYTSAEIRFNLLALIKNREDVYRTR 241
           L  G  +L P      WL+ V P IQ R     + +Y+S EIRFNL+A+        + R
Sbjct: 176 LKAGTPSLYPLQPPAAWLDAVTPAIQARARALGIEQYSSREIRFNLMAV--------QAR 227

Query: 242 IGEID-----ERMRHASNTNNSS---------------ELMQLSEERDQLLQRIEMEKVK 281
            G++      ER+  +     ++                L  L+    ++   IE E+ +
Sbjct: 228 AGKLPSPAELERLAASHPEPPATGEVAVDERTLEQLLIALAHLTARAAKVAADIENEQQR 287

Query: 282 FKRYERENSLRKHNFIQFIYNIIR---------------------------ILAERGELQ 314
             +++ EN  R+HN+  FI N ++                           +LAERGEL 
Sbjct: 288 VGQWKIENIRRRHNYAPFIVNFLKARPRDAAERRPRRGGGRVPCHASGCEQVLAERGELG 347

Query: 315 ARIEYARKE 323
             +E A+K+
Sbjct: 348 PLVEQAKKK 356



>gi|195566369|ref|XP_002106756.1| GD15942 [Drosophila simulans]
 gi|194204145|gb|EDX17721.1| GD15942 [Drosophila simulans]
          Length = 426

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 197/328 (60%), Gaps = 19/328 (5%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WCLIESDPGVFTE+I  F   G QVEE+WS++      L+P++GLIFLFKW     + R+
Sbjct: 111 WCLIESDPGVFTEMISGFGCTGAQVEEIWSMNADAFRHLEPIHGLIFLFKWMDNKPAGRV 170

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPT--IDLGAELDNFKDFTRLFDPYD 130
                ++   +++FA+QV+ NACATQA++ +LLN     I+LG  L   K F +   P  
Sbjct: 171 -----VTDRSDIFFARQVVTNACATQALICLLLNLQHEDIELGPILSELKIFCQDLCPDC 225

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           +G  +   E IR VHNSFAR + F ++  D + SE  D +HF+ ++P++G LYELDG+  
Sbjct: 226 RGQCLAKEERIRKVHNSFARPELFVVE--DSADSEDVDCYHFVGFMPIKGKLYELDGMKE 283

Query: 191 GPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM 249
           GP+ LG      NWL+ VRP+I+ RM RY+  EI FNL+AL+ +R+  Y  +I  + E  
Sbjct: 284 GPIELGEIGQHQNWLDVVRPIIEGRMKRYSVGEIHFNLMALVSDRQRCYERQIQMLVELP 343

Query: 250 RHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAE 309
              S  +  +E+         L+  +++EK K +RY +EN  R+HN++ FI  +++ L E
Sbjct: 344 SPLSYADCQAEIA-------TLISFVKLEKEKKRRYRKENIRRRHNYLPFIVELLKQLGE 396

Query: 310 RGELQARIEYA--RKEMSKRIKDRAEKK 335
            G+L A  + A  R   SK  KD  +++
Sbjct: 397 TGQLLAICDKAKDRSCPSKSNKDAMDQQ 424



>gi|290462191|gb|ADD24143.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Lepeophtheirus
           salmonis]
          Length = 233

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 167/231 (72%), Gaps = 13/231 (5%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           AG WCLIESDPGVFTELI  F  +G QVEE+WSLD +   +LKPV+GLIFLFK    ++ 
Sbjct: 3   AGNWCLIESDPGVFTELIHKFGTKGVQVEELWSLDKEQFVDLKPVHGLIFLFKMVPDHN- 61

Query: 70  SRLHPEADLSVDENV---YFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTR 124
               P+  + +D  V   +FAKQVINNACATQAILS+LLN   P ++LG  L NFK+F  
Sbjct: 62  ----PQGTVVLDSRVDKMFFAKQVINNACATQAILSVLLNVDHPELELGTTLSNFKEFCS 117

Query: 125 LFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYE 184
            FD   KGL+++NS+ IR VHNSFA+   F  D   + +S+ +D++HF+SY+P+ G LYE
Sbjct: 118 SFDSAMKGLSLSNSDEIRSVHNSFAKQTLFEFDS--KMASKDDDVYHFVSYIPMNGRLYE 175

Query: 185 LDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNR 234
           LDGL  GPV+ GP + D +WL+ VRP+I++RM++Y + EI FNL+A+++++
Sbjct: 176 LDGLKEGPVDHGPVSEDVDWLDVVRPIIEQRMAKYQAGEIHFNLMAIVRDQ 226



>gi|260794993|ref|XP_002592491.1| hypothetical protein BRAFLDRAFT_118926 [Branchiostoma floridae]
 gi|229277711|gb|EEN48502.1| hypothetical protein BRAFLDRAFT_118926 [Branchiostoma floridae]
          Length = 300

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 206/343 (60%), Gaps = 51/343 (14%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           MSD G+WCLIESDPGVFTELI+ F V+G QVEE+WSLD +  ++LKPV+GLIFLFKWQ  
Sbjct: 1   MSDGGEWCLIESDPGVFTELIKGFGVKGLQVEEIWSLDPENFDKLKPVHGLIFLFKWQQE 60

Query: 67  NDSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKD 121
            +     P   +  D   ++++FAKQVINNACATQAILS+LLNC  P I+LG  L NFK+
Sbjct: 61  EE-----PSGSVVQDSRLDHIFFAKQVINNACATQAILSVLLNCRHPDIELGETLANFKE 115

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGA 181
           F + FD   KGL+++NS++IR VHNSFAR   F  D   +S+ + +D++HF+ Y+P+ G 
Sbjct: 116 FVQHFDATMKGLSLSNSDVIRNVHNSFARQQMFEFDV--KSAGKDDDVYHFVGYIPIDGR 173

Query: 182 LYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTR 241
           LY+ DG                                  EI FNL+A++ +R+  Y  +
Sbjct: 174 LYQ-DG----------------------------------EIHFNLMAVVSDRKMTYERQ 198

Query: 242 IGEIDERMRHASNTNNSSELMQ---LSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQ 298
           + ++  ++  A    ++ E  Q   +  E  +L   I  E+ K +RY+ EN  RKHN++ 
Sbjct: 199 LTDLQAQLA-AIQDGSAMETDQSDTIQSEIGKLHMLIGEEEQKMRRYKTENLRRKHNYLP 257

Query: 299 FIYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKKGESGS 341
            I  +++ILA+ G+L + +E A+ + ++    +  KK  E+ S
Sbjct: 258 MIMELLKILAQEGKLVSLVEKAKDKTAELQSKKDAKKTQEAKS 300



>gi|410986481|ref|XP_003999538.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like
           [Felis catus]
          Length = 210

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 120/215 (55%), Positives = 158/215 (73%), Gaps = 12/215 (5%)

Query: 8   SDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN 67
            +AG+WCL+ESDPGVFTELI+ F  +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G 
Sbjct: 3   GNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGE 62

Query: 68  DSSRLHPEADLSVD---ENVYFAKQVINNACATQAILSILLNCPTID--LGAELDNFKDF 122
           +     P   +  D   + ++FAKQVINNACATQAI+S+LLNC   D  LG  L  FK+F
Sbjct: 63  E-----PAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEF 117

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           ++ FD   KGLA++NS++IR VHNSFAR   F  D   ++S+++ED FHF+SYVPV G L
Sbjct: 118 SQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRL 175

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSR 217
           YELDGL  GP++LG C  D+W+  VRPVI++R+ +
Sbjct: 176 YELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK 210



>gi|323449674|gb|EGB05560.1| hypothetical protein AURANDRAFT_69917 [Aureococcus anophagefferens]
          Length = 301

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 194/324 (59%), Gaps = 31/324 (9%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSR 71
            WC IESDPGVFTEL+  F V G +  E++SLDD  L    PV+GLIFLFKW G  D   
Sbjct: 2   SWCTIESDPGVFTELVEKFGVSGCEFAELYSLDDGELARHAPVFGLIFLFKWTGEKDD-- 59

Query: 72  LHPEADLSVDE---NVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDP 128
               A LS DE    +++AKQ++NNACATQAILS+LLNC  +  GA LD  K F     P
Sbjct: 60  ---RATLSFDEAPPGLFYAKQMVNNACATQAILSVLLNCEHVSRGATLDELKAFGAEL-P 115

Query: 129 YD-KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
           +D +GLAI NSE IR  HN+FAR +PF  D+  + ++  +D+FHF++YVP  G +YELDG
Sbjct: 116 FDMRGLAIENSEAIRAAHNAFARPEPFVSDE--KRATADDDVFHFVAYVPSGGKVYELDG 173

Query: 188 LSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           L  GP++LG    D+WL   R  I+ R+ +Y ++EI+FNL+A+++++             
Sbjct: 174 LKAGPIDLGSFE-DSWLPVARSAIEARIQKYAASEIKFNLMAIVRDK------------- 219

Query: 248 RMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRIL 307
             R A     ++     + E D  L R   E  K   +  EN  R HN++ F+ +++++L
Sbjct: 220 --RAALEDAKAAADAATAAELDAELAR---EHAKRADWAAENVRRHHNYVPFVIDLLKVL 274

Query: 308 AERGELQARIEYARKEMSKRIKDR 331
           AE+G+L A ++ A+ + S     R
Sbjct: 275 AEQGKLGAMMDDAKAKASTDANKR 298



>gi|474246845|gb|EMS60015.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Triticum urartu]
          Length = 288

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 192/327 (58%), Gaps = 70/327 (21%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WC IESDPGVFTELI+   V+G                                      
Sbjct: 3   WCTIESDPGVFTELIQEMQVKGV------------------------------------- 25

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
                           QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  KG
Sbjct: 26  ----------------QVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKG 69

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NS+ IR  HNSFAR +PF  D+  +++++ ++++HFISY+P +G LYELDGL  GP
Sbjct: 70  LAINNSDSIRAAHNSFARPEPFVSDE-QKAATKDDEVYHFISYIPFEGVLYELDGLKEGP 128

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG   G      WL+ V+PVIQER+ RY+ +EIRFNL+A+IKNR+DVY   + E++++
Sbjct: 129 ISLGQYPGGPEDLGWLQMVQPVIQERIERYSQSEIRFNLMAIIKNRKDVYTAELKELEKK 188

Query: 249 ----MRHASNTNNSSE--------LMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNF 296
               ++  SN   ++         L +++   + + ++I ME+ KF++++ EN  RKHN+
Sbjct: 189 REQILQELSNEATAAAEKEPLNGVLAEVALAVEAVGEKIAMEEEKFRKWKTENVRRKHNY 248

Query: 297 IQFIYNIIRILAERGELQARIEYARKE 323
           I F++N+++ LAE+ +L   +E AR++
Sbjct: 249 IPFLFNLLKALAEKKQLTPLVEKARQQ 275



>gi|470634909|ref|XP_004322990.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5,
           partial [Tursiops truncatus]
          Length = 280

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 177/265 (66%), Gaps = 19/265 (7%)

Query: 32  VQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRLHPEADLSVD---ENVYFAK 88
            +G QVEE+WSL+ +  E+LKPV+GLIFLFKWQ G +     P   +  D   + ++FAK
Sbjct: 25  CRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEE-----PAGSVVQDSRLDTIFFAK 79

Query: 89  QVINNACATQAILSILLNCPTID--LGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHN 146
           QVINNACATQAI+S+LLNC   D  LG  L  FK+F++ FD   KGLA++NS++IR VHN
Sbjct: 80  QVINNACATQAIVSVLLNCTHQDVHLGDTLSEFKEFSQSFDAAMKGLALSNSDVIRQVHN 139

Query: 147 SFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEK 206
           SFAR   F  D   ++S+++ED FHF+SYVPV G LYELDGL  GP++LG C  D+W+  
Sbjct: 140 SFARQQMFEFDA--KTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISA 197

Query: 207 VRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI-----DERMRHASNTNNSSEL 261
           VRPVI++R+ +Y+  EIRFNL+A++ +R+ +Y  +I E+     +E        NN    
Sbjct: 198 VRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNNMLSA 257

Query: 262 MQLSEERDQLLQRIEMEKVKFKRYE 286
           +Q    ++Q+L  IE E  K KRY+
Sbjct: 258 IQSEVAKNQML--IEEEVQKLKRYK 280



>gi|145347079|ref|XP_001418005.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578233|gb|ABO96298.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 303

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/325 (39%), Positives = 199/325 (61%), Gaps = 25/325 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           WCLIESDPGVF EL+     +G    E++SLD   L   +P+YGLIFLFKW+GG+ SS +
Sbjct: 3   WCLIESDPGVFGELVHRIGARGVAFTELYSLDVDELRRNEPIYGLIFLFKWRGGHSSSAV 62

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPT-IDLGAELDNFKDFTRLFDPYDK 131
             E D +  ++++FA QVI+NACATQA+LS+LLN    ++LG  L   ++FT  FD   K
Sbjct: 63  --EVDENPPQDLFFASQVIHNACATQAVLSVLLNAEQEVELGETLQTLREFTLDFDAETK 120

Query: 132 GLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNG 191
           G++I+NS++IR  HNSFAR +P  L    + + E +D+FHF++YVP  G+++ELDGL  G
Sbjct: 121 GMSISNSDIIRDAHNSFARPEPIVLQS--RPAQEDDDVFHFVAYVPRGGSVFELDGLQRG 178

Query: 192 PVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMRH 251
           P+N G     +WL+   P IQ +++ + S EI+FNL+A+ K+       R+ E+      
Sbjct: 179 PINHGSFGDGHWLDVAVPAIQRKIASFASNEIKFNLMAVTKDPRIAISQRLEEL-----R 233

Query: 252 ASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERG 311
           +S+T  + E+  L  E       +E+E+ K   +  +N  R+HN+I  ++ +++ +A   
Sbjct: 234 SSSTGAADEIAHLQRE-------LEVEEAKVAEWRNDNIRRRHNYIPLVFALLKEVAAAK 286

Query: 312 ELQARIEYARKEMSKRIKDRAEKKK 336
           +L   +E A+K        RAE +K
Sbjct: 287 KLTEALEQAKK--------RAEAQK 303



>gi|508123789|pdb|4IG7|A Chain A, Crystal Structure Of Trichinella Spiralis Uch37 Bound To
           Ubiquitin Vinyl Methyl Ester
          Length = 343

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 186/304 (61%), Gaps = 26/304 (8%)

Query: 11  GQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSS 70
           G WCLIESDPG+FTE+I  F   G QVEE+  LD +++E LKP++G IFLF+W       
Sbjct: 38  GNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLD-ESIEHLKPIHGFIFLFRWL----KK 92

Query: 71  RLHPEADLS--VDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLF 126
            +  E D S     +VYF++QVI NACA+QA++++LLNC  P +DLG  L  FKDFT   
Sbjct: 93  EMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDL 152

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           D   +GL +TNSE IR VHNSF R   F +D  DQ   ++ED+FHF++YVPV   +YELD
Sbjct: 153 DSASRGLCLTNSEKIRAVHNSFGRQQLFEID--DQQKLDEEDVFHFVTYVPVNDGVYELD 210

Query: 187 GLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL   P+ LG    D +W E     I+E++  Y  +E+RFNL+A+I +++  Y       
Sbjct: 211 GLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQKLKY------- 263

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
           +  M   +   +S+E+       D+L+  I  E  K +RY  E +  +HN++ FI  ++R
Sbjct: 264 EREMEKFAQAGDSAEV-------DRLVALIAAEDAKRERYAMEAARHRHNYVPFIVELLR 316

Query: 306 ILAE 309
           ILAE
Sbjct: 317 ILAE 320



>gi|215697292|dbj|BAG91286.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215764981|dbj|BAG86678.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 278

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 181/253 (71%), Gaps = 13/253 (5%)

Query: 83  NVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKGLAITNSELIR 142
           N++FA QVI NACATQAILSIL+N P ID+G EL N K+FT  F P  KGLAI NS+ IR
Sbjct: 17  NLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGLAINNSDSIR 76

Query: 143 GVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGPVNLGPCTGD- 201
             HNSFAR +PF  D+  +++ + ++++HFISY+P +G LYELDGL  GP++LG C+G  
Sbjct: 77  TAHNSFARPEPFVSDE-QRAAGKDDEVYHFISYLPFEGVLYELDGLKEGPISLGQCSGGP 135

Query: 202 ---NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER-------MRH 251
              +WL  V+PVIQ+R+ RY+ +EIRFNL+A+IKNR+DVY   + E+++R       M  
Sbjct: 136 DDLDWLRMVQPVIQKRIERYSQSEIRFNLMAIIKNRKDVYTAELKELEKRRDQLLQEMNE 195

Query: 252 ASNTNN-SSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAER 310
           +S   + +SEL +++   + + ++I ME+ KFK++  EN  RKHN+I F++N +++LAE+
Sbjct: 196 SSAAESLNSELAEVTSAIETVSEKIIMEEEKFKKWRTENIRRKHNYIPFLFNFLKMLAEK 255

Query: 311 GELQARIEYARKE 323
            +L+  +E A+++
Sbjct: 256 KQLKPLVEKAKQQ 268



>gi|413921742|gb|AFW61674.1| hypothetical protein ZEAMMB73_636432 [Zea mays]
          Length = 465

 Score =  248 bits (634), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/326 (39%), Positives = 200/326 (61%), Gaps = 25/326 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPGVFTEL++   ++G QV+E++SLD   L +L+P+YGLI L+KW+      R 
Sbjct: 137 WAAIENDPGVFTELLQQMQLKGLQVDEIYSLDLDALNDLQPIYGLIVLYKWRPPEKDER- 195

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P    ++  N++FA Q+INNACATQAILS+LLN P I L  EL   K+F +   P  KG
Sbjct: 196 -PVIKDAIP-NLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKG 253

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI N E IR ++NS ARS+   + +  +  S  +D++HFISYVPV G LYELDGL  GP
Sbjct: 254 LAIVNCESIRMINNSLARSE---VSEEQKRPSNGDDVYHFISYVPVDGVLYELDGLKEGP 310

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           + L  C G      WL   +PVI+  +  ++  ++R +++A++KNR+++    + E+  +
Sbjct: 311 ICLEKCPGGVGDAGWLRLAQPVIKGHIDLFSQNDVRCSVMAILKNRKEMCTVELKELKRK 370

Query: 249 -------------MRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
                        +RH  +   S  L ++S + + + +++ ME+ K K ++ EN  RKHN
Sbjct: 371 RESLLQQTGYPSAIRHVPSVEQS--LAEVSAQIEAVTEKMIMEEEKVKTWKTENLRRKHN 428

Query: 296 FIQFIYNIIRILAERGELQARIEYAR 321
           ++ F++N ++IL E+ +L   IE A+
Sbjct: 429 YVPFLFNFLKILEEKQQLNPLIEKAK 454



>gi|307106323|gb|EFN54569.1| hypothetical protein CHLNCDRAFT_10119, partial [Chlorella
           variabilis]
          Length = 333

 Score =  246 bits (628), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 197/338 (58%), Gaps = 34/338 (10%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IESDPGVFTEL+    V+G Q+EE+WSLDD +L  L+P+YGLIFLFKWQ   D    
Sbjct: 1   WTTIESDPGVFTELLDRMGVKGVQMEELWSLDDDSLNSLQPIYGLIFLFKWQKEEDE--- 57

Query: 73  HPEADLSVDENVYFAKQVINNACATQA--------------ILSILLNCPTIDLGAELDN 118
            P A    +  V+FA QVI+NACATQA              I+S+L+N P +++G EL  
Sbjct: 58  RPVATDYEERGVFFASQVIHNACATQARRCPCSRRSFRSPAIVSVLMNRPELEIGPELSQ 117

Query: 119 FKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPV 178
            ++FTR F P  KGLAI NSE IR VHNSF+   P      ++   +K + FHFI+YVPV
Sbjct: 118 LREFTRGFPPDMKGLAIGNSETIRSVHNSFSPPQPIL--PPEERDDDKGEAFHFIAYVPV 175

Query: 179 QGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVY 238
            G LYELDGL  GP+ L  C+  +WL K    I  R+ RY ++E++FNL+A I++R   +
Sbjct: 176 GGCLYELDGLKEGPIKLADCSEGDWLTKAAAAITARIRRYAASEVKFNLMACIEDRRQKH 235

Query: 239 RTRIGE---IDERMR--HASNTNNSSELMQLSEERDQLLQR----------IEMEKVKFK 283
           +  + +   +  R+R  H++ T  S +       +  +  R          + ME+ +  
Sbjct: 236 QRELAQQRRLQVRLRGPHSAATQRSWDGAAGLAGQAGMPARSLACPRLQAQLAMEEERRG 295

Query: 284 RYERENSLRKHNFIQFIYNIIRILAERGELQARIEYAR 321
           R+  EN  R+ ++I F + ++  LAERG+LQ  ++ A+
Sbjct: 296 RWRDENVRRRTDYIPFAFQLLSALAERGQLQPLVQKAQ 333



>gi|296413936|ref|XP_002836662.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630495|emb|CAZ80853.1| unnamed protein product [Tuber melanosporum]
          Length = 313

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 203/336 (60%), Gaps = 39/336 (11%)

Query: 10  AGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDS 69
           +G W  IESD GVFT L+    V+  Q EE+ +LD   L +  PVYG+IFLFK+  G   
Sbjct: 2   SGGWNTIESDAGVFTYLVDNLGVKNVQFEEMIALDADYLNQQSPVYGVIFLFKYPVGQKK 61

Query: 70  S--RLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFD 127
           +   +  + D +  EN++FA Q I NACATQAILS+LLN   +DLG +L  FK+FT+ F 
Sbjct: 62  ADEAVDGQYDFAASENIFFANQTIQNACATQAILSVLLNRGDLDLGDQLREFKEFTQAFP 121

Query: 128 PYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDG 187
              +G A++NSELIRGVHNSFARS P F+D+  ++++E +D++HFI+Y P+ G LYE+DG
Sbjct: 122 AELRGEALSNSELIRGVHNSFARSSP-FIDEGTRAATEDDDLYHFIAYTPINGILYEIDG 180

Query: 188 LSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
           L   P++ G CT + + EKV PV+Q R+ RY + EIRFNLLA++++     R R  EI +
Sbjct: 181 LQPSPISHGKCTEEQFPEKVIPVLQRRIERYPATEIRFNLLAMVQD----LRIRAAEIGD 236

Query: 248 RMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNII-RI 306
                                   ++ +  E  K K +  EN LR+HNF+ F + ++ R 
Sbjct: 237 ------------------------VETVAREDEKRKMWIWENELRRHNFVGFAHEVLKRA 272

Query: 307 LAER---GELQARIEYARKE----MSKRIKDRAEKK 335
           +A +   G+    I+ A+++    MS+R K R EK+
Sbjct: 273 VASKLRDGKYDEWIDEAKQKAKDRMSERKKVRGEKE 308



>gi|195469854|ref|XP_002099851.1| GE16722 [Drosophila yakuba]
 gi|194187375|gb|EDX00959.1| GE16722 [Drosophila yakuba]
          Length = 329

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 190/315 (60%), Gaps = 17/315 (5%)

Query: 11  GQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSS 70
           G WCLIESDPGVFTELIR F   G QVEE+W+LD      L+P++GLIFLFKW     + 
Sbjct: 16  GNWCLIESDPGVFTELIRGFGCTGAQVEEIWTLDADAFHHLEPIHGLIFLFKWVDDKPAG 75

Query: 71  RLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDFTRLFDP 128
           R+     ++   +++FA+QVI+NACATQA+L +LLN     IDLG  L+ FK F +  DP
Sbjct: 76  RV-----VTDRSDIFFARQVISNACATQALLCLLLNLRHSDIDLGQTLNGFKRFCQDLDP 130

Query: 129 YDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGL 188
             +G  + N E IR VHNSFAR  P   +   +  S  +  +HF+ Y+P++G L+ELDG+
Sbjct: 131 ETRGHCLGNEEKIRKVHNSFAR--PVLFEFDTRPGSPDDYCYHFVGYMPIKGKLFELDGM 188

Query: 189 SNGPVNLGPC-TGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDE 247
             GP+ L       NWL+ VRP+I+ RM RY+  EI FNL+AL+ +R+  Y  +I  +  
Sbjct: 189 HEGPIELAEIGQHQNWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERQIQLLVH 248

Query: 248 RMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRIL 307
           +    S+    SE+  L          ++ E+ K +RY +EN  R+HN++ FI  +++ L
Sbjct: 249 QPSPLSHAERQSEIATLR-------TFVKFEQEKKRRYRQENIRRRHNYLPFILELLKQL 301

Query: 308 AERGELQARIEYARK 322
            E G+L    E A++
Sbjct: 302 GETGQLMPIYEKAKQ 316



>gi|472585169|gb|EMS22735.1| ubiquitin carboxyl-terminal hydrolase L5 [Rhodosporidium toruloides
           NP11]
          Length = 331

 Score =  246 bits (627), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 135/339 (39%), Positives = 214/339 (63%), Gaps = 21/339 (6%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELK---PVYGLIFLFKW 63
           M+++  W L ESDPGVFT L+    V+G +VEE+W LD Q L++L+   PV+ L+FLFKW
Sbjct: 1   MAESAGWSLTESDPGVFTGLLHELGVRGLEVEELWGLDAQLLQDLEFVPPVFALVFLFKW 60

Query: 64  QGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKD 121
            G  D  ++  + +     + YFA QVINNACA+ A+L+  LN   P + LG EL N + 
Sbjct: 61  VGHGDPEKMDGKLEEPAGPH-YFAHQVINNACASIALLNATLNIRDPNVQLGEELSNLQL 119

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGA 181
           F+   DP  +G  I+NSE IR VHNSFARSDPF L++ ++   E ED +HFI+Y+P+   
Sbjct: 120 FSEGLDPETRGWTISNSEKIREVHNSFARSDPFHLEE-NRPQDEHEDAYHFIAYLPIGDK 178

Query: 182 LYELDGLSNGPVNLGPCTG--DNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYR 239
           LYELDGL   PV+ G   G  + W +  R V++ R++ Y + E+ FNLLA +  R    +
Sbjct: 179 LYELDGLKPMPVSHGEIPGGREKWTDMAREVLERRIATYPAGEVMFNLLA-VTGRRTALQ 237

Query: 240 TRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQF 299
            R+ E++     A++ ++     +L + RD+ LQ IE    + K +E EN+LR+HN+I  
Sbjct: 238 KRLAELE-----AADQSSGEVQAELVDVRDK-LQGIEE---RLKDWEVENTLRRHNYIGL 288

Query: 300 IYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKKGE 338
           ++ ++   A++ +L+ +I+ A+++M ++I+++  ++KGE
Sbjct: 289 VHALLVESAKQDKLKPQIDEAKQKMKQKIEEK--RRKGE 325



>gi|293335145|ref|NP_001168238.1| uncharacterized protein LOC100382000 [Zea mays]
 gi|223946907|gb|ACN27537.1| unknown [Zea mays]
          Length = 322

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/286 (48%), Positives = 196/286 (68%), Gaps = 15/286 (5%)

Query: 51  LKPVYGLIFLFKWQGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTI 110
           L+PVYGLIFLFKW  G    R         + N++FA QVI NACATQAILS+L+N P I
Sbjct: 35  LRPVYGLIFLFKWIPGEKDER---PVVRDPNPNLFFAHQVITNACATQAILSVLMNRPEI 91

Query: 111 DLGAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIF 170
           D+G EL   K+FT  F P  KGLAI+NSE IR  HNSFAR +PF  D+  +++++ +D++
Sbjct: 92  DIGPELSQLKEFTGAFTPDLKGLAISNSESIRTAHNSFARPEPFISDE-QRAATKDDDVY 150

Query: 171 HFISYVPVQGALYELDGLSNGPVNLGPCTGD---NWLEKVRPVIQERMSRYTSAEIRFNL 227
           HFISY+P +G LYELDGL  GPVNLG C G    +WL  V+PVIQER+ RY+ +EIRFNL
Sbjct: 151 HFISYLPFEGVLYELDGLKEGPVNLGQCDGADDLDWLRMVQPVIQERIERYSQSEIRFNL 210

Query: 228 LALIKNREDVYRTRIGEIDERMRHA-SNTNNSSELMQLSEERDQLLQRIE-------MEK 279
           +A+IKNR++VY   + E+++R        NN+S    LS    +++  IE       ME+
Sbjct: 211 MAIIKNRKEVYSAELEELEKRREQILQEMNNASSTESLSSSLTEVISAIETVTEKVIMEE 270

Query: 280 VKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMS 325
            KFK++++EN  RKHN+I F++N++++LAE+ +L+  +E A+++ S
Sbjct: 271 EKFKKWKKENIRRKHNYIPFLFNLLKMLAEKQQLKPLVEKAKQQKS 316



>gi|331233118|ref|XP_003329220.1| hypothetical protein PGTG_10272 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309308210|gb|EFP84801.1| hypothetical protein PGTG_10272 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 320

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 193/326 (59%), Gaps = 26/326 (7%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGN--DSS 70
           WCL ESDP +FT L+    V G QVEE+WSLD+Q+LE+LKPV+ LIFLFK+   +  D S
Sbjct: 5   WCLTESDPAIFTILLSELGVSGLQVEELWSLDNQSLEQLKPVHALIFLFKYVNSDQRDPS 64

Query: 71  RLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPT----IDLGAELDNFKDFTRLF 126
           +   E         +FA QVI NACAT AIL+ ++N P+    I LG EL   K+F+   
Sbjct: 65  KQAGEQQ-PAPPGTWFAHQVITNACATLAILNAVMNIPSTSSKIQLGQELSQLKEFSVDL 123

Query: 127 DPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELD 186
           D    G  +TNSE IR VHNSFAR DPF  D+  Q S+  ED +HFI+Y+P+QG LYELD
Sbjct: 124 DSQMTGELLTNSERIRAVHNSFARPDPFQRDEPKQMST--EDAYHFITYLPLQGKLYELD 181

Query: 187 GLSNGPVNLGPCT-GDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEI 245
           GL+  PV  G    G +W    R VIQ R++ Y+S E+ FNL+A+ ++R +V        
Sbjct: 182 GLNGLPVFHGKIPEGQSWTSLAREVIQNRINTYSSTEVHFNLMAVCEDRLNVLEE----- 236

Query: 246 DERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIR 305
               R AS T +S     L  E       IE E+ K KR+  E ++++HN I  I+ ++ 
Sbjct: 237 ----RKASMTVDSMGYENLKME-------IEAEEAKRKRWAEEVAIKRHNHIGLIHALMV 285

Query: 306 ILAERGELQARIEYARKEMSKRIKDR 331
            LA+ G L  R+  A+++M  R ++R
Sbjct: 286 GLAKHGSLAERVNLAKQKMVDRQRNR 311



>gi|145537161|ref|XP_001454297.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124422052|emb|CAK86900.1| unnamed protein product [Paramecium tetraurelia]
          Length = 356

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 200/344 (58%), Gaps = 43/344 (12%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSL-DDQTLEELKPVYGLIFLFKWQGGNDSS 70
           +WC IESDPGVFTELI A  VQG QVEE++ L D+Q + +++P+YG IFLF+W     +S
Sbjct: 3   EWCTIESDPGVFTELINAIGVQGVQVEEIYDLNDEQQMAQMQPIYGFIFLFRW-----TS 57

Query: 71  RLHPEADLSV-DENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPY 129
           +      L + D++++FA QVI NACATQAI+SILLN P I++G  L N+K+FT   DP 
Sbjct: 58  KGEKRECLKIYDQDLFFANQVIQNACATQAIISILLNSPQIEIGEALKNYKEFTIALDPK 117

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
           ++G  +   E+I+  HNSFAR +PF      + + E +D+FHF+SY+P +G +YELDGL 
Sbjct: 118 ERGNCLGGVEVIKTAHNSFARPEPFIFSNEKKKAKEGDDVFHFVSYLPFKGKVYELDGLQ 177

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNRE----DVYRTRIGEI 245
            GP+ +G    D+W+ + +  I +R+  Y   E  F LLA+ + R+     +  +   EI
Sbjct: 178 EGPILIGEYQ-DDWIVRAKEAILKRIQHYQEKETAFTLLAVNQCRKFKANKILSSSQNEI 236

Query: 246 ---------------DERMRHASNTNNSSELMQ--LSEERDQLLQR-------------- 274
                          +E+ +     +N   + Q  L E +++LL R              
Sbjct: 237 LLILKTLDFMGVDLSEEQKQQLIELSNQQNIEQELLQESKEELLIRLNNANNRIQEAQII 296

Query: 275 IEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
           +  E  KF++Y+ ENS RKHN+I FI  + ++   +G+L+  +E
Sbjct: 297 LSEENAKFQKYKEENSRRKHNYIPFILELFKMAQRKGQLEGLLE 340



>gi|308804071|ref|XP_003079348.1| Ubiquitin C-terminal hydrolase UCHL1 (ISS) [Ostreococcus tauri]
 gi|116057803|emb|CAL54006.1| Ubiquitin C-terminal hydrolase UCHL1 (ISS) [Ostreococcus tauri]
          Length = 318

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 200/326 (61%), Gaps = 20/326 (6%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQG--GNDS 69
           +W  IESDPGVFTEL RA  V+G   EE+++L+   L+ L+P+YGLIFLFK++G  G + 
Sbjct: 2   EWTTIESDPGVFTELARAIGVRGVAFEELYTLEADELKRLEPIYGLIFLFKYRGDDGGEV 61

Query: 70  SRLHPEADLSVDENVYFAKQVINNACATQAILSILLNC-PTIDLGAELDNFKDFTRLFDP 128
             +  EA+    + V+FA+Q+I NACATQA+LS+LLN    ++LG  L  FK+FT  FD 
Sbjct: 62  CAIDAEAE---SKGVFFARQMIQNACATQAVLSVLLNADDKLELGETLSAFKEFTSEFDA 118

Query: 129 YDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGL 188
             KGLAI+NS++IR  HNSFAR +P  L    + + E +D+FHF+ YVP    +YELDGL
Sbjct: 119 ETKGLAISNSDVIRDAHNSFARPEPIVLQS--RPAREDDDVFHFVGYVPKGKVVYELDGL 176

Query: 189 SNGPVNLGPCTGDN----WLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGE 244
             GP+N G    ++    WL+   P IQ R++ Y++ EI+FNLLA+ K++    R RI E
Sbjct: 177 RQGPINHGHFGNEDDDKTWLDVAVPAIQRRIAAYSTNEIKFNLLAVTKDQRISLRERIAE 236

Query: 245 IDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNII 304
           + + +  +   + + E+ QLS E   L  + E        +  EN  R+ N++ FI+ ++
Sbjct: 237 L-QGIGDSIGDSLAKEITQLSSELAYLESKAE-------DWRNENIRRRWNYLPFIFGLL 288

Query: 305 RILAERGELQARIEYARKEMSKRIKD 330
           R +A + +L +  E A+K   K   D
Sbjct: 289 REVAAKKQLMSAFEIAKKNREKGASD 314



>gi|475606717|gb|EMT26482.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aegilops
           tauschii]
          Length = 387

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 212/345 (61%), Gaps = 37/345 (10%)

Query: 13  WCLIESDP---------------GVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGL 57
           W  IE+DP               GVFTEL++   ++G QV+E++SLD   L +L+P+YGL
Sbjct: 47  WAPIENDPVIDDWSITKELAMDRGVFTELLQQLQLKGLQVDELYSLDLDALNDLQPIYGL 106

Query: 58  IFLFKWQGGNDSSRLHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELD 117
           I L+KW+      R  P    +V  N++FA Q+IN+ACATQAI+S+LLN   I L  +L 
Sbjct: 107 IVLYKWRPPEKDER--PVIKDAV-PNLFFANQIINSACATQAIVSVLLNSSGITLSEDLK 163

Query: 118 NFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVP 177
             K+F +   P  KGLAI N E IR   NSFA+SD    D +++  S+ +D++HFISYVP
Sbjct: 164 KLKEFAKDMPPELKGLAIVNCESIRMTSNSFAKSD----DYSEEQKSKDDDVYHFISYVP 219

Query: 178 VQGALYELDGLSNGPVNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKN 233
           V G LYELDGL  GP++LG C G      WL+ V+PVIQER+ +++  EIRF+++A+ KN
Sbjct: 220 VDGVLYELDGLKEGPISLGKCPGGIGEMGWLKMVQPVIQERVDKFSQNEIRFSVMAITKN 279

Query: 234 REDVYRTRIGEIDERMRH--------ASNTNNSS---ELMQLSEERDQLLQRIEMEKVKF 282
           R++++   + E+  +  +        ++N    S    L +++ + + + ++I ME+ K 
Sbjct: 280 RKEIFIMELKELQRKRENLLSQMGDPSANRQRPSVERSLAEVAAQIEAVTEKIIMEEEKA 339

Query: 283 KRYERENSLRKHNFIQFIYNIIRILAERGELQARIEYARKEMSKR 327
           K+++ EN  RKHN++ F++N ++IL E+ +L+  IE A++    R
Sbjct: 340 KKWKTENIRRKHNYVPFLFNFLKILEEKQQLKPLIEKAKQNSHSR 384



>gi|145553351|ref|XP_001462350.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124430189|emb|CAK94977.1| unnamed protein product [Paramecium tetraurelia]
          Length = 356

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 194/344 (56%), Gaps = 43/344 (12%)

Query: 12  QWCLIESDPGVFTELIRAFNVQGTQVEEVWSL-DDQTLEELKPVYGLIFLFKWQGGNDSS 70
           +WC IESDPGVFTELI A  VQG QVEE++ L D+Q + +++P+YG IFLF+W     +S
Sbjct: 3   EWCTIESDPGVFTELINAIGVQGVQVEEIYDLNDEQQIAQMQPIYGFIFLFRW-----TS 57

Query: 71  RLHPEADLSV-DENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPY 129
           +      L + D++++FA QVI NACATQAI+SILLNCP I++G  L N+K+F    DP 
Sbjct: 58  KGEKRESLKIYDQDLFFANQVIQNACATQAIISILLNCPQIEIGEALRNYKEFALALDPK 117

Query: 130 DKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLS 189
           ++G  +   ++I+  HNSFAR +PF      + + E +D+FHF+SY+P +G +YELDGL 
Sbjct: 118 ERGNCLGAVDIIKTAHNSFARPEPFIFSNDKKKAKEGDDVFHFVSYIPFKGKVYELDGLQ 177

Query: 190 NGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERM 249
            GP+ +G    D+W+ + +  I  R+  Y   E  F LLA+ + R+      I +    +
Sbjct: 178 EGPILIGEYQ-DDWVVRAKEAILTRIQHYQEKETAFTLLAVNQCRKFKANNIILQSQNEI 236

Query: 250 RHASNT------------------------------NNSSELMQ----LSEERDQLLQRI 275
             +  T                                SSE +Q    L+  R Q  Q I
Sbjct: 237 LQSLKTLQFIGVDLTEEQTQQLLQLSNQQNIEQELLQESSEELQNRLALANNRIQEAQII 296

Query: 276 -EMEKVKFKRYERENSLRKHNFIQFIYNIIRILAERGELQARIE 318
              E  KF++Y+ ENS RKHN+I FI  + ++   +G+L+  +E
Sbjct: 297 LSEESAKFQKYQEENSRRKHNYIPFILELFKMAQRKGQLEGLLE 340



>gi|345563791|gb|EGX46775.1| hypothetical protein AOL_s00097g405 [Arthrobotrys oligospora ATCC
           24927]
          Length = 311

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 203/337 (60%), Gaps = 34/337 (10%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+++G W  IESD GVFT LI +  VQG Q EE+ +L+   L++L PVYG+IFLFK+Q G
Sbjct: 1   MAESGGWHTIESDAGVFTYLIESLGVQGVQFEELIALEADYLKQLSPVYGVIFLFKYQMG 60

Query: 67  NDSSR--LHPEADLSVDENVYFAKQVINNACATQAILSILLNC--PTIDLGAELDNFKDF 122
            + S   +    D+    +++FA Q I NACATQAILS+LLN     +D+G  L  FK+F
Sbjct: 61  KNRSEAPMDGRHDMDAPNHMFFANQTIQNACATQAILSVLLNADKEQVDIGDSLREFKEF 120

Query: 123 TRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGAL 182
           T  F    +G  ++NS+LIR VHNSF+RS PF +D+  + ++E++D++HFI+Y PV G L
Sbjct: 121 TNGFPSDLRGETLSNSDLIRDVHNSFSRSSPF-VDEGTRQATEEDDLYHFIAYTPVNGVL 179

Query: 183 YELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRI 242
           YE+DGL   P+  G CT D + +KV PVI  R+ RY  +EIRFNL+A++++     R + 
Sbjct: 180 YEIDGLQPAPIAHGSCTQDEFCDKVIPVIHRRIDRYPPSEIRFNLMAVVQD----LRVKA 235

Query: 243 GEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYN 302
            EI +                     +++L R   E+ K   +E EN LR+HNF+ FI+ 
Sbjct: 236 VEIGD---------------------EEMLAR---EEQKRNDWETENELRRHNFVGFIHE 271

Query: 303 IIR-ILAERGELQARIEYARKEMSKRIKDRAEKKKGE 338
           +++ ++ E+ +     E+ ++     ++     +KGE
Sbjct: 272 LLKGVIKEKIKGGTYDEWIKQTKDLNLQKAIAARKGE 308



>gi|125538335|gb|EAY84730.1| hypothetical protein OsI_06099 [Oryza sativa Indica Group]
          Length = 332

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 185/297 (62%), Gaps = 25/297 (8%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W  IE+DPGVFTEL++   ++G QV+E++SLD   L +L+PVYGLI L+KWQ      R 
Sbjct: 32  WAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDER- 90

Query: 73  HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG 132
            P  D     N++FAKQ+INNACATQAI+S+LLN P I L  EL   K+F +   P  KG
Sbjct: 91  -PIKDPI--PNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKG 147

Query: 133 LAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSNGP 192
           LAI NSE IR   NSFAR +   + +  +SS + +D++HFISYVPV G LYELDGL  GP
Sbjct: 148 LAIVNSESIRLASNSFARPE---VPEEQKSSVKDDDVYHFISYVPVDGVLYELDGLKEGP 204

Query: 193 VNLGPCTGD----NWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDER 248
           ++LG C G      WL  V+PVIQER+ R++  EIRF+++A++KNR + +   + E+  +
Sbjct: 205 ISLGKCPGGVGDIGWLRMVQPVIQERIDRFSQNEIRFSVMAILKNRREKFTLELKELQRK 264

Query: 249 M-------------RHASNTNNS-SELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
                         RHA +  +S +E+    E   +++   E+E+V+ + ++ E  L
Sbjct: 265 RENLLAQMGDPSANRHAPSVEHSLAEVAAHIELNKKIIMEKEVEEVEDREHQEEAQL 321



>gi|507111422|emb|CDF35146.1| Ubiquitin carboxyl-terminal hydrolase [Chondrus crispus]
          Length = 327

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 134/341 (39%), Positives = 200/341 (58%), Gaps = 33/341 (9%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M D+G WC IESDPGVFTEL+ +   +  QVEE++SLD   + +   VYGL+FLFK+Q  
Sbjct: 1   MGDSG-WCTIESDPGVFTELLSSIGAKRVQVEELYSLDKTLIPQHGTVYGLVFLFKYQKR 59

Query: 67  NDSSR-----LHPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKD 121
             ++      ++P  D      ++FA Q I NACATQAILSI++N P +D+G EL  F++
Sbjct: 60  PPAAERPGTLIYPPPD-----TLFFANQTIQNACATQAILSIIMNAPAVDVGEELQRFRE 114

Query: 122 FTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGA 181
           F+   DP  KG+ + NSE+IR  HNSFA  +   +D+    ++EKED FHF++YVP  G 
Sbjct: 115 FSAGMDPVTKGMVVGNSEVIRTAHNSFAPQEQLVVDR--DPNAEKEDPFHFVAYVPHNGK 172

Query: 182 LYELDGLSNGPVNLGPCTGD-NWLEKVRPVIQERMSRYTSA----EIRFNLLALIKN-RE 235
           +YELDGL  GP  LG    + +WL+   PVI +RM  Y  A    EIRFNL+ ++++ RE
Sbjct: 173 VYELDGLQKGPFELGEVPKEADWLDVATPVISKRMEEYQQAGDGTEIRFNLMMVVEDPRE 232

Query: 236 DVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHN 295
            + R    +I+E  +   +T    +L           +++  E+ K K++ +EN  R+ N
Sbjct: 233 KLTR----KIEELRKDGGDTGRKMDLE----------EKLAREEDKHKQWHKENVRRRFN 278

Query: 296 FIQFIYNIIRILAERGELQARIEYARKEMSKRIKDRAEKKK 336
           F  FI + ++ LA  G   A I+   ++     ++R EK+K
Sbjct: 279 FTPFIISFLKALATSGHAGAVIKQVTEQKKTAYQERLEKEK 319



>gi|358055142|dbj|GAA98911.1| hypothetical protein E5Q_05599 [Mixia osmundae IAM 14324]
          Length = 322

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 195/326 (59%), Gaps = 13/326 (3%)

Query: 13  WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL 72
           W L ESDP VF+ ++    V+G +VEE++ LD   LE+L+P    IFLFK+ GG  +   
Sbjct: 5   WSLTESDPSVFSAILWELGVKGVEVEELYGLDAALLEDLQP-QAFIFLFKYLGGERA--- 60

Query: 73  HPEADLSVDENV--YFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYD 130
            P      D N   YFA QVI NAC T AIL+  +N     LG EL N KDF+   DP  
Sbjct: 61  -PARAGRQDTNFRGYFAHQVIENACGTLAILNATMNLNLTQLGPELSNLKDFSSQLDPQT 119

Query: 131 KGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKEDIFHFISYVPVQGALYELDGLSN 190
           KG  +TNSE++R VHNSFARSDPF LD+  + ++E +D++HFI Y+P+ G LYELDGL  
Sbjct: 120 KGEVLTNSEVLRQVHNSFARSDPFQLDEA-RPATEDDDVYHFIVYLPIDGHLYELDGLQP 178

Query: 191 GPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALIKNREDVYRTRIGEIDERMR 250
            P++ G      W +K + VIQ R++ Y + E+ FNL+A+ ++R    ++RI  +     
Sbjct: 179 WPLDHGAVDASRWTDKAKEVIQARIATYPANELHFNLMAICEDRLANLQSRIDALQAVQG 238

Query: 251 HASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSLRKHNFIQFIYNIIRILAER 310
            A +T+ S   + L+  + QL      E+ K +R+  +N+LR+HN +  ++ ++  LA+ 
Sbjct: 239 SAVDTSRSDASLDLAHLQSQL----SDEQAKRQRWAFDNALRRHNHVGLVHALLEQLAKA 294

Query: 311 GELQARIEYAR-KEMSKRIKDRAEKK 335
           G+L A IE A+ K   +R + RA +K
Sbjct: 295 GQLSAEIEQAKAKANEQRERRRAAQK 320



>gi|212531795|ref|XP_002146054.1| ubiquitin hydrolase, putative [Talaromyces marneffei ATCC 18224]
 gi|210071418|gb|EEA25507.1| ubiquitin hydrolase, putative [Talaromyces marneffei ATCC 18224]
          Length = 318

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 201/344 (58%), Gaps = 49/344 (14%)

Query: 7   MSDAGQWCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGG 66
           M+D G W  IESD GVFT LI    V+G Q EE+ SLD  T+  L PVYG+IFLFKW GG
Sbjct: 1   MADGGGWSTIESDEGVFTSLIENLGVKGVQFEELISLDADTIRSLSPVYGVIFLFKWIGG 60

Query: 67  NDSSRLHPEADLSVDE------NVYFAKQVINNACATQAILSILLNCPT--------IDL 112
             S+   P AD + D+       ++FA Q I NAC TQAILS++LN  T        I++
Sbjct: 61  QSSNSTAP-ADGTYDQTAASEQGLFFAAQTIQNACGTQAILSVILNQDTPASGTPYPIEI 119

Query: 113 GAELDNFKDFTRLFDPYDKGLAITNSELIRGVHNSFARSDPFFLDQTDQSSSEKE-DIFH 171
           G+EL +FK FT+ F     G A++NSE IR  HN+FAR+ PF +D+T +++ ++E D++H
Sbjct: 120 GSELSSFKSFTQGFPSDLLGEALSNSEAIRTAHNAFARASPF-VDETQRTAQDEEGDVYH 178

Query: 172 FISYVPVQGALYELDGLSNGPVNLGPCTGDNWLEKVRPVIQERMSRYTSAEIRFNLLALI 231
           FI+Y PV G LYELDGL   P++ G C  +++ EKV  V+Q R++RY   E+RFNL+A +
Sbjct: 179 FIAYTPVNGKLYELDGLQPFPISHGDCDAESFPEKVIEVLQRRIARYPPGEVRFNLMAAV 238

Query: 232 KNREDVYRTRIGEIDERMRHASNTNNSSELMQLSEERDQLLQRIEMEKVKFKRYERENSL 291
           ++     R R  E  +           SEL+             E E  K + +  EN+L
Sbjct: 239 RD----LRIRAQEFGD-----------SELL-------------ERENAKRRAWAWENTL 270

Query: 292 RKHNFIQFIYNIIRILAER----GELQARIEYARKEMSKRIKDR 331
           R+ NF+ FI  + + + ++    G+ +  +E A+KE  +R + R
Sbjct: 271 RRSNFVGFIGEVAKAVVQKKVQDGKYEEWVEGAKKETLRRAEAR 314