BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10043_c0_seq1-m.17 5prime_partial 9-449(-) 147 (-)
         (146 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|301121610|ref|XP_002908532.1| 60S ribosomal protein L23 [Phyt...   226   1e-57   Phytophthora infestans T30-4
gi|393227063|gb|EJD34760.1| ribosomal protein L14b/L23e [Auricul...   226   2e-57   Auricularia subglabra TFB-10046 SS5
gi|299115573|emb|CBN75776.1| conserved unknown protein [Ectocarp...   225   2e-57   Ectocarpus siliculosus
gi|348681444|gb|EGZ21260.1| hypothetical protein PHYSODRAFT_2855...   225   3e-57   Phytophthora sojae
gi|157690684|tpe|CAL69069.1| TPA: putative 60S ribosomal protein...   225   4e-57   Spadella cephaloptera
gi|336366466|gb|EGN94813.1| hypothetical protein SERLA73DRAFT_18...   225   4e-57   Serpula lacrymans var. lacrymans S7.3
gi|507114980|emb|CDF38487.1| unnamed protein product [Chondrus c...   224   7e-57   Chondrus crispus [Irish moss]
gi|469664433|gb|AGH70171.1| 60S ribosomal protein L23 [Placozoa ...   223   2e-56   Placozoa sp. H4
gi|395331586|gb|EJF63967.1| 60S ribosomal protein L17/L23 [Dicho...   222   2e-56   Dichomitus squalens LYAD-421 SS1
gi|325186350|emb|CCA20856.1| 60S ribosomal protein L23 putative ...   222   3e-56   Albugo laibachii Nc14
gi|213403163|ref|XP_002172354.1| 60S ribosomal protein L23 [Schi...   222   3e-56   Schizosaccharomyces japonicus yFS275
gi|392562665|gb|EIW55845.1| 60S ribosomal protein L17/L23 [Trame...   222   3e-56   Trametes versicolor FP-101664 SS1
gi|384253137|gb|EIE26612.1| ribosomal protein L14b/L23e [Coccomy...   221   4e-56   Coccomyxa subellipsoidea C-169
gi|470620201|ref|XP_004318392.1| PREDICTED: 60S ribosomal protei...   221   5e-56   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|466072648|ref|XP_004282758.1| PREDICTED: 60S ribosomal protei...   221   5e-56   Orcinus orca [Orca]
gi|238604917|ref|XP_002396325.1| hypothetical protein MPER_03468...   220   8e-56   
gi|449545650|gb|EMD36621.1| hypothetical protein CERSUDRAFT_1156...   220   8e-56   Gelatoporia subvermispora B
gi|406698144|gb|EKD01386.1| 60s ribosomal protein l23 [Trichospo...   220   9e-56   Trichosporon asahii var. asahii CBS 8904
gi|290997802|ref|XP_002681470.1| 60S ribosomal protein L23 [Naeg...   220   1e-55   Naegleria gruberi strain NEG-M
gi|401883404|gb|EJT47613.1| 60s ribosomal protein l23 [Trichospo...   220   1e-55   Trichosporon asahii var. asahii CBS 2479
gi|19075639|ref|NP_588139.1| 60S ribosomal protein L23 [Schizosa...   220   1e-55   Schizosaccharomyces pombe 972h-
gi|307110263|gb|EFN58499.1| hypothetical protein CHLNCDRAFT_5957...   219   1e-55   Chlorella variabilis
gi|41282078|ref|NP_957026.1| 60S ribosomal protein L23 [Danio re...   219   1e-55   Danio rerio [leopard danio]
gi|482567419|gb|EOA31608.1| hypothetical protein CARUB_v10014805...   219   2e-55   Capsella rubella
gi|4583511|gb|AAD25102.1| ribosomal protein L17 [Dicentrarchus l...   219   2e-55   Dicentrarchus labrax [European sea bass]
gi|4506605|ref|NP_000969.1| 60S ribosomal protein L23 [Homo sapi...   219   2e-55   Homo sapiens [man]
gi|260794408|ref|XP_002592201.1| hypothetical protein BRAFLDRAFT...   219   2e-55   Branchiostoma floridae
gi|38571606|gb|AAH62716.1| Ribosomal protein L23 [Homo sapiens]       219   2e-55   Homo sapiens [man]
gi|328768212|gb|EGF78259.1| hypothetical protein BATDEDRAFT_2680...   219   2e-55   Batrachochytrium dendrobatidis JAM81
gi|431890704|gb|ELK01583.1| F-box only protein 47 [Pteropus alecto]   219   2e-55   Pteropus alecto
gi|242212506|ref|XP_002472086.1| 60S ribosomal protein L17/L23 [...   219   2e-55   Postia placenta Mad-698-R
gi|389742735|gb|EIM83921.1| ribosomal protein L14b/L23e [Stereum...   219   2e-55   Stereum hirsutum FP-91666 SS1
gi|388581556|gb|EIM21864.1| ribosomal protein L14b/L23e [Wallemi...   219   2e-55   Wallemia mellicola CBS 633.66
gi|470430884|ref|XP_004338344.1| 60S ribosomal protein L23, puta...   218   3e-55   Acanthamoeba castellanii str. Neff
gi|17647883|ref|NP_523813.1| ribosomal protein L23 [Drosophila m...   218   3e-55   Drosophila melanogaster
gi|70909731|emb|CAJ17291.1| ribosomal protein L23e [Sphaerius sp...   218   3e-55   Sphaerius sp. APV-2005
gi|264667415|gb|ACY71293.1| ribosomal protein L23 [Chrysomela tr...   218   4e-55   Chrysomela tremula
gi|10121725|gb|AAG13342.1|AF266222_1 ribosomal protein L23 [Gill...   218   4e-55   Gillichthys mirabilis
gi|157108448|ref|XP_001650232.1| 60S ribosomal protein L23 [Aede...   218   4e-55   Aedes aegypti
gi|168004133|ref|XP_001754766.1| predicted protein [Physcomitrel...   218   4e-55   Physcomitrella patens
gi|91085777|ref|XP_974360.1| PREDICTED: similar to ribosomal pro...   218   4e-55   Tribolium castaneum [rust-red flour beetle]
gi|730536|sp|Q07760.1|RL23_TOBAC RecName: Full=60S ribosomal pro...   218   4e-55   Nicotiana tabacum [American tobacco]
gi|345565658|gb|EGX48607.1| hypothetical protein AOL_s00080g236 ...   218   5e-55   Arthrobotrys oligospora ATCC 24927
gi|197099010|ref|NP_001124779.1| 60S ribosomal protein L23 [Pong...   218   5e-55   Pongo abelii [Orang-utan]
gi|32400871|gb|AAP80667.1|AF479048_1 ribosomal Pr 117, partial [...   218   5e-55   Triticum aestivum [Canadian hard winter wheat]
gi|12849613|dbj|BAB28415.1| unnamed protein product [Mus musculus]    218   5e-55   Mus musculus [mouse]
gi|426228459|ref|XP_004008323.1| PREDICTED: 60S ribosomal protei...   218   5e-55   
gi|307170578|gb|EFN62772.1| 60S ribosomal protein L23 [Camponotu...   218   6e-55   Camponotus floridanus
gi|148233630|ref|NP_001085921.1| ribosomal protein L23 [Xenopus ...   218   6e-55   Xenopus laevis [clawed frog]
gi|332028579|gb|EGI68616.1| 60S ribosomal protein L23 [Acromyrme...   217   7e-55   Acromyrmex echinatior
gi|157816849|gb|ABV82416.1| TA01212p [Drosophila melanogaster]        217   7e-55   Drosophila melanogaster
gi|58260986|ref|XP_567903.1| 60s ribosomal protein l23 [Cryptoco...   217   8e-55   Cryptococcus neoformans var. neoformans JEC21
gi|224065549|ref|XP_002301852.1| predicted protein [Populus tric...   217   8e-55   Populus trichocarpa [western balsam poplar]
gi|357114121|ref|XP_003558849.1| PREDICTED: 60S ribosomal protei...   217   8e-55   Brachypodium distachyon [annual false brome]
gi|168022174|ref|XP_001763615.1| predicted protein [Physcomitrel...   217   8e-55   Physcomitrella patens
gi|498968813|ref|XP_004526407.1| PREDICTED: 60S ribosomal protei...   217   8e-55   Ceratitis capitata
gi|254564747|ref|XP_002489484.1| 60S ribosomal protein L23 [Koma...   217   8e-55   Komagataella phaffii GS115
gi|115449557|ref|NP_001048495.1| Os02g0814700 [Oryza sativa Japo...   217   8e-55   
gi|471872558|emb|CCO36433.1| 60S ribosomal protein L23 [Rhizocto...   217   8e-55   Rhizoctonia solani AG-1 IB
gi|242034221|ref|XP_002464505.1| hypothetical protein SORBIDRAFT...   217   9e-55   Sorghum bicolor [broomcorn]
gi|321263699|ref|XP_003196567.1| 60S ribosomal protein L23 [Cryp...   217   1e-54   Cryptococcus gattii WM276
gi|507654954|ref|XP_004633745.1| PREDICTED: 60S ribosomal protei...   217   1e-54   Octodon degus
gi|505756588|gb|EOR00738.1| 60S ribosomal protein L23 [Wallemia ...   217   1e-54   Wallemia ichthyophaga EXF-994
gi|224086322|ref|XP_002192767.1| PREDICTED: 60S ribosomal protei...   217   1e-54   Taeniopygia guttata
gi|112984274|ref|NP_001037227.1| ribosomal protein L23 [Bombyx m...   216   1e-54   Bombyx mori [silk moth]
gi|116784756|gb|ABK23460.1| unknown [Picea sitchensis] >gi|11678...   216   1e-54   Picea sitchensis
gi|78042492|ref|NP_001030186.1| 60S ribosomal protein L23 [Bos t...   216   1e-54   Bos taurus [bovine]
gi|470107295|ref|XP_004289983.1| PREDICTED: 60S ribosomal protei...   216   1e-54   Fragaria vesca subsp. vesca
gi|226533522|ref|NP_001140843.1| uncharacterized protein LOC1002...   216   1e-54   Zea mays [maize]
gi|12832665|dbj|BAB22203.1| unnamed protein product [Mus musculus]    216   1e-54   Mus musculus [mouse]
gi|389608303|dbj|BAM17763.1| ribosomal protein L23 [Papilio xuth...   216   1e-54   Papilio xuthus [Chinese swallowtail]
gi|302851946|ref|XP_002957495.1| component of cytosolic 80S ribo...   216   1e-54   Volvox carteri f. nagariensis
gi|71018899|ref|XP_759680.1| 60S ribosomal protein L23 [Ustilago...   216   1e-54   
gi|387914520|gb|AFK10869.1| 60S ribosomal protein L23 [Callorhin...   216   1e-54   Callorhinchus milii [Australian ghost shark]
gi|292659544|pdb|2X7N|C Chain C, Mechanism Of Eif6s Anti-Associa...   216   1e-54   Saccharomyces cerevisiae [brewer's yeast]
gi|6319384|ref|NP_009466.1| ribosomal 60S subunit protein L23A [...   216   1e-54   Saccharomyces cerevisiae S288c
gi|15226102|ref|NP_180895.1| 60S ribosomal protein L23B [Arabido...   216   1e-54   Arabidopsis thaliana [mouse-ear cress]
gi|302759366|ref|XP_002963106.1| hypothetical protein SELMODRAFT...   216   1e-54   Selaginella moellendorffii
gi|157361531|gb|ABV44723.1| 60S ribosomal protein L23-like prote...   216   1e-54   Phlebotomus papatasi
gi|281500848|pdb|3JYW|R Chain R, Structure Of The 60s Proteins F...   216   2e-54   Thermomyces lanuginosus
gi|161701447|gb|ABX75541.1| 60S ribosomal protein L17-like prote...   216   2e-54   Panax ginseng [Chinese ginseng]
gi|390596107|gb|EIN05510.1| ribosomal protein L14b/L23e [Punctul...   216   2e-54   Punctularia strigosozonata HHB-11173 SS5
gi|403260397|ref|XP_003922660.1| PREDICTED: 60S ribosomal protei...   216   2e-54   Saimiri boliviensis boliviensis
gi|402225329|gb|EJU05390.1| ribosomal protein L14b/L23e [Dacryop...   216   2e-54   Dacryopinax primogenitus
gi|470120643|ref|XP_004296407.1| PREDICTED: 60S ribosomal protei...   216   2e-54   Fragaria vesca subsp. vesca
gi|351727781|ref|NP_001235125.1| uncharacterized protein LOC1003...   216   2e-54   Glycine max [soybeans]
gi|238231703|ref|NP_001154037.1| 60S ribosomal protein L23 [Onco...   216   2e-54   Oncorhynchus mykiss
gi|116782734|gb|ABK22634.1| unknown [Picea sitchensis]                216   2e-54   Picea sitchensis
gi|340382358|ref|XP_003389687.1| PREDICTED: 60S ribosomal protei...   216   2e-54   Amphimedon queenslandica
gi|195658145|gb|ACG48540.1| 60S ribosomal protein L23 [Zea mays]      215   2e-54   Zea mays [maize]
gi|66558956|ref|XP_392812.2| PREDICTED: 60S ribosomal protein L2...   215   2e-54   Apis mellifera [European honey bee]
gi|391342593|ref|XP_003745601.1| PREDICTED: 60S ribosomal protei...   215   2e-54   Metaseiulus occidentalis
gi|291242287|ref|XP_002741039.1| PREDICTED: ribosomal protein L2...   215   3e-54   
gi|67084029|gb|AAY66949.1| 60S ribosomal protein L23 [Ixodes sca...   215   3e-54   Ixodes scapularis [blacklegged tick]
gi|409074605|gb|EKM74999.1| hypothetical protein AGABI1DRAFT_116...   215   3e-54   Agaricus bisporus var. burnettii JB137-S8
gi|501290315|dbj|BAN20164.1| ribosomal protein L23 [Riptortus pe...   215   3e-54   Riptortus pedestris
gi|506965788|gb|AGM32246.1| 60S ribosomal protein L23 [Coptoterm...   215   3e-54   Coptotermes formosanus
gi|392572582|gb|EIW65727.1| hypothetical protein TREMEDRAFT_7489...   215   3e-54   Tremella mesenterica DSM 1558
gi|157929900|gb|ABW04138.1| ribosomal protein L23 [Epinephelus c...   215   3e-54   Epinephelus coioides [estuary cod]
gi|449277069|gb|EMC85376.1| 60S ribosomal protein L23, partial [...   215   3e-54   Columba livia [carrier pigeon]
gi|170592041|ref|XP_001900778.1| 60S ribosomal protein L23 [Brug...   215   3e-54   Brugia malayi [agent of lymphatic filariasis]
gi|410084222|ref|XP_003959688.1| hypothetical protein KAFR_0K019...   215   3e-54   Kazachstania africana CBS 2517
gi|501752383|emb|CCG83645.1| 60S ribosomal protein L23 [Taphrina...   215   3e-54   Taphrina deformans PYCC 5710
gi|340724772|ref|XP_003400755.1| PREDICTED: 60S ribosomal protei...   215   3e-54   Bombus terrestris [large earth bumblebee]
gi|326934106|ref|XP_003213136.1| PREDICTED: 60S ribosomal protei...   215   3e-54   
gi|403214162|emb|CCK68663.1| hypothetical protein KNAG_0B02210 [...   215   3e-54   Kazachstania naganishii CBS 8797
gi|393222273|gb|EJD07757.1| 60S ribosomal protein L17/L23 [Fomit...   215   3e-54   Fomitiporia mediterranea MF3/22
gi|2341028|gb|AAB70426.1| Strong similarity to 60S ribosomal pro...   215   3e-54   Arabidopsis thaliana [mouse-ear cress]
gi|21618149|gb|AAM67199.1| putative 60S ribosomal protein L17 [A...   215   4e-54   Arabidopsis thaliana [mouse-ear cress]
gi|281344351|gb|EFB19935.1| hypothetical protein PANDA_004968 [A...   215   4e-54   Ailuropoda melanoleuca
gi|392880274|gb|AFM88969.1| 60S ribosomal protein L23 [Callorhin...   215   4e-54   Callorhinchus milii [Australian ghost shark]
gi|168022308|ref|XP_001763682.1| predicted protein [Physcomitrel...   214   4e-54   Physcomitrella patens
gi|195999246|ref|XP_002109491.1| conserved hypothetical protein ...   214   5e-54   Trichoplax adhaerens
gi|449445630|ref|XP_004140575.1| PREDICTED: 60S ribosomal protei...   214   5e-54   Cucumis sativus [cucumbers]
gi|452823020|gb|EME30034.1| 60S ribosomal protein L23e [Galdieri...   214   5e-54   Galdieria sulphuraria
gi|242786687|ref|XP_002480854.1| 60S ribosomal protein L23 [Tala...   214   5e-54   Talaromyces stipitatus ATCC 10500
gi|225717578|gb|ACO14635.1| 60S ribosomal protein L23 [Caligus c...   214   5e-54   Caligus clemensi
gi|366989251|ref|XP_003674393.1| hypothetical protein NCAS_0A145...   214   5e-54   Naumovozyma castellii CBS 4309
gi|326491995|dbj|BAJ98222.1| predicted protein [Hordeum vulgare ...   214   5e-54   Hordeum vulgare subsp. vulgare [barley]
gi|302672745|ref|XP_003026060.1| 60S ribosomal protein L23 [Schi...   214   5e-54   Schizophyllum commune H4-8
gi|13097600|gb|AAH03518.1| Similar to ribosomal protein L23, par...   214   5e-54   Homo sapiens [man]
gi|242019454|ref|XP_002430176.1| 60S ribosomal protein L23, puta...   214   5e-54   Pediculus humanus corporis [human body lice]
gi|168004682|ref|XP_001755040.1| predicted protein [Physcomitrel...   214   6e-54   Physcomitrella patens
gi|2500265|sp|Q93140.1|RL23_BRUMA RecName: Full=60S ribosomal pr...   214   6e-54   Brugia malayi [agent of lymphatic filariasis]
gi|307195846|gb|EFN77642.1| 60S ribosomal protein L23 [Harpegnat...   214   6e-54   Harpegnathos saltator
gi|470316816|gb|EMR08554.1| hypothetical protein PNEG_03035 [Pne...   214   6e-54   Pneumocystis murina B123
gi|159481307|ref|XP_001698723.1| ribosomal protein L23, componen...   214   6e-54   Chlamydomonas reinhardtii
gi|225703828|gb|ACO07760.1| 60S ribosomal protein L23 [Oncorhync...   214   7e-54   Oncorhynchus mykiss
gi|509391752|gb|AGN29657.1| 60S ribosomal protein L23 [Acartia h...   214   7e-54   Acartia pacifica
gi|392875054|gb|AFM86359.1| 60S ribosomal protein L23 [Callorhin...   214   7e-54   Callorhinchus milii [Australian ghost shark]
gi|197260806|gb|ACH56903.1| 60S ribosomal protein L14/L17/L23 [S...   214   7e-54   Simulium vittatum
gi|50978792|ref|NP_001003100.1| 60S ribosomal protein L23 [Canis...   214   7e-54   
gi|291407371|ref|XP_002719902.1| PREDICTED: ribosomal protein L2...   214   7e-54   Oryctolagus cuniculus [European rabbit]
gi|225716984|gb|ACO14338.1| 60S ribosomal protein L23 [Esox lucius]   214   8e-54   Esox lucius
gi|392587615|gb|EIW76949.1| ribosomal protein L17 [Coniophora pu...   214   8e-54   Coniophora puteana RWD-64-598 SS2
gi|212543433|ref|XP_002151871.1| 60S ribosomal protein L23 [Tala...   214   8e-54   Talaromyces marneffei ATCC 18224
gi|444318830|ref|XP_004180072.1| hypothetical protein TBLA_0D004...   214   9e-54   Tetrapisispora blattae CBS 6284
gi|465792739|emb|CCU97981.1| unnamed protein product [Malassezia...   214   9e-54   Malassezia sympodialis ATCC 42132
gi|378727902|gb|EHY54361.1| 60S ribosomal protein L23 [Exophiala...   213   9e-54   Exophiala dermatitidis NIH/UT8656
gi|367011755|ref|XP_003680378.1| 60S ribosomal protein L23 [Toru...   213   9e-54   Torulaspora delbrueckii
gi|119188963|ref|XP_001245088.1| 60S ribosomal protein L23 [Cocc...   213   9e-54   Coccidioides immitis RS
gi|392877056|gb|AFM87360.1| 60S ribosomal protein L23 [Callorhin...   213   9e-54   Callorhinchus milii [Australian ghost shark]
gi|320580111|gb|EFW94334.1| 60S ribosomal protein L23 [Ogataea p...   213   9e-54   
gi|452844236|gb|EME46170.1| hypothetical protein DOTSEDRAFT_7023...   213   9e-54   Dothistroma septosporum NZE10
gi|355754092|gb|EHH58057.1| 60S ribosomal protein L17, partial [...   213   9e-54   Macaca fascicularis [crab eating macaque]
gi|225704556|gb|ACO08124.1| 60S ribosomal protein L23 [Oncorhync...   213   1e-53   Oncorhynchus mykiss
gi|365981431|ref|XP_003667549.1| ribosomal protein L23 [Naumovoz...   213   1e-53   Naumovozyma dairenensis CBS 421
gi|321458834|gb|EFX69895.1| hypothetical protein DAPPUDRAFT_3006...   213   1e-53   Daphnia pulex
gi|238883155|gb|EEQ46793.1| conserved hypothetical protein [Cand...   213   1e-53   Candida albicans WO-1
gi|448533425|ref|XP_003870635.1| Rpl23a ribosomal protein [Candi...   213   1e-53   Candida orthopsilosis Co 90-125
gi|255727366|ref|XP_002548609.1| 60S ribosomal protein L23 [Cand...   213   1e-53   Candida tropicalis MYA-3404
gi|353235390|emb|CCA67404.1| probable RPL23A-60S large subunit r...   213   1e-53   Serendipita indica DSM 11827
gi|296419434|ref|XP_002839313.1| 60S ribosomal protein L23 [Tube...   213   1e-53   Tuber melanosporum Mel28
gi|395849372|ref|XP_003797302.1| PREDICTED: 60S ribosomal protei...   213   1e-53   Otolemur garnettii
gi|50308523|ref|XP_454264.1| 60S ribosomal protein L23 [Kluyvero...   213   1e-53   Kluyveromyces lactis NRRL Y-1140
gi|453086049|gb|EMF14091.1| ribosomal protein L14b/L23e [Mycosph...   213   2e-53   Sphaerulina musiva SO2202
gi|478262700|gb|ENN81247.1| hypothetical protein YQE_02341, part...   213   2e-53   Dendroctonus ponderosae
gi|255712413|ref|XP_002552489.1| 60S ribosomal protein L23 [Lach...   213   2e-53   Lachancea thermotolerans CBS 6340
gi|158187776|gb|ABW23177.1| ribosomal protein rpl23 [Arenicola m...   213   2e-53   Arenicola marina [rock worm]
gi|149236241|ref|XP_001523998.1| 60S ribosomal protein L23 [Lodd...   213   2e-53   Lodderomyces elongisporus NRRL YB-4239
gi|167534168|ref|XP_001748762.1| hypothetical protein [Monosiga ...   213   2e-53   Monosiga brevicollis MX1
gi|164449276|gb|ABY56104.1| ribosomal protein [Cucumis sativus]       213   2e-53   Cucumis sativus [cucumbers]
gi|217075358|gb|ACJ86039.1| unknown [Medicago truncatula] >gi|38...   213   2e-53   Medicago truncatula
gi|511011832|gb|EPB93037.1| 60S ribosomal protein L23 [Mucor cir...   213   2e-53   Mucor circinelloides f. circinelloides 1006PhL
gi|225705444|gb|ACO08568.1| 60S ribosomal protein L23 [Oncorhync...   213   2e-53   Oncorhynchus mykiss
gi|357510141|ref|XP_003625359.1| 60S ribosomal protein L23 [Medi...   213   2e-53   
gi|256709331|gb|ACV21037.1| large subunit ribosomal protein 23 [...   213   2e-53   Diplogastrellus gracilis
gi|213514600|ref|NP_001134137.1| 60S ribosomal protein L23 [Salm...   212   2e-53   Salmo salar
gi|70909727|emb|CAJ17289.1| ribosomal protein L23e [Biphyllus lu...   212   2e-53   Biphyllus lunatus
gi|452983731|gb|EME83489.1| hypothetical protein MYCFIDRAFT_5220...   212   2e-53   Cercospora fijiensis CIRAD86
gi|2982289|gb|AAC32130.1| 60S ribosomal protein L17 [Picea mariana]   212   2e-53   Picea mariana [black spruce]
gi|150982034|gb|ABR87219.1| large subunit ribosomal protein 23 [...   212   3e-53   Pristionchus sp. 15 RS5229
gi|119498289|ref|XP_001265902.1| 60S ribosomal protein L23 [Neos...   212   3e-53   Aspergillus fischeri NRRL 181
gi|110671520|gb|ABG82011.1| putative ribosomal protein L17/23 [D...   212   3e-53   Diaphorina citri
gi|156846013|ref|XP_001645895.1| hypothetical protein Kpol_1045p...   212   3e-53   Vanderwaltozyma polyspora DSM 70294
gi|425769278|gb|EKV07775.1| Alkaline serine protease [Penicilliu...   212   3e-53   Penicillium digitatum Pd1
gi|154279732|ref|XP_001540679.1| 60S ribosomal protein L23 [Ajel...   212   3e-53   Histoplasma capsulatum NAm1
gi|291394043|ref|XP_002713585.1| PREDICTED: ribosomal protein L2...   212   3e-53   Oryctolagus cuniculus [European rabbit]
gi|160550241|gb|ABX44825.1| putative 60S ribosomal protein RPL23...   212   3e-53   Flustra foliacea
gi|121543837|gb|ABM55583.1| putative 60S ribosomal protein L23 [...   212   3e-53   Maconellicoccus hirsutus [pink hibiscus mealybug]
gi|344300098|gb|EGW30438.1| 60S ribosomal protein L23 [Spathaspo...   212   3e-53   Spathaspora passalidarum NRRL Y-27907
gi|50288181|ref|XP_446519.1| 60S ribosomal protein L23 [Candida ...   211   4e-53   Candida glabrata CBS 138
gi|45200809|ref|NP_986379.1| 60S ribosomal protein L23 [Ashbya g...   211   4e-53   Eremothecium gossypii ATCC 10895
gi|256709335|gb|ACV21039.1| large subunit ribosomal protein 23 [...   211   4e-53   Koerneria sudhausi
gi|240849037|ref|NP_001155385.1| ribosomal protein L23-like [Acy...   211   4e-53   Acyrthosiphon pisum
gi|443705738|gb|ELU02136.1| hypothetical protein CAPTEDRAFT_1727...   211   4e-53   Capitella teleta
gi|384489793|gb|EIE81015.1| 60S ribosomal protein L23 [Rhizopus ...   211   4e-53   Rhizopus delemar RA 99-880
gi|254578282|ref|XP_002495127.1| 60S ribosomal protein L23 [Zygo...   211   5e-53   Zygosaccharomyces rouxii CBS 732
gi|261199199|ref|XP_002626001.1| 60S ribosomal protein L23 [Ajel...   211   5e-53   Blastomyces gilchristii SLH14081
gi|226442003|gb|ACO57591.1| ribosomal protein L23, partial [Gill...   211   5e-53   Gillichthys seta
gi|256709327|gb|ACV21035.1| large subunit ribosomal protein 23 [...   211   5e-53   Acrostichus sp. RS5083
gi|331230491|ref|XP_003327910.1| 60S ribosomal protein L23 [Pucc...   211   5e-53   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|170116680|ref|XP_001889530.1| 60S ribosomal protein L23 [Lacc...   211   5e-53   Laccaria bicolor S238N-H82
gi|150982032|gb|ABR87218.1| large subunit ribosomal protein 23 [...   211   6e-53   Pristionchus sp. 14 RS5230
gi|115442740|ref|XP_001218177.1| 60S ribosomal protein L23 [Aspe...   211   6e-53   Aspergillus terreus NIH2624
gi|126135718|ref|XP_001384383.1| 60S ribosomal protein L23 [Sche...   211   6e-53   Scheffersomyces stipitis CBS 6054
gi|344232108|gb|EGV63987.1| ribosomal protein L14b/L23e [Candida...   211   6e-53   Candida tenuis ATCC 10573
gi|407919763|gb|EKG12988.1| Ribosomal protein L14b/L23e [Macroph...   211   7e-53   Macrophomina phaseolina MS6
gi|255942907|ref|XP_002562222.1| Pc18g03860 [Penicillium chrysog...   211   7e-53   Penicillium rubens Wisconsin 54-1255
gi|150982018|gb|ABR87211.1| large subunit ribosomal protein 23 [...   211   7e-53   Pristionchus marianneae
gi|150982014|gb|ABR87209.1| large subunit ribosomal protein 23 [...   211   7e-53   Pristionchus aerivorus
gi|326428484|gb|EGD74054.1| ribosomal protein rpl23 [Salpingoeca...   210   9e-53   Salpingoeca rosetta
gi|448091253|ref|XP_004197283.1| Piso0_004530 [Millerozyma farin...   210   9e-53   Millerozyma farinosa CBS 7064
gi|150982036|gb|ABR87220.1| large subunit ribosomal protein 23 [...   210   1e-52   Koerneria sp. RS1982
gi|299739086|ref|XP_001835036.2| 60S ribosomal protein L23 [Copr...   210   1e-52   Coprinopsis cinerea okayama7#130
gi|256709329|gb|ACV21036.1| large subunit ribosomal protein 23 [...   210   1e-52   Pseudodiplogasteroides sp. SB257
gi|256709317|gb|ACV21030.1| large subunit ribosomal protein 23 [...   210   1e-52   Micoletzkya sp. WEM-2009
gi|150982004|gb|ABR87204.1| large subunit ribosomal protein 23 [...   210   1e-52   Pristionchus lheritieri
gi|255078342|ref|XP_002502751.1| predicted protein [Micromonas s...   210   1e-52   Micromonas commoda
gi|256709321|gb|ACV21032.1| large subunit ribosomal protein 23 [...   210   1e-52   Myctolaimus sp. RS5442
gi|164661623|ref|XP_001731934.1| hypothetical protein MGL_1202 [...   210   1e-52   Malassezia globosa CBS 7966
gi|6006439|emb|CAB56830.1| 60S ribosomal protein L17 [Cyanophora...   209   1e-52   Cyanophora paradoxa
gi|150982002|gb|ABR87203.1| large subunit ribosomal protein 23 [...   209   1e-52   Pristionchus maupasi
gi|472582967|gb|EMS20629.1| 60S ribosomal protein l23 [Rhodospor...   209   1e-52   Rhodotorula toruloides NP11
gi|403414351|emb|CCM01051.1| predicted protein [Fibroporia radic...   209   1e-52   Fibroporia radiculosa
gi|256709313|gb|ACV21028.1| large subunit ribosomal protein 23 [...   209   1e-52   Diplogasteriana schneideri
gi|37779090|gb|AAP20205.1| ribosomal protein L17 [Pagrus major]       209   2e-52   Pagrus major [red tail]
gi|50550357|ref|XP_502651.1| 60S ribosomal protein L23 [Yarrowia...   209   2e-52   Yarrowia lipolytica CLIB122
gi|188572534|gb|ACD65173.1| putative 60S ribosomal protein RPL23...   209   2e-52   Phoronis muelleri
gi|387600371|gb|AFJ92675.1| large ribosomal protein 23, partial ...   209   2e-52   Parapristionchus giblindavisi
gi|332375604|gb|AEE62943.1| unknown [Dendroctonus ponderosae]         209   2e-52   Dendroctonus ponderosae
gi|294655716|ref|XP_457899.2| 60S ribosomal protein L23 [Debaryo...   209   2e-52   Debaryomyces hansenii CBS767
gi|189208225|ref|XP_001940446.1| 60S ribosomal protein L23 [Pyre...   209   2e-52   Pyrenophora tritici-repentis Pt-1C-BFP
gi|256709333|gb|ACV21038.1| large subunit ribosomal protein 23 [...   209   2e-52   Rhabditoides inermis
gi|256709337|gb|ACV21040.1| large subunit ribosomal protein 23 [...   209   2e-52   Tylopharynx sp. WEM-2009
gi|22758906|gb|AAN05612.1| ribosomal protein L17A [Argopecten ir...   209   2e-52   Argopecten irradians
gi|296810872|ref|XP_002845774.1| 60S ribosomal protein L23 [Arth...   209   2e-52   Arthroderma otae CBS 113480
gi|150982026|gb|ABR87215.1| large subunit ribosomal protein 23 [...   209   3e-52   Pristionchus sp. 11 RS5228
gi|161671298|gb|ABX75501.1| ribosomal protein l23 [Lycosa singor...   209   3e-52   Lycosa singoriensis
gi|150982000|gb|ABR87202.1| large subunit ribosomal protein 23 [...   209   3e-52   Pristionchus pacificus
gi|398408834|ref|XP_003855882.1| 60S ribosomal protein L23 [Zymo...   208   3e-52   Zymoseptoria tritici IPO323
gi|17369866|sp|Q9XEK8.1|RL23_TORRU RecName: Full=60S ribosomal p...   208   3e-52   Syntrichia ruralis
gi|256709309|gb|ACV21026.1| large subunit ribosomal protein 23 [...   208   3e-52   Rhabditidoides sp. RS5443
gi|428172426|gb|EKX41335.1| large subunit ribosomal protein L23e...   208   3e-52   Guillardia theta CCMP2712
gi|150982020|gb|ABR87212.1| large subunit ribosomal protein 23 [...   208   3e-52   Pristionchus pauli
gi|146414359|ref|XP_001483150.1| 60S ribosomal protein L23 [Meye...   208   3e-52   Meyerozyma guilliermondii ATCC 6260
gi|150982010|gb|ABR87207.1| large subunit ribosomal protein 23 [...   208   4e-52   Pristionchus sp. 3 CZ3975
gi|303283132|ref|XP_003060857.1| predicted protein [Micromonas p...   208   4e-52   Micromonas pusilla CCMP1545
gi|156394964|ref|XP_001636882.1| predicted protein [Nematostella...   208   4e-52   Nematostella vectensis
gi|17554750|ref|NP_498231.1| Protein RPL-23 [Caenorhabditis eleg...   208   4e-52   Caenorhabditis elegans [roundworm]
gi|224007988|ref|XP_002292953.1| protein 23 of the large ribosom...   208   4e-52   Thalassiosira pseudonana CCMP1335
gi|409043839|gb|EKM53321.1| hypothetical protein PHACADRAFT_2595...   208   4e-52   Phanerochaete carnosa HHB-10118-sp
gi|188572437|gb|ACD65125.1| putative 60S ribosomal protein RPL23...   208   4e-52   Novocrania anomala
gi|86355131|dbj|BAE78800.1| ribosomal protein L23 [Pelodiscus si...   208   5e-52   Pelodiscus sinensis [Chinese softshell turtle]
gi|169595466|ref|XP_001791157.1| hypothetical protein SNOG_00472...   208   5e-52   Parastagonospora nodorum SN15
gi|332207802|ref|XP_003252985.1| PREDICTED: 60S ribosomal protei...   207   5e-52   
gi|225709460|gb|ACO10576.1| 60S ribosomal protein L23 [Caligus r...   207   6e-52   Caligus rogercresseyi
gi|150982022|gb|ABR87213.1| large subunit ribosomal protein 23 [...   207   7e-52   Pristionchus pseudaerivorus
gi|256709311|gb|ACV21027.1| large subunit ribosomal protein 23 [...   207   8e-52   Mononchoides sp. RS5441
gi|449468582|ref|XP_004152000.1| PREDICTED: 60S ribosomal protei...   207   8e-52   
gi|145238424|ref|XP_001391859.1| 60S ribosomal protein L23 [Aspe...   207   8e-52   Aspergillus niger CBS 513.88
gi|396460030|ref|XP_003834627.1| hypothetical protein LEMA_P0677...   207   9e-52   Leptosphaeria maculans JN3
gi|169779043|ref|XP_001823986.1| 60S ribosomal protein L23 [Aspe...   207   9e-52   Aspergillus oryzae RIB40
gi|256709315|gb|ACV21029.1| large subunit ribosomal protein 23 [...   207   9e-52   Diplogasteroides sp. 1 RS5444
gi|457866951|emb|CCQ18586.1| 60S ribosomal protein L23 [Sycon ci...   207   1e-51   Sycon ciliatum
gi|356575235|ref|XP_003555747.1| PREDICTED: LOW QUALITY PROTEIN:...   206   1e-51   
gi|300175094|emb|CBK20405.2| Ribosomal protein L14b/L23e [Blasto...   206   1e-51   Blastocystis hominis
gi|405967540|gb|EKC32688.1| 60S ribosomal protein L23 [Crassostr...   206   1e-51   Crassostrea gigas
gi|256709319|gb|ACV21031.1| large subunit ribosomal protein 23 [...   206   2e-51   Neodiplogaster sp. WEM-2009
gi|485923300|gb|EOD48499.1| putative 60s ribosomal protein l23 p...   206   2e-51   Neofusicoccum parvum UCRNP2
gi|256709323|gb|ACV21033.1| large subunit ribosomal protein 23 [...   206   2e-51   Oigolaimella attenuata
gi|259482683|tpe|CBF77394.1| TPA: hypothetical protein similar t...   206   2e-51   Aspergillus nidulans FGSC A4
gi|385305581|gb|EIF49543.1| 60s ribosomal protein l23 [Dekkera b...   206   2e-51   Brettanomyces bruxellensis AWRI1499
gi|61654658|gb|AAX48855.1| L23 [Suberites domuncula]                  205   3e-51   Suberites domuncula
gi|256709325|gb|ACV21034.1| large subunit ribosomal protein 23 [...   204   5e-51   Diplogasteroides magnus
gi|406865110|gb|EKD18153.1| 60S ribosomal protein L23 [Marssonin...   204   5e-51   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|512195898|gb|EPE24736.1| Ribosomal protein L14 [Glarea lozoye...   204   5e-51   Glarea lozoyensis ATCC 20868
gi|158330|gb|AAA28867.1| ribosomal protein L17A [Drosophila mela...   204   6e-51   Drosophila melanogaster
gi|466077067|ref|XP_004283659.1| PREDICTED: 60S ribosomal protei...   204   8e-51   Orcinus orca [Orca]
gi|67626685|gb|AAY78546.1| L17 ribosomal protein [Strigomonas cu...   204   8e-51   Strigomonas culicis
gi|340897524|gb|EGS17114.1| 60S ribosomal protein l23-like prote...   204   8e-51   Chaetomium thermophilum var. thermophilum DSM 1495
gi|71659840|ref|XP_821640.1| 60S ribosomal protein L23 [Trypanos...   204   8e-51   Trypanosoma cruzi strain CL Brener
gi|71659842|ref|XP_821641.1| 60S ribosomal protein L23 [Trypanos...   203   1e-50   Trypanosoma cruzi strain CL Brener
gi|320591266|gb|EFX03705.1| 60S ribosomal protein l23 [Grosmanni...   203   1e-50   Grosmannia clavigera kw1407
gi|302924330|ref|XP_003053865.1| 60S ribosomal protein L23 [Nect...   203   1e-50   Nectria haematococca mpVI 77-13-4
gi|160948274|emb|CAO94738.1| putative ribosomal protein L23 [Pom...   203   1e-50   Pomphorhynchus laevis
gi|33772493|gb|AAQ54648.1| 60S ribosomal protein L23 [Oikopleura...   203   1e-50   Oikopleura dioica
gi|313221500|emb|CBY32248.1| unnamed protein product [Oikopleura...   203   1e-50   Oikopleura dioica
gi|46107838|ref|XP_380978.1| hypothetical protein FG00802.1 [Fus...   203   1e-50   
gi|323450083|gb|EGB05966.1| hypothetical protein AURANDRAFT_6021...   203   1e-50   
gi|361130542|gb|EHL02311.1| putative 60S ribosomal protein L23-B...   203   1e-50   
gi|150982016|gb|ABR87210.1| large subunit ribosomal protein 23 [...   203   1e-50   
gi|154321469|ref|XP_001560050.1| 60S ribosomal protein L23 [Botr...   203   1e-50   
gi|511003144|gb|EPB84556.1| 60S ribosomal protein L23 [Mucor cir...   203   1e-50   
gi|154345077|ref|XP_001568480.1| putative 60S ribosomal protein ...   203   1e-50   
gi|406601395|emb|CCH46976.1| 60S ribosomal protein L23 [Wickerha...   203   1e-50   
gi|237862652|gb|ACR24951.1| ribosomal protein L23 [Lepidochitona...   203   2e-50   
gi|145354583|ref|XP_001421560.1| Ribosomal protein L23, componen...   202   2e-50   
gi|400602081|gb|EJP69706.1| 60S ribosomal protein L23 [Beauveria...   202   2e-50   
gi|71745554|ref|XP_827407.1| 60S ribosomal protein L23 [Trypanos...   202   2e-50   
gi|389629518|ref|XP_003712412.1| 60S ribosomal protein L23 [Magn...   202   2e-50   
gi|340517945|gb|EGR48187.1| hypothetical protein TRIREDRAFT_1220...   202   2e-50   
gi|471561582|gb|EMR63316.1| putative 60s ribosomal protein l23 p...   202   2e-50   
gi|146101722|ref|XP_001469187.1| putative 60S ribosomal protein ...   202   2e-50   
gi|302404200|ref|XP_002999938.1| 60S ribosomal protein L23 [Vert...   202   2e-50   
gi|322696655|gb|EFY88444.1| 60S ribosomal protein L23 [Metarhizi...   202   2e-50   
gi|85119188|ref|XP_965587.1| 60S ribosomal protein L23 [Neurospo...   202   2e-50   
gi|384485907|gb|EIE78087.1| 60S ribosomal protein L23 [Rhizopus ...   202   2e-50   
gi|358390524|gb|EHK39929.1| hypothetical protein TRIATDRAFT_2597...   202   3e-50   
gi|477532986|gb|ENH84580.1| 60s ribosomal protein l23 [Colletotr...   202   3e-50   
gi|241956526|ref|XP_002420983.1| 60S ribosomal protein L23 [Cand...   202   3e-50   
gi|397602023|gb|EJK58053.1| hypothetical protein THAOC_21848 [Th...   202   3e-50   
gi|475528783|gb|EMT07675.1| 60S ribosomal protein L23 [Aegilops ...   202   3e-50   
gi|336274522|ref|XP_003352015.1| 60S ribosomal protein L23 [Sord...   202   3e-50   
gi|485638216|gb|EOD32651.1| hypothetical protein EMIHUDRAFT_4181...   202   3e-50   
gi|194695264|gb|ACF81716.1| unknown [Zea mays] >gi|313586535|gb|...   202   3e-50   
gi|171694576|ref|XP_001912212.1| hypothetical protein [Podospora...   202   3e-50   
gi|367030980|ref|XP_003664773.1| hypothetical protein MYCTH_7136...   201   4e-50   
gi|470327016|ref|XP_004364834.1| 60S ribosomal protein L23 [Caps...   201   5e-50   
gi|116182920|ref|XP_001221309.1| 60S ribosomal protein L23 [Chae...   201   6e-50   
gi|334185072|ref|NP_001189805.1| 60S ribosomal protein L23 [Arab...   201   6e-50   
gi|403332090|gb|EJY65037.1| 60S ribosomal protein L23 [Oxytricha...   200   8e-50   
gi|403221905|dbj|BAM40037.1| ribosomal protein L23 [Theileria or...   200   9e-50   
gi|166952303|gb|ABZ04234.1| ribosomal protein rpl23 [Lineus viri...   200   9e-50   
gi|38327027|gb|AAO65478.4| alkaline serine protease [Bionectria ...   199   2e-49   
gi|149272413|ref|XP_001472273.1| PREDICTED: 60S ribosomal protei...   199   2e-49   
gi|121710454|ref|XP_001272843.1| 60S ribosomal protein L23 [Aspe...   199   2e-49   
gi|3851618|gb|AAC72377.1| ribosomal protein L17 [Leishmania infa...   199   2e-49   
gi|387598193|gb|AFJ91752.1| ribosomal protein L17/23, partial [O...   199   2e-49   
gi|449664818|ref|XP_002161668.2| PREDICTED: 60S ribosomal protei...   199   3e-49   
gi|260918217|gb|ACX54278.1| ribosomal protein L23 [Panthera tigr...   199   3e-49   
gi|328858303|gb|EGG07416.1| hypothetical protein MELLADRAFT_5244...   198   3e-49   
gi|471195891|ref|XP_004254904.1| 60S ribosomal protein L23, puta...   198   4e-49   
gi|51172914|gb|AAT97352.1| large subunit ribosomal protein L23 [...   198   4e-49   
gi|510900255|ref|XP_004828856.1| 60S ribosomal protein L23, puta...   197   5e-49   
gi|424513646|emb|CCO66268.1| 60S ribosomal protein L23 [Bathycoc...   197   6e-49   
gi|357510143|ref|XP_003625360.1| 60S ribosomal protein L23 [Medi...   197   7e-49   
gi|160331023|ref|XP_001712219.1| rpl23 [Hemiselmis andersenii] >...   197   7e-49   
gi|407262287|ref|XP_003946049.1| PREDICTED: 60S ribosomal protei...   197   7e-49   
gi|399949763|gb|AFP65420.1| 60S ribosomal protein L23 [Chroomona...   197   8e-49   
gi|449019457|dbj|BAM82859.1| 60S ribosomal protein L23 [Cyanidio...   197   9e-49   
gi|315051666|ref|XP_003175207.1| 60S ribosomal protein L23 [Arth...   197   1e-48   
gi|71030494|ref|XP_764889.1| 60S ribosomal protein L23 [Theileri...   196   1e-48   
gi|219130102|ref|XP_002185212.1| predicted protein [Phaeodactylu...   196   2e-48   
gi|296207153|ref|XP_002750531.1| PREDICTED: 60S ribosomal protei...   195   3e-48   
gi|156088723|ref|XP_001611768.1| ribosomal protein L14p/L23e  [B...   195   3e-48   
gi|323305276|gb|EGA59023.1| Rpl23bp [Saccharomyces cerevisiae Fo...   195   3e-48   
gi|401411453|ref|XP_003885174.1| putative 60S ribosomal protein ...   195   3e-48   
gi|310798706|gb|EFQ33599.1| ribosomal protein L14p/L23e [Glomere...   194   5e-48   
gi|512194028|gb|EPE09785.1| 60s ribosomal protein l23 [Ophiostom...   194   5e-48   
gi|294886775|ref|XP_002771847.1| 60S ribosomal protein L23, puta...   194   5e-48   
gi|365761118|gb|EHN02794.1| Rpl23bp [Saccharomyces cerevisiae x ...   194   5e-48   
gi|4028025|gb|AAC96111.1| ribosomal protein L17 homolog [Dicentr...   194   6e-48   
gi|157093599|gb|ABV22454.1| ribosomal protein L23 [Oxyrrhis marina]   194   8e-48   
gi|470272414|ref|XP_004363117.1| S60 ribosomal protein L23 [Dict...   192   3e-47   
gi|477508335|gb|ENH61629.1| 60S ribosomal protein L23-B [Fusariu...   192   4e-47   
gi|475663446|gb|EMT61241.1| 60S ribosomal protein L23-B [Fusariu...   191   4e-47   
gi|237830267|ref|XP_002364431.1| 60S ribosomal protein L23, puta...   191   4e-47   
gi|67470668|ref|XP_651297.1| 60S ribosomal protein L23 [Entamoeb...   191   4e-47   
gi|195620934|gb|ACG32297.1| 60S ribosomal protein L23 [Zea mays]      191   6e-47   
gi|66475246|ref|XP_627439.1| 60S ribosomal protein L23 [Cryptosp...   190   9e-47   
gi|68490692|ref|XP_710842.1| likely cytosolic ribosomal protein ...   190   1e-46   
gi|358058628|dbj|GAA95591.1| hypothetical protein E5Q_02247 [Mix...   190   1e-46   
gi|209877328|ref|XP_002140106.1| 60S ribosomal protein L23 [Cryp...   190   1e-46   
gi|67594829|ref|XP_665904.1| 60S ribosomal protein L23 [Cryptosp...   190   1e-46   
gi|68075865|ref|XP_679852.1| 60S ribosomal protein L23 [Plasmodi...   190   1e-46   
gi|327357626|gb|EGE86483.1| alkaline serine protease [Ajellomyce...   189   2e-46   
gi|488590792|ref|XP_004480666.1| PREDICTED: 60S ribosomal protei...   189   2e-46   
gi|38048025|gb|AAR09915.1| similar to Drosophila melanogaster Rp...   189   2e-46   
gi|124513388|ref|XP_001350050.1| 60S ribosomal protein L23, puta...   189   2e-46   
gi|399217923|emb|CCF74810.1| unnamed protein product [Babesia mi...   187   5e-46   
gi|256071884|ref|XP_002572268.1| 60S ribosomal protein L23 [Schi...   187   7e-46   
gi|70989247|ref|XP_749473.1| alkaline serine protease [Aspergill...   187   7e-46   
gi|358334437|dbj|GAA52876.1| large subunit ribosomal protein L23...   187   1e-45   
gi|66803967|ref|XP_635797.1| S60 ribosomal protein L23 [Dictyost...   187   1e-45   
gi|212543435|ref|XP_002151872.1| 60S ribosomal protein L23 [Tala...   186   1e-45   
gi|507551457|ref|XP_004659529.1| PREDICTED: 60S ribosomal protei...   186   2e-45   
gi|444520450|gb|ELV13002.1| 60S ribosomal protein L23 [Tupaia ch...   185   3e-45   
gi|297287698|ref|XP_001102875.2| PREDICTED: RWD domain-containin...   185   4e-45   
gi|488570431|ref|XP_004474817.1| PREDICTED: 60S ribosomal protei...   184   6e-45   
gi|339243151|ref|XP_003377501.1| 60S ribosomal protein L23 [Tric...   184   6e-45   
gi|292397872|gb|ADE27976.1| ribosomal protein L23 [Nylanderia nr...   184   7e-45   
gi|281203136|gb|EFA77337.1| S60 ribosomal protein L23 [Polysphon...   184   9e-45   
gi|494830734|gb|EON67249.1| 60S ribosomal protein L23 [Coniospor...   184   1e-44   
gi|302503043|ref|XP_003013482.1| hypothetical protein ARB_00300 ...   183   1e-44   
gi|159109758|ref|XP_001705142.1| Ribosomal protein L23 [Giardia ...   183   2e-44   
gi|354502937|ref|XP_003513538.1| PREDICTED: 60S ribosomal protei...   183   2e-44   
gi|308160105|gb|EFO62611.1| Ribosomal protein L23 [Giardia lambl...   182   2e-44   
gi|145475561|ref|XP_001423803.1| hypothetical protein [Parameciu...   182   3e-44   
gi|483501704|gb|EOA95216.1| 60S ribosomal protein L23, partial [...   182   3e-44   
gi|300175574|emb|CBK20885.2| unnamed protein product [Blastocyst...   181   4e-44   
gi|390361773|ref|XP_003729998.1| PREDICTED: uncharacterized prot...   181   7e-44   
gi|344251536|gb|EGW07640.1| 60S ribosomal protein L23 [Cricetulu...   180   1e-43   
gi|330796147|ref|XP_003286130.1| ribosomal protein L23 [Dictyost...   179   2e-43   
gi|403283686|ref|XP_003933241.1| PREDICTED: 60S ribosomal protei...   178   4e-43   
gi|513226048|ref|XP_004948631.1| PREDICTED: 60S ribosomal protei...   178   4e-43   
gi|499035977|ref|XP_004568657.1| PREDICTED: 60S ribosomal protei...   178   5e-43   
gi|258576081|ref|XP_002542222.1| 60S ribosomal protein L23 [Unci...   177   6e-43   
gi|40643024|emb|CAD91439.1| ribosomal protein L17A [Crassostrea ...   177   9e-43   
gi|488526320|ref|XP_004454994.1| PREDICTED: 60S ribosomal protei...   177   1e-42   
gi|70909729|emb|CAJ17290.1| ribosomal protein L23e [Mycetophagus...   176   2e-42   
gi|350427941|ref|XP_003494934.1| PREDICTED: 60S ribosomal protei...   176   2e-42   
gi|465961425|gb|EMP29330.1| 60S ribosomal protein L23 [Chelonia ...   176   2e-42   
gi|162606006|ref|XP_001713518.1| 60S ribosomal protein L23 [Guil...   176   2e-42   
gi|413924090|gb|AFW64022.1| hypothetical protein ZEAMMB73_988730...   176   3e-42   
gi|123352746|ref|XP_001295406.1| 60S ribosomal protein L23 [Tric...   176   3e-42   
gi|125584853|gb|EAZ25517.1| hypothetical protein OsJ_09341 [Oryz...   174   5e-42   
gi|354465602|ref|XP_003495268.1| PREDICTED: 60S ribosomal protei...   174   7e-42   
gi|2500266|sp|Q94776.1|RL23_TRYCR RecName: Full=60S ribosomal pr...   173   1e-41   
gi|226482063|emb|CAX79297.1| Ribosomal Protein, Large subunit [S...   173   1e-41   
gi|326474191|gb|EGD98200.1| alkaline serine protease [Trichophyt...   172   4e-41   
gi|356533453|ref|XP_003535278.1| PREDICTED: LOW QUALITY PROTEIN:...   171   6e-41   
gi|471225561|ref|XP_004031850.1| large subunit ribosomal protein...   171   8e-41   
gi|378755954|gb|EHY65979.1| ribosomal protein rpl23 [Nematocida ...   169   2e-40   
gi|146164168|ref|XP_001013247.2| Ribosomal protein L14p/L23e con...   169   3e-40   
gi|293345772|ref|XP_002726132.1| PREDICTED: 60S ribosomal protei...   168   4e-40   
gi|47824967|gb|AAT38741.1| 60S ribosomal protein L23, putative [...   167   7e-40   
gi|224112255|ref|XP_002316132.1| predicted protein [Populus tric...   166   2e-39   
gi|403279997|ref|XP_003931526.1| PREDICTED: uncharacterized prot...   166   2e-39   
gi|357438569|ref|XP_003589560.1| 60S ribosomal protein L23 [Medi...   165   4e-39   
gi|430813391|emb|CCJ29270.1| unnamed protein product [Pneumocyst...   162   3e-38   
gi|340383862|ref|XP_003390435.1| PREDICTED: 60S ribosomal protei...   161   4e-38   
gi|444732655|gb|ELW72935.1| 60S ribosomal protein L23 [Tupaia ch...   161   4e-38   
gi|459184397|ref|XP_002121204.2| PREDICTED: 60S ribosomal protei...   161   5e-38   
gi|224117278|ref|XP_002317528.1| predicted protein [Populus tric...   160   8e-38   
gi|310771957|emb|CBH28916.1| RIBOSOMAL PROTEIN L23 [Anncaliia al...   160   9e-38   
gi|402468206|gb|EJW03392.1| hypothetical protein EDEG_02249 [Edh...   160   1e-37   
gi|224072108|ref|XP_002303626.1| predicted protein [Populus tric...   160   1e-37   
gi|47156919|gb|AAT12309.1| large subunit ribosomal protein L23e ...   159   2e-37   
gi|485604104|gb|EOD04569.1| hypothetical protein EMIHUDRAFT_4227...   159   2e-37   
gi|444724799|gb|ELW65390.1| 60S ribosomal protein L23 [Tupaia ch...   159   3e-37   
gi|222354842|gb|ACM48182.1| 60S ribosomal protein L23 [Epinephel...   158   4e-37   
gi|224171878|ref|XP_002339578.1| predicted protein [Populus tric...   157   1e-36   
gi|19173443|ref|NP_597246.1| 60S ribosomal protein L23 [Encephal...   155   3e-36   
gi|85812211|gb|ABC84243.1| RPL23 [Bos taurus]                         155   4e-36   
gi|218192055|gb|EEC74482.1| hypothetical protein OsI_09940 [Oryz...   154   7e-36   
gi|56155405|gb|AAV80406.1| ribosomal protein L23-like protein [C...   153   1e-35   
gi|413924089|gb|AFW64021.1| hypothetical protein ZEAMMB73_988730...   153   2e-35   
gi|308812388|ref|XP_003083501.1| 60S ribosomal protein L14/L17/L...   153   2e-35   
gi|401827408|ref|XP_003887796.1| 60S ribosomal protein L23 [Ence...   153   2e-35   
gi|159145634|gb|ABW90354.1| putative ribosomal protein L23 [Sipu...   152   3e-35   
gi|256071886|ref|XP_002572269.1| 60S ribosomal protein L23 [Schi...   152   3e-35   
gi|108706090|gb|ABF93885.1| 60S ribosomal protein L23, putative,...   152   3e-35   
gi|301769847|ref|XP_002920342.1| PREDICTED: LOW QUALITY PROTEIN:...   152   4e-35   
gi|413956981|gb|AFW89630.1| 60S ribosomal protein L23 [Zea mays]      151   4e-35   
gi|303390354|ref|XP_003073408.1| 60S ribosomal protein L23 [Ence...   150   8e-35   
gi|357455843|ref|XP_003598202.1| 60S ribosomal protein L23 [Medi...   150   1e-34   
gi|326578091|gb|ADZ95689.1| 60S ribosomal protein L23 [Nosema bo...   148   4e-34   
gi|326578093|gb|ADZ95690.1| 60S ribosomal protein L23 [Nosema bo...   148   5e-34   
gi|167043041|gb|ABZ07753.1| putative ribosomal protein L14p/L23e...   147   8e-34   
gi|432328999|ref|YP_007247143.1| 50S ribosomal protein L14P [Aci...   147   8e-34   
gi|16082262|ref|NP_394717.1| 50S ribosomal protein L14P [Thermop...   147   9e-34   
gi|70930748|ref|XP_737227.1| hypothetical protein [Plasmodium ch...   147   1e-33   
gi|465961792|gb|EMP29483.1| 60S ribosomal protein L23 [Chelonia ...   146   2e-33   
gi|289597183|ref|YP_003483879.1| 50S ribosomal protein L14P [Aci...   146   2e-33   
gi|357488405|ref|XP_003614490.1| 60S ribosomal protein L23 [Medi...   146   2e-33   
gi|48477722|ref|YP_023428.1| 50S ribosomal protein L14 [Picrophi...   145   4e-33   
gi|300707743|ref|XP_002996068.1| 60S ribosomal protein L23 [Nose...   145   4e-33   
gi|330040240|ref|XP_003239814.1| 60S ribosomal protein L23 [Cryp...   145   5e-33   
gi|161899391|ref|XP_001712922.1| ribosomal protein L23 [Bigelowi...   144   6e-33   
gi|167385974|ref|XP_001737561.1| 60S ribosomal protein L23 [Enta...   143   2e-32   
gi|440492139|gb|ELQ74733.1| 60S ribosomal protein L14/L17/L23 [T...   142   2e-32   
gi|226493013|ref|NP_001152709.1| 60S ribosomal protein L23 [Zea ...   142   3e-32   
gi|119630339|gb|EAX09934.1| hCG1780094, isoform CRA_b [Homo sapi...   142   4e-32   
gi|497572990|ref|WP_009887174.1| 50S ribosomal protein L14 [Ferr...   141   5e-32   
gi|312137086|ref|YP_004004423.1| 50S ribosomal protein L14 [Meth...   141   5e-32   
gi|429963911|gb|ELA45909.1| hypothetical protein VCUG_02602 [Vav...   140   8e-32   
gi|490729004|ref|WP_004591402.1| 50S ribosomal protein L14P [Met...   140   8e-32   
gi|13541166|ref|NP_110854.1| 50S ribosomal protein L14P [Thermop...   140   8e-32   
gi|385805554|ref|YP_005841952.1| 50S ribosomal protein L14 [Ferv...   140   8e-32   
gi|20094654|ref|NP_614501.1| 50S ribosomal protein L14 [Methanop...   140   8e-32   
gi|320101356|ref|YP_004176948.1| 50S ribosomal protein L14 [Desu...   140   1e-31   
gi|429962553|gb|ELA42097.1| hypothetical protein VICG_00946 [Vit...   140   1e-31   
gi|347524206|ref|YP_004781776.1| 50S ribosomal protein L14P [Pyr...   139   2e-31   
gi|119580943|gb|EAW60539.1| ribosomal protein L23, isoform CRA_a...   139   2e-31   
gi|296242595|ref|YP_003650082.1| 50S ribosomal protein L14 [Ther...   139   2e-31   
gi|511059294|ref|YP_008071179.1| 50S ribosomal protein L14P [Met...   139   3e-31   
gi|296109310|ref|YP_003616259.1| 50S ribosomal protein L14P [met...   138   5e-31   
gi|218884476|ref|YP_002428858.1| 50S ribosomal protein L14P [Des...   138   6e-31   
gi|384495615|gb|EIE86106.1| 60S ribosomal protein L23 [Rhizopus ...   137   6e-31   
gi|333910783|ref|YP_004484516.1| 50S ribosomal protein L14 [Meth...   137   7e-31   
gi|474934884|ref|YP_007688466.1| LSU ribosomal protein L14P [The...   137   8e-31   
gi|413934080|gb|AFW68631.1| hypothetical protein ZEAMMB73_789582...   137   8e-31   
gi|413939451|gb|AFW74002.1| hypothetical protein ZEAMMB73_103592...   137   8e-31   
gi|390938981|ref|YP_006402719.1| 50S ribosomal protein L14 [Desu...   137   1e-30   
gi|297527397|ref|YP_003669421.1| 50S ribosomal protein L14P [Sta...   136   2e-30   
gi|494103281|ref|WP_007044068.1| 50S ribosomal protein L14 [Meth...   136   2e-30   
gi|478483416|ref|YP_007714066.1| LSU ribosomal protein L23e (L14...   136   2e-30   
gi|124028165|ref|YP_001013485.1| 50S ribosomal protein L14P [Hyp...   136   2e-30   
gi|268323286|emb|CBH36874.1| 50S ribosomal protein L14P [uncultu...   135   4e-30   
gi|126465926|ref|YP_001041035.1| 50S ribosomal protein L14 [Stap...   135   5e-30   
gi|84489697|ref|YP_447929.1| 50S ribosomal protein L14P [Methano...   135   5e-30   
gi|284162450|ref|YP_003401073.1| 50S ribosomal protein L14b/L23e...   135   5e-30   
gi|156938195|ref|YP_001435991.1| 50S ribosomal protein L14 [Igni...   134   6e-30   
gi|304314264|ref|YP_003849411.1| 50S ribosomal protein L14P [Met...   134   9e-30   
gi|495716222|ref|WP_008440801.1| LSU ribosomal protein L14P [Tha...   134   1e-29   
gi|150402578|ref|YP_001329872.1| 50S ribosomal protein L14P [Met...   134   1e-29   
gi|344246768|gb|EGW02872.1| 60S ribosomal protein L23 [Cricetulu...   134   1e-29   
gi|150399471|ref|YP_001323238.1| 50S ribosomal protein L14P [Met...   134   1e-29   
gi|426230783|ref|XP_004009438.1| PREDICTED: 60S ribosomal protei...   133   1e-29   
gi|15678044|ref|NP_275158.1| 50S ribosomal protein L14 [Methanot...   133   1e-29   
gi|325958542|ref|YP_004290008.1| 50S ribosomal protein L14 [Meth...   133   1e-29   
gi|45358972|ref|NP_988529.1| 50S ribosomal protein L14P [Methano...   133   1e-29   
gi|289193202|ref|YP_003459143.1| 50S ribosomal protein L14P [Met...   133   1e-29   
gi|77024949|gb|ABA61376.1| ribosomal protein L14 [uncultured mar...   133   1e-29   
gi|159905647|ref|YP_001549309.1| 50S ribosomal protein L14P [Met...   133   2e-29   
gi|15668643|ref|NP_247441.1| 50S ribosomal protein L14 [Methanoc...   133   2e-29   
gi|490129999|ref|WP_004030389.1| 50S ribosomal protein L14 [Meth...   133   2e-29   
gi|193083745|gb|ACF09432.1| ribosomal protein L14 [uncultured ma...   133   2e-29   
gi|497446488|ref|WP_009760686.1| 50S ribosomal protein L14 [Halo...   133   2e-29   


>gi|301121610|ref|XP_002908532.1| 60S ribosomal protein L23 [Phytophthora infestans T30-4]
 gi|66270163|gb|AAY43411.1| ribosomal protein L23 [Phytophthora infestans]
 gi|262103563|gb|EEY61615.1| 60S ribosomal protein L23 [Phytophthora infestans T30-4]
          Length = 141

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 124/142 (87%), Gaps = 3/142 (2%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           T   RGGA+   GNKFRMT GLPV AVMNCADN+GAKNLYIIAV G   RLNRLP AGVG
Sbjct: 3   TKRGRGGAS---GNKFRMTLGLPVGAVMNCADNSGAKNLYIIAVCGIKGRLNRLPAAGVG 59

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMVLATVKKGKP+LRKKVMPAVV+RQRKSWRR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 60  DMVLATVKKGKPDLRKKVMPAVVIRQRKSWRRKDGVFLYFEDNAGVIVNPKGEMKGSAIT 119

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+GKECADLWPRIAS+AG++V
Sbjct: 120 GPVGKECADLWPRIASNAGSIV 141



>gi|393227063|gb|EJD34760.1| ribosomal protein L14b/L23e [Auricularia delicata TFB-10046 SS5]
          Length = 141

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/140 (77%), Positives = 123/140 (87%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           +KRGG A  +GNK+RMT GLP  AV+NCADN+GAKNLYII   G+G+RLNRLP AGVGDM
Sbjct: 4   AKRGGGA--QGNKYRMTLGLPTGAVLNCADNSGAKNLYIIETFGFGARLNRLPDAGVGDM 61

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+A+VKKGKPELRKK MPAVVVRQRKSWRRRDG  +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 62  VVASVKKGKPELRKKTMPAVVVRQRKSWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGP 121

Query: 127 IGKECADLWPRIASHAGTVV 146
           + KECADLWPRIAS+AGTVV
Sbjct: 122 VAKECADLWPRIASNAGTVV 141



>gi|299115573|emb|CBN75776.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 140

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (87%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  A  +GNK+RMT GLPVAAVMNC DN+GAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRG-RAGAQGNKYRMTLGLPVAAVMNCCDNSGAKNLYIISVCGIKGRLNRLPSAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATV+KGKPELRKKVMPAVVVRQRK+WRR+DG  IYFEDN GVIV+NKGEMKGS + G
Sbjct: 60  MVMATVRKGKPELRKKVMPAVVVRQRKAWRRKDGVFIYFEDNGGVIVNNKGEMKGSAING 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AG++V
Sbjct: 120 PVAKECADLWPRIASNAGSIV 140



>gi|348681444|gb|EGZ21260.1| hypothetical protein PHYSODRAFT_285581 [Phytophthora sojae]
          Length = 141

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 3/142 (2%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           T   RGGA+   GNKFRMT GLPV AVMNCADN+GAKNLYIIAV G   RLNRLP AGVG
Sbjct: 3   TKRGRGGAS---GNKFRMTLGLPVGAVMNCADNSGAKNLYIIAVCGIKGRLNRLPAAGVG 59

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMVLATVKKGKP+LRKKVMPAVV+RQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 60  DMVLATVKKGKPDLRKKVMPAVVIRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAIT 119

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+GKECADLWPRIAS+AG++V
Sbjct: 120 GPVGKECADLWPRIASNAGSIV 141



>gi|157690684|tpe|CAL69069.1| TPA: putative 60S ribosomal protein L23 [Spadella cephaloptera]
          Length = 140

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++  LPVAAVMNCADNTGAKNLYII+V+G+GSRLNRLP A VGD
Sbjct: 1   MSKRG-RGGTSGGKFRISLALPVAAVMNCADNTGAKNLYIISVAGFGSRLNRLPAAAVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVTLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|336366466|gb|EGN94813.1| hypothetical protein SERLA73DRAFT_187875 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336379156|gb|EGO20312.1| hypothetical protein SERLADRAFT_477753 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 140

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/140 (77%), Positives = 124/140 (88%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           ++RGG AS  GNKFRMT GLPV AV+NCADN+GAK+LYII   G+G+RLNRLP AGVGDM
Sbjct: 3   TQRGGGAS--GNKFRMTLGLPVGAVLNCADNSGAKSLYIIEPYGFGARLNRLPDAGVGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+A+VKKGKPELRKK MPAVVVRQRKSWRRRDG  +YF+DNAGVIV+ KGEMKGS + GP
Sbjct: 61  VVASVKKGKPELRKKTMPAVVVRQRKSWRRRDGVFLYFQDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           + KECADLWPRIAS+AGTVV
Sbjct: 121 VAKECADLWPRIASNAGTVV 140



>gi|507114980|emb|CDF38487.1| unnamed protein product [Chondrus crispus]
          Length = 140

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 125/142 (88%), Gaps = 3/142 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  G+KFR++ GLPVAAVMNCADNTGAKNLYII+V+    RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GSKFRVSLGLPVAAVMNCADNTGAKNLYIISVTKIKGRLNRLPAAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMVLATVKKGKPELRKKV PAVV+RQRKSWRR+DGT +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVLATVKKGKPELRKKVAPAVVIRQRKSWRRKDGTFLYFEDNAGVIVNIKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+ KECADLWPRIAS AGT+V
Sbjct: 119 GPVAKECADLWPRIASAAGTIV 140



>gi|469664433|gb|AGH70171.1| 60S ribosomal protein L23 [Placozoa sp. H4]
          Length = 140

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G+KFR++ GLPV AVMNCADNTGAKNLYII+V G   RLNR+P AG+GD
Sbjct: 1   MSKRGRGGSS-GSKFRISLGLPVGAVMNCADNTGAKNLYIISVKGIKGRLNRMPSAGIGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           +VLATVKKGKPELRKKVMPAVVVRQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  LVLATVKKGKPELRKKVMPAVVVRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|395331586|gb|EJF63967.1| 60S ribosomal protein L17/L23 [Dichomitus squalens LYAD-421 SS1]
          Length = 139

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  AS  GNKFRMT GLP  AV+NCADN+GAK+L++I   G GS LNRLP AGVGD
Sbjct: 1   MSKRGAGAS--GNKFRMTLGLPTGAVLNCADNSGAKSLFVIEAFGTGSHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVVASVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|325186350|emb|CCA20856.1| 60S ribosomal protein L23 putative [Albugo laibachii Nc14]
          Length = 141

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 120/141 (85%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS + G     GNK RM  GLPVAAV NCADN+GA+NLYIIAV G   RLNRLP AGVGD
Sbjct: 1   MSSKRGRGGASGNKLRMALGLPVAAVANCADNSGARNLYIIAVCGIKGRLNRLPAAGVGD 60

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKP+LRKKVMPAV++RQRKSWRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 61  MVLATVKKGKPDLRKKVMPAVIIRQRKSWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 120

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKECADLWPRIAS+AG++V
Sbjct: 121 PVGKECADLWPRIASNAGSIV 141



>gi|213403163|ref|XP_002172354.1| 60S ribosomal protein L23 [Schizosaccharomyces japonicus yFS275]
 gi|213407172|ref|XP_002174357.1| 60S ribosomal protein L23 [Schizosaccharomyces japonicus yFS275]
 gi|212000401|gb|EEB06061.1| 60S ribosomal protein L23 [Schizosaccharomyces japonicus yFS275]
 gi|212002404|gb|EEB08064.1| 60S ribosomal protein L23 [Schizosaccharomyces japonicus yFS275]
          Length = 139

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (87%)

Query: 10  GGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLA 69
           GG A+  G KFRMT GLPV A+MNCADN+GAKNLYI++V G G+RLNRLP A  GDMVLA
Sbjct: 3   GGRAAASGTKFRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAAACGDMVLA 62

Query: 70  TVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGK 129
           TVKKGKP+LRKK+MPA++VRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ K
Sbjct: 63  TVKKGKPDLRKKIMPAIIVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAK 122

Query: 130 ECADLWPRIASHAGTVV 146
           ECADLWPRIAS+AGTVV
Sbjct: 123 ECADLWPRIASNAGTVV 139



>gi|392562665|gb|EIW55845.1| 60S ribosomal protein L17/L23 [Trametes versicolor FP-101664 SS1]
          Length = 139

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  AS  GNKFRMT GLP  AV+NCADN+GAK+L++I   G GS LNRLP AGVGD
Sbjct: 1   MSKRGAGAS--GNKFRMTMGLPTGAVLNCADNSGAKSLFVIEAYGTGSHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVVASVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|384253137|gb|EIE26612.1| ribosomal protein L14b/L23e [Coccomyxa subellipsoidea C-169]
          Length = 141

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 120/138 (86%), Gaps = 3/138 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGAA   GNKFRM+ GLPV A++NCADNTGAKNLY+I+V GWG+RLNRLP A  GDMV+
Sbjct: 7   RGGAA---GNKFRMSLGLPVGAILNCADNTGAKNLYVISVVGWGARLNRLPSAACGDMVM 63

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKP+LRKKVMPAVVVRQRK WRR+DG  IYFEDNAGVIV+ KGEMKGS + GP+ 
Sbjct: 64  ATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFIYFEDNAGVIVNPKGEMKGSAITGPVA 123

Query: 129 KECADLWPRIASHAGTVV 146
           KECADLWPRIAS A ++V
Sbjct: 124 KECADLWPRIASAANSIV 141



>gi|470620201|ref|XP_004318392.1| PREDICTED: 60S ribosomal protein L23 [Tursiops truncatus]
          Length = 166

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 109/148 (73%), Positives = 125/148 (84%), Gaps = 4/148 (2%)

Query: 1   FCHNT---MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNR 57
           FCH     MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNR
Sbjct: 19  FCHFPAFKMSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNR 77

Query: 58  LPKAGVGDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGE 117
           LP AGVGDMV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGE
Sbjct: 78  LPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGE 137

Query: 118 MKGSQVAGPIGKECADLWPRIASHAGTV 145
           MKGS + GP+ KECADLWPRIAS+AG++
Sbjct: 138 MKGSAITGPVAKECADLWPRIASNAGSI 165



>gi|466072648|ref|XP_004282758.1| PREDICTED: 60S ribosomal protein L23 [Orcinus orca]
          Length = 166

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 109/148 (73%), Positives = 125/148 (84%), Gaps = 4/148 (2%)

Query: 1   FCHNT---MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNR 57
           FCH     MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNR
Sbjct: 19  FCHFPAFKMSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNR 77

Query: 58  LPKAGVGDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGE 117
           LP AGVGDMV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGE
Sbjct: 78  LPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGE 137

Query: 118 MKGSQVAGPIGKECADLWPRIASHAGTV 145
           MKGS + GP+ KECADLWPRIAS+AG++
Sbjct: 138 MKGSAITGPVAKECADLWPRIASNAGSI 165



>gi|238604917|ref|XP_002396325.1| hypothetical protein MPER_03468 [Moniliophthora perniciosa FA553]
 gi|215468664|gb|EEB97255.1| hypothetical protein MPER_03468 [Moniliophthora perniciosa FA553]
          Length = 138

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 123/141 (87%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSK G +A   GNKFR+T GLPV AV+NCADN+GAK+LYII   G+G+RLNRLP AGVGD
Sbjct: 1   MSKPGVSA---GNKFRLTLGLPVGAVLNCADNSGAKSLYIIEPFGFGARLNRLPDAGVGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVVASVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|449545650|gb|EMD36621.1| hypothetical protein CERSUDRAFT_115659 [Ceriporiopsis subvermispora
           B]
          Length = 139

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  AS  GNKFR+T GLP  AV+NCADN+GAK+LY+I   G GS LNRLP AGVGD
Sbjct: 1   MSKRGSGAS--GNKFRLTLGLPTGAVLNCADNSGAKSLYVIEAFGTGSHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MP VVVRQRK+WRRR+G V+YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVVASVKKGKPELRKKTMPVVVVRQRKAWRRREGLVLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|406698144|gb|EKD01386.1| 60s ribosomal protein l23 [Trichosporon asahii var. asahii CBS
           8904]
          Length = 256

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%)

Query: 12  AASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATV 71
           AA+  G KFRM+ GLPV AVMNCADN+GAKNLY+I+V G+G+RLNRLP A  GDMV+A+V
Sbjct: 122 AAAATGTKFRMSLGLPVGAVMNCADNSGAKNLYVISVVGFGARLNRLPAAAAGDMVMASV 181

Query: 72  KKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKEC 131
           KKGKPELRKKVMPAV+ RQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KEC
Sbjct: 182 KKGKPELRKKVMPAVICRQRKPWRRRDGVFLYFEDNAGVIVNAKGEMKGSAINGPVAKEC 241

Query: 132 ADLWPRIASHAGTVV 146
           ADLWPRIAS+AGTVV
Sbjct: 242 ADLWPRIASNAGTVV 256



>gi|290997802|ref|XP_002681470.1| 60S ribosomal protein L23 [Naegleria gruberi]
 gi|284095094|gb|EFC48726.1| 60S ribosomal protein L23 [Naegleria gruberi]
          Length = 140

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/130 (80%), Positives = 115/130 (88%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFR++  LP AAVMNCADN+GAKNLY+IAV+    RLNRLP AGVGDMV+ATVKKGKP
Sbjct: 11  GNKFRISTALPTAAVMNCADNSGAKNLYVIAVNQTQGRLNRLPAAGVGDMVMATVKKGKP 70

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPAVV+RQRK WRRRDGT IYFEDNAGVIV+NKGEMKGS VAGP+ KECAD+WP
Sbjct: 71  ELRKKVMPAVVIRQRKPWRRRDGTFIYFEDNAGVIVNNKGEMKGSAVAGPVAKECADMWP 130

Query: 137 RIASHAGTVV 146
           RIAS A  VV
Sbjct: 131 RIASSASCVV 140



>gi|401883404|gb|EJT47613.1| 60s ribosomal protein l23 [Trichosporon asahii var. asahii CBS
           2479]
          Length = 139

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%)

Query: 12  AASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATV 71
           AA+  G KFRM+ GLPV AVMNCADN+GAKNLY+I+V G+G+RLNRLP A  GDMV+A+V
Sbjct: 5   AAAATGTKFRMSLGLPVGAVMNCADNSGAKNLYVISVVGFGARLNRLPAAAAGDMVMASV 64

Query: 72  KKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKEC 131
           KKGKPELRKKVMPAV+ RQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KEC
Sbjct: 65  KKGKPELRKKVMPAVICRQRKPWRRRDGVFLYFEDNAGVIVNAKGEMKGSAINGPVAKEC 124

Query: 132 ADLWPRIASHAGTVV 146
           ADLWPRIAS+AGTVV
Sbjct: 125 ADLWPRIASNAGTVV 139



>gi|19075639|ref|NP_588139.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe 972h-]
 gi|19114987|ref|NP_594075.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe 972h-]
 gi|6094037|sp|O42867.1|RL23_SCHPO RecName: Full=60S ribosomal protein L23
 gi|2706454|emb|CAA15912.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe]
 gi|4176551|emb|CAA22864.1| 60S ribosomal protein L23 [Schizosaccharomyces pombe]
          Length = 139

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS+  GAAS  G K+RMT GLPV A+MNCADN+GAKNLYI++V G G+RLNRLP A  GD
Sbjct: 1   MSRGRGAAS--GTKYRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAASCGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKP+LRKK+MPA+VVRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVLATVKKGKPDLRKKIMPAIVVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|307110263|gb|EFN58499.1| hypothetical protein CHLNCDRAFT_59578 [Chlorella variabilis]
          Length = 140

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 117/130 (90%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRMT GLPVAA MNCADN+GAKNLY+I+V GWGSRLNRLP A  GDMV+ATVKKGKP
Sbjct: 11  GNKFRMTLGLPVAATMNCADNSGAKNLYVISVHGWGSRLNRLPAAAPGDMVMATVKKGKP 70

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           +LRKKVMPA+VVRQRK++RR+DGT IYFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 71  DLRKKVMPAIVVRQRKAFRRKDGTFIYFEDNAGVIVNTKGEMKGSAITGPVCKECADLWP 130

Query: 137 RIASHAGTVV 146
           R+A+ A T+V
Sbjct: 131 RVAAAANTIV 140



>gi|41282078|ref|NP_957026.1| 60S ribosomal protein L23 [Danio rerio]
 gi|410901665|ref|XP_003964316.1| PREDICTED: 60S ribosomal protein L23-like [Takifugu rubripes]
 gi|51316654|sp|Q6PC14.1|RL23_DANRE RecName: Full=60S ribosomal protein L23
 gi|37747951|gb|AAH59509.1| Zgc:73149 [Danio rerio]
 gi|47216271|emb|CAG05967.1| unnamed protein product [Tetraodon nigroviridis]
 gi|51038319|gb|AAT94068.1| ribosomal protein L23 [Sparus aurata]
 gi|211827611|gb|AAH49038.2| Zgc:73149 [Danio rerio]
          Length = 140

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|482567419|gb|EOA31608.1| hypothetical protein CARUB_v10014805mg, partial [Capsella rubella]
          Length = 161

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 120/142 (84%), Gaps = 1/142 (0%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           TMSKRG    T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VG
Sbjct: 21  TMSKRG-RGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVG 79

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 80  DMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT 139

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GPIGKECADLWPRIAS A  +V
Sbjct: 140 GPIGKECADLWPRIASAANAIV 161



>gi|4583511|gb|AAD25102.1| ribosomal protein L17 [Dicentrarchus labrax]
          Length = 140

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV A +NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAAINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIVSNKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVSNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|4506605|ref|NP_000969.1| 60S ribosomal protein L23 [Homo sapiens]
 gi|12584986|ref|NP_075029.1| 60S ribosomal protein L23 [Mus musculus]
 gi|56090279|ref|NP_001007600.1| 60S ribosomal protein L23 [Rattus norvegicus]
 gi|58332166|ref|NP_001011231.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 gi|194018720|ref|NP_001123427.1| 60S ribosomal protein L23 [Sus scrofa]
 gi|318760126|ref|NP_001187049.1| 60S ribosomal protein L23 [Ictalurus punctatus]
 gi|388490440|ref|NP_001253138.1| 60S ribosomal protein L23 [Macaca mulatta]
 gi|114667757|ref|XP_511444.2| PREDICTED: uncharacterized protein LOC454619 isoform 6 [Pan
           troglodytes]
 gi|126308182|ref|XP_001366590.1| PREDICTED: 60S ribosomal protein L23-like [Monodelphis domestica]
 gi|291405927|ref|XP_002719380.1| PREDICTED: ribosomal protein L17 [Oryctolagus cuniculus]
 gi|296202685|ref|XP_002748553.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Callithrix
           jacchus]
 gi|301762866|ref|XP_002916851.1| PREDICTED: 60S ribosomal protein L23-like [Ailuropoda melanoleuca]
 gi|327275650|ref|XP_003222586.1| PREDICTED: 60S ribosomal protein L23-like [Anolis carolinensis]
 gi|332258346|ref|XP_003278259.1| PREDICTED: 60S ribosomal protein L23 isoform 1 [Nomascus
           leucogenys]
 gi|332258358|ref|XP_003278265.1| PREDICTED: 60S ribosomal protein L23 isoform 7 [Nomascus
           leucogenys]
 gi|332847894|ref|XP_003315548.1| PREDICTED: uncharacterized protein LOC454619 [Pan troglodytes]
 gi|332847896|ref|XP_003315549.1| PREDICTED: uncharacterized protein LOC454619 [Pan troglodytes]
 gi|338710897|ref|XP_003362441.1| PREDICTED: 60S ribosomal protein L23-like [Equus caballus]
 gi|344285963|ref|XP_003414729.1| PREDICTED: 60S ribosomal protein L23-like [Loxodonta africana]
 gi|345319092|ref|XP_001509789.2| PREDICTED: 60S ribosomal protein L23-like [Ornithorhynchus
           anatinus]
 gi|348517843|ref|XP_003446442.1| PREDICTED: 60S ribosomal protein L23-like [Oreochromis niloticus]
 gi|348562313|ref|XP_003466955.1| PREDICTED: 60S ribosomal protein L23-like [Cavia porcellus]
 gi|354474813|ref|XP_003499624.1| PREDICTED: 60S ribosomal protein L23-like [Cricetulus griseus]
 gi|363743473|ref|XP_418122.3| PREDICTED: 60S ribosomal protein L23 isoformX2 [Gallus gallus]
 gi|377837128|ref|XP_003688806.1| PREDICTED: 60S ribosomal protein L23-like [Mus musculus]
 gi|377837258|ref|XP_003689266.1| PREDICTED: 60S ribosomal protein L23-like [Mus musculus]
 gi|395532530|ref|XP_003768323.1| PREDICTED: 60S ribosomal protein L23 [Sarcophilus harrisii]
 gi|395826550|ref|XP_003786480.1| PREDICTED: 60S ribosomal protein L23 [Otolemur garnettii]
 gi|397477028|ref|XP_003809888.1| PREDICTED: 60S ribosomal protein L23 [Pan paniscus]
 gi|402855371|ref|XP_003892299.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Papio anubis]
 gi|402855373|ref|XP_003892300.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Papio anubis]
 gi|402855375|ref|XP_003892301.1| PREDICTED: 60S ribosomal protein L23-like isoform 3 [Papio anubis]
 gi|402855377|ref|XP_003892302.1| PREDICTED: 60S ribosomal protein L23-like isoform 4 [Papio anubis]
 gi|402899985|ref|XP_003912963.1| PREDICTED: 60S ribosomal protein L23 [Papio anubis]
 gi|410980905|ref|XP_003996814.1| PREDICTED: 60S ribosomal protein L23 [Felis catus]
 gi|426237863|ref|XP_004012877.1| PREDICTED: 60S ribosomal protein L23 [Ovis aries]
 gi|426348537|ref|XP_004041890.1| PREDICTED: 60S ribosomal protein L23 [Gorilla gorilla gorilla]
 gi|432960814|ref|XP_004086478.1| PREDICTED: 60S ribosomal protein L23-like [Oryzias latipes]
 gi|471380551|ref|XP_004378071.1| PREDICTED: 60S ribosomal protein L23 [Trichechus manatus
           latirostris]
 gi|472350883|ref|XP_004395126.1| PREDICTED: 60S ribosomal protein L23 [Odobenus rosmarus divergens]
 gi|478520865|ref|XP_004434646.1| PREDICTED: 60S ribosomal protein L23 [Ceratotherium simum simum]
 gi|488526322|ref|XP_004454995.1| PREDICTED: 60S ribosomal protein L23 isoform 2 [Dasypus
           novemcinctus]
 gi|499035979|ref|XP_004568658.1| PREDICTED: 60S ribosomal protein L23-like isoform X2 [Maylandia
           zebra]
 gi|504159898|ref|XP_004591186.1| PREDICTED: 60S ribosomal protein L23 [Ochotona princeps]
 gi|505802875|ref|XP_004608777.1| PREDICTED: 60S ribosomal protein L23 [Sorex araneus]
 gi|507543109|ref|XP_004655546.1| PREDICTED: 60S ribosomal protein L23 [Jaculus jaculus]
 gi|507664755|ref|XP_004707161.1| PREDICTED: 60S ribosomal protein L23 [Echinops telfairi]
 gi|507952684|ref|XP_004684321.1| PREDICTED: 60S ribosomal protein L23 [Condylura cristata]
 gi|511890070|ref|XP_004764745.1| PREDICTED: 60S ribosomal protein L23 [Mustela putorius furo]
 gi|511961737|ref|XP_004799058.1| PREDICTED: 60S ribosomal protein L23 [Mustela putorius furo]
 gi|512881233|ref|XP_004895166.1| PREDICTED: 60S ribosomal protein L23 [Heterocephalus glaber]
 gi|512995994|ref|XP_004859587.1| PREDICTED: 60S ribosomal protein L23 [Heterocephalus glaber]
 gi|46577102|sp|Q90YU5.2|RL23_ICTPU RecName: Full=60S ribosomal protein L23
 gi|51338616|sp|P62831.1|RL23_PIG RecName: Full=60S ribosomal protein L23; AltName: Full=Ribosomal
           protein L17
 gi|51338617|sp|P62832.1|RL23_RAT RecName: Full=60S ribosomal protein L23
 gi|51338639|sp|P62829.1|RL23_HUMAN RecName: Full=60S ribosomal protein L23; AltName: Full=60S
           ribosomal protein L17
 gi|51338640|sp|P62830.1|RL23_MOUSE RecName: Full=60S ribosomal protein L23
 gi|190356062|sp|Q3T057.2|RL23_BOVIN RecName: Full=60S ribosomal protein L23
 gi|187609309|pdb|2ZKR|KK Chain k, Structure Of A Mammalian Ribosomal 60s Subunit Within An
           80s Complex Obtained By Docking Homology Models Of The
           Rna And Proteins Into An 8.7 A Cryo-Em Map
 gi|485601426|pdb|3J3B|V Chain V, Structure Of The Human 60s Ribosomal Proteins
 gi|5354205|gb|AAD42413.1|AF158022_1 ribosomal protein L23 [Mus musculus]
 gi|9502282|gb|AAF88071.1|AF287271_1 ribosomal protein L23 [Mus musculus]
 gi|24762286|gb|AAK95149.2|AF401577_1 ribosomal protein L23 [Ictalurus punctatus]
 gi|34194|emb|CAA39417.1| HL23 ribosomal protein [Homo sapiens]
 gi|36126|emb|CAA37023.1| ribosomal protein L17 [Homo sapiens]
 gi|57688|emb|CAA41177.1| ribosomal protein L23 [Rattus rattus]
 gi|12846298|dbj|BAB27112.1| unnamed protein product [Mus musculus]
 gi|12858591|dbj|BAB31373.1| unnamed protein product [Mus musculus]
 gi|14603313|gb|AAH10114.1| Ribosomal protein L23 [Homo sapiens]
 gi|17932948|dbj|BAB79465.1| ribosomal protein L23 [Homo sapiens]
 gi|19484155|gb|AAH25918.1| Ribosomal protein L23 [Mus musculus]
 gi|37231757|gb|AAH58500.1| Ribosomal protein L23 [Rattus norvegicus]
 gi|51980397|gb|AAH81448.1| Ribosomal protein L23 [Mus musculus]
 gi|56611168|gb|AAH87796.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 gi|74177908|dbj|BAE29753.1| unnamed protein product [Mus musculus]
 gi|74207716|dbj|BAE40102.1| unnamed protein product [Mus musculus]
 gi|74356227|gb|AAI04652.1| Ribosomal protein L23 [Homo sapiens]
 gi|76780073|gb|AAI06062.1| RPL23 protein [Homo sapiens]
 gi|89268196|emb|CAJ82654.1| ribosomal protein L23 [Xenopus (Silurana) tropicalis]
 gi|117661026|gb|ABK55650.1| RPL23 [Sus scrofa]
 gi|119580944|gb|EAW60540.1| ribosomal protein L23, isoform CRA_b [Homo sapiens]
 gi|119580945|gb|EAW60541.1| ribosomal protein L23, isoform CRA_b [Homo sapiens]
 gi|123993085|gb|ABM84144.1| ribosomal protein L23 [synthetic construct]
 gi|124000075|gb|ABM87546.1| ribosomal protein L23 [synthetic construct]
 gi|148684153|gb|EDL16100.1| ribosomal protein L23, isoform CRA_b [Mus musculus]
 gi|149054067|gb|EDM05884.1| rCG34264, isoform CRA_b [Rattus norvegicus]
 gi|151556408|gb|AAI48015.1| Ribosomal protein L23 [Bos taurus]
 gi|164690981|dbj|BAF98673.1| ribosomal protein L23 [Solea senegalensis]
 gi|206558008|gb|ACI12870.1| ribosomal protein L23 [Gillichthys mirabilis]
 gi|261860426|dbj|BAI46735.1| ribosomal protein L23 [synthetic construct]
 gi|296476465|tpg|DAA18580.1| TPA: 60S ribosomal protein L23 [Bos taurus]
 gi|327239298|gb|AEA39516.1| ribosomal protein L23 [Ailuropoda melanoleuca]
 gi|327239400|gb|AEA39567.1| ribosomal protein L23 [Ailuropoda melanoleuca]
 gi|344249178|gb|EGW05282.1| 60S ribosomal protein L23 [Cricetulus griseus]
 gi|351706759|gb|EHB09678.1| 60S ribosomal protein L23 [Heterocephalus glaber]
 gi|444713983|gb|ELW54871.1| 60S ribosomal protein L23 [Tupaia chinensis]
 gi|465974411|gb|EMP33812.1| 60S ribosomal protein L23 [Chelonia mydas]
          Length = 140

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|260794408|ref|XP_002592201.1| hypothetical protein BRAFLDRAFT_123946 [Branchiostoma floridae]
 gi|30144650|gb|AAP14949.1| ribosomal protein L23 [Branchiostoma belcheri tsingtauense]
 gi|229277416|gb|EEN48212.1| hypothetical protein BRAFLDRAFT_123946 [Branchiostoma floridae]
          Length = 140

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 3/141 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  G KFR++ GLPV AV+NCADNTGAKNLYIIAV G   RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GAKFRISLGLPVGAVINCADNTGAKNLYIIAVKGIKGRLNRLPAAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKPELRKKVMPAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPELRKKVMPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KECADLWPRIAS+AG++
Sbjct: 119 GPVAKECADLWPRIASNAGSI 139



>gi|38571606|gb|AAH62716.1| Ribosomal protein L23 [Homo sapiens]
          Length = 140

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVRPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|328768212|gb|EGF78259.1| hypothetical protein BATDEDRAFT_26800 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 140

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 120/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS RG + ST G K RMT  LPV AV+NCADN+GAKNLYIIAV G   RLNRLP AGVGD
Sbjct: 1   MSTRGRSGST-GTKLRMTLALPVGAVINCADNSGAKNLYIIAVKGIKGRLNRLPSAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKP+LRKKV PAVV+RQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVLATVKKGKPDLRKKVHPAVVIRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKECAD+WP+IAS AGTVV
Sbjct: 120 PVGKECADIWPKIASSAGTVV 140



>gi|431890704|gb|ELK01583.1| F-box only protein 47 [Pteropus alecto]
          Length = 467

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 3/143 (2%)

Query: 3   HNTMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAG 62
            + MS RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AG
Sbjct: 327 QSIMSGRGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAG 383

Query: 63  VGDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQ 122
           VGDMV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS 
Sbjct: 384 VGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSA 443

Query: 123 VAGPIGKECADLWPRIASHAGTV 145
           + GP+ KECADLWPRIAS+AG++
Sbjct: 444 ITGPVAKECADLWPRIASNAGSI 466



>gi|242212506|ref|XP_002472086.1| 60S ribosomal protein L17/L23 [Postia placenta Mad-698-R]
 gi|242217950|ref|XP_002474770.1| 60S ribosomal protein L17/L23 [Postia placenta Mad-698-R]
 gi|220726076|gb|EED80038.1| 60S ribosomal protein L17/L23 [Postia placenta Mad-698-R]
 gi|220728816|gb|EED82702.1| 60S ribosomal protein L17/L23 [Postia placenta Mad-698-R]
          Length = 139

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  AS  GNKFR+T GLP  AV+NCADN+GAK+L++I   G GS LNRLP AGVGD
Sbjct: 1   MSKRGSGAS--GNKFRLTLGLPTGAVLNCADNSGAKSLFVIEAFGTGSHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MP VVVRQRK+WRRR+G V+YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVVASVKKGKPELRKKTMPVVVVRQRKAWRRREGLVLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|389742735|gb|EIM83921.1| ribosomal protein L14b/L23e [Stereum hirsutum FP-91666 SS1]
          Length = 140

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           ++RGG AS  GNKFR+T GLP  AV+NCADN+GAK+L+II   G+GS LNRLP AGVGDM
Sbjct: 3   AQRGGGAS--GNKFRLTLGLPTGAVLNCADNSGAKSLFIIEPFGFGSHLNRLPDAGVGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+A+VKKGKPELRKK MPA+V+RQRKSWRR+DG  +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VVASVKKGKPELRKKTMPAIVIRQRKSWRRKDGLFLYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           + KECADLWPRIAS+AGTVV
Sbjct: 121 VAKECADLWPRIASNAGTVV 140



>gi|388581556|gb|EIM21864.1| ribosomal protein L14b/L23e [Wallemia sebi CBS 633.66]
          Length = 137

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 102/133 (76%), Positives = 115/133 (86%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
             +GNKFRMT GLP  AV+NCADN+GAKNLY+++V G G+RLNRLP A  GDMV+ATVKK
Sbjct: 5   QNQGNKFRMTLGLPTGAVLNCADNSGAKNLYVVSVIGTGARLNRLPAASAGDMVMATVKK 64

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKVMPAVVVRQRK WRRRDG  +YFEDNAGVI + KGEMKGS + GP+ KECAD
Sbjct: 65  GKPELRKKVMPAVVVRQRKPWRRRDGVFLYFEDNAGVITNPKGEMKGSAITGPVAKECAD 124

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS+AGTVV
Sbjct: 125 LWPRIASNAGTVV 137



>gi|470430884|ref|XP_004338344.1| 60S ribosomal protein L23, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440795195|gb|ELR16331.1| 60S ribosomal protein L23, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 140

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           M KRG  A+T G KFR+T GLPV AV+NCADNTGAKNLY+I+V G G+RLNRLP A  GD
Sbjct: 1   MPKRGAGATT-GAKFRITLGLPVGAVVNCADNTGAKNLYVISVKGIGARLNRLPAAASGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAV++RQRK +RR+DG  IYFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVTPAVIIRQRKPFRRQDGVFIYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS AGTVV
Sbjct: 120 PVAKECADLWPRIASSAGTVV 140



>gi|17647883|ref|NP_523813.1| ribosomal protein L23 [Drosophila melanogaster]
 gi|125811487|ref|XP_001361886.1| GA17595 [Drosophila pseudoobscura pseudoobscura]
 gi|194757096|ref|XP_001960801.1| GF13548 [Drosophila ananassae]
 gi|194884631|ref|XP_001976307.1| GG22807 [Drosophila erecta]
 gi|195028698|ref|XP_001987213.1| GH21796 [Drosophila grimshawi]
 gi|195122160|ref|XP_002005580.1| GI20545 [Drosophila mojavensis]
 gi|195170286|ref|XP_002025944.1| GL10129 [Drosophila persimilis]
 gi|195346883|ref|XP_002039984.1| GM15964 [Drosophila sechellia]
 gi|195384353|ref|XP_002050882.1| GJ22396 [Drosophila virilis]
 gi|195426403|ref|XP_002061324.1| GK20786 [Drosophila willistoni]
 gi|195488916|ref|XP_002092516.1| RpL23 [Drosophila yakuba]
 gi|195585839|ref|XP_002082686.1| GD11716 [Drosophila simulans]
 gi|56405342|sp|P48159.2|RL23_DROME RecName: Full=60S ribosomal protein L23; AltName: Full=L17A
 gi|485601346|pdb|3J39|V Chain V, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gi|7291488|gb|AAF46914.1| ribosomal protein L23 [Drosophila melanogaster]
 gi|54637062|gb|EAL26465.1| GA17595 [Drosophila pseudoobscura pseudoobscura]
 gi|190622099|gb|EDV37623.1| GF13548 [Drosophila ananassae]
 gi|190659494|gb|EDV56707.1| GG22807 [Drosophila erecta]
 gi|193903213|gb|EDW02080.1| GH21796 [Drosophila grimshawi]
 gi|193910648|gb|EDW09515.1| GI20545 [Drosophila mojavensis]
 gi|194110808|gb|EDW32851.1| GL10129 [Drosophila persimilis]
 gi|194135333|gb|EDW56849.1| GM15964 [Drosophila sechellia]
 gi|194145679|gb|EDW62075.1| GJ22396 [Drosophila virilis]
 gi|194157409|gb|EDW72310.1| GK20786 [Drosophila willistoni]
 gi|194178617|gb|EDW92228.1| RpL23 [Drosophila yakuba]
 gi|194194695|gb|EDX08271.1| GD11716 [Drosophila simulans]
 gi|218505921|gb|ACK77617.1| GM15762p [Drosophila melanogaster]
          Length = 140

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRG-RGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|70909731|emb|CAJ17291.1| ribosomal protein L23e [Sphaerius sp. APV-2005]
          Length = 140

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G G RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GXKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|264667415|gb|ACY71293.1| ribosomal protein L23 [Chrysomela tremula]
          Length = 140

 Score =  218 bits (556), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++  LPV AVMNCADNTGAKNLY+IAV G G RLNRLP A  GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLALPVGAVMNCADNTGAKNLYVIAVQGIGGRLNRLPAAAAGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS AG++
Sbjct: 120 PVAKECADLWPRIASTAGSI 139



>gi|10121725|gb|AAG13342.1|AF266222_1 ribosomal protein L23 [Gillichthys mirabilis]
          Length = 140

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVYPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ K+CADLWPRIAS+AG++
Sbjct: 120 PVAKDCADLWPRIASNAGSI 139



>gi|157108448|ref|XP_001650232.1| 60S ribosomal protein L23 [Aedes aegypti]
 gi|157134449|ref|XP_001663308.1| 60S ribosomal protein L23 [Aedes aegypti]
 gi|157136559|ref|XP_001663765.1| 60S ribosomal protein L23 [Aedes aegypti]
 gi|158299333|ref|XP_319443.3| AGAP010252-PA [Anopheles gambiae str. PEST]
 gi|170050526|ref|XP_001861351.1| RL23 [Culex quinquefasciatus]
 gi|29839631|sp|Q9GNE2.1|RL23_AEDAE RecName: Full=60S ribosomal protein L23; AltName: Full=AeRpL17A;
           AltName: Full=L17A
 gi|11276033|gb|AAG33863.1|AF315596_1 ribosomal protein L17A [Aedes aegypti]
 gi|11276035|gb|AAG33864.1|AF315597_1 ribosomal protein L17A [Aedes aegypti]
 gi|15281833|gb|AAK94453.1|AF399675_1 ribosomal protein L17A [Aedes aegypti]
 gi|19335706|gb|AAL85622.1| ribosomal protein L17A [Aedes aegypti]
 gi|108868542|gb|EAT32767.1| AAEL015006-PA [Aedes aegypti]
 gi|108869919|gb|EAT34144.1| AAEL013583-PA [Aedes aegypti]
 gi|108870472|gb|EAT34697.1| AAEL013097-PA [Aedes aegypti]
 gi|122937757|gb|ABM68599.1| RL23 [Aedes aegypti]
 gi|157014314|gb|EAA13962.4| AGAP010252-PA [Anopheles gambiae str. PEST]
 gi|167872146|gb|EDS35529.1| RL23 [Culex quinquefasciatus]
          Length = 140

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSA-GGKFRISLGLPVGAVINCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|168004133|ref|XP_001754766.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|168025241|ref|XP_001765143.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|168033856|ref|XP_001769430.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|168057012|ref|XP_001780511.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668097|gb|EDQ54712.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679350|gb|EDQ65799.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683730|gb|EDQ70138.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693870|gb|EDQ80220.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 140

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 120/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ GNKFRM+ GLPV AV+NCADNTGAKNLY+I+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSS-GNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|91085777|ref|XP_974360.1| PREDICTED: similar to ribosomal protein L23e [Tribolium castaneum]
 gi|270010126|gb|EFA06574.1| hypothetical protein TcasGA2_TC009485 [Tribolium castaneum]
          Length = 140

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G G RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|730536|sp|Q07760.1|RL23_TOBAC RecName: Full=60S ribosomal protein L23
 gi|310933|gb|AAA34113.1| 60S ribosomal protein subunit L17 [Nicotiana tabacum]
          Length = 140

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAVVVRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|345565658|gb|EGX48607.1| hypothetical protein AOL_s00080g236 [Arthrobotrys oligospora ATCC
           24927]
          Length = 140

 Score =  218 bits (555), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 122/140 (87%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           +KRG  A+  GNK +MT GLPV AVMNCADN+GA+NLYIIAV+G G+RLNRLP AGVGDM
Sbjct: 3   AKRGKGAA--GNKLKMTLGLPVGAVMNCADNSGARNLYIIAVAGAGARLNRLPAAGVGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+ATVKKGKPELRKKVMPAVVVRQ K WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VMATVKKGKPELRKKVMPAVVVRQSKPWRRQDGVYLYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           +GKE ADLWPRIAS++G V+
Sbjct: 121 VGKEAADLWPRIASNSGVVM 140



>gi|197099010|ref|NP_001124779.1| 60S ribosomal protein L23 [Pongo abelii]
 gi|62900930|sp|Q5REU2.1|RL23_PONAB RecName: Full=60S ribosomal protein L23
 gi|55725871|emb|CAH89715.1| hypothetical protein [Pongo abelii]
          Length = 140

 Score =  218 bits (555), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   +LNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGQLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|32400871|gb|AAP80667.1|AF479048_1 ribosomal Pr 117, partial [Triticum aestivum]
          Length = 147

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 120/142 (84%), Gaps = 1/142 (0%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           +MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VG
Sbjct: 7   SMSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVG 65

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 66  DMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT 125

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GPIGKECADLWPRIAS A  +V
Sbjct: 126 GPIGKECADLWPRIASAANAIV 147



>gi|12849613|dbj|BAB28415.1| unnamed protein product [Mus musculus]
          Length = 140

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGE+KGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEIKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|426228459|ref|XP_004008323.1| PREDICTED: 60S ribosomal protein L23-like [Ovis aries]
          Length = 222

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLN LP AGVGD
Sbjct: 1   MSKRGHGESS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNSLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPEL KKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELSKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|307170578|gb|EFN62772.1| 60S ribosomal protein L23 [Camponotus floridanus]
          Length = 140

 Score =  218 bits (554), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|148233630|ref|NP_001085921.1| ribosomal protein L23 [Xenopus laevis]
 gi|49257378|gb|AAH73541.1| MGC82808 protein [Xenopus laevis]
          Length = 140

 Score =  218 bits (554), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTG KNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGGKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|332028579|gb|EGI68616.1| 60S ribosomal protein L23 [Acromyrmex echinatior]
          Length = 153

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 122/141 (86%), Gaps = 3/141 (2%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           T ++RGG+A   G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG G
Sbjct: 15  TKTRRGGSA---GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSG 71

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DM++ATVKKGKPELRKKVMPAVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + 
Sbjct: 72  DMIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGTFIYFEDNAGVIVNNKGEMKGSAIT 131

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KECADLWPRIAS+A ++
Sbjct: 132 GPVAKECADLWPRIASNASSI 152



>gi|157816849|gb|ABV82416.1| TA01212p [Drosophila melanogaster]
          Length = 140

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRG-RGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           + +ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  LFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|58260986|ref|XP_567903.1| 60s ribosomal protein l23 [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134116875|ref|XP_772664.1| 60S ribosomal protein L23 [Cryptococcus neoformans var. neoformans
           B-3501A]
 gi|50255282|gb|EAL18017.1| hypothetical protein CNBK0380 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229984|gb|AAW46386.1| 60s ribosomal protein l23, putative [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|405123405|gb|AFR98170.1| 60s ribosomal protein l23 [Cryptococcus neoformans var. grubii H99]
          Length = 138

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS +  AA   G KFRM+ GLPV AVMNCADN+GAKNLY+I+V G+G+RLNRLP A  GD
Sbjct: 1   MSIKSAAA---GTKFRMSLGLPVGAVMNCADNSGAKNLYVISVIGFGARLNRLPAAAAGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKKVMPAV+ RQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVMASVKKGKPELRKKVMPAVICRQRKPWRRRDGIFLYFEDNAGVIVNAKGEMKGSAING 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|224065549|ref|XP_002301852.1| predicted protein [Populus trichocarpa]
 gi|224077606|ref|XP_002335793.1| predicted protein [Populus trichocarpa]
 gi|224102227|ref|XP_002312599.1| predicted protein [Populus trichocarpa]
 gi|224110634|ref|XP_002315585.1| predicted protein [Populus trichocarpa]
 gi|357137580|ref|XP_003570378.1| PREDICTED: 60S ribosomal protein L23-like [Brachypodium distachyon]
 gi|357146533|ref|XP_003574026.1| PREDICTED: 60S ribosomal protein L23-like [Brachypodium distachyon]
 gi|460389682|ref|XP_004240479.1| PREDICTED: 60S ribosomal protein L23-like [Solanum lycopersicum]
 gi|460393548|ref|XP_004242371.1| PREDICTED: 60S ribosomal protein L23 [Solanum lycopersicum]
 gi|460404048|ref|XP_004247497.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Solanum
           lycopersicum]
 gi|460404050|ref|XP_004247498.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Solanum
           lycopersicum]
 gi|460404594|ref|XP_004247766.1| PREDICTED: 60S ribosomal protein L23-like [Solanum lycopersicum]
 gi|315113254|pdb|3IZR|M Chain M, Localization Of The Large Subunit Ribosomal Proteins Into
           A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
           Ribosome
 gi|57471720|gb|AAW50991.1| ribosomal protein L17 [Triticum aestivum]
 gi|76573329|gb|ABA46769.1| ribosomal protein L17-like protein [Solanum tuberosum]
 gi|118481489|gb|ABK92687.1| unknown [Populus trichocarpa]
 gi|118482141|gb|ABK93001.1| unknown [Populus trichocarpa]
 gi|118483249|gb|ABK93527.1| unknown [Populus trichocarpa]
 gi|118483257|gb|ABK93531.1| unknown [Populus trichocarpa]
 gi|118484402|gb|ABK94078.1| unknown [Populus trichocarpa]
 gi|118487170|gb|ABK95413.1| unknown [Populus trichocarpa]
 gi|222834818|gb|EEE73267.1| predicted protein [Populus trichocarpa]
 gi|222843578|gb|EEE81125.1| predicted protein [Populus trichocarpa]
 gi|222852419|gb|EEE89966.1| predicted protein [Populus trichocarpa]
 gi|222864625|gb|EEF01756.1| predicted protein [Populus trichocarpa]
 gi|326507922|dbj|BAJ86704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|473951176|gb|EMS50725.1| 60S ribosomal protein L23 [Triticum urartu]
 gi|474240764|gb|EMS59771.1| 60S ribosomal protein L23 [Triticum urartu]
 gi|475549124|gb|EMT11203.1| 60S ribosomal protein L23 [Aegilops tauschii]
          Length = 140

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|357114121|ref|XP_003558849.1| PREDICTED: 60S ribosomal protein L23-like [Brachypodium distachyon]
 gi|326532548|dbj|BAK05203.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|474142394|gb|EMS56602.1| 60S ribosomal protein L23 [Triticum urartu]
 gi|475555387|gb|EMT12421.1| 60S ribosomal protein L23 [Aegilops tauschii]
          Length = 140

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV++RQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIIRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKECADLWPRIAS+A  +V
Sbjct: 120 PVGKECADLWPRIASNANAIV 140



>gi|168022174|ref|XP_001763615.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685108|gb|EDQ71505.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 140

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 109/142 (76%), Positives = 121/142 (85%), Gaps = 3/142 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  GNKFRM+ GLPV AV+NCADNTGAKNLY+I+V G   RLNRLP A VG
Sbjct: 1   MSKRGRGGAS--GNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GPIGKECADLWPRIAS A  +V
Sbjct: 119 GPIGKECADLWPRIASAANAIV 140



>gi|498968813|ref|XP_004526407.1| PREDICTED: 60S ribosomal protein L23-like [Ceratitis capitata]
          Length = 140

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRG-RGGTAGGKFRISLGLPVGAVMNCADNTGAKNLFVIAVHGIRGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|254564747|ref|XP_002489484.1| 60S ribosomal protein L23 [Komagataella pastoris GS115]
 gi|238029280|emb|CAY67203.1| hypothetical protein PAS_chr1-3_0300 [Komagataella pastoris GS115]
 gi|328349912|emb|CCA36312.1| 60S ribosomal protein L23 [Komagataella pastoris CBS 7435]
          Length = 137

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 117/130 (90%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+ GLPV A++NCADN+GA+NLYI+AV G G+RLNRLP A VGDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLGLPVGAIINCADNSGARNLYILAVKGVGARLNRLPAASVGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ K+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+GKECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSKTWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|115449557|ref|NP_001048495.1| Os02g0814700 [Oryza sativa Japonica Group]
 gi|115450623|ref|NP_001048912.1| Os03g0139100 [Oryza sativa Japonica Group]
 gi|115482426|ref|NP_001064806.1| Os10g0466700 [Oryza sativa Japonica Group]
 gi|212722212|ref|NP_001132424.1| uncharacterized protein LOC100193874 [Zea mays]
 gi|212723532|ref|NP_001132737.1| uncharacterized protein LOC100194224 [Zea mays]
 gi|226494003|ref|NP_001148342.1| 60S ribosomal protein L23 [Zea mays]
 gi|226532932|ref|NP_001149366.1| 60S ribosomal protein L23 [Zea mays]
 gi|259490208|ref|NP_001159003.1| 60S ribosomal protein L23 [Zea mays]
 gi|225433247|ref|XP_002285443.1| PREDICTED: 60S ribosomal protein L23-like [Vitis vinifera]
 gi|225438001|ref|XP_002273253.1| PREDICTED: 60S ribosomal protein L23 [Vitis vinifera]
 gi|255571210|ref|XP_002526555.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gi|255574915|ref|XP_002528364.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gi|13489168|gb|AAK27802.1|AC022457_5 60S ribosomal protein L17 [Oryza sativa Japonica Group]
 gi|31432581|gb|AAP54196.1| 60S ribosomal protein L23, putative, expressed [Oryza sativa
           Japonica Group]
 gi|47847875|dbj|BAD21668.1| 60S ribosomal protein L17 [Oryza sativa Japonica Group]
 gi|108706089|gb|ABF93884.1| 60S ribosomal protein L23, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113538026|dbj|BAF10409.1| Os02g0814700 [Oryza sativa Japonica Group]
 gi|113547383|dbj|BAF10826.1| Os03g0139100 [Oryza sativa Japonica Group]
 gi|113639415|dbj|BAF26720.1| Os10g0466700 [Oryza sativa Japonica Group]
 gi|125532288|gb|EAY78853.1| hypothetical protein OsI_33956 [Oryza sativa Indica Group]
 gi|125575086|gb|EAZ16370.1| hypothetical protein OsJ_31833 [Oryza sativa Japonica Group]
 gi|194694346|gb|ACF81257.1| unknown [Zea mays]
 gi|195605548|gb|ACG24604.1| 60S ribosomal protein L23 [Zea mays]
 gi|195607254|gb|ACG25457.1| 60S ribosomal protein L23 [Zea mays]
 gi|195618084|gb|ACG30872.1| 60S ribosomal protein L23 [Zea mays]
 gi|195618344|gb|ACG31002.1| 60S ribosomal protein L23 [Zea mays]
 gi|195622716|gb|ACG33188.1| 60S ribosomal protein L23 [Zea mays]
 gi|195622784|gb|ACG33222.1| 60S ribosomal protein L23 [Zea mays]
 gi|195626480|gb|ACG35070.1| 60S ribosomal protein L23 [Zea mays]
 gi|195626676|gb|ACG35168.1| 60S ribosomal protein L23 [Zea mays]
 gi|195636706|gb|ACG37821.1| 60S ribosomal protein L23 [Zea mays]
 gi|195641046|gb|ACG39991.1| 60S ribosomal protein L23 [Zea mays]
 gi|215767739|dbj|BAG99967.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218191803|gb|EEC74230.1| hypothetical protein OsI_09417 [Oryza sativa Indica Group]
 gi|222623902|gb|EEE58034.1| hypothetical protein OsJ_08852 [Oryza sativa Japonica Group]
 gi|223532232|gb|EEF34036.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gi|223534116|gb|EEF35833.1| 60S ribosomal protein L23, putative [Ricinus communis]
 gi|223946861|gb|ACN27514.1| unknown [Zea mays]
 gi|284520978|gb|ADB93064.1| 60S ribosomal protein L17 [Jatropha curcas]
 gi|296083720|emb|CBI23709.3| unnamed protein product [Vitis vinifera]
 gi|297744205|emb|CBI37175.3| unnamed protein product [Vitis vinifera]
 gi|313586531|gb|ADR71276.1| 60S ribosomal protein L23A [Hevea brasiliensis]
 gi|313586533|gb|ADR71277.1| 60S ribosomal protein L23B [Hevea brasiliensis]
 gi|413924091|gb|AFW64023.1| 60S ribosomal protein L23 [Zea mays]
 gi|413939450|gb|AFW74001.1| 60S ribosomal protein L23 [Zea mays]
 gi|413956980|gb|AFW89629.1| 60S ribosomal protein L23 [Zea mays]
 gi|414864729|tpg|DAA43286.1| TPA: 60S ribosomal protein L23 [Zea mays]
          Length = 140

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|471872558|emb|CCO36433.1| 60S ribosomal protein L23 [Rhizoctonia solani AG-1 IB]
 gi|471888889|emb|CCO32785.1| 60S ribosomal protein L23 [Rhizoctonia solani AG-1 IB]
          Length = 137

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%)

Query: 13  ASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVK 72
           A+  G KFR+T GLPV AV+NCADN+GAK L+II   G+G+RLNRLP AGVGDMV+A+VK
Sbjct: 4   AAASGTKFRLTLGLPVGAVLNCADNSGAKTLFIIEPYGFGARLNRLPDAGVGDMVVASVK 63

Query: 73  KGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECA 132
           KGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECA
Sbjct: 64  KGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECA 123

Query: 133 DLWPRIASHAGTVV 146
           DLWPRIAS+AGTVV
Sbjct: 124 DLWPRIASNAGTVV 137



>gi|242034221|ref|XP_002464505.1| hypothetical protein SORBIDRAFT_01g019770 [Sorghum bicolor]
 gi|242042297|ref|XP_002468543.1| hypothetical protein SORBIDRAFT_01g047680 [Sorghum bicolor]
 gi|242063474|ref|XP_002453026.1| hypothetical protein SORBIDRAFT_04g036970 [Sorghum bicolor]
 gi|241918359|gb|EER91503.1| hypothetical protein SORBIDRAFT_01g019770 [Sorghum bicolor]
 gi|241922397|gb|EER95541.1| hypothetical protein SORBIDRAFT_01g047680 [Sorghum bicolor]
 gi|241932857|gb|EES06002.1| hypothetical protein SORBIDRAFT_04g036970 [Sorghum bicolor]
          Length = 140

 Score =  217 bits (552), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRG-RGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|321263699|ref|XP_003196567.1| 60S ribosomal protein L23 [Cryptococcus gattii WM276]
 gi|317463044|gb|ADV24780.1| 60S ribosomal protein L23, putative [Cryptococcus gattii WM276]
          Length = 138

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 120/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS +  AA   G KFRM+ GLPV AVMNCADN+GAKNLY+I+V G+G+RLNRLP A  GD
Sbjct: 1   MSIKSAAA---GTKFRMSLGLPVGAVMNCADNSGAKNLYVISVIGFGARLNRLPAAAAGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKKVMPA++ RQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVMASVKKGKPELRKKVMPAIICRQRKPWRRRDGIFLYFEDNAGVIVNAKGEMKGSAING 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|507654954|ref|XP_004633745.1| PREDICTED: 60S ribosomal protein L23 [Octodon degus]
          Length = 140

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRK +RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKLYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|505756588|gb|EOR00738.1| 60S ribosomal protein L23 [Wallemia ichthyophaga EXF-994]
          Length = 137

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 101/133 (75%), Positives = 114/133 (85%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
             +GNKFRMT GLP  AV+NCADN+GAKNLY++AV   G+RLNRLP A  GDM++ATVKK
Sbjct: 5   QNQGNKFRMTLGLPTGAVLNCADNSGAKNLYVVAVFHSGARLNRLPAASAGDMIMATVKK 64

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKVMPAVVVRQRK WRRRDG  +YFEDNAGVI + KGEMKGS + GP+ KECAD
Sbjct: 65  GKPELRKKVMPAVVVRQRKPWRRRDGVFLYFEDNAGVITNPKGEMKGSAITGPVAKECAD 124

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS+AGTVV
Sbjct: 125 LWPRIASNAGTVV 137



>gi|224086322|ref|XP_002192767.1| PREDICTED: 60S ribosomal protein L23 [Taeniopygia guttata]
          Length = 189

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 55  RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 111

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 112 ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 171

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 172 KECADLWPRIASNAGSI 188



 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%)

Query: 40 AKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKPELRKK 81
          AKNLYII+V G   RLNRLP AGVGDMV+ATVKKGKPELRKK
Sbjct: 12 AKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKK 53



>gi|112984274|ref|NP_001037227.1| ribosomal protein L23 [Bombyx mori]
 gi|15081322|gb|AAK83857.1|AF395586_1 ribosomal protein L17/23 [Spodoptera frugiperda]
 gi|49532860|dbj|BAD26665.1| Ribosomal protein L17/23 [Plutella xylostella]
 gi|54609237|gb|AAV34834.1| ribosomal protein L23 [Bombyx mori]
 gi|268306378|gb|ACY95310.1| ribosomal protein L23 [Manduca sexta]
 gi|315115429|gb|ADT80687.1| ribosomal protein L23 [Euphydryas aurinia]
 gi|342356417|gb|AEL28867.1| ribosomal protein L23 [Heliconius melpomene cythera]
 gi|357620607|gb|EHJ72748.1| ribosomal protein L23 [Danaus plexippus]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|116784756|gb|ABK23460.1| unknown [Picea sitchensis]
 gi|116787189|gb|ABK24404.1| unknown [Picea sitchensis]
 gi|116792399|gb|ABK26350.1| unknown [Picea sitchensis]
 gi|148908249|gb|ABR17239.1| unknown [Picea sitchensis]
 gi|224284703|gb|ACN40083.1| unknown [Picea sitchensis]
 gi|224285166|gb|ACN40310.1| unknown [Picea sitchensis]
 gi|224285466|gb|ACN40455.1| unknown [Picea sitchensis]
 gi|224286055|gb|ACN40739.1| unknown [Picea sitchensis]
 gi|224286587|gb|ACN40998.1| unknown [Picea sitchensis]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPAACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|78042492|ref|NP_001030186.1| 60S ribosomal protein L23 [Bos taurus]
 gi|74267764|gb|AAI02557.1| Ribosomal protein L23 [Bos taurus]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSK G   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKLGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|470107295|ref|XP_004289983.1| PREDICTED: 60S ribosomal protein L23-like [Fragaria vesca subsp.
           vesca]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAVVVRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|226533522|ref|NP_001140843.1| uncharacterized protein LOC100272919 [Zea mays]
 gi|194701396|gb|ACF84782.1| unknown [Zea mays]
 gi|195616414|gb|ACG30037.1| 60S ribosomal protein L23 [Zea mays]
 gi|413934079|gb|AFW68630.1| 60S ribosomal protein L23 [Zea mays]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRG-RGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKLWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|12832665|dbj|BAB22203.1| unnamed protein product [Mus musculus]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRL  AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLSAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|389608303|dbj|BAM17763.1| ribosomal protein L23 [Papilio xuthus]
 gi|389610691|dbj|BAM18957.1| ribosomal protein L23 [Papilio polytes]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGIFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|302851946|ref|XP_002957495.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox
           carteri f. nagariensis]
 gi|300257137|gb|EFJ41389.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox
           carteri f. nagariensis]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           SKR G   T GNKFRM  GLPVAAVMNCADNTGAKNLY+I+V GWGSRLNRLP A  GDM
Sbjct: 3   SKRKGG--TSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNRLPAAACGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+A+VKKGKP+LRKKV PAVV+RQRK +RR++G  IYFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           + KECADLWPRIAS A ++V
Sbjct: 121 VAKECADLWPRIASAANSIV 140



>gi|71018899|ref|XP_759680.1| 60S ribosomal protein L23 [Ustilago maydis 521]
 gi|46099438|gb|EAK84671.1| RL23_AEDAE 60S ribosomal protein L23 (L17A) [Ustilago maydis 521]
 gi|319411895|emb|CBQ73938.1| probable RPL23A-60S large subunit ribosomal protein L23.e
           [Sporisorium reilianum SRZ2]
 gi|388854958|emb|CCF51461.1| probable RPL23A-60S large subunit ribosomal protein L23.e [Ustilago
           hordei]
 gi|443895723|dbj|GAC73068.1| 60S ribosomal protein L14/L17/L23 [Pseudozyma antarctica T-34]
 gi|501304463|dbj|GAC93764.1| hypothetical protein PHSY_001329 [Pseudozyma hubeiensis SY62]
          Length = 136

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (87%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           G KFRMT  LPV AVMNCADN+GAKNL++IAV G G+RLNRLP A  GDMV+A+VKKGKP
Sbjct: 7   GTKFRMTLALPVGAVMNCADNSGAKNLFVIAVHGIGARLNRLPAAAAGDMVVASVKKGKP 66

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPAVVVRQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECAD+WP
Sbjct: 67  ELRKKVMPAVVVRQRKPWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECADIWP 126

Query: 137 RIASHAGTVV 146
           RIAS+AGTVV
Sbjct: 127 RIASNAGTVV 136



>gi|387914520|gb|AFK10869.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392874864|gb|AFM86264.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392877506|gb|AFM87585.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392877776|gb|AFM87720.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392878370|gb|AFM88017.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392883582|gb|AFM90623.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392883602|gb|AFM90633.1| 60S ribosomal protein L23 [Callorhinchus milii]
 gi|392883832|gb|AFM90748.1| 60S ribosomal protein L23 [Callorhinchus milii]
          Length = 140

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSC-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRK++RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|292659544|pdb|2X7N|C Chain C, Mechanism Of Eif6s Anti-Association Activity
          Length = 132

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (88%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLPV A+MNCADN+GA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 2   QGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 61

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRRRDG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 62  PELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 121

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 122 PRVASNSGVVV 132



>gi|6319384|ref|NP_009466.1| ribosomal 60S subunit protein L23A [Saccharomyces cerevisiae S288c]
 gi|398364725|ref|NP_011042.3| ribosomal 60S subunit protein L23B [Saccharomyces cerevisiae S288c]
 gi|338819290|sp|P0CX41.1|RL23A_YEAST RecName: Full=60S ribosomal protein L23-A; AltName: Full=L17a;
           AltName: Full=YL32
 gi|338819291|sp|P0CX42.1|RL23B_YEAST RecName: Full=60S ribosomal protein L23-B; AltName: Full=L17a;
           AltName: Full=YL32
 gi|49258856|pdb|1S1I|R Chain R, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From
           Yeast Obtained By Docking Atomic Models For Rna And
           Protein Components Into A 11.7 A Cryo-Em Map. This File,
           1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is
           In File 1s1h.
 gi|315113312|pdb|3IZS|M Chain M, Localization Of The Large Subunit Ribosomal Proteins Into
           A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
           Translating 80s Ribosome
 gi|315113544|pdb|3O58|U Chain U, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The First 80s In The Asymmetric Unit.
 gi|315113591|pdb|3O5H|U Chain U, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The Second 80s In The Asymmetric Unit.
 gi|365767272|pdb|3U5E|V Chain V, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome A
 gi|365767314|pdb|3U5I|V Chain V, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome B
 gi|377656243|pdb|3J16|I Chain I, Models Of Ribosome-Bound Dom34p And Rli1p And Their
           Ribosomal Binding Partners
 gi|410562500|pdb|4B6A|V Chain V, Cryo-Em Structure Of The 60s Ribosomal Subunit In Complex
           With Arx1 And Rei1
 gi|4324|emb|CAA25841.1| ribosomal protein L17 [Saccharomyces cerevisiae]
 gi|496691|emb|CAA56018.1| L23 B x-137 [Saccharomyces cerevisiae]
 gi|536142|emb|CAA84908.1| RPL17A [Saccharomyces cerevisiae]
 gi|603356|gb|AAC03215.1| Rpl17bp: Ribosomal protein, large subunit [Saccharomyces
           cerevisiae]
 gi|622952|gb|AAA61906.1| ribosomal protein L17B [Saccharomyces cerevisiae]
 gi|151944833|gb|EDN63092.1| ribosomal protein L23B [Saccharomyces cerevisiae YJM789]
 gi|151946313|gb|EDN64535.1| ribosomal protein L23A [Saccharomyces cerevisiae YJM789]
 gi|190405679|gb|EDV08946.1| ribosomal protein L23B [Saccharomyces cerevisiae RM11-1a]
 gi|190408906|gb|EDV12171.1| ribosomal protein L23A [Saccharomyces cerevisiae RM11-1a]
 gi|259144758|emb|CAY77697.1| Rpl23ap [Saccharomyces cerevisiae EC1118]
 gi|259146040|emb|CAY79300.1| Rpl23bp [Saccharomyces cerevisiae EC1118]
 gi|285810252|tpg|DAA07037.1| TPA: ribosomal 60S subunit protein L23A [Saccharomyces cerevisiae
           S288c]
 gi|285811749|tpg|DAA07777.1| TPA: ribosomal 60S subunit protein L23B [Saccharomyces cerevisiae
           S288c]
 gi|349576298|dbj|GAA21469.1| K7_Rpl23ap [Saccharomyces cerevisiae Kyokai no. 7]
 gi|349577782|dbj|GAA22950.1| K7_Rpl23bp [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392299820|gb|EIW10912.1| Rpl23bp [Saccharomyces cerevisiae CEN.PK113-7D]
 gi|392300936|gb|EIW12025.1| Rpl23bp [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 137

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (88%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLPV A+MNCADN+GA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRRRDG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|15226102|ref|NP_180895.1| 60S ribosomal protein L23B [Arabidopsis thaliana]
 gi|15229287|ref|NP_187090.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|18390397|ref|NP_563707.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|297826791|ref|XP_002881278.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|297828934|ref|XP_002882349.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|297843256|ref|XP_002889509.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|19884121|sp|P49690.3|RL23_ARATH RecName: Full=60S ribosomal protein L23; AltName: Full=Protein
           EMBRYO DEFECTIVE 2171
 gi|2459420|gb|AAB80655.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|7547099|gb|AAF63771.1| ribosomal protein L17, putative [Arabidopsis thaliana]
 gi|14596111|gb|AAK68783.1| 60S ribosomal protein L17 [Arabidopsis thaliana]
 gi|15450856|gb|AAK96699.1| Strong similarity to 60S ribosomal protein L17 [Arabidopsis
           thaliana]
 gi|18377460|gb|AAL66896.1| unknown protein [Arabidopsis thaliana]
 gi|20148697|gb|AAM10239.1| similar to 60S ribosomal protein L17 [Arabidopsis thaliana]
 gi|21555625|gb|AAM63901.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
 gi|21593801|gb|AAM65768.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
 gi|98961079|gb|ABF59023.1| At2g33370 [Arabidopsis thaliana]
 gi|297327117|gb|EFH57537.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|297328189|gb|EFH58608.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|297335351|gb|EFH65768.1| 60S ribosomal protein L23 [Arabidopsis lyrata subsp. lyrata]
 gi|330253730|gb|AEC08824.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|332189581|gb|AEE27702.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|332640555|gb|AEE74076.1| 60S ribosomal protein L23 [Arabidopsis thaliana]
 gi|482563909|gb|EOA28099.1| hypothetical protein CARUB_v10024281mg [Capsella rubella]
 gi|482573552|gb|EOA37739.1| hypothetical protein CARUB_v10012532mg [Capsella rubella]
          Length = 140

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRG-RGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|302759366|ref|XP_002963106.1| hypothetical protein SELMODRAFT_165708 [Selaginella moellendorffii]
 gi|302796914|ref|XP_002980218.1| hypothetical protein SELMODRAFT_228682 [Selaginella moellendorffii]
 gi|300151834|gb|EFJ18478.1| hypothetical protein SELMODRAFT_228682 [Selaginella moellendorffii]
 gi|300169967|gb|EFJ36569.1| hypothetical protein SELMODRAFT_165708 [Selaginella moellendorffii]
          Length = 140

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%), Gaps = 3/142 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKR  GAAS  GNKFRM+ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP A +G
Sbjct: 1   MSKRARGAAS--GNKFRMSLGLPVGAVVNCADNTGAKNLYIISVKGVKGRLNRLPAAAIG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKP+LRKKVMPAV+VRQRK +RR+DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPDLRKKVMPAVIVRQRKPYRRKDGVFMYFEDNAGVIVNPKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GPIGKECADLWPRIAS A  +V
Sbjct: 119 GPIGKECADLWPRIASAANAIV 140



>gi|157361531|gb|ABV44723.1| 60S ribosomal protein L23-like protein [Phlebotomus papatasi]
          Length = 140

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSA-GGKFRISLGLPVGAVINCADNTGAKNLYVIAVHGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A +V
Sbjct: 120 PVAKECADLWPRIASNASSV 139



>gi|281500848|pdb|3JYW|R Chain R, Structure Of The 60s Proteins For Eukaryotic Ribosome
           Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome
           At 8.9a Resolution
          Length = 131

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (88%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLPV A+MNCADN+GA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 1   QGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 60

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRRRDG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 61  PELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 120

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 121 PRVASNSGVVV 131



>gi|161701447|gb|ABX75541.1| 60S ribosomal protein L17-like protein [Panax ginseng]
          Length = 138

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 118/138 (85%), Gaps = 3/138 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG+A   GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGDMV+
Sbjct: 4   RGGSA---GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM 60

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + GPIG
Sbjct: 61  ATVKKGKPELRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG 120

Query: 129 KECADLWPRIASHAGTVV 146
           KECADLWPRIAS A  +V
Sbjct: 121 KECADLWPRIASAANAIV 138



>gi|390596107|gb|EIN05510.1| ribosomal protein L14b/L23e [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 140

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           ++RGG AS  GNK+RMT GLP  AV+NCADN+GAK+L++I   G G+ LNRLP AGVGDM
Sbjct: 3   AQRGGGAS--GNKYRMTLGLPTGAVLNCADNSGAKSLFVIEPFGTGAHLNRLPDAGVGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+A+VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VVASVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           + KECADLWPRIAS+AGTVV
Sbjct: 121 VAKECADLWPRIASNAGTVV 140



>gi|403260397|ref|XP_003922660.1| PREDICTED: 60S ribosomal protein L23-like [Saimiri boliviensis
           boliviensis]
          Length = 140

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GL V AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLLVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|402225329|gb|EJU05390.1| ribosomal protein L14b/L23e [Dacryopinax sp. DJM-731 SS1]
          Length = 138

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 121/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSK  GA   +GNKFR+T GLPV AV+NCADN+GAK L++I   G+G+RLNRLP AGVGD
Sbjct: 1   MSKTTGA---QGNKFRLTLGLPVGAVLNCADNSGAKTLFVIEPYGFGARLNRLPDAGVGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK M AV+VRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVVASVKKGKPELRKKTMQAVIVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|470120643|ref|XP_004296407.1| PREDICTED: 60S ribosomal protein L23-like [Fragaria vesca subsp.
           vesca]
 gi|502079324|ref|XP_004486225.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 gi|502110174|ref|XP_004493817.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 gi|502114857|ref|XP_004495066.1| PREDICTED: 60S ribosomal protein L23-like [Cicer arietinum]
 gi|13430182|gb|AAK25758.1|AF334838_1 ribosomal protein L17 [Castanea sativa]
 gi|388492470|gb|AFK34301.1| unknown [Lotus japonicus]
 gi|462402998|gb|EMJ08555.1| hypothetical protein PRUPE_ppa013091mg [Prunus persica]
 gi|462424485|gb|EMJ28748.1| hypothetical protein PRUPE_ppa013088mg [Prunus persica]
          Length = 140

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|351727781|ref|NP_001235125.1| uncharacterized protein LOC100306699 [Glycine max]
 gi|356505056|ref|XP_003521308.1| PREDICTED: 60S ribosomal protein L23-like [Glycine max]
 gi|356548091|ref|XP_003542437.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Glycine max]
 gi|356548093|ref|XP_003542438.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Glycine max]
 gi|356572286|ref|XP_003554300.1| PREDICTED: 60S ribosomal protein L23-like [Glycine max]
 gi|255629315|gb|ACU15002.1| unknown [Glycine max]
 gi|508702445|gb|EOX94341.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
 gi|508714270|gb|EOY06167.1| Ribosomal protein L14p/L23e family protein [Theobroma cacao]
          Length = 140

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|238231703|ref|NP_001154037.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gi|223646576|gb|ACN10046.1| 60S ribosomal protein L23 [Salmo salar]
 gi|223672423|gb|ACN12393.1| 60S ribosomal protein L23 [Salmo salar]
 gi|225703556|gb|ACO07624.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gi|225704842|gb|ACO08267.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
 gi|225705758|gb|ACO08725.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
          Length = 140

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|116782734|gb|ABK22634.1| unknown [Picea sitchensis]
          Length = 140

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNR+P A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRIPAACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|340382358|ref|XP_003389687.1| PREDICTED: 60S ribosomal protein L23-like [Amphimedon
           queenslandica]
          Length = 140

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKR    S  G+KFRM  GLPV AV+NCADNTGAKNLYIIAV G   RLNRLP AG GD
Sbjct: 1   MSKRAAKGSA-GSKFRMALGLPVGAVINCADNTGAKNLYIIAVKGIKGRLNRLPAAGAGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           +VLATVKKGKPELRKKVMPAVV+RQRK +RR+DG  +YFEDNAGVIV+ KGEMKGS VAG
Sbjct: 60  LVLATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFLYFEDNAGVIVNVKGEMKGSTVAG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECAD+WPRIAS+A ++
Sbjct: 120 PVAKECADIWPRIASNASSI 139



>gi|195658145|gb|ACG48540.1| 60S ribosomal protein L23 [Zea mays]
          Length = 140

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 118/141 (83%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP   VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSXCVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|66558956|ref|XP_392812.2| PREDICTED: 60S ribosomal protein L23 [Apis mellifera]
 gi|156545547|ref|XP_001605069.1| PREDICTED: 60S ribosomal protein L23-like [Nasonia vitripennis]
 gi|380028209|ref|XP_003697800.1| PREDICTED: 60S ribosomal protein L23-like [Apis florea]
 gi|383854692|ref|XP_003702854.1| PREDICTED: 60S ribosomal protein L23-like [Megachile rotundata]
 gi|62083503|gb|AAX62476.1| ribosomal protein L23 [Lysiphlebus testaceipes]
 gi|90819996|gb|ABD98755.1| putative ribosomal protein L17/23 [Graphocephala atropunctata]
          Length = 140

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|391342593|ref|XP_003745601.1| PREDICTED: 60S ribosomal protein L23-like [Metaseiulus
           occidentalis]
          Length = 140

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG      G KFR++ GLPV AVMNCADNTGAKNL++IAV+G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGQA-GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVNGIKGRLNRLPAAGCGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK++RR+DGT IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKAFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVSKECADLWPRIASNASSI 139



>gi|291242287|ref|XP_002741039.1| PREDICTED: ribosomal protein L23-like [Saccoglossus kowalevskii]
          Length = 140

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 121/140 (86%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVVNCADNTGAKNLYIISVKGIKGRLNRLPAAAVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAV++RQRK +RR++G V+YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVMPAVIIRQRKPYRRKEGIVLYFEDNAGVIVNQKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|67084029|gb|AAY66949.1| 60S ribosomal protein L23 [Ixodes scapularis]
          Length = 140

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 122/142 (85%), Gaps = 5/142 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   G KFR++ GLPV AV+NCADNTGAKNLY+IAV+G   RLNRLP AG 
Sbjct: 1   MSKRGRGGAA---GAKFRISLGLPVGAVINCADNTGAKNLYVIAVNGIKGRLNRLPAAGA 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDM++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS +
Sbjct: 58  GDMIVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTV 145
            GP+ KECADLWPRIAS+A ++
Sbjct: 118 TGPVAKECADLWPRIASNASSI 139



>gi|409074605|gb|EKM74999.1| hypothetical protein AGABI1DRAFT_116624 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426193186|gb|EKV43120.1| hypothetical protein AGABI2DRAFT_195355 [Agaricus bisporus var.
           bisporus H97]
          Length = 137

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%)

Query: 13  ASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVK 72
           A+  G KFR+T GLPV AV+NCADN+GAK+LYII   G G+RLNRLP AGVGDMV+A+VK
Sbjct: 4   ATVSGTKFRITLGLPVGAVLNCADNSGAKSLYIIEPFGSGARLNRLPDAGVGDMVVASVK 63

Query: 73  KGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECA 132
           KGKPELRKK MPAVVVRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECA
Sbjct: 64  KGKPELRKKTMPAVVVRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECA 123

Query: 133 DLWPRIASHAGTVV 146
           DLWPRIAS+AGTVV
Sbjct: 124 DLWPRIASNAGTVV 137



>gi|501290315|dbj|BAN20164.1| ribosomal protein L23 [Riptortus pedestris]
          Length = 140

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGIFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|506965788|gb|AGM32246.1| 60S ribosomal protein L23 [Coptotermes formosanus]
          Length = 140

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGVKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|392572582|gb|EIW65727.1| hypothetical protein TREMEDRAFT_74898 [Tremella mesenterica DSM
           1558]
          Length = 138

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS +  AA   G KFRM+ GLPV AVMNCADN+GAKNLYII+V G+G+RLNRLP A  GD
Sbjct: 1   MSAKTAAA---GTKFRMSLGLPVGAVMNCADNSGAKNLYIISVVGFGARLNRLPAAAPGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKKVMPAV+ RQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVMASVKKGKPELRKKVMPAVICRQRKIWRRKDGVFLYFEDNAGVIVNPKGEMKGSAING 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|157929900|gb|ABW04138.1| ribosomal protein L23 [Epinephelus coioides]
          Length = 141

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (86%), Gaps = 1/138 (0%)

Query: 8   KRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMV 67
           KRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV
Sbjct: 4   KRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMV 62

Query: 68  LATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPI 127
           +ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+
Sbjct: 63  MATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV 122

Query: 128 GKECADLWPRIASHAGTV 145
            KECADLWPRIAS+AG++
Sbjct: 123 AKECADLWPRIASNAGSI 140



>gi|449277069|gb|EMC85376.1| 60S ribosomal protein L23, partial [Columba livia]
          Length = 139

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 5   RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 61

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 62  ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 121

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 122 KECADLWPRIASNAGSI 138



>gi|170592041|ref|XP_001900778.1| 60S ribosomal protein L23 [Brugia malayi]
 gi|312068045|ref|XP_003137029.1| large subunit ribosomal protein 23 [Loa loa]
 gi|158591930|gb|EDP30533.1| 60S ribosomal protein L23, putative [Brugia malayi]
 gi|307767810|gb|EFO27044.1| 60S ribosomal protein L23 [Loa loa]
 gi|402595110|gb|EJW89036.1| 60S ribosomal protein L23 [Wuchereria bancrofti]
          Length = 140

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (86%), Gaps = 3/141 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIKGRLNRLPSAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DM +A+VKKGKPELRKKV+ AVVVRQRK +RR+DG+ IYFEDNAGVIV+NKGEMKGS + 
Sbjct: 59  DMFVASVKKGKPELRKKVLQAVVVRQRKQYRRKDGSFIYFEDNAGVIVNNKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KECADLWPRIAS+AG++
Sbjct: 119 GPVAKECADLWPRIASNAGSI 139



>gi|410084222|ref|XP_003959688.1| hypothetical protein KAFR_0K01990 [Kazachstania africana CBS 2517]
 gi|372466280|emb|CCF60553.1| hypothetical protein KAFR_0K01990 [Kazachstania africana CBS 2517]
          Length = 137

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/131 (75%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADNTGA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNTGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKSWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|501752383|emb|CCG83645.1| 60S ribosomal protein L23 [Taphrina deformans PYCC 5710]
          Length = 125

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 101/125 (80%), Positives = 114/125 (91%)

Query: 22  MTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKPELRKK 81
           MT GLPV AVMNCADN+GAKNLYII+V G G+RLNRLP +GVGDMV+ATVKKGKPELRKK
Sbjct: 1   MTLGLPVGAVMNCADNSGAKNLYIISVKGIGARLNRLPASGVGDMVMATVKKGKPELRKK 60

Query: 82  VMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWPRIASH 141
           VMPA+V+RQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+GKECADLWPRIAS+
Sbjct: 61  VMPAIVIRQRKPWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKECADLWPRIASN 120

Query: 142 AGTVV 146
           +GTVV
Sbjct: 121 SGTVV 125



>gi|340724772|ref|XP_003400755.1| PREDICTED: 60S ribosomal protein L23-like [Bombus terrestris]
          Length = 140

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAV++RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVIIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|326934106|ref|XP_003213136.1| PREDICTED: 60S ribosomal protein L23-like, partial [Meleagris
           gallopavo]
          Length = 135

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 1   RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|403214162|emb|CCK68663.1| hypothetical protein KNAG_0B02210 [Kazachstania naganishii CBS
           8797]
 gi|403214947|emb|CCK69447.1| hypothetical protein KNAG_0C03400 [Kazachstania naganishii CBS
           8797]
          Length = 137

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/131 (75%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADNTGA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNTGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQAKSWRRKDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|393222273|gb|EJD07757.1| 60S ribosomal protein L17/L23 [Fomitiporia mediterranea MF3/22]
          Length = 139

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  +S  GNKFRM+ GLP  AV+NCADN+GA++LY+I   G+G+ LNRLP AGVGD
Sbjct: 1   MSKRGAGSS--GNKFRMSLGLPTGAVVNCADNSGARSLYLIEPYGFGAHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MP V+VRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVVASVKKGKPELRKKTMPIVIVRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|2341028|gb|AAB70426.1| Strong similarity to 60S ribosomal protein L17 (gb|X01694). EST
           gb|AA042332 comes from this gene [Arabidopsis thaliana]
          Length = 157

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           R G   T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGDMV+
Sbjct: 20  RLGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM 79

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + GPIG
Sbjct: 80  ATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG 139

Query: 129 KECADLWPRIASHAGTVV 146
           KECADLWPRIAS A  +V
Sbjct: 140 KECADLWPRIASAANAIV 157



>gi|21618149|gb|AAM67199.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
          Length = 140

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRG-RGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KG+MKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGDMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|281344351|gb|EFB19935.1| hypothetical protein PANDA_004968 [Ailuropoda melanoleuca]
 gi|355568450|gb|EHH24731.1| 60S ribosomal protein L17, partial [Macaca mulatta]
 gi|440904225|gb|ELR54764.1| 60S ribosomal protein L23, partial [Bos grunniens mutus]
          Length = 136

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 2   RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 58

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 59  ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 118

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 119 KECADLWPRIASNAGSI 135



>gi|392880274|gb|AFM88969.1| 60S ribosomal protein L23 [Callorhinchus milii]
          Length = 140

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSC-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRK++RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG +
Sbjct: 120 PVAKECADLWPRIASNAGGI 139



>gi|168022308|ref|XP_001763682.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685175|gb|EDQ71572.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 136

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (85%), Gaps = 3/138 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   GNKFRM+ GLPV AV+NCADNTGAKNLY+I+V G   RLNRLP A VGDMV+
Sbjct: 2   RGGAS---GNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGDMVM 58

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + GPIG
Sbjct: 59  ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG 118

Query: 129 KECADLWPRIASHAGTVV 146
           KECADLWPRIAS A  +V
Sbjct: 119 KECADLWPRIASAANAIV 136



>gi|195999246|ref|XP_002109491.1| conserved hypothetical protein [Trichoplax adhaerens]
 gi|190587615|gb|EDV27657.1| conserved hypothetical protein, partial [Trichoplax adhaerens]
          Length = 136

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G+KFR++  LPV AVMNCADNTGAKNLY+I+V G   RLNR+P AG+GD+VL
Sbjct: 2   RGGSS---GSKFRISLALPVGAVMNCADNTGAKNLYVISVKGIKGRLNRMPSAGIGDLVL 58

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKVMPAVVVRQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 59  ATVKKGKPELRKKVMPAVVVRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGPVA 118

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS++G++
Sbjct: 119 KECADLWPRIASNSGSI 135



>gi|449445630|ref|XP_004140575.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 gi|449458864|ref|XP_004147166.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 gi|449487355|ref|XP_004157585.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 gi|449498587|ref|XP_004160577.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
 gi|449526191|ref|XP_004170097.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
          Length = 140

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 106/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           PIGKECADLWPRIAS A  +
Sbjct: 120 PIGKECADLWPRIASAANAI 139



>gi|452823020|gb|EME30034.1| 60S ribosomal protein L23e [Galdieria sulphuraria]
          Length = 140

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   ST G+KFR + GLPV A++NCADNTGAKNLYII+V G  SRLNRLP A VGD
Sbjct: 1   MSKRGRKGST-GSKFRTSVGLPVGALINCADNTGAKNLYIISVKGVKSRLNRLPAASVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKPELRKKV PAVV+RQR+ WRR+DG ++YFEDNAGVIV+ KGEMKGS VAG
Sbjct: 60  MVLATVKKGKPELRKKVTPAVVIRQRRPWRRKDGVILYFEDNAGVIVNPKGEMKGSAVAG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECAD+WPRIAS A  +
Sbjct: 120 PVAKECADMWPRIASAASAI 139



>gi|242786687|ref|XP_002480854.1| 60S ribosomal protein L23 [Talaromyces stipitatus ATCC 10500]
 gi|218721001|gb|EED20420.1| alkaline serine protease [Talaromyces stipitatus ATCC 10500]
          Length = 140

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  A+  GNK +MT GLPV AVMNC DN+GA+NLYII+V+G G+RLNRLP AGVGD
Sbjct: 1   MSKRGRGAAA-GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVTGAGARLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKE A+LWPRIAS++G V+
Sbjct: 120 PVGKEAAELWPRIASNSGVVM 140



>gi|225717578|gb|ACO14635.1| 60S ribosomal protein L23 [Caligus clemensi]
          Length = 140

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AV+NCADNTGAKNLYIIAV G   RLNRLP AG GD
Sbjct: 1   MSKRG-RGGTAGAKFRISLGLPVGAVINCADNTGAKNLYIIAVGGIRGRLNRLPAAGNGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKPELRKKV+PAVV+RQRK++RR+DGT +YFEDNAGVIV+NKGE KGS + G
Sbjct: 60  MVLATVKKGKPELRKKVIPAVVIRQRKTFRRKDGTFLYFEDNAGVIVNNKGETKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIA+ AG++
Sbjct: 120 PVSKECADLWPRIATLAGSI 139



>gi|366989251|ref|XP_003674393.1| hypothetical protein NCAS_0A14560 [Naumovozyma castellii CBS 4309]
 gi|366993821|ref|XP_003676675.1| hypothetical protein NCAS_0E02460 [Naumovozyma castellii CBS 4309]
 gi|342300256|emb|CCC68014.1| hypothetical protein NCAS_0A14560 [Naumovozyma castellii CBS 4309]
 gi|342302542|emb|CCC70316.1| hypothetical protein NCAS_0E02460 [Naumovozyma castellii CBS 4309]
          Length = 137

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 98/131 (74%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADNTGA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNTGARNLYILAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKSWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|326491995|dbj|BAJ98222.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 139

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 116/136 (85%)

Query: 11  GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLAT 70
           G  ST GNK RMT GLPV AVMNCADN+GA+NLYII+V G G+RLNRLP  GVGDMV+AT
Sbjct: 4   GRGSTSGNKLRMTLGLPVGAVMNCADNSGARNLYIISVKGIGARLNRLPAGGVGDMVMAT 63

Query: 71  VKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKE 130
           VKKGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+GKE
Sbjct: 64  VKKGKPELRKKVMPAVIVRQSKPWRRADGMFLYFEDNAGVIVNPKGEMKGSAITGPVGKE 123

Query: 131 CADLWPRIASHAGTVV 146
            A+LWPRIAS++G V+
Sbjct: 124 AAELWPRIASNSGVVM 139



>gi|302672745|ref|XP_003026060.1| 60S ribosomal protein L23 [Schizophyllum commune H4-8]
 gi|300099740|gb|EFI91157.1| hypothetical protein SCHCODRAFT_86294 [Schizophyllum commune H4-8]
          Length = 138

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 120/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSK  G++   G KFR+T GLPV AV+NCADN+GAK+L+II   G+GS LNRLP AGVGD
Sbjct: 1   MSKPTGSS---GTKFRLTLGLPVGAVLNCADNSGAKSLFIIEPYGFGSHLNRLPDAGVGD 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+A+VKKGKPELRKK MP VVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 58  MVVASVKKGKPELRKKTMPVVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 118 PVAKECADLWPRIASNAGTVV 138



>gi|13097600|gb|AAH03518.1| Similar to ribosomal protein L23, partial [Homo sapiens]
          Length = 134

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (88%)

Query: 15  TRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKG 74
           + G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+ATVKKG
Sbjct: 3   SSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKG 62

Query: 75  KPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADL 134
           KPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ KECADL
Sbjct: 63  KPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADL 122

Query: 135 WPRIASHAGTV 145
           WPRIAS+AG++
Sbjct: 123 WPRIASNAGSI 133



>gi|242019454|ref|XP_002430176.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis]
 gi|212515267|gb|EEB17438.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis]
          Length = 140

 Score =  214 bits (545), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|168004682|ref|XP_001755040.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693633|gb|EDQ79984.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 140

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ GNKFRM+ GLPV AV+NCADNTGAKNLY+I+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSS-GNKFRMSLGLPVGAVVNCADNTGAKNLYVISVKGVKGRLNRLPAAAVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+D   +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDCVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 120 PIGKECADLWPRIASAANAIV 140



>gi|2500265|sp|Q93140.1|RL23_BRUMA RecName: Full=60S ribosomal protein L23
 gi|1518127|gb|AAB07464.1| 60S ribosomal protein [Brugia malayi]
          Length = 140

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 122/141 (86%), Gaps = 3/141 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  G KFR++ GLPV AVMNCADNTGAKNL++IAVSG   RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVSGIKGRLNRLPSAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DM +A+VKKGKPELRKKV+ AVVVRQRK +RR DG+ IYFEDNAGVIV+NKGEMKGS + 
Sbjct: 59  DMFVASVKKGKPELRKKVLQAVVVRQRKQYRRIDGSSIYFEDNAGVIVNNKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KECADLWPRIAS+AG++
Sbjct: 119 GPVTKECADLWPRIASNAGSI 139



>gi|307195846|gb|EFN77642.1| 60S ribosomal protein L23 [Harpegnathos saltator]
          Length = 205

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 105/146 (71%), Positives = 122/146 (83%), Gaps = 5/146 (3%)

Query: 2   CHNTM--SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLP 59
           C NT+    RGG+A   G KFR++ GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP
Sbjct: 62  CSNTLFFPGRGGSA---GAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLP 118

Query: 60  KAGVGDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMK 119
            AG GDM++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMK
Sbjct: 119 AAGSGDMIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMK 178

Query: 120 GSQVAGPIGKECADLWPRIASHAGTV 145
           GS + GP+ KECADLWPRIAS+A ++
Sbjct: 179 GSAITGPVAKECADLWPRIASNASSI 204



>gi|470316816|gb|EMR08554.1| hypothetical protein PNEG_03035 [Pneumocystis murina B123]
          Length = 140

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 102/140 (72%), Positives = 119/140 (85%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           SKR  A  T GNK RMT GLPV A++NCADN+GAKNLYII+V G G+RLNRLP + +GDM
Sbjct: 3   SKR--ARGTSGNKLRMTLGLPVGAIINCADNSGAKNLYIISVKGTGARLNRLPASSIGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           VLATVKKGKPELRKK +  ++VRQRK WRRRDGT +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VLATVKKGKPELRKKALQVIIVRQRKPWRRRDGTHLYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           +GKECADLWPRIAS++G V+
Sbjct: 121 VGKECADLWPRIASNSGMVI 140



>gi|159481307|ref|XP_001698723.1| ribosomal protein L23, component of cytosolic 80S ribosome and 60S
           large subunit [Chlamydomonas reinhardtii]
 gi|158273617|gb|EDO99405.1| ribosomal protein L23 [Chlamydomonas reinhardtii]
          Length = 140

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 100/132 (75%), Positives = 115/132 (87%)

Query: 15  TRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKG 74
           T GNKFRM  GLPVAAVMNCADNTGAKNLY+I+V GWGSRLN+LP A  GDMV+A+VKKG
Sbjct: 9   TSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDMVMASVKKG 68

Query: 75  KPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADL 134
           KP+LRKKV PAVV+RQRK +RR++G  IYFEDNAGVIV+ KGEMKGS + GP+ KECADL
Sbjct: 69  KPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGPVAKECADL 128

Query: 135 WPRIASHAGTVV 146
           WPRIAS A ++V
Sbjct: 129 WPRIASAANSIV 140



>gi|225703828|gb|ACO07760.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
          Length = 140

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLY I+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYTISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|509391752|gb|AGN29657.1| 60S ribosomal protein L23 [Acartia hudsonica]
          Length = 140

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   +  G KFR++  LPV A+MNCADNTGAKNL+I+AV G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGAV-GAKFRISLALPVGAIMNCADNTGAKNLFIMAVGGIRGRLNRLPAACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKPELRKKVMPAVV+RQRK++RR+DGT IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVLATVKKGKPELRKKVMPAVVIRQRKTFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|392875054|gb|AFM86359.1| 60S ribosomal protein L23 [Callorhinchus milii]
          Length = 140

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 119/139 (85%), Gaps = 1/139 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLYII+  G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSC-GAKFRISLGLPVGAVINCADNTGAKNLYIISAKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRK++RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGT 144
           P+ KECADLWPRIAS+AG+
Sbjct: 120 PVAKECADLWPRIASNAGS 138



>gi|197260806|gb|ACH56903.1| 60S ribosomal protein L14/L17/L23 [Simulium vittatum]
          Length = 140

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV++CADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSA-GGKFRISLGLPVGAVIDCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M + TVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVVTVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A +V
Sbjct: 120 PVAKECADLWPRIASNASSV 139



>gi|50978792|ref|NP_001003100.1| 60S ribosomal protein L23 [Canis lupus familiaris]
 gi|62901063|sp|Q9XSU3.1|RL23_CANFA RecName: Full=60S ribosomal protein L23
 gi|5441537|emb|CAB46823.1| Ribosomal protein [Canis lupus familiaris]
          Length = 140

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP LRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPXLRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWP IAS+AG++
Sbjct: 120 PVXKECADLWPXIASNAGSI 139



>gi|291407371|ref|XP_002719902.1| PREDICTED: ribosomal protein L23-like [Oryctolagus cuniculus]
          Length = 140

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GL V AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GTKFRISLGLLVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWP+I S+AG++
Sbjct: 120 PVAKECADLWPKIVSNAGSI 139



>gi|225716984|gb|ACO14338.1| 60S ribosomal protein L23 [Esox lucius]
          Length = 140

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           M KRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MFKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG+V
Sbjct: 120 PVAKECADLWPRIASNAGSV 139



>gi|392587615|gb|EIW76949.1| ribosomal protein L17 [Coniophora puteana RWD-64-598 SS2]
          Length = 137

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 117/133 (87%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
           ++ GNK+RMT GLP  AV+NCADN+GAK+L+II   G+G+RLNRLP AGVGDMV+A+VKK
Sbjct: 5   ASAGNKYRMTLGLPTGAVLNCADNSGAKSLFIIEPYGFGARLNRLPDAGVGDMVVASVKK 64

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKK MP VVVRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECAD
Sbjct: 65  GKPELRKKTMPVVVVRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECAD 124

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS+AGTVV
Sbjct: 125 LWPRIASNAGTVV 137



>gi|212543433|ref|XP_002151871.1| 60S ribosomal protein L23 [Talaromyces marneffei ATCC 18224]
 gi|210066778|gb|EEA20871.1| alkaline serine protease [Talaromyces marneffei ATCC 18224]
          Length = 139

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (85%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  A+  GNK +MT GLPV AVMNC DN+GA+NLYII+V+G G+RLNRLP AGVGD
Sbjct: 1   MSKRGRGAA--GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVAGAGARLNRLPAAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKE A+LWPRIAS++G V+
Sbjct: 119 PVGKEAAELWPRIASNSGVVM 139



>gi|444318830|ref|XP_004180072.1| hypothetical protein TBLA_0D00430 [Tetrapisispora blattae CBS 6284]
 gi|387513114|emb|CCH60553.1| hypothetical protein TBLA_0D00430 [Tetrapisispora blattae CBS 6284]
          Length = 137

 Score =  214 bits (544), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 98/131 (74%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADN+GA+NLYIIAV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQAKSWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|465792739|emb|CCU97981.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 136

 Score =  214 bits (544), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 101/130 (77%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNK+RMT GLPV AVMNCADN+GAKNLY+IAV G G+ LNRLP A  GDM +A+VKKGKP
Sbjct: 7   GNKYRMTLGLPVGAVMNCADNSGAKNLYVIAVFGAGASLNRLPAASAGDMFVASVKKGKP 66

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPAV+VRQRK WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 67  ELRKKVMPAVIVRQRKPWRRGDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 126

Query: 137 RIASHAGTVV 146
           RIAS+AGTVV
Sbjct: 127 RIASNAGTVV 136



>gi|378727902|gb|EHY54361.1| 60S ribosomal protein L23 [Exophiala dermatitidis NIH/UT8656]
          Length = 140

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (85%), Gaps = 3/142 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  GNK +MT GLPV AVM+CADN+GA+NLYII+V G G+RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GNKLKMTLGLPVGAVMSCADNSGARNLYIISVKGIGARLNRLPAAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNPKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+GKE A+LWPRIAS++G V+
Sbjct: 119 GPVGKEAAELWPRIASNSGVVM 140



>gi|367011755|ref|XP_003680378.1| 60S ribosomal protein L23 [Torulaspora delbrueckii]
 gi|359748037|emb|CCE91167.1| hypothetical protein TDEL_0C02780 [Torulaspora delbrueckii]
          Length = 135

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (86%)

Query: 13  ASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVK 72
           +  +G KFR++ GLPV A+MNCADN+GA+NLYIIAV G GSRLNRLP A +GDMV+ATVK
Sbjct: 2   SGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVIATVK 61

Query: 73  KGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECA 132
           KGKPELRKKVMPA+VVRQ K WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECA
Sbjct: 62  KGKPELRKKVMPAIVVRQSKPWRRKDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECA 121

Query: 133 DLWPRIASHAGTVV 146
           DLWPR+AS++G VV
Sbjct: 122 DLWPRVASNSGVVV 135



>gi|119188963|ref|XP_001245088.1| 60S ribosomal protein L23 [Coccidioides immitis RS]
 gi|303323447|ref|XP_003071715.1| 60S ribosomal protein L23 [Coccidioides posadasii C735 delta SOWgp]
 gi|240111417|gb|EER29570.1| 60S ribosomal protein L23, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320035162|gb|EFW17104.1| alkaline serine protease [Coccidioides posadasii str. Silveira]
 gi|392867990|gb|EAS33714.2| 60S ribosomal protein L23 [Coccidioides immitis RS]
          Length = 140

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG     +GNK +MT GLPV AVMNC DN+GA+NLYII+V  WG+RLNRLP AGVGD
Sbjct: 1   MSKRG-RGGAQGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKAWGARLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKE A++WPRIAS++G V+
Sbjct: 120 PVGKEAAEMWPRIASNSGVVM 140



>gi|392877056|gb|AFM87360.1| 60S ribosomal protein L23 [Callorhinchus milii]
          Length = 140

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSC-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRK++RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKAYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLW RIAS+AG++
Sbjct: 120 PVAKECADLWSRIASNAGSI 139



>gi|320580111|gb|EFW94334.1| 60S ribosomal protein L23 [Ogataea parapolymorpha DL-1]
          Length = 137

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 115/130 (88%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LP  A+MNCADN+GA+NLY++AV G G+RLNRLP A VGDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPTGAIMNCADNSGARNLYVLAVKGTGARLNRLPAASVGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           +LRKKVMPA+VVRQ K+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+GKECADLWP
Sbjct: 68  DLRKKVMPAIVVRQAKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|452844236|gb|EME46170.1| hypothetical protein DOTSEDRAFT_70233 [Dothistroma septosporum
           NZE10]
          Length = 138

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 116/133 (87%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
           ST GNK +MT GLPV AVMNC DN+GA+NLYII+V G+G+RLNRLP AGVGDMV+ATVKK
Sbjct: 6   STSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGFGARLNRLPAAGVGDMVMATVKK 65

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+GKE A+
Sbjct: 66  GKPELRKKVMPAVIVRQSKPWRRADGVYLYFEDNAGVIVNPKGEMKGSAITGPVGKEAAE 125

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS++G V+
Sbjct: 126 LWPRIASNSGVVM 138



>gi|355754092|gb|EHH58057.1| 60S ribosomal protein L17, partial [Macaca fascicularis]
          Length = 136

 Score =  213 bits (543), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 120/137 (87%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 2   RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 58

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 59  ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 118

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWP+IAS+AG++
Sbjct: 119 KECADLWPQIASNAGSI 135



>gi|225704556|gb|ACO08124.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
          Length = 140

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           M KRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MFKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|365981431|ref|XP_003667549.1| ribosomal protein L23 [Naumovozyma dairenensis CBS 421]
 gi|365987263|ref|XP_003670463.1| ribosomal protein L23 [Naumovozyma dairenensis CBS 421]
 gi|343766315|emb|CCD22306.1| hypothetical protein NDAI_0A01480 [Naumovozyma dairenensis CBS 421]
 gi|343769233|emb|CCD25220.1| hypothetical protein NDAI_0E04030 [Naumovozyma dairenensis CBS 421]
          Length = 137

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/131 (74%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADNTGA+NLYIIAV G GSRL+RLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNTGARNLYIIAVKGSGSRLSRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ KSWRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKSWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|321458834|gb|EFX69895.1| hypothetical protein DAPPUDRAFT_300630 [Daphnia pulex]
          Length = 140

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTGAKNLY+IAV G   RLNRLP AGVGD
Sbjct: 1   MSKRG-RGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVYGVKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVM AVVVRQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMQAVVVRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS++ ++
Sbjct: 120 PVAKECADLWPRIASNSSSI 139



>gi|238883155|gb|EEQ46793.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 137

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV AVMNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSVSLPVGAVMNCADNSGARNLYVLAVKGTGARLNRLPAAAAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ K WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|448533425|ref|XP_003870635.1| Rpl23a ribosomal protein [Candida orthopsilosis Co 90-125]
 gi|354543045|emb|CCE39763.1| hypothetical protein CPAR2_601830 [Candida parapsilosis]
 gi|380354990|emb|CCG24506.1| Rpl23a ribosomal protein [Candida orthopsilosis]
          Length = 137

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV AVMNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPVGAVMNCADNSGARNLYVLAVKGTGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+VVRQ K WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVVRQAKPWRRRDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|255727366|ref|XP_002548609.1| 60S ribosomal protein L23 [Candida tropicalis MYA-3404]
 gi|240134533|gb|EER34088.1| 60S ribosomal protein L23 [Candida tropicalis MYA-3404]
 gi|459372961|gb|EMG50292.1| Ribosomal protein, large subunit, putative [Candida maltosa Xu316]
          Length = 137

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV AVMNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPVGAVMNCADNSGARNLYVLAVKGVGARLNRLPAAAAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ K WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|353235390|emb|CCA67404.1| probable RPL23A-60S large subunit ribosomal protein L23.e
           [Piriformospora indica DSM 11827]
          Length = 139

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 119/141 (84%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           M K+  AAS  G KFR+T GLPV AV+NCADN+GAK+LY+I   G G+RLNRLP A VGD
Sbjct: 1   MPKKVSAAS--GTKFRLTMGLPVGAVINCADNSGAKSLYVIEPYGTGARLNRLPDASVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +A+VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MFVASVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNAKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|296419434|ref|XP_002839313.1| 60S ribosomal protein L23 [Tuber melanosporum Mel28]
 gi|295635441|emb|CAZ83504.1| unnamed protein product [Tuber melanosporum]
          Length = 140

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (85%), Gaps = 3/138 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGAA   GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP AGVGDMV+
Sbjct: 6   RGGAA---GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGVGDMVM 62

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+G
Sbjct: 63  ATVKKGKPELRKKVMPAVVVRQSKPWRRADGVYLYFEDNAGVIVNPKGEMKGSAITGPVG 122

Query: 129 KECADLWPRIASHAGTVV 146
           KE ADLWPRIAS++G V+
Sbjct: 123 KEAADLWPRIASNSGVVM 140



>gi|395849372|ref|XP_003797302.1| PREDICTED: 60S ribosomal protein L23-like [Otolemur garnettii]
          Length = 140

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GEKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKPE RKKV PAVV+ QRKS+RR+DG  +YFEDNAGVIV+NKG+MKGS + G
Sbjct: 60  MVLATVKKGKPEFRKKVHPAVVIWQRKSYRRKDGVFLYFEDNAGVIVNNKGKMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|50308523|ref|XP_454264.1| 60S ribosomal protein L23 [Kluyveromyces lactis NRRL Y-1140]
 gi|49643399|emb|CAG99351.1| KLLA0E06997p [Kluyveromyces lactis]
          Length = 137

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/131 (74%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADN+GA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ K+WRR+DG  +YFEDNAGVI + KGEMKGS V GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKAWRRKDGVFLYFEDNAGVIANPKGEMKGSAVTGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PRIAS++G VV
Sbjct: 127 PRIASNSGVVV 137



>gi|453086049|gb|EMF14091.1| ribosomal protein L14b/L23e [Mycosphaerella populorum SO2202]
          Length = 140

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/142 (72%), Positives = 120/142 (84%), Gaps = 3/142 (2%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           + +KRGG   T G K +MT GLPV AVMNC DN+GA+NLYII+V G+G+RLNRLP AGVG
Sbjct: 2   SANKRGG---TSGQKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGFGARLNRLPAAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPELRKKVMPAVIVRQSKPWRRADGIYLYFEDNAGVIVNPKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+GKE A+LWPRIAS+AG V+
Sbjct: 119 GPVGKEAAELWPRIASNAGVVM 140



>gi|478262700|gb|ENN81247.1| hypothetical protein YQE_02341, partial [Dendroctonus ponderosae]
          Length = 140

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++  LPV AV+NCADNTGAKNLY+IAV G G RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLALPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MLVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|255712413|ref|XP_002552489.1| 60S ribosomal protein L23 [Lachancea thermotolerans]
 gi|363755174|ref|XP_003647802.1| hypothetical protein Ecym_7136 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|238933868|emb|CAR22051.1| KLTH0C06072p [Lachancea thermotolerans CBS 6340]
 gi|356891838|gb|AET40985.1| hypothetical protein Ecym_7136 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 137

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/131 (74%), Positives = 114/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADNTGA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNTGARNLYIMAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ K WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKPWRRKDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PRIAS++G VV
Sbjct: 127 PRIASNSGVVV 137



>gi|158187776|gb|ABW23177.1| ribosomal protein rpl23 [Arenicola marina]
          Length = 140

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 118/141 (83%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++  LPV AVMNCADNTGAKNLY+IAV G   RLNRLP AG GD
Sbjct: 1   MSKRG-RGGTAGGKFRISLALPVGAVMNCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKV+PAVV+RQRK  RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVIPAVVIRQRKPIRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+A +++
Sbjct: 120 PVAKECADLWPRIASNASSIL 140



>gi|149236241|ref|XP_001523998.1| 60S ribosomal protein L23 [Lodderomyces elongisporus NRRL YB-4239]
 gi|146452374|gb|EDK46630.1| 60S ribosomal protein L23 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 137

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV A+MNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPVGAIMNCADNSGARNLYVLAVKGVGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ K WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|167534168|ref|XP_001748762.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772724|gb|EDQ86372.1| predicted protein [Monosiga brevicollis MX1]
          Length = 383

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (86%), Gaps = 1/141 (0%)

Query: 5   TMSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           TMSKRG A   R +KFR++ GLPVAAVMNCADNTGAKNLY++AV+GWG+RLNR+P A +G
Sbjct: 243 TMSKRG-AGGGRVHKFRISLGLPVAAVMNCADNTGAKNLYVVAVNGWGARLNRMPAACIG 301

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DM +ATVKKGKPELRKKVMPAVV+RQRK +RR+DG ++YFEDNAGVIV+ KGEMKGS + 
Sbjct: 302 DMFVATVKKGKPELRKKVMPAVVIRQRKQFRRKDGGILYFEDNAGVIVNVKGEMKGSAIN 361

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KE AD WPRIAS A ++
Sbjct: 362 GPVAKEAADAWPRIASAAPSI 382



>gi|164449276|gb|ABY56104.1| ribosomal protein [Cucumis sativus]
          Length = 161

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/137 (75%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG+A   GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGDMV+
Sbjct: 27  RGGSA---GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM 83

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + GPIG
Sbjct: 84  ATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIG 143

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS A  +
Sbjct: 144 KECADLWPRIASAANAI 160



>gi|217075358|gb|ACJ86039.1| unknown [Medicago truncatula]
 gi|388519871|gb|AFK47997.1| unknown [Medicago truncatula]
          Length = 140

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (82%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A  GD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACAGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PI KECADLWPRIAS A  +V
Sbjct: 120 PIAKECADLWPRIASAANAIV 140



>gi|511011832|gb|EPB93037.1| 60S ribosomal protein L23 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 139

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/133 (76%), Positives = 113/133 (84%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
           S  G K+RMT GLPV AVMNCADN+GAKNLY+IAV     RLNRLP AG GDMV+ATVKK
Sbjct: 7   SVSGTKYRMTLGLPVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK 66

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKVM AVV+RQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECAD
Sbjct: 67  GKPELRKKVMAAVVIRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECAD 126

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS +GTVV
Sbjct: 127 LWPRIASASGTVV 139



>gi|225705444|gb|ACO08568.1| 60S ribosomal protein L23 [Oncorhynchus mykiss]
          Length = 140

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVRPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
            + KECADLWPRIAS+AG++
Sbjct: 120 LVAKECADLWPRIASNAGSI 139



>gi|357510141|ref|XP_003625359.1| 60S ribosomal protein L23 [Medicago truncatula]
 gi|355500374|gb|AES81577.1| 60S ribosomal protein L23 [Medicago truncatula]
          Length = 169

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (82%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A  GD
Sbjct: 30  MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACAGD 88

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 89  MVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 148

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PI KECADLWPRIAS A  +V
Sbjct: 149 PIAKECADLWPRIASAANAIV 169



>gi|256709331|gb|ACV21037.1| large subunit ribosomal protein 23 [Diplogastrellus gracilis]
          Length = 135

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 119/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAS---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPTAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQYRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|213514600|ref|NP_001134137.1| 60S ribosomal protein L23 [Salmo salar]
 gi|209730938|gb|ACI66338.1| 60S ribosomal protein L23 [Salmo salar]
          Length = 140

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISPGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNADSI 139



>gi|70909727|emb|CAJ17289.1| ribosomal protein L23e [Biphyllus lunatus]
          Length = 140

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++  LPV AV+N ADNTGAKNLY+IAV G G RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLALPVGAVINRADNTGAKNLYVIAVQGIGGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|452983731|gb|EME83489.1| hypothetical protein MYCFIDRAFT_52202 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 140

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
           +T GNK +MT GLPV AVMNC DN+GA+NLYII+V G+G+RLNRLP AGVGDMV+ATVKK
Sbjct: 8   NTSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGFGARLNRLPAAGVGDMVMATVKK 67

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+GKE A+
Sbjct: 68  GKPELRKKVMPAVIVRQSKPWRRADGVYLYFEDNAGVIVNPKGEMKGSAITGPVGKEAAE 127

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS++G V+
Sbjct: 128 LWPRIASNSGVVM 140



>gi|2982289|gb|AAC32130.1| 60S ribosomal protein L17 [Picea mariana]
          Length = 133

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGDMV+ATVKKGKP
Sbjct: 4   GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPAACVGDMVMATVKKGKP 63

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           +LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEMKGS + GPIGKECADLWP
Sbjct: 64  DLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWP 123

Query: 137 RIASHAGTVV 146
           RIAS A  +V
Sbjct: 124 RIASAANAIV 133



>gi|150982034|gb|ABR87219.1| large subunit ribosomal protein 23 [Pristionchus sp. 15 RS5229]
          Length = 135

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKVM AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVMQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|119498289|ref|XP_001265902.1| 60S ribosomal protein L23 [Neosartorya fischeri NRRL 181]
 gi|119414066|gb|EAW24005.1| alkaline serine protease [Neosartorya fischeri NRRL 181]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 3/142 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG GAAS  GNK +MT GLP  AVMNC DN+GA+NLYII+V G G+RLNRLP AGVG
Sbjct: 1   MSKRGRGAAS--GNKLKMTLGLPCGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + 
Sbjct: 59  DMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNAKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTVV 146
           GP+GKE A+LWPRIAS++G V+
Sbjct: 119 GPVGKEAAELWPRIASNSGVVM 140



>gi|110671520|gb|ABG82011.1| putative ribosomal protein L17/23 [Diaphorina citri]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++  LPV AV+NCADNTGAKNL++IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RRRDG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|156846013|ref|XP_001645895.1| hypothetical protein Kpol_1045p23 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116565|gb|EDO18037.1| hypothetical protein Kpol_1045p23 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 135

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADN+GA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 5   QGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGSRLNRLPAASLGDMVMATVKKGK 64

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ K+WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 65  PELRKKVMPAIVVRQSKAWRRKDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 124

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 125 PRVASNSGVVV 135



>gi|425769278|gb|EKV07775.1| Alkaline serine protease [Penicillium digitatum Pd1]
 gi|425770876|gb|EKV09336.1| Alkaline serine protease [Penicillium digitatum PHI26]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/143 (74%), Positives = 121/143 (84%), Gaps = 5/143 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP AGV
Sbjct: 1   MSKRGRGGAA---GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGV 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS +
Sbjct: 58  GDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTVV 146
            GP+GKE A+LWPRIAS++G V+
Sbjct: 118 TGPVGKEAAELWPRIASNSGVVM 140



>gi|154279732|ref|XP_001540679.1| 60S ribosomal protein L23 [Ajellomyces capsulatus NAm1]
 gi|295661284|ref|XP_002791197.1| 60S ribosomal protein L23 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|150412622|gb|EDN08009.1| hypothetical protein HCAG_04519 [Ajellomyces capsulatus NAm1]
 gi|225562716|gb|EEH10995.1| 60S ribosomal protein L23 [Ajellomyces capsulatus G186AR]
 gi|225680436|gb|EEH18720.1| 60S ribosomal protein L23 [Paracoccidioides brasiliensis Pb03]
 gi|226280759|gb|EEH36325.1| ribosomal protein L23e [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226292945|gb|EEH48365.1| ribosomal protein L23e [Paracoccidioides brasiliensis Pb18]
 gi|240279525|gb|EER43030.1| 60S ribosomal protein L23 [Ajellomyces capsulatus H143]
 gi|325092652|gb|EGC45962.1| 60S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/143 (74%), Positives = 120/143 (83%), Gaps = 5/143 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   GNK +MT GLPV AVMNC DN+GA+N+YII+V G G+RLNRLP AGV
Sbjct: 1   MSKRGRGGAA---GNKLKMTLGLPVGAVMNCCDNSGARNIYIISVKGIGARLNRLPAAGV 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS +
Sbjct: 58  GDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRADGIYLYFEDNAGVIVNAKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTVV 146
            GPIGKE  DLWPRIA+++G VV
Sbjct: 118 TGPIGKEATDLWPRIAANSGVVV 140



>gi|291394043|ref|XP_002713585.1| PREDICTED: ribosomal protein L23-like [Oryctolagus cuniculus]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 120/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KF+++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFQISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGK ELRKKV PAVV+RQRKS+RR+DG  +YFEDNA VIV+NKGEMKGS + G
Sbjct: 60  MVMATVKKGKLELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAEVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|160550241|gb|ABX44825.1| putative 60S ribosomal protein RPL23 [Flustra foliacea]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR+  GLPV AVMNCADN+GAKNLYIIAV G  S LNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GGKFRIALGLPVGAVMNCADNSGAKNLYIIAVFGVKSCLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MVLATVKKGKPELRKKVMPAVVVRQRK  RR+ G  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVLATVKKGKPELRKKVMPAVVVRQRKCIRRKHGQFVYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 120 PVAKECADLWPRIASNAGSI 139



>gi|121543837|gb|ABM55583.1| putative 60S ribosomal protein L23 [Maconellicoccus hirsutus]
          Length = 140

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNL++IAV G   RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLFVIAVHGVKGRLNRLPAAGCGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|344300098|gb|EGW30438.1| 60S ribosomal protein L23 [Spathaspora passalidarum NRRL Y-27907]
          Length = 137

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/130 (73%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV A+MNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPVGAIMNCADNSGARNLYVLAVKGIGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ K WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSKPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|50288181|ref|XP_446519.1| 60S ribosomal protein L23 [Candida glabrata CBS 138]
 gi|367001731|ref|XP_003685600.1| 60S ribosomal protein L23 [Tetrapisispora phaffii CBS 4417]
 gi|49525827|emb|CAG59446.1| unnamed protein product [Candida glabrata]
 gi|357523899|emb|CCE63166.1| hypothetical protein TPHA_0E00710 [Tetrapisispora phaffii CBS 4417]
          Length = 137

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADN+GA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ K+WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKAWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PR+AS++G VV
Sbjct: 127 PRVASNSGVVV 137



>gi|45200809|ref|NP_986379.1| 60S ribosomal protein L23 [Ashbya gossypii ATCC 10895]
 gi|44985507|gb|AAS54203.1| AGL288Wp [Ashbya gossypii ATCC 10895]
 gi|374109624|gb|AEY98529.1| FAGL288Wp [Ashbya gossypii FDAG1]
          Length = 137

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G KFR++ GLP  A+MNCADN+GA+NLYI+AV G GSRLNRLP A +GDMV+ATVKKGK
Sbjct: 7   QGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGSRLNRLPAASLGDMVMATVKKGK 66

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKKVMPA+VVRQ K WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKECADLW
Sbjct: 67  PELRKKVMPAIVVRQSKPWRRKDGVYLYFEDNAGVIANPKGEMKGSAITGPVGKECADLW 126

Query: 136 PRIASHAGTVV 146
           PRIAS++G VV
Sbjct: 127 PRIASNSGVVV 137



>gi|256709335|gb|ACV21039.1| large subunit ribosomal protein 23 [Koerneria sudhausi]
          Length = 135

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 119/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   G KFR++ GLPV AV+NCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAS---GAKFRISLGLPVGAVINCADNTGAKNLFVIAVYGIKGRLNRLPSAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|240849037|ref|NP_001155385.1| ribosomal protein L23-like [Acyrthosiphon pisum]
 gi|239799377|dbj|BAH70612.1| ACYPI000455 [Acyrthosiphon pisum]
          Length = 140

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++ GLPV AV+NCADNTGAKNL++IAV G   RLNRLP A  GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLGLPVGAVINCADNTGAKNLFVIAVQGIKGRLNRLPAAASGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|443705738|gb|ELU02136.1| hypothetical protein CAPTEDRAFT_172799 [Capitella teleta]
          Length = 140

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTG KNLY+IAV G   RLNRLP AG+GD
Sbjct: 1   MSKRG-RGGTSGGKFRISLGLPVGAVMNCADNTGGKNLYVIAVHGIRGRLNRLPAAGMGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M +ATVKKGKPELRKKVMPAVV+RQRK+ RR DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MFVATVKKGKPELRKKVMPAVVIRQRKAIRRIDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+GKECADLWPRIAS+A  +
Sbjct: 120 PVGKECADLWPRIASNASCI 139



>gi|384489793|gb|EIE81015.1| 60S ribosomal protein L23 [Rhizopus delemar RA 99-880]
 gi|384496240|gb|EIE86731.1| 60S ribosomal protein L23 [Rhizopus delemar RA 99-880]
          Length = 137

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/133 (76%), Positives = 113/133 (84%)

Query: 14  STRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKK 73
           S  G K+RMT GLPV AVMNCADN+GAKNLY+IAV     RLNRLP AG GDMV+ATVKK
Sbjct: 5   SVSGTKYRMTLGLPVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK 64

Query: 74  GKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECAD 133
           GKPELRKKV+ AVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECAD
Sbjct: 65  GKPELRKKVLAAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECAD 124

Query: 134 LWPRIASHAGTVV 146
           LWPRIAS +GTVV
Sbjct: 125 LWPRIASASGTVV 137



>gi|254578282|ref|XP_002495127.1| 60S ribosomal protein L23 [Zygosaccharomyces rouxii]
 gi|238938017|emb|CAR26194.1| ZYRO0B03960p [Zygosaccharomyces rouxii]
          Length = 136

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (86%)

Query: 12  AASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATV 71
           ++  +G KFR++ GLPV AV+NCADNTGA+NLY++AV G G+RLNRLP A +GDMV+ATV
Sbjct: 2   SSGAQGTKFRISLGLPVGAVLNCADNTGARNLYVVAVKGSGTRLNRLPAASLGDMVMATV 61

Query: 72  KKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKEC 131
           KKGKPELRKK+MPA+VVRQ K WRR+DG  +YFEDNAGVI + KGEMKGS + GP+GKEC
Sbjct: 62  KKGKPELRKKIMPAIVVRQAKPWRRKDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKEC 121

Query: 132 ADLWPRIASHAGTVV 146
           ADLWPR+AS++G VV
Sbjct: 122 ADLWPRVASNSGVVV 136



>gi|261199199|ref|XP_002626001.1| 60S ribosomal protein L23 [Ajellomyces dermatitidis SLH14081]
 gi|239595153|gb|EEQ77734.1| alkaline serine protease [Ajellomyces dermatitidis SLH14081]
 gi|239609745|gb|EEQ86732.1| alkaline serine protease [Ajellomyces dermatitidis ER-3]
          Length = 140

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (83%), Gaps = 5/143 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   GNK +MT GLPV AVMNC DN+GA+N+Y+I+V G G+RLNRLP AGV
Sbjct: 1   MSKRGRGGAA---GNKLKMTLGLPVGAVMNCCDNSGARNIYVISVKGIGARLNRLPAAGV 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS +
Sbjct: 58  GDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRADGIYLYFEDNAGVIVNAKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTVV 146
            GPIGKE  DLWPRIA+++G VV
Sbjct: 118 TGPIGKEATDLWPRIAANSGVVV 140



>gi|226442003|gb|ACO57591.1| ribosomal protein L23, partial [Gillichthys seta]
          Length = 131

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 3/134 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDMV+
Sbjct: 1   RGGSS---GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVM 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHA 142
           KECADLWPRIAS+A
Sbjct: 118 KECADLWPRIASNA 131



>gi|256709327|gb|ACV21035.1| large subunit ribosomal protein 23 [Acrostichus sp. RS5083]
          Length = 135

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 119/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG   T G+KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGG---TSGSKFRISLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPTAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGTVIYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTVIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+A ++
Sbjct: 118 KECADLWPRIASNAPSI 134



>gi|331230491|ref|XP_003327910.1| 60S ribosomal protein L23 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309306900|gb|EFP83491.1| 60S ribosomal protein L23 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 137

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 4/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS +  A++    KFRMT  LPV AV+NCADN+GAKNLYII+V G+G+RLNRLP A  GD
Sbjct: 1   MSNKAKAST----KFRMTLALPVGAVVNCADNSGAKNLYIISVVGFGARLNRLPAASCGD 56

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV  A++VRQRK WRRRDG  +YFEDNAGVIV+ KGEMKGS +AG
Sbjct: 57  MVMATVKKGKPELRKKVHVAIIVRQRKPWRRRDGIFLYFEDNAGVIVNPKGEMKGSAIAG 116

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 117 PVAKECADLWPRIASNAGTVV 137



>gi|170116680|ref|XP_001889530.1| 60S ribosomal protein L23 [Laccaria bicolor S238N-H82]
 gi|164635532|gb|EDQ99838.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 140

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 99/129 (76%), Positives = 114/129 (88%)

Query: 18  NKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKPE 77
            KFRMT GLPV AV+NCADN+GAK+L+II   G+G+ LNRLP AGVGDMV+A+VKKGKPE
Sbjct: 12  TKFRMTLGLPVGAVLNCADNSGAKSLFIIEPFGFGAHLNRLPDAGVGDMVVASVKKGKPE 71

Query: 78  LRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWPR 137
           LRKK MPAVVVRQRK+WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWPR
Sbjct: 72  LRKKTMPAVVVRQRKAWRRKDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWPR 131

Query: 138 IASHAGTVV 146
           IAS+AGTVV
Sbjct: 132 IASNAGTVV 140



>gi|150982032|gb|ABR87218.1| large subunit ribosomal protein 23 [Pristionchus sp. 14 RS5230]
 gi|479330835|gb|AGJ74544.1| large subunit ribosomal protein 23, partial [Pristionchus
           bucculentus]
          Length = 135

 Score =  211 bits (537), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|115442740|ref|XP_001218177.1| 60S ribosomal protein L23 [Aspergillus terreus NIH2624]
 gi|114188046|gb|EAU29746.1| 60S ribosomal protein L23 [Aspergillus terreus NIH2624]
          Length = 140

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   +  GNK +M+ GLPV AV+NC DN+GA+NLYIIAV+G G+RLNRLP AGVGD
Sbjct: 1   MSKRGRGGNA-GNKLKMSLGLPVGAVLNCCDNSGARNLYIIAVTGTGARLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+GKE A+LWPRIAS++G V+
Sbjct: 120 PVGKEAAELWPRIASNSGVVM 140



>gi|126135718|ref|XP_001384383.1| 60S ribosomal protein L23 [Scheffersomyces stipitis CBS 6054]
 gi|126091581|gb|ABN66354.1| ribosomal protein L14b/L23e [Scheffersomyces stipitis CBS 6054]
          Length = 137

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 96/130 (73%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LPV AVMNCADN+GA+NLY++AV G G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPVGAVMNCADNSGARNLYVLAVKGVGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+V+RQ + WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVIRQSRPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|344232108|gb|EGV63987.1| ribosomal protein L14b/L23e [Candida tenuis ATCC 10573]
 gi|344232109|gb|EGV63988.1| hypothetical protein CANTEDRAFT_121943 [Candida tenuis ATCC 10573]
          Length = 133

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 96/132 (72%), Positives = 115/132 (87%)

Query: 15  TRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKG 74
           + GNKFRM+ GLPV AV+NC DN+GA+NLYI+AV G+G++LNRLP A  GDMV+ATVKKG
Sbjct: 2   SSGNKFRMSLGLPVGAVLNCCDNSGARNLYILAVKGFGAKLNRLPAASAGDMVMATVKKG 61

Query: 75  KPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADL 134
           KPELRKKVMPA+VVRQ + WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADL
Sbjct: 62  KPELRKKVMPAIVVRQSRPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADL 121

Query: 135 WPRIASHAGTVV 146
           WPRIAS++G VV
Sbjct: 122 WPRIASNSGVVV 133



>gi|407919763|gb|EKG12988.1| Ribosomal protein L14b/L23e [Macrophomina phaseolina MS6]
          Length = 140

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 119/140 (85%), Gaps = 2/140 (1%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           SKRG AA+  GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP  GVGDM
Sbjct: 3   SKRGRAAT--GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAGGVGDM 60

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+ATVKKGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP
Sbjct: 61  VMATVKKGKPELRKKVMPAVIVRQSKPWRRGDGVFLYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 127 IGKECADLWPRIASHAGTVV 146
           +GKE A+LWPRIAS++G V+
Sbjct: 121 VGKEAAELWPRIASNSGVVM 140



>gi|255942907|ref|XP_002562222.1| Pc18g03860 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586955|emb|CAP94610.1| Pc18g03860 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 140

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (83%), Gaps = 5/143 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   GNK +MT GLP  AVMNC DN+GA+NLYII+V G G+RLNRLP AGV
Sbjct: 1   MSKRGRGGAA---GNKLKMTLGLPTGAVMNCCDNSGARNLYIISVKGIGARLNRLPAAGV 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMV+ATVKKGKPELRKKVMPAVVVRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS +
Sbjct: 58  GDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGVIVNAKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTVV 146
            GP+GKE A+LWPRIAS++G V+
Sbjct: 118 TGPVGKEAAELWPRIASNSGVVM 140



>gi|150982018|gb|ABR87211.1| large subunit ribosomal protein 23 [Pristionchus marianneae]
          Length = 135

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|150982014|gb|ABR87209.1| large subunit ribosomal protein 23 [Pristionchus aerivorus]
 gi|150982028|gb|ABR87216.1| large subunit ribosomal protein 23 [Pristionchus americanus]
          Length = 135

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|326428484|gb|EGD74054.1| ribosomal protein rpl23 [Salpingoeca sp. ATCC 50818]
          Length = 140

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 119/140 (85%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKR G A+ +GNKFRM+  LP  AVMNCADNTGAKNLY++AV G   RLNRLP A  GD
Sbjct: 1   MSKRTGGAN-KGNKFRMSLALPTQAVMNCADNTGAKNLYVVAVYGIKGRLNRLPAACCGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVV+RQRK++RR+DGT +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVVATVKKGKPELRKKVMPAVVIRQRKAFRRKDGTTVYFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECA+LWPRIAS A +V
Sbjct: 120 PVVKECAELWPRIASAAPSV 139



>gi|448091253|ref|XP_004197283.1| Piso0_004530 [Millerozyma farinosa CBS 7064]
 gi|448095735|ref|XP_004198314.1| Piso0_004530 [Millerozyma farinosa CBS 7064]
 gi|359378705|emb|CCE84964.1| Piso0_004530 [Millerozyma farinosa CBS 7064]
 gi|359379736|emb|CCE83933.1| Piso0_004530 [Millerozyma farinosa CBS 7064]
          Length = 137

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRMT GLP  A++NC DN+GA+NLYI+AV G+G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMTLGLPTGAILNCCDNSGARNLYILAVKGFGARLNRLPAAAAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+VVRQ + WRR+DG  +YFEDNAGV+V+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVVRQARPWRRKDGVFLYFEDNAGVVVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|150982036|gb|ABR87220.1| large subunit ribosomal protein 23 [Koerneria sp. RS1982]
          Length = 135

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   G KFR++ GLPV AV+NCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAS---GAKFRISLGLPVGAVINCADNTGAKNLFVIAVFGIKGRLNRLPSAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVVVRQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVVRQRKQYRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+A ++
Sbjct: 118 KECADLWPRIASNASSI 134



>gi|299739086|ref|XP_001835036.2| 60S ribosomal protein L23 [Coprinopsis cinerea okayama7#130]
 gi|298403616|gb|EAU86802.2| ribosomal protein L17 [Coprinopsis cinerea okayama7#130]
          Length = 138

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (87%)

Query: 16  RGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGK 75
           +G K+R+T GLP  AV+NCADN+GAK+LYII   G G+RLNRLP AGVGD+V+A+VKKGK
Sbjct: 8   QGTKYRLTMGLPTGAVINCADNSGAKSLYIIEPYGTGARLNRLPDAGVGDIVVASVKKGK 67

Query: 76  PELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLW 135
           PELRKK MPA++VRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLW
Sbjct: 68  PELRKKTMPAIIVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLW 127

Query: 136 PRIASHAGTVV 146
           PRIAS+AGTVV
Sbjct: 128 PRIASNAGTVV 138



>gi|256709329|gb|ACV21036.1| large subunit ribosomal protein 23 [Pseudodiplogasteroides sp.
           SB257]
          Length = 135

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 119/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG++   G KFR++  LPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGSS---GAKFRISLALPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPTAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DG+VIYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQYRRKDGSVIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|256709317|gb|ACV21030.1| large subunit ribosomal protein 23 [Micoletzkya sp. WEM-2009]
          Length = 135

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG A   G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGTA---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DG+VIYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQYRRKDGSVIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|150982004|gb|ABR87204.1| large subunit ribosomal protein 23 [Pristionchus lheritieri]
 gi|150982006|gb|ABR87205.1| large subunit ribosomal protein 23 [Pristionchus entomophagus]
 gi|150982008|gb|ABR87206.1| large subunit ribosomal protein 23 [Pristionchus uniformis]
 gi|150982012|gb|ABR87208.1| large subunit ribosomal protein 23 [Pristionchus sp. 4 RS5050]
 gi|150982030|gb|ABR87217.1| large subunit ribosomal protein 23 [Pristionchus sp. 13 RS5231]
          Length = 135

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR+T GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRITLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|255078342|ref|XP_002502751.1| predicted protein [Micromonas sp. RCC299]
 gi|226518017|gb|ACO64009.1| predicted protein [Micromonas sp. RCC299]
          Length = 140

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/141 (70%), Positives = 119/141 (84%), Gaps = 1/141 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRGG A++ G K++M+   PV AVMNCADNTGAKNLY+I+V  WGSRLNRLP A  G 
Sbjct: 1   MSKRGGGAAS-GTKYKMSIACPVGAVMNCADNTGAKNLYVISVKRWGSRLNRLPGASTGS 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV PA++VRQRK +RR+DG V+YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVFPAIMVRQRKPFRRKDGLVLYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS A ++V
Sbjct: 120 PVAKECADLWPRIASAANSIV 140



>gi|256709321|gb|ACV21032.1| large subunit ribosomal protein 23 [Myctolaimus sp. RS5442]
          Length = 135

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG A   G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGTA---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DG+VIYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQYRRKDGSVIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|164661623|ref|XP_001731934.1| hypothetical protein MGL_1202 [Malassezia globosa CBS 7966]
 gi|159105835|gb|EDP44720.1| hypothetical protein MGL_1202 [Malassezia globosa CBS 7966]
          Length = 136

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNK+RM+  LP  AV+NCADN+GAKNLY+IAV G G+RLNRLP A  GDM +A+VKKGKP
Sbjct: 7   GNKYRMSLALPAGAVINCADNSGAKNLYVIAVFGAGARLNRLPAASAGDMFVASVKKGKP 66

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPAVVVRQRK WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 67  ELRKKVMPAVVVRQRKPWRRGDGVFLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 126

Query: 137 RIASHAGTVV 146
           RIAS+AGTVV
Sbjct: 127 RIASNAGTVV 136



>gi|6006439|emb|CAB56830.1| 60S ribosomal protein L17 [Cyanophora paradoxa]
          Length = 135

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/138 (74%), Positives = 117/138 (84%), Gaps = 3/138 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   GNKFRMT GLPV AV+NCADNTGAKNLY+IAV G   RLNRLP A VGDMV+
Sbjct: 1   RGGAS---GNKFRMTLGLPVGAVVNCADNTGAKNLYVIAVKGVHGRLNRLPAATVGDMVM 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKVMPAV++RQ+    R+DG  I+FEDNAGVIV+ KGEMKGS + GP+G
Sbjct: 58  ATVKKGKPELRKKVMPAVIIRQKNRGARKDGVYIFFEDNAGVIVNPKGEMKGSAITGPVG 117

Query: 129 KECADLWPRIASHAGTVV 146
           KECADLWPRIAS AG++V
Sbjct: 118 KECADLWPRIASAAGSIV 135



>gi|150982002|gb|ABR87203.1| large subunit ribosomal protein 23 [Pristionchus maupasi]
          Length = 135

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 119/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT+I+FEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTLIFFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|472582967|gb|EMS20629.1| 60S ribosomal protein l23 [Rhodosporidium toruloides NP11]
          Length = 141

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/129 (76%), Positives = 112/129 (86%)

Query: 18  NKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKPE 77
           NKFRMT  LPV AVMNCADN+GAKNLY+IAV+  G+RLNRLP A  GDM + TVKKGKP+
Sbjct: 13  NKFRMTLALPVGAVMNCADNSGAKNLYVIAVTRSGARLNRLPAAAAGDMCMCTVKKGKPD 72

Query: 78  LRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWPR 137
           LRKKV PA+VVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWPR
Sbjct: 73  LRKKVHPAIVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAIQGPVAKECADLWPR 132

Query: 138 IASHAGTVV 146
           IAS+AGTVV
Sbjct: 133 IASNAGTVV 141



>gi|403414351|emb|CCM01051.1| predicted protein [Fibroporia radiculosa]
          Length = 159

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 121/161 (75%), Gaps = 22/161 (13%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG  AS  GNKFR+T GLP  AV+NCADN+GAK+L++I   G GS LNRLP AGVGD
Sbjct: 1   MSKRGAGAS--GNKFRLTLGLPTGAVLNCADNSGAKSLFVIEAFGTGSHLNRLPDAGVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFE-------------------- 105
           MV+A+VKKGKPELRKK MP VVVRQRKSWRRR+G V+YFE                    
Sbjct: 59  MVVASVKKGKPELRKKTMPVVVVRQRKSWRRREGLVLYFEVHANLFSHISLVYARIFKIQ 118

Query: 106 DNAGVIVSNKGEMKGSQVAGPIGKECADLWPRIASHAGTVV 146
           DNAGVIV+ KGEMKGS + GP+ KECADLWPRIAS+AGTVV
Sbjct: 119 DNAGVIVNPKGEMKGSAITGPVAKECADLWPRIASNAGTVV 159



>gi|256709313|gb|ACV21028.1| large subunit ribosomal protein 23 [Diplogasteriana schneideri]
          Length = 135

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG   T G+KFR++  LPV AVMNCADNTGAKNL++IAV G   RLNRLP A VGDM +
Sbjct: 1   RGG---TSGSKFRISLALPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPTAAVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQYRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|37779090|gb|AAP20205.1| ribosomal protein L17 [Pagrus major]
          Length = 143

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (84%), Gaps = 1/139 (0%)

Query: 7   SKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDM 66
           SKRG   S+ G KFR+  GLP  AV+NCADNTGAKNLYII+V G   RLNRLP AGVGDM
Sbjct: 5   SKRGRGGSS-GAKFRIALGLPGGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGDM 63

Query: 67  VLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGP 126
           V+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS + GP
Sbjct: 64  VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP 123

Query: 127 IGKECADLWPRIASHAGTV 145
           + KECADL PR+AS+AG++
Sbjct: 124 VAKECADLGPRMASNAGSI 142



>gi|50550357|ref|XP_502651.1| 60S ribosomal protein L23 [Yarrowia lipolytica]
 gi|49648519|emb|CAG80839.1| YALI0D10263p [Yarrowia lipolytica CLIB122]
          Length = 135

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/130 (73%), Positives = 113/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           G K++M+  LPV A+MNCADN+GA+NLY+IAV G G+RLNRLP AG GDMV+ATVKKGKP
Sbjct: 6   GTKYKMSMALPVGAIMNCADNSGARNLYVIAVKGCGARLNRLPAAGAGDMVMATVKKGKP 65

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+VVRQ K WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 66  ELRKKVMPAIVVRQSKPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 125

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 126 RIASNSGVVV 135



>gi|188572534|gb|ACD65173.1| putative 60S ribosomal protein RPL23 [Phoronis muelleri]
          Length = 140

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/140 (72%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G KFR++ GLPV AVMNCADNTGAKNLY+IAV G   RLNRLP A  GD
Sbjct: 1   MSKRG-RGGTSGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAAAGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           +V+ATVKKGKPELRKKVMPAVV+RQRKS RR+DG  ++FEDNAGVIV+ KGEMKGS + G
Sbjct: 60  LVVATVKKGKPELRKKVMPAVVIRQRKSIRRKDGVFLFFEDNAGVIVNVKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|387600371|gb|AFJ92675.1| large ribosomal protein 23, partial [Parapristionchus giblindavisi]
          Length = 135

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAS---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DG+ IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG +
Sbjct: 118 KECADLWPRIASNAGCI 134



>gi|332375604|gb|AEE62943.1| unknown [Dendroctonus ponderosae]
          Length = 140

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/140 (72%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  G KFR++  LPV AV+NCADNTGAKNLY+IAV G G RLNRLP AG GD
Sbjct: 1   MSKRGRGGSA-GAKFRISLALPVGAVINCADNTGAKNLYVIAVQGIGGRLNRLPAAGSGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M++ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MLVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNAKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADL PRIAS+A ++
Sbjct: 120 PVAKECADLCPRIASNASSI 139



>gi|294655716|ref|XP_457899.2| 60S ribosomal protein L23 [Debaryomyces hansenii CBS767]
 gi|199430550|emb|CAG85949.2| DEHA2C04884p [Debaryomyces hansenii CBS767]
          Length = 137

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 114/130 (87%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+ GLPV AV+NC DN+GA+NLYI++V G+G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLGLPVGAVVNCCDNSGARNLYIVSVKGFGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKK+MPA+VVRQ + WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKIMPAIVVRQARPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|189208225|ref|XP_001940446.1| 60S ribosomal protein L23 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|330916397|ref|XP_003297404.1| 60S ribosomal protein L23 [Pyrenophora teres f. teres 0-1]
 gi|187976539|gb|EDU43165.1| 60S ribosomal protein L23 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|311329944|gb|EFQ94512.1| hypothetical protein PTT_07797 [Pyrenophora teres f. teres 0-1]
 gi|451850806|gb|EMD64107.1| hypothetical protein COCSADRAFT_160353 [Bipolaris sorokiniana
           ND90Pr]
 gi|451996005|gb|EMD88472.1| hypothetical protein COCHEDRAFT_1142133 [Bipolaris maydis C5]
 gi|477583592|gb|ENI00689.1| hypothetical protein COCC4DRAFT_205246 [Bipolaris maydis ATCC
           48331]
 gi|482809747|gb|EOA86553.1| hypothetical protein SETTUDRAFT_162798 [Setosphaeria turcica Et28A]
          Length = 141

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/141 (70%), Positives = 116/141 (82%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MS + G  ST GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP  G GD
Sbjct: 1   MSGKRGRGSTSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAGGAGD 60

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 61  MVMATVKKGKPELRKKVMPAVIVRQSKPWRRADGIYLYFEDNAGVIVNPKGEMKGSAITG 120

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KE A+LWPRIAS++G V+
Sbjct: 121 PVAKEAAELWPRIASNSGVVM 141



>gi|256709333|gb|ACV21038.1| large subunit ribosomal protein 23 [Rhabditoides inermis]
          Length = 135

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 118/137 (86%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA+   G KFR++ GLPV AV+NCADNTGAKNL++IAV G   RLNRLP A VGDM +
Sbjct: 1   RGGAS---GAKFRISLGLPVGAVINCADNTGAKNLFVIAVFGIRGRLNRLPSAAVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|256709337|gb|ACV21040.1| large subunit ribosomal protein 23 [Tylopharynx sp. WEM-2009]
          Length = 135

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG A   G KFR++  LPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGQA---GAKFRISLALPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPTAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DG+ IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQYRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|22758906|gb|AAN05612.1| ribosomal protein L17A [Argopecten irradians]
          Length = 140

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG+A   G KFR++  LPV AV+NCADNTGAKNLY+IAV G   RLNR+P AG GDM++
Sbjct: 6   RGGSA---GGKFRISLALPVGAVINCADNTGAKNLYVIAVKGIKGRLNRMPAAGAGDMIV 62

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           ATVKKGKPELRKKVMPAVVVRQRKS RR++G  IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 63  ATVKKGKPELRKKVMPAVVVRQRKSVRRKNGVFIYFEDNAGVIVNNKGEMKGSAITGPVA 122

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+A ++
Sbjct: 123 KECADLWPRIASNASSI 139



>gi|296810872|ref|XP_002845774.1| 60S ribosomal protein L23 [Arthroderma otae CBS 113480]
 gi|238843162|gb|EEQ32824.1| 60S ribosomal protein L23 [Arthroderma otae CBS 113480]
          Length = 140

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (83%), Gaps = 5/143 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   GNK +MT GLPV AVMNC DN+GA+NLYII+V   G+RLNRLP AGV
Sbjct: 1   MSKRGRGGAA---GNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKATGARLNRLPAAGV 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMV+ATVKKGKPELRKKVMPAVVVRQ K W+R DG  +YFEDNAGVIV+ KGEMKGS +
Sbjct: 58  GDMVMATVKKGKPELRKKVMPAVVVRQSKPWKRPDGIFLYFEDNAGVIVNAKGEMKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTVV 146
            GP+GKE A+LWPRIAS++G V+
Sbjct: 118 TGPVGKEAAELWPRIASNSGVVM 140



>gi|150982026|gb|ABR87215.1| large subunit ribosomal protein 23 [Pristionchus sp. 11 RS5228]
          Length = 135

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|161671298|gb|ABX75501.1| ribosomal protein l23 [Lycosa singoriensis]
          Length = 140

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/140 (72%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG    T G K  ++ G PV AV+NCADNTGAKNLYIIAV+G   RLNRLP AG GD
Sbjct: 1   MSKRG-RGGTAGAKLPISLGSPVGAVINCADNTGAKNLYIIAVNGIKGRLNRLPAAGAGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAVV+RQRK +RR+DG  +YFEDNAGVIV+NKGEMKGS + G
Sbjct: 60  MVVATVKKGKPELRKKVMPAVVIRQRKPYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+A ++
Sbjct: 120 PVAKECADLWPRIASNASSI 139



>gi|150982000|gb|ABR87202.1| large subunit ribosomal protein 23 [Pristionchus pacificus]
 gi|150982024|gb|ABR87214.1| large subunit ribosomal protein 23 [Pristionchus sp. 10 RS5133]
 gi|390135435|gb|AFL56698.1| large subunit ribosomal protein 23, partial [Pristionchus
           exspectatus]
 gi|390135483|gb|AFL56722.1| large subunit ribosomal protein 23, partial [Pristionchus arcanus]
          Length = 135

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|398408834|ref|XP_003855882.1| 60S ribosomal protein L23 [Zymoseptoria tritici IPO323]
 gi|339475767|gb|EGP90858.1| hypothetical protein MYCGRDRAFT_102005 [Zymoseptoria tritici
           IPO323]
          Length = 139

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (85%)

Query: 13  ASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVK 72
           ++T GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP  GVGDMV+ATVK
Sbjct: 6   SNTSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAGGVGDMVMATVK 65

Query: 73  KGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECA 132
           KGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + GP+GKE A
Sbjct: 66  KGKPELRKKVMPAVIVRQSKPWRRGDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKEAA 125

Query: 133 DLWPRIASHAGTVV 146
           +LWPRIAS++G V+
Sbjct: 126 ELWPRIASNSGVVM 139



>gi|17369866|sp|Q9XEK8.1|RL23_TORRU RecName: Full=60S ribosomal protein L23; AltName: Full=L17
 gi|4574244|gb|AAD23966.1|AF108726_1 ribosomal protein L17 [Syntrichia ruralis]
          Length = 139

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (83%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ GNKFRM+ GLPV AV+NCADNTGAKNLY+I+ SG   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSS-GNKFRMSLGLPVGAVVNCADNTGAKNLYVIS-SGVRGRLNRLPAAAVGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKVMPAV+VRQRK WRR+DG  +YFEDNAGVIV+ KGEM  S + G
Sbjct: 59  MVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMNPSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           PIGKECADLWPRIAS A  +V
Sbjct: 119 PIGKECADLWPRIASAANAIV 139



>gi|256709309|gb|ACV21026.1| large subunit ribosomal protein 23 [Rhabditidoides sp. RS5443]
          Length = 135

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGG A   G KFR++  LPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGQA---GAKFRISLALPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPTAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
           A+VKKGKPELRKKV+ AVV+RQRK +RR+DG+ IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  ASVKKGKPELRKKVLQAVVIRQRKQFRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|428172426|gb|EKX41335.1| large subunit ribosomal protein L23e, cytoplasmic [Guillardia theta
           CCMP2712]
          Length = 138

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 116/141 (82%), Gaps = 3/141 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSK+    +T GNKFR + GLP +AVMNCADNTGAKNLYIIAV G   RLN+LP A VG 
Sbjct: 1   MSKK---VATAGNKFRTSLGLPTSAVMNCADNTGAKNLYIIAVKGVKGRLNKLPAATVGS 57

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M + +VKKGKPELRKKVMP +VVRQRK+ RRRDG V+YFEDNAGVIV+ KGEMKGS V G
Sbjct: 58  MCMCSVKKGKPELRKKVMPGIVVRQRKTIRRRDGMVLYFEDNAGVIVNPKGEMKGSAVTG 117

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS AGT+V
Sbjct: 118 PVAKECADLWPRIASAAGTIV 138



>gi|150982020|gb|ABR87212.1| large subunit ribosomal protein 23 [Pristionchus pauli]
          Length = 135

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|146414359|ref|XP_001483150.1| 60S ribosomal protein L23 [Meyerozyma guilliermondii ATCC 6260]
 gi|146392849|gb|EDK41007.1| 60S ribosomal protein L23 [Meyerozyma guilliermondii ATCC 6260]
          Length = 137

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 112/130 (86%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           GNKFRM+  LP  AVMNC DN+GA+NLY++AV G+G+RLNRLP A  GDMV+ATVKKGKP
Sbjct: 8   GNKFRMSLALPTGAVMNCCDNSGARNLYVLAVKGFGARLNRLPAASAGDMVMATVKKGKP 67

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKVMPA+VVRQ + WRR+DG  +YFEDNAGVIV+ KGEMKGS + GP+ KECADLWP
Sbjct: 68  ELRKKVMPAIVVRQARPWRRKDGVYLYFEDNAGVIVNPKGEMKGSAITGPVAKECADLWP 127

Query: 137 RIASHAGTVV 146
           RIAS++G VV
Sbjct: 128 RIASNSGVVV 137



>gi|150982010|gb|ABR87207.1| large subunit ribosomal protein 23 [Pristionchus sp. 3 CZ3975]
          Length = 135

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|303283132|ref|XP_003060857.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457208|gb|EEH54507.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 141

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 115/141 (81%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG      G K++M+   PV AVMNCADNTGAKNLY+IAV  WGSRLNR+P A  G 
Sbjct: 1   MSKRGSGGIASGTKYKMSIACPVGAVMNCADNTGAKNLYVIAVKRWGSRLNRIPGASTGG 60

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV PA+VVRQRK +RR+DG VIYFEDNAGVIV+ KGEMKGS + G
Sbjct: 61  MVMATVKKGKPDLRKKVFPAIVVRQRKPFRRKDGLVIYFEDNAGVIVNPKGEMKGSAITG 120

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS A +++
Sbjct: 121 PVAKECADLWPRIASAANSIM 141



>gi|156394964|ref|XP_001636882.1| predicted protein [Nematostella vectensis]
 gi|156223989|gb|EDO44819.1| predicted protein [Nematostella vectensis]
          Length = 136

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 113/135 (83%)

Query: 11  GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLAT 70
           G   T G KFR+  GLPV AV+NCADNTG KNLYIIAV G   RLNRLP A  GDMVLAT
Sbjct: 1   GRGGTSGGKFRIALGLPVGAVINCADNTGGKNLYIIAVKGIKGRLNRLPAAASGDMVLAT 60

Query: 71  VKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKE 130
           VKKGKPELRKKVMPAVV+RQRK++RR++G  +YFEDNAGVIV+ KGEMKGS + GP+ KE
Sbjct: 61  VKKGKPELRKKVMPAVVIRQRKAYRRKNGVFLYFEDNAGVIVNVKGEMKGSAITGPVAKE 120

Query: 131 CADLWPRIASHAGTV 145
           CADLWPRIAS+AG++
Sbjct: 121 CADLWPRIASNAGSI 135



>gi|17554750|ref|NP_498231.1| Protein RPL-23 [Caenorhabditis elegans]
 gi|268571789|ref|XP_002641149.1| C. briggsae CBR-RPL-23 protein [Caenorhabditis briggsae]
 gi|308497528|ref|XP_003110951.1| CRE-RPL-23 protein [Caenorhabditis remanei]
 gi|1350671|sp|P48158.1|RL23_CAEEL RecName: Full=60S ribosomal protein L23
 gi|308242831|gb|EFO86783.1| CRE-RPL-23 protein [Caenorhabditis remanei]
 gi|341883922|gb|EGT39857.1| CBN-RPL-23 protein [Caenorhabditis brenneri]
 gi|351065565|emb|CCD61530.1| Protein RPL-23 [Caenorhabditis elegans]
          Length = 140

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 3/141 (2%)

Query: 6   MSKRG-GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVG 64
           MSKRG G AS  G KFR++ GLPV AVMNCADNTGAKNL++I+V G   RLNRLP AGVG
Sbjct: 1   MSKRGRGGAS--GAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVG 58

Query: 65  DMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVA 124
           DM + +VKKGKPELRKKV+  VV+RQRK +RR+DGT IYFEDNAGVIV+NKGEMKGS + 
Sbjct: 59  DMFVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAIT 118

Query: 125 GPIGKECADLWPRIASHAGTV 145
           GP+ KECADLWPRIA++AG++
Sbjct: 119 GPVAKECADLWPRIAANAGSI 139



>gi|224007988|ref|XP_002292953.1| protein 23 of the large ribosomal subunit [Thalassiosira pseudonana
           CCMP1335]
 gi|220971079|gb|EED89414.1| protein 23 of the large ribosomal subunit [Thalassiosira pseudonana
           CCMP1335]
          Length = 145

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 120/136 (88%)

Query: 11  GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLAT 70
           G A+  G K R+  GLPVAAV+NCADN+GAKNL+IIAV   G RLNRLPKAG GDMV+A+
Sbjct: 10  GRAAASGIKHRVAAGLPVAAVINCADNSGAKNLHIIAVCNIGGRLNRLPKAGSGDMVMAS 69

Query: 71  VKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKE 130
           +KKGKPELRKKVMPA++VRQRKS+RR++G  I+FED+AGVIV+NKGEMKGS V+GP+ KE
Sbjct: 70  IKKGKPELRKKVMPAIIVRQRKSFRRKEGVFIHFEDSAGVIVNNKGEMKGSAVSGPVAKE 129

Query: 131 CADLWPRIASHAGTVV 146
           CA+LWPRIAS+AG++V
Sbjct: 130 CAELWPRIASNAGSIV 145



>gi|409043839|gb|EKM53321.1| hypothetical protein PHACADRAFT_259596 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 139

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (82%), Gaps = 2/141 (1%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKR   AS  G K+RMT GLP  AV+NCADN+GAK+L++I   G G+RLNRLP A  GD
Sbjct: 1   MSKRVVGAS--GQKYRMTLGLPTGAVLNCADNSGAKSLFVIEPYGTGARLNRLPAACAGD 58

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           M+L +VKKGKPELRKK MPAVVVRQRK+WRRRDG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 59  MILCSVKKGKPELRKKTMPAVVVRQRKAWRRRDGVFLYFEDNAGVIVNPKGEMKGSAITG 118

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KECADLWPRIAS+AGTVV
Sbjct: 119 PVAKECADLWPRIASNAGTVV 139



>gi|188572437|gb|ACD65125.1| putative 60S ribosomal protein RPL23 [Novocrania anomala]
          Length = 140

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%)

Query: 20  FRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKPELR 79
           FR++ GLPV AV+NCADNTG KNLYIIAV G   RLNR+P A  GDMV+ATVKKGKPELR
Sbjct: 14  FRISIGLPVGAVINCADNTGGKNLYIIAVHGIKGRLNRMPAAASGDMVMATVKKGKPELR 73

Query: 80  KKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWPRIA 139
           KKVMPAVV+RQRK +RR+DG  IYFEDNAGVIV+NKGEMKGS + GP+ KECADLWPRIA
Sbjct: 74  KKVMPAVVIRQRKPYRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGPVSKECADLWPRIA 133

Query: 140 SHAGTV 145
           +HAG++
Sbjct: 134 AHAGSI 139



>gi|86355131|dbj|BAE78800.1| ribosomal protein L23 [Pelodiscus sinensis]
          Length = 136

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 118/140 (84%), Gaps = 5/140 (3%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV+NCADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKV PAVV+RQRKS+RR+DG  +YFEDNAGVI    GEMKGS + G
Sbjct: 60  MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVI----GEMKGSAITG 115

Query: 126 PIGKECADLWPRIASHAGTV 145
           P+ KECADLWPRIAS+AG++
Sbjct: 116 PVAKECADLWPRIASNAGSI 135



>gi|169595466|ref|XP_001791157.1| hypothetical protein SNOG_00472 [Phaeosphaeria nodorum SN15]
 gi|111070847|gb|EAT91967.1| hypothetical protein SNOG_00472 [Phaeosphaeria nodorum SN15]
          Length = 141

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 116/141 (82%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           M+ + G  S+ GNK +MT GLPV AVMNC DN+GA+NLYII+V G G+RLNRLP  G GD
Sbjct: 1   MASKRGRGSSSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAGGAGD 60

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKPELRKKVMPAV+VRQ K WRR DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 61  MVMATVKKGKPELRKKVMPAVIVRQSKPWRRADGVFLYFEDNAGVIVNPKGEMKGSAITG 120

Query: 126 PIGKECADLWPRIASHAGTVV 146
           P+ KE A+LWPRIAS++G V+
Sbjct: 121 PVAKEAAELWPRIASNSGVVM 141



>gi|332207802|ref|XP_003252985.1| PREDICTED: 60S ribosomal protein L23-like isoform 1 [Nomascus
           leucogenys]
 gi|441638198|ref|XP_004090117.1| PREDICTED: 60S ribosomal protein L23-like isoform 2 [Nomascus
           leucogenys]
          Length = 142

 Score =  207 bits (528), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 3/142 (2%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S+ G KFR++ GLPV AV++CADNTGAKNLYII+V G   RLNRLP AGVGD
Sbjct: 1   MSKRGRGGSS-GAKFRISLGLPVGAVISCADNTGAKNLYIISVKGIKGRLNRLPAAGVGD 59

Query: 66  MVLATVKKGKPELRKK--VMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           MV+ATVKKGKPELRKK  V PAVV+RQRKS+RR+DG  +YFEDNAGVIV+NKGEMKGS +
Sbjct: 60  MVMATVKKGKPELRKKKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAI 119

Query: 124 AGPIGKECADLWPRIASHAGTV 145
            GP+ KECADLWP IAS+AG++
Sbjct: 120 TGPVAKECADLWPWIASNAGSI 141



>gi|225709460|gb|ACO10576.1| 60S ribosomal protein L23 [Caligus rogercresseyi]
          Length = 140

 Score =  207 bits (528), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 105/142 (73%), Positives = 121/142 (85%), Gaps = 5/142 (3%)

Query: 6   MSKRG--GAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGV 63
           MSKRG  GAA   G KFR++ GLPV AV+NCADNTGAKNLYIIAV G   RLNRLP AG 
Sbjct: 1   MSKRGRGGAA---GAKFRISLGLPVGAVINCADNTGAKNLYIIAVGGIRGRLNRLPAAGN 57

Query: 64  GDMVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQV 123
           GDMVLATVKKGKPELRKKV+PAVV+RQRK++RR+ GT +YFEDNAGVIV++KGE KGS +
Sbjct: 58  GDMVLATVKKGKPELRKKVLPAVVIRQRKTFRRKCGTFLYFEDNAGVIVNSKGETKGSAI 117

Query: 124 AGPIGKECADLWPRIASHAGTV 145
            GP+ KECADLWPRIA+ AG++
Sbjct: 118 TGPVSKECADLWPRIATLAGSI 139



>gi|150982022|gb|ABR87213.1| large subunit ribosomal protein 23 [Pristionchus pseudaerivorus]
          Length = 135

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 117/137 (85%), Gaps = 3/137 (2%)

Query: 9   RGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVL 68
           RGGA    G KFR++ GLPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +
Sbjct: 1   RGGAC---GAKFRVSLGLPVGAVMNCADNTGAKNLFVIAVFGIRGRLNRLPAAGVGDMFV 57

Query: 69  ATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIG 128
            +VKKGKPELRKKV+ AVV+RQRK +RR+DGT I+FEDNAGVIV+NKGEMKGS + GP+ 
Sbjct: 58  CSVKKGKPELRKKVLQAVVIRQRKQFRRKDGTFIFFEDNAGVIVNNKGEMKGSAITGPVA 117

Query: 129 KECADLWPRIASHAGTV 145
           KECADLWPRIAS+AG++
Sbjct: 118 KECADLWPRIASNAGSI 134



>gi|256709311|gb|ACV21027.1| large subunit ribosomal protein 23 [Mononchoides sp. RS5441]
          Length = 135

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 113/129 (87%)

Query: 17  GNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGDMVLATVKKGKP 76
           G KFR++  LPV AVMNCADNTGAKNL++IAV G   RLNRLP AGVGDM +A+VKKGKP
Sbjct: 6   GAKFRISLALPVGAVMNCADNTGAKNLFVIAVYGIRGRLNRLPTAGVGDMFVASVKKGKP 65

Query: 77  ELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAGPIGKECADLWP 136
           ELRKKV+ AVV+RQRK +RR+DG+ IYFEDNAGVIV+NKGEMKGS + GP+ KECADLWP
Sbjct: 66  ELRKKVLQAVVIRQRKQYRRKDGSFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWP 125

Query: 137 RIASHAGTV 145
           RIAS+AG++
Sbjct: 126 RIASNAGSI 134



>gi|449468582|ref|XP_004152000.1| PREDICTED: 60S ribosomal protein L23-like [Cucumis sativus]
          Length = 140

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 102/140 (72%), Positives = 114/140 (81%), Gaps = 1/140 (0%)

Query: 6   MSKRGGAASTRGNKFRMTCGLPVAAVMNCADNTGAKNLYIIAVSGWGSRLNRLPKAGVGD 65
           MSKRG   S  GNKFRM+ GLPVAA +NCADNTGAKNLYII+V G   RLNRLP A VGD
Sbjct: 1   MSKRGRGGSA-GNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGD 59

Query: 66  MVLATVKKGKPELRKKVMPAVVVRQRKSWRRRDGTVIYFEDNAGVIVSNKGEMKGSQVAG 125
           MV+ATVKKGKP+LRKKV+PAV+ RQ   W R+DG  +YFEDNAGVIV+ KGEMKGS + G
Sbjct: 60  MVMATVKKGKPDLRKKVLPAVIARQSNPWHRKDGVFMYFEDNAGVIVNPKGEMKGSAITG 119

Query: 126 PIGKECADLWPRIASHAGTV 145
           PIGKECADLWPRIAS A  +
Sbjct: 120 PIGKECADLWPRIASAANAI 139