BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10048_c0_seq1-m.18 5prime_partial 403-2349(-) 649 (-)
         (648 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384501963|gb|EIE92454.1| hypothetical protein RO3G_16976 [Rhi...   573   e-161   Rhizopus delemar RA 99-880
gi|511011063|gb|EPB92277.1| hypothetical protein HMPREF1544_0084...   561   e-157   Mucor circinelloides f. circinelloides 1006PhL
gi|384495647|gb|EIE86138.1| hypothetical protein RO3G_10849 [Rhi...   554   e-155   Rhizopus delemar RA 99-880
gi|511006225|gb|EPB87542.1| hypothetical protein HMPREF1544_0563...   543   e-152   Mucor circinelloides f. circinelloides 1006PhL
gi|384499448|gb|EIE89939.1| hypothetical protein RO3G_14650 [Rhi...   534   e-149   Rhizopus delemar RA 99-880
gi|510999790|gb|EPB81381.1| hypothetical protein HMPREF1544_1191...   514   e-143   Mucor circinelloides f. circinelloides 1006PhL
gi|384499555|gb|EIE90046.1| hypothetical protein RO3G_14757 [Rhi...   511   e-142   Rhizopus delemar RA 99-880
gi|358059825|dbj|GAA94471.1| hypothetical protein E5Q_01123 [Mix...   500   e-139   Mixia osmundae IAM 14324
gi|225560596|gb|EEH08877.1| CBS and PB1 domain-containing protei...   500   e-139   Histoplasma capsulatum G186AR
gi|388852932|emb|CCF53380.1| uncharacterized protein [Ustilago h...   499   e-139   Ustilago hordei
gi|402220904|gb|EJU00974.1| CBS-domain-containing protein [Dacry...   499   e-139   Dacryopinax primogenitus
gi|320038151|gb|EFW20087.1| CBS and PB1 domain-containing protei...   499   e-138   Coccidioides posadasii str. Silveira
gi|303316684|ref|XP_003068344.1| CBS/PB1 domain-containing prote...   499   e-138   Coccidioides posadasii C735 delta SOWgp
gi|258576507|ref|XP_002542435.1| conserved hypothetical protein ...   498   e-138   Uncinocarpus reesii 1704
gi|331220075|ref|XP_003322713.1| hypothetical protein PGTG_04250...   498   e-138   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|295659197|ref|XP_002790157.1| CBS/PB1 domain-containing prote...   496   e-138   Paracoccidioides lutzii Pb01
gi|71006334|ref|XP_757833.1| hypothetical protein UM01686.1 [Ust...   496   e-138   
gi|67539092|ref|XP_663320.1| hypothetical protein AN5716.2 [Aspe...   496   e-138   Aspergillus nidulans FGSC A4
gi|328854683|gb|EGG03814.1| hypothetical protein MELLADRAFT_1172...   496   e-138   Melampsora larici-populina 98AG31
gi|482813228|gb|EOA89932.1| hypothetical protein SETTUDRAFT_1676...   496   e-137   Setosphaeria turcica Et28A
gi|119187931|ref|XP_001244572.1| CBS/PB1 domain-containing prote...   495   e-137   Coccidioides immitis RS
gi|449550757|gb|EMD41721.1| hypothetical protein CERSUDRAFT_1102...   494   e-137   Gelatoporia subvermispora B
gi|452005050|gb|EMD97506.1| hypothetical protein COCHEDRAFT_1190...   494   e-137   Bipolaris maydis C5
gi|384494220|gb|EIE84711.1| hypothetical protein RO3G_09421 [Rhi...   494   e-137   Rhizopus delemar RA 99-880
gi|358373443|dbj|GAA90041.1| CBS and PB1 domain protein [Aspergi...   494   e-137   Aspergillus kawachii IFO 4308
gi|212528298|ref|XP_002144306.1| CBS/PB1 domain-containing prote...   494   e-137   Talaromyces marneffei ATCC 18224
gi|406864620|gb|EKD17664.1| ribosomal protein subunit S4 [Marsso...   493   e-137   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|255935165|ref|XP_002558609.1| Pc13g01640 [Penicillium chrysog...   493   e-137   Penicillium rubens Wisconsin 54-1255
gi|343428370|emb|CBQ71900.1| conserved hypothetical protein [Spo...   493   e-137   Sporisorium reilianum SRZ2
gi|451855607|gb|EMD68899.1| hypothetical protein COCSADRAFT_1351...   493   e-137   Bipolaris sorokiniana ND90Pr
gi|317037370|ref|XP_001399033.2| CBS/PB1 domain-containing prote...   493   e-136   Aspergillus niger CBS 513.88
gi|440634832|gb|ELR04751.1| hypothetical protein GMDG_06979 [Geo...   492   e-136   Pseudogymnoascus destructans 20631-21
gi|134084625|emb|CAK97501.1| unnamed protein product [Aspergillu...   492   e-136   Aspergillus niger
gi|501307313|dbj|GAC96281.1| hypothetical protein PHSY_003861 [P...   491   e-136   Pseudozyma hubeiensis SY62
gi|471563439|gb|EMR64693.1| putative mitochondrial ribosomal pro...   491   e-136   Eutypa lata UCREL1
gi|342874129|gb|EGU76199.1| hypothetical protein FOXB_13271 [Fus...   491   e-136   Fusarium oxysporum Fo5176
gi|119496427|ref|XP_001264987.1| CBS/PB1 domain-containing prote...   490   e-136   Aspergillus fischeri NRRL 181
gi|261206284|ref|XP_002627879.1| CBS/PB1 domain-containing prote...   489   e-136   Blastomyces gilchristii SLH14081
gi|317142635|ref|XP_001818994.2| CBS/PB1 domain-containing prote...   489   e-135   Aspergillus oryzae RIB40
gi|238501480|ref|XP_002381974.1| CBS/PB1 domain-containing prote...   489   e-135   Aspergillus flavus NRRL3357
gi|378725744|gb|EHY52203.1| hypothetical protein HMPREF1120_0041...   488   e-135   Exophiala dermatitidis NIH/UT8656
gi|393218841|gb|EJD04329.1| CBS-domain-containing protein [Fomit...   488   e-135   Fomitiporia mediterranea MF3/22
gi|353227418|emb|CCA77926.1| hypothetical protein PIIN_00640 [Pi...   488   e-135   Serendipita indica DSM 11827
gi|472236462|gb|EMR81395.1| putative cbs pb1 domain-containing p...   487   e-135   Botrytis cinerea BcDW1
gi|350630805|gb|EHA19177.1| hypothetical protein ASPNIDRAFT_5422...   487   e-135   Aspergillus niger ATCC 1015
gi|240280165|gb|EER43669.1| CBS and PB1 protein [Ajellomyces cap...   487   e-135   Histoplasma capsulatum H143
gi|225680402|gb|EEH18686.1| CBS and PB1 domain-containing protei...   487   e-135   
gi|154301338|ref|XP_001551082.1| CBS/PB1 domain-containing prote...   486   e-135   Botrytis cinerea B05.10
gi|164656969|ref|XP_001729611.1| hypothetical protein MGL_3155 [...   486   e-135   Malassezia globosa CBS 7966
gi|494828397|gb|EON65238.1| hypothetical protein W97_04475 [Coni...   486   e-135   Coniosporium apollinis CBS 100218
gi|326472832|gb|EGD96841.1| CBS and PB1 domain-containing protei...   486   e-134   Trichophyton tonsurans CBS 112818
gi|242766797|ref|XP_002341242.1| CBS/PB1 domain-containing prote...   486   e-134   Talaromyces stipitatus ATCC 10500
gi|392597207|gb|EIW86529.1| CBS-domain-containing protein [Conio...   485   e-134   Coniophora puteana RWD-64-598 SS2
gi|407923859|gb|EKG16922.1| Phox/Bem1p [Macrophomina phaseolina ...   485   e-134   Macrophomina phaseolina MS6
gi|46123863|ref|XP_386485.1| hypothetical protein FG06309.1 [Fus...   485   e-134   
gi|425769641|gb|EKV08130.1| hypothetical protein PDIP_69880 [Pen...   485   e-134   Penicillium digitatum Pd1
gi|156039609|ref|XP_001586912.1| CBS/PB1 domain-containing prote...   485   e-134   Sclerotinia sclerotiorum 1980 UF-70
gi|408399597|gb|EKJ78696.1| hypothetical protein FPSE_01184 [Fus...   485   e-134   Fusarium pseudograminearum CS3096
gi|169618018|ref|XP_001802423.1| hypothetical protein SNOG_12196...   484   e-134   Parastagonospora nodorum SN15
gi|426201879|gb|EKV51802.1| hypothetical protein AGABI2DRAFT_190...   484   e-134   Agaricus bisporus var. bisporus H97
gi|400601710|gb|EJP69335.1| CBS domain-containing protein [Beauv...   484   e-134   Beauveria bassiana ARSEF 2860
gi|115389224|ref|XP_001212117.1| CBS/PB1 domain-containing prote...   484   e-134   Aspergillus terreus NIH2624
gi|327294133|ref|XP_003231762.1| CBS/PB1 domain-containing prote...   484   e-134   Trichophyton rubrum CBS 118892
gi|330932518|ref|XP_003303808.1| CBS/PB1 domain-containing prote...   484   e-134   Pyrenophora teres f. teres 0-1
gi|485928003|gb|EOD51829.1| putative cbs and pb1 domain containi...   484   e-134   Neofusicoccum parvum UCRNP2
gi|390604204|gb|EIN13595.1| CBS-domain-containing protein [Punct...   484   e-134   Punctularia strigosozonata HHB-11173 SS5
gi|395334117|gb|EJF66493.1| CBS-domain-containing protein [Dicho...   484   e-134   Dichomitus squalens LYAD-421 SS1
gi|409083070|gb|EKM83427.1| hypothetical protein AGABI1DRAFT_812...   484   e-134   Agaricus bisporus var. burnettii JB137-S8
gi|302503214|ref|XP_003013567.1| hypothetical protein ARB_00014 ...   483   e-133   Arthroderma benhamiae CBS 112371
gi|500253651|gb|EON97320.1| putative mitochondrial ribosomal pro...   482   e-133   Phaeoacremonium minimum UCRPA7
gi|299755073|ref|XP_001828409.2| CBS and PB1 domain-containing p...   482   e-133   Coprinopsis cinerea okayama7#130
gi|70991156|ref|XP_750427.1| CBS and PB1 domain protein [Aspergi...   481   e-133   Aspergillus fumigatus Af293
gi|396483815|ref|XP_003841796.1| similar to CBS and PB1 domain c...   481   e-133   Leptosphaeria maculans JN3
gi|189194755|ref|XP_001933716.1| CBS/PB1 domain-containing prote...   481   e-133   Pyrenophora tritici-repentis Pt-1C-BFP
gi|320590954|gb|EFX03395.1| cbs and pb1 domain containing protei...   481   e-133   Grosmannia clavigera kw1407
gi|226287801|gb|EEH43314.1| CBS and PB1 domain-containing protei...   481   e-133   
gi|302697565|ref|XP_003038461.1| hypothetical protein SCHCODRAFT...   481   e-133   Schizophyllum commune H4-8
gi|472585909|gb|EMS23451.1| CBS and PB1 domain containing protei...   480   e-133   Rhodotorula toruloides NP11
gi|302652051|ref|XP_003017887.1| hypothetical protein TRV_08098 ...   480   e-133   Trichophyton verrucosum HKI 0517
gi|336467143|gb|EGO55307.1| mitochondrial ribosomal protein subu...   479   e-133   Neurospora tetrasperma FGSC 2508
gi|315056125|ref|XP_003177437.1| CBS/PB1 domain-containing prote...   479   e-133   Microsporum gypseum CBS 118893
gi|346327044|gb|EGX96640.1| mitochondrial ribosomal protein subu...   479   e-132   Cordyceps militaris CM01
gi|392571726|gb|EIW64898.1| CBS-domain-containing protein [Trame...   479   e-132   Trametes versicolor FP-101664 SS1
gi|350288234|gb|EGZ69470.1| hypothetical protein NEUTE2DRAFT_159...   479   e-132   Neurospora tetrasperma FGSC 2509
gi|310791950|gb|EFQ27477.1| hypothetical protein GLRG_01972 [Glo...   479   e-132   Colletotrichum graminicola M1.001
gi|345568238|gb|EGX51135.1| hypothetical protein AOL_s00054g511 ...   478   e-132   Arthrobotrys oligospora ATCC 24927
gi|327357586|gb|EGE86443.1| CBS and PB1 domain-containing protei...   478   e-132   
gi|389751715|gb|EIM92788.1| CBS-domain-containing protein [Stere...   476   e-132   Stereum hirsutum FP-91666 SS1
gi|347835680|emb|CCD50252.1| similar to CBS and PB1 domain-conta...   476   e-132   Botrytis cinerea T4
gi|403415486|emb|CCM02186.1| predicted protein [Fibroporia radic...   475   e-131   Fibroporia radiculosa
gi|512207091|gb|EPE35909.1| CAD & PB1 [Glarea lozoyensis ATCC 20...   475   e-131   Glarea lozoyensis ATCC 20868
gi|471910424|emb|CCO27785.1| CBS domain-containing protein CBSCB...   474   e-131   Rhizoctonia solani AG-1 IB
gi|389643690|ref|XP_003719477.1| mitochondrial ribosomal protein...   474   e-131   Magnaporthe oryzae 70-15
gi|121702431|ref|XP_001269480.1| CBS/PB1 domain-containing prote...   473   e-131   Aspergillus clavatus NRRL 1
gi|340966856|gb|EGS22363.1| putative 40S ribosomal protein [Chae...   473   e-130   Chaetomium thermophilum var. thermophilum DSM 1495
gi|340518860|gb|EGR49100.1| predicted protein [Trichoderma reese...   473   e-130   Trichoderma reesei QM6a
gi|402080513|gb|EJT75658.1| mitochondrial ribosomal protein subu...   472   e-130   Gaeumannomyces graminis var. tritici R3-111a-1
gi|171679826|ref|XP_001904859.1| hypothetical protein [Podospora...   472   e-130   Podospora anserina S mat+
gi|296419865|ref|XP_002839512.1| CBS/PB1 domain-containing prote...   472   e-130   Tuber melanosporum Mel28
gi|58261286|ref|XP_568053.1| hypothetical protein [Cryptococcus ...   472   e-130   Cryptococcus neoformans var. neoformans JEC21
gi|380494191|emb|CCF33335.1| hypothetical protein CH063_05547 [C...   471   e-130   Colletotrichum higginsianum
gi|322708062|gb|EFY99639.1| ribosomal protein subunit S4 [Metarh...   471   e-130   Metarhizium robertsii ARSEF 23
gi|358394371|gb|EHK43764.1| hypothetical protein TRIATDRAFT_1718...   471   e-130   Trichoderma atroviride IMI 206040
gi|367048487|ref|XP_003654623.1| hypothetical protein THITE_1363...   471   e-130   Thielavia terrestris NRRL 8126
gi|399168714|emb|CCE30500.1| uncharacterized protein CPUR_04348 ...   470   e-130   Claviceps purpurea 20.1
gi|336269220|ref|XP_003349371.1| CBS/PB1 domain-containing prote...   470   e-130   Sordaria macrospora k-hell
gi|342320856|gb|EGU12794.1| Hypothetical Protein RTG_00812 [Rhod...   470   e-130   Rhodotorula toruloides ATCC 204091
gi|380089158|emb|CCC12924.1| unnamed protein product [Sordaria m...   469   e-130   Sordaria macrospora k-hell
gi|449304257|gb|EMD00265.1| hypothetical protein BAUCODRAFT_3074...   468   e-129   Baudoinia panamericana UAMH 10762
gi|170086117|ref|XP_001874282.1| predicted protein [Laccaria bic...   468   e-129   Laccaria bicolor S238N-H82
gi|296822790|ref|XP_002850342.1| CBS/PB1 domain-containing prote...   467   e-129   Arthroderma otae CBS 113480
gi|453080833|gb|EMF08883.1| CBS-domain-containing protein [Mycos...   466   e-129   Sphaerulina musiva SO2202
gi|358385733|gb|EHK23329.1| hypothetical protein TRIVIDRAFT_7990...   465   e-128   Trichoderma virens Gv29-8
gi|322697495|gb|EFY89274.1| ribosomal protein subunit S4 [Metarh...   464   e-128   Metarhizium acridum CQMa 102
gi|367031380|ref|XP_003664973.1| hypothetical protein MYCTH_2135...   464   e-128   Myceliophthora thermophila ATCC 42464
gi|321255198|ref|XP_003193342.1| hypothetical protein CGB_D1880W...   463   e-128   Cryptococcus gattii WM276
gi|501752936|emb|CCG83283.1| CBS and PB1 domain protein [Taphrin...   463   e-128   Taphrina deformans PYCC 5710
gi|512189410|gb|EPE05177.1| mitochondrial ribosomal protein subu...   463   e-128   Ophiostoma piceae UAMH 11346
gi|470316596|gb|EMR08342.1| hypothetical protein PNEG_03182 [Pne...   463   e-127   Pneumocystis murina B123
gi|116204175|ref|XP_001227898.1| hypothetical protein CHGG_09971...   462   e-127   Chaetomium globosum CBS 148.51
gi|443899306|dbj|GAC76637.1| predicted dehydrogenase [Pseudozyma...   462   e-127   Moesziomyces antarcticus T-34
gi|336376304|gb|EGO04639.1| hypothetical protein SERLA73DRAFT_11...   462   e-127   Serpula lacrymans var. lacrymans S7.3
gi|302916341|ref|XP_003051981.1| CBS/PB1 domain-containing prote...   462   e-127   Nectria haematococca mpVI 77-13-4
gi|440472354|gb|ELQ41219.1| mitochondrial ribosomal protein subu...   461   e-127   Magnaporthe oryzae Y34
gi|452838321|gb|EME40262.1| hypothetical protein DOTSEDRAFT_7491...   461   e-127   Dothistroma septosporum NZE10
gi|443926166|gb|ELU44888.1| CBS and PB1 domain-containing protei...   461   e-127   Rhizoctonia solani AG-1 IA
gi|452978400|gb|EME78164.1| hypothetical protein MYCFIDRAFT_2004...   461   e-127   Cercospora fijiensis CIRAD86
gi|134115681|ref|XP_773554.1| hypothetical protein CNBI1680 [Cry...   461   e-127   Cryptococcus neoformans var. neoformans B-3501A
gi|58261288|ref|XP_568054.1| hypothetical protein [Cryptococcus ...   461   e-127   Cryptococcus neoformans var. neoformans JEC21
gi|505756171|gb|EOR00344.1| Meiotically up-regulated 70 protein ...   460   e-127   Wallemia ichthyophaga EXF-994
gi|164422735|ref|XP_001727992.1| CBS/PB1 domain-containing prote...   460   e-127   
gi|477534228|gb|ENH85790.1| cbs and pb1 domain containing protei...   459   e-127   Colletotrichum orbiculare MAFF 240422
gi|405119601|gb|AFR94373.1| CBS and PB1 domain-containing protei...   459   e-126   
gi|393247785|gb|EJD55292.1| CBS-domain-containing protein [Auric...   458   e-126   Auricularia subglabra TFB-10046 SS5
gi|392577363|gb|EIW70492.1| hypothetical protein TREMEDRAFT_2914...   457   e-126   Tremella mesenterica DSM 1558
gi|409051394|gb|EKM60870.1| hypothetical protein PHACADRAFT_8081...   457   e-126   Phanerochaete carnosa HHB-10118-sp
gi|398390317|ref|XP_003848619.1| hypothetical protein MYCGRDRAFT...   454   e-125   Zymoseptoria tritici IPO323
gi|361127748|gb|EHK99707.1| putative Meiotically up-regulated ge...   454   e-125   Glarea lozoyensis 74030
gi|388580282|gb|EIM20598.1| CBS-domain-containing protein [Walle...   453   e-125   Wallemia mellicola CBS 633.66
gi|346979111|gb|EGY22563.1| CBS domain-containing protein [Verti...   447   e-123   Verticillium dahliae VdLs.17
gi|302418246|ref|XP_003006954.1| CBS/PB1 domain-containing prote...   447   e-123   Verticillium alfalfae VaMs.102
gi|50550993|ref|XP_502970.1| CBS/PB1 domain-containing protein [...   446   e-122   Yarrowia lipolytica CLIB122
gi|154278497|ref|XP_001540062.1| predicted protein [Ajellomyces ...   439   e-120   Histoplasma capsulatum NAm1
gi|326480461|gb|EGE04471.1| CBS and PB1 domain-containing protei...   439   e-120   Trichophyton equinum CBS 127.97
gi|429850172|gb|ELA25470.1| cbs and pb1 domain protein [Colletot...   422   e-115   Colletotrichum gloeosporioides Nara gc5
gi|406602467|emb|CCH46008.1| Inosine-5'-monophosphate dehydrogen...   416   e-113   Wickerhamomyces ciferrii
gi|320580871|gb|EFW95093.1| hypothetical protein HPODL_3465 [Oga...   413   e-113   
gi|294659574|ref|XP_461972.2| CBS/PB1 domain-containing protein ...   401   e-109   Debaryomyces hansenii CBS767
gi|401888948|gb|EJT52892.1| hypothetical protein A1Q1_00797 [Tri...   401   e-109   Trichosporon asahii var. asahii CBS 2479
gi|238878382|gb|EEQ42020.1| conserved hypothetical protein [Cand...   398   e-108   Candida albicans WO-1
gi|68479125|ref|XP_716368.1| hypothetical protein CaO19.12702 [C...   398   e-108   Candida albicans SC5314
gi|448114822|ref|XP_004202675.1| Piso0_001524 [Millerozyma farin...   397   e-108   Millerozyma farinosa CBS 7064
gi|254565947|ref|XP_002490084.1| hypothetical protein [Komagatae...   396   e-107   Komagataella phaffii GS115
gi|448112259|ref|XP_004202051.1| Piso0_001524 [Millerozyma farin...   396   e-107   Millerozyma farinosa CBS 7064
gi|260943069|ref|XP_002615833.1| hypothetical protein CLUG_04715...   394   e-107   Clavispora lusitaniae ATCC 42720
gi|448535220|ref|XP_003870934.1| hypothetical protein CORT_0G012...   392   e-106   Candida orthopsilosis Co 90-125
gi|344232849|gb|EGV64722.1| hypothetical protein CANTEDRAFT_1043...   388   e-105   Candida tenuis ATCC 10573
gi|255728581|ref|XP_002549216.1| conserved hypothetical protein ...   387   e-105   Candida tropicalis MYA-3404
gi|241950133|ref|XP_002417789.1| CBS/PB1 domain-containing prote...   384   e-104   Candida dubliniensis CD36
gi|50302383|ref|XP_451126.1| hypothetical protein [Kluyveromyces...   380   e-103   Kluyveromyces lactis NRRL Y-1140
gi|354548364|emb|CCE45100.1| hypothetical protein CPAR2_701040 [...   380   e-103   Candida parapsilosis
gi|465795639|emb|CCV00131.1| unnamed protein product [Malassezia...   374   e-101   Malassezia sympodialis ATCC 42132
gi|126275953|ref|XP_001386928.1| CBS/PB1 domain-containing prote...   365   2e-98   Scheffersomyces stipitis CBS 6054
gi|344302225|gb|EGW32530.1| hypothetical protein SPAPADRAFT_1397...   364   5e-98   Spathaspora passalidarum NRRL Y-27907
gi|459371818|gb|EMG49487.1| hypothetical protein G210_5735 [Cand...   358   2e-96   Candida maltosa Xu316
gi|83766852|dbj|BAE56992.1| unnamed protein product [Aspergillus...   358   3e-96   Aspergillus oryzae RIB40
gi|149239558|ref|XP_001525655.1| hypothetical protein LELG_03583...   354   6e-95   Lodderomyces elongisporus NRRL YB-4239
gi|328767299|gb|EGF77349.1| hypothetical protein BATDEDRAFT_3603...   343   1e-91   Batrachochytrium dendrobatidis JAM81
gi|190346549|gb|EDK38658.2| hypothetical protein PGUG_02756 [Mey...   280   1e-72   Meyerozyma guilliermondii ATCC 6260
gi|146418122|ref|XP_001485027.1| hypothetical protein PGUG_02756...   277   8e-72   Meyerozyma guilliermondii ATCC 6260
gi|19114942|ref|NP_594030.1| conserved protein Mug20 [Schizosacc...   266   2e-68   Schizosaccharomyces pombe 972h-
gi|213407912|ref|XP_002174727.1| CBS domain-containing protein [...   265   3e-68   Schizosaccharomyces japonicus yFS275
gi|42565877|ref|NP_190863.3| CBS / octicosapeptide/Phox/Bemp1 do...   264   8e-68   Arabidopsis thaliana [mouse-ear cress]
gi|508700816|gb|EOX92712.1| CBS / octicosapeptide/Phox/Bemp1 (PB...   262   3e-67   Theobroma cacao [chocolate]
gi|297816584|ref|XP_002876175.1| CBS domain-containing protein [...   261   6e-67   Arabidopsis lyrata subsp. lyrata
gi|482559546|gb|EOA23737.1| hypothetical protein CARUB_v10016950...   260   8e-67   Capsella rubella
gi|357157411|ref|XP_003577789.1| PREDICTED: CBS domain-containin...   256   1e-65   
gi|502137179|ref|XP_004502996.1| PREDICTED: CBS domain-containin...   256   2e-65   
gi|225438337|ref|XP_002272502.1| PREDICTED: CBS domain-containin...   256   2e-65   Vitis vinifera
gi|502137176|ref|XP_004502995.1| PREDICTED: CBS domain-containin...   256   2e-65   Cicer arietinum [garbanzo]
gi|168028312|ref|XP_001766672.1| predicted protein [Physcomitrel...   254   4e-65   Physcomitrella patens
gi|296082621|emb|CBI21626.3| unnamed protein product [Vitis vini...   254   6e-65   Vitis vinifera
gi|449457321|ref|XP_004146397.1| PREDICTED: CBS domain-containin...   253   1e-64   Cucumis sativus [cucumbers]
gi|473951596|gb|EMS50765.1| Meiotically up-regulated gene 70 pro...   251   4e-64   Triticum urartu
gi|449519605|ref|XP_004166825.1| PREDICTED: LOW QUALITY PROTEIN:...   251   6e-64   
gi|22136010|gb|AAM91587.1| putative protein [Arabidopsis thalian...   251   7e-64   Arabidopsis thaliana [mouse-ear cress]
gi|356518812|ref|XP_003528071.1| PREDICTED: CBS domain-containin...   250   8e-64   
gi|413925448|gb|AFW65380.1| hypothetical protein ZEAMMB73_586556...   250   9e-64   Zea mays [maize]
gi|470148343|ref|XP_004309727.1| PREDICTED: LOW QUALITY PROTEIN:...   249   1e-63   Fragaria vesca subsp. vesca
gi|356511510|ref|XP_003524468.1| PREDICTED: CBS domain-containin...   249   2e-63   
gi|462418727|gb|EMJ22990.1| hypothetical protein PRUPE_ppa003919...   248   3e-63   Prunus persica
gi|357464823|ref|XP_003602693.1| Octicosapeptide/Phox/Bem1p doma...   248   3e-63   Medicago truncatula
gi|409038017|gb|EKM48265.1| hypothetical protein PHACADRAFT_1325...   248   3e-63   Phanerochaete carnosa HHB-10118-sp
gi|356512874|ref|XP_003525140.1| PREDICTED: CBS domain-containin...   248   3e-63   Glycine max [soybeans]
gi|326524536|dbj|BAK00651.1| predicted protein [Hordeum vulgare ...   248   3e-63   Hordeum vulgare subsp. vulgare [barley]
gi|118489093|gb|ABK96353.1| unknown [Populus trichocarpa x Popul...   248   5e-63   Populus trichocarpa x Populus deltoides
gi|356507428|ref|XP_003522469.1| PREDICTED: CBS domain-containin...   248   5e-63   
gi|218185325|gb|EEC67752.1| hypothetical protein OsI_35274 [Oryz...   247   1e-62   Oryza sativa Indica Group [Indian rice]
gi|302783404|ref|XP_002973475.1| hypothetical protein SELMODRAFT...   247   1e-62   Selaginella moellendorffii
gi|224093670|ref|XP_002309952.1| predicted protein [Populus tric...   246   1e-62   
gi|255574194|ref|XP_002528012.1| conserved hypothetical protein ...   246   2e-62   Ricinus communis
gi|482562683|gb|EOA26873.1| hypothetical protein CARUB_v10022966...   246   2e-62   Capsella rubella
gi|508775246|gb|EOY22502.1| CBS / octicosapeptide/Phox/Bemp1 dom...   246   2e-62   Theobroma cacao [chocolate]
gi|508775245|gb|EOY22501.1| CBS / octicosapeptide/Phox/Bemp1 dom...   245   2e-62   Theobroma cacao [chocolate]
gi|297598372|ref|NP_001045471.2| Os01g0961200 [Oryza sativa Japo...   245   3e-62   
gi|413925447|gb|AFW65379.1| hypothetical protein ZEAMMB73_586556...   244   5e-62   Zea mays [maize]
gi|297823463|ref|XP_002879614.1| CBS domain-containing protein [...   244   7e-62   Arabidopsis lyrata subsp. lyrata
gi|302809978|ref|XP_002986681.1| hypothetical protein SELMODRAFT...   244   9e-62   Selaginella moellendorffii
gi|357520151|ref|XP_003630364.1| Meiotically up-regulated gene 7...   244   9e-62   Medicago truncatula
gi|449440540|ref|XP_004138042.1| PREDICTED: CBS domain-containin...   244   9e-62   Cucumis sativus [cucumbers]
gi|218186500|gb|EEC68927.1| hypothetical protein OsI_37618 [Oryz...   244   9e-62   Oryza sativa Indica Group [Indian rice]
gi|15227986|ref|NP_181191.1| CBS / octicosapeptide/Phox/Bemp1 do...   243   1e-61   Arabidopsis thaliana [mouse-ear cress]
gi|28973655|gb|AAO64148.1| unknown protein [Arabidopsis thaliana]     243   1e-61   Arabidopsis thaliana [mouse-ear cress]
gi|222616703|gb|EEE52835.1| hypothetical protein OsJ_35364 [Oryz...   243   2e-61   Oryza sativa Japonica Group [Japonica rice]
gi|460377044|ref|XP_004234305.1| PREDICTED: CBS domain-containin...   242   3e-61   Solanum lycopersicum
gi|508775247|gb|EOY22503.1| CBS / octicosapeptide/Phox/Bemp1 (PB...   242   3e-61   Theobroma cacao [chocolate]
gi|357160673|ref|XP_003578839.1| PREDICTED: CBS domain-containin...   242   3e-61   Brachypodium distachyon [annual false brome]
gi|508775248|gb|EOY22504.1| CBS / octicosapeptide/Phox/Bemp1 (PB...   241   4e-61   Theobroma cacao [chocolate]
gi|297612744|ref|NP_001066263.2| Os12g0169400 [Oryza sativa Japo...   241   5e-61   
gi|414588468|tpg|DAA39039.1| TPA: hypothetical protein ZEAMMB73_...   241   5e-61   Zea mays [maize]
gi|118484915|gb|ABK94323.1| unknown [Populus trichocarpa]             241   5e-61   Populus trichocarpa [western balsam poplar]
gi|356527022|ref|XP_003532113.1| PREDICTED: CBS domain-containin...   241   6e-61   Glycine max [soybeans]
gi|326523955|dbj|BAJ96988.1| predicted protein [Hordeum vulgare ...   241   6e-61   Hordeum vulgare subsp. vulgare [barley]
gi|255540203|ref|XP_002511166.1| conserved hypothetical protein ...   240   8e-61   Ricinus communis
gi|125528914|gb|EAY77028.1| hypothetical protein OsI_04983 [Oryz...   240   1e-60   Oryza sativa Indica Group [Indian rice]
gi|108864045|gb|ABA91621.2| CBS domain-containing protein, putat...   240   1e-60   Oryza sativa Japonica Group [Japonica rice]
gi|502139757|ref|XP_004503889.1| PREDICTED: CBS domain-containin...   240   1e-60   Cicer arietinum [garbanzo]
gi|460413674|ref|XP_004252207.1| PREDICTED: CBS domain-containin...   240   1e-60   Solanum lycopersicum
gi|225456355|ref|XP_002283958.1| PREDICTED: CBS domain-containin...   239   2e-60   
gi|359491097|ref|XP_003634219.1| PREDICTED: CBS domain-containin...   239   2e-60   Vitis vinifera
gi|474215686|gb|EMS59026.1| Meiotically up-regulated gene 70 pro...   239   2e-60   Triticum urartu
gi|502139380|ref|XP_004503746.1| PREDICTED: CBS domain-containin...   238   3e-60   Cicer arietinum [garbanzo]
gi|357126564|ref|XP_003564957.1| PREDICTED: CBS domain-containin...   238   5e-60   Brachypodium distachyon [annual false brome]
gi|462406302|gb|EMJ11766.1| hypothetical protein PRUPE_ppa003833...   237   8e-60   Prunus persica
gi|326509897|dbj|BAJ87164.1| predicted protein [Hordeum vulgare ...   237   8e-60   Hordeum vulgare subsp. vulgare [barley]
gi|414868430|tpg|DAA46987.1| TPA: hypothetical protein ZEAMMB73_...   237   8e-60   Zea mays [maize]
gi|226501428|ref|NP_001148069.1| CBS domain containing protein [...   237   9e-60   Zea mays [maize]
gi|224122050|ref|XP_002318739.1| predicted protein [Populus tric...   236   1e-59   
gi|242084930|ref|XP_002442890.1| hypothetical protein SORBIDRAFT...   236   1e-59   Sorghum bicolor [broomcorn]
gi|475592009|gb|EMT21949.1| hypothetical protein F775_07841 [Aeg...   236   2e-59   Aegilops tauschii
gi|168034755|ref|XP_001769877.1| predicted protein [Physcomitrel...   234   7e-59   Physcomitrella patens
gi|413951480|gb|AFW84129.1| hypothetical protein ZEAMMB73_744710...   234   7e-59   Zea mays [maize]
gi|460391765|ref|XP_004241489.1| PREDICTED: CBS domain-containin...   233   2e-58   Solanum lycopersicum
gi|348688916|gb|EGZ28730.1| hypothetical protein PHYSODRAFT_3492...   233   2e-58   Phytophthora sojae
gi|226495213|ref|NP_001151563.1| CBS domain containing protein [...   232   3e-58   Zea mays [maize]
gi|356527608|ref|XP_003532400.1| PREDICTED: CBS domain-containin...   232   3e-58   
gi|224031159|gb|ACN34655.1| unknown [Zea mays] >gi|414878944|tpg...   231   5e-58   Zea mays [maize]
gi|62701927|gb|AAX93000.1| CBS domain, putative [Oryza sativa Ja...   231   7e-58   Oryza sativa Japonica Group [Japonica rice]
gi|224081072|ref|XP_002306285.1| predicted protein [Populus tric...   230   9e-58   
gi|18423173|ref|NP_568736.1| CBS / octicosapeptide/Phox/Bemp1 do...   230   1e-57   Arabidopsis thaliana [mouse-ear cress]
gi|242055437|ref|XP_002456864.1| hypothetical protein SORBIDRAFT...   229   2e-57   Sorghum bicolor [broomcorn]
gi|482551014|gb|EOA15208.1| hypothetical protein CARUB_v10028624...   229   2e-57   Capsella rubella
gi|297795865|ref|XP_002865817.1| CBS domain-containing protein [...   229   3e-57   Arabidopsis lyrata subsp. lyrata
gi|356508821|ref|XP_003523152.1| PREDICTED: CBS domain-containin...   228   4e-57   
gi|470123033|ref|XP_004297541.1| PREDICTED: CBS domain-containin...   228   5e-57   Fragaria vesca subsp. vesca
gi|168002427|ref|XP_001753915.1| predicted protein [Physcomitrel...   228   7e-57   Physcomitrella patens
gi|460413672|ref|XP_004252206.1| PREDICTED: CBS domain-containin...   228   7e-57   
gi|147863576|emb|CAN79772.1| hypothetical protein VITISV_019408 ...   227   1e-56   Vitis vinifera
gi|406602257|emb|CCH46150.1| Inosine-5'-monophosphate dehydrogen...   226   2e-56   Wickerhamomyces ciferrii
gi|301118278|ref|XP_002906867.1| myosin-like protein [Phytophtho...   225   3e-56   Phytophthora infestans T30-4
gi|168028557|ref|XP_001766794.1| predicted protein [Physcomitrel...   225   3e-56   Physcomitrella patens
gi|475529836|gb|EMT07817.1| hypothetical protein F775_10200 [Aeg...   223   1e-55   Aegilops tauschii
gi|384489617|gb|EIE80839.1| hypothetical protein RO3G_05544 [Rhi...   223   1e-55   Rhizopus delemar RA 99-880
gi|502139383|ref|XP_004503747.1| PREDICTED: CBS domain-containin...   223   2e-55   Cicer arietinum [garbanzo]
gi|357465031|ref|XP_003602797.1| Meiotically up-regulated gene 7...   223   2e-55   Medicago truncatula
gi|388514175|gb|AFK45149.1| unknown [Medicago truncatula]             222   3e-55   Medicago truncatula
gi|502133303|ref|XP_004501712.1| PREDICTED: CBS domain-containin...   218   3e-54   Cicer arietinum [garbanzo]
gi|168028206|ref|XP_001766619.1| predicted protein [Physcomitrel...   218   7e-54   Physcomitrella patens
gi|482550579|gb|EOA14773.1| hypothetical protein CARUB_v10028072...   217   1e-53   Capsella rubella
gi|15242788|ref|NP_201154.1| CBS / octicosapeptide/Phox/Bemp1 do...   216   1e-53   Arabidopsis thaliana [mouse-ear cress]
gi|242070207|ref|XP_002450380.1| hypothetical protein SORBIDRAFT...   215   3e-53   Sorghum bicolor [broomcorn]
gi|224136197|ref|XP_002322269.1| predicted protein [Populus tric...   213   1e-52   Populus trichocarpa [western balsam poplar]
gi|297797347|ref|XP_002866558.1| CBS domain-containing protein [...   213   1e-52   Arabidopsis lyrata subsp. lyrata
gi|348664773|gb|EGZ04613.1| hypothetical protein PHYSODRAFT_3626...   207   6e-51   Phytophthora sojae
gi|328768526|gb|EGF78572.1| hypothetical protein BATDEDRAFT_1289...   207   7e-51   Batrachochytrium dendrobatidis JAM81
gi|325182681|emb|CCA17136.1| myosin 29 putative [Albugo laibachi...   202   2e-49   Albugo laibachii Nc14
gi|301113386|ref|XP_002998463.1| myosin-like protein [Phytophtho...   202   3e-49   Phytophthora infestans T30-4
gi|302772022|ref|XP_002969429.1| hypothetical protein SELMODRAFT...   201   4e-49   Selaginella moellendorffii
gi|302774691|ref|XP_002970762.1| hypothetical protein SELMODRAFT...   201   5e-49   Selaginella moellendorffii
gi|357156732|ref|XP_003577557.1| PREDICTED: CBS domain-containin...   200   1e-48   
gi|219363345|ref|NP_001136492.1| uncharacterized protein LOC1002...   194   5e-47   
gi|363753990|ref|XP_003647211.1| hypothetical protein Ecym_5661 ...   193   1e-46   
gi|239925803|gb|ACS35536.1| myosin 29 [Phaeodactylum tricornutum]     192   2e-46   
gi|508700817|gb|EOX92713.1| CBS / octicosapeptide/Phox/Bemp1 dom...   189   2e-45   
gi|50305749|ref|XP_452835.1| hypothetical protein [Kluyveromyces...   184   6e-44   
gi|222619917|gb|EEE56049.1| hypothetical protein OsJ_04848 [Oryz...   184   9e-44   
gi|325181316|emb|CCA15731.1| myosinlike protein putative [Albugo...   183   2e-43   
gi|397621002|gb|EJK66050.1| hypothetical protein THAOC_13058, pa...   181   5e-43   
gi|298714699|emb|CBJ27624.1| myosin 29 [Ectocarpus siliculosus]       181   7e-43   
gi|474434215|gb|EMS68129.1| Meiotically up-regulated gene 70 pro...   180   1e-42   
gi|219122133|ref|XP_002181407.1| predicted protein [Phaeodactylu...   179   2e-42   
gi|224003559|ref|XP_002291451.1| predicted protein [Thalassiosir...   176   2e-41   
gi|302798198|ref|XP_002980859.1| hypothetical protein SELMODRAFT...   173   1e-40   
gi|325182347|emb|CCA16800.1| myosinlike protein putative [Albugo...   173   2e-40   
gi|222616000|gb|EEE52132.1| hypothetical protein OsJ_33959 [Oryz...   170   1e-39   
gi|513033569|gb|AGO13535.1| AaceriAGL347Cp [Saccharomycetaceae s...   167   1e-38   
gi|356518878|ref|XP_003528104.1| PREDICTED: LOW QUALITY PROTEIN:...   167   1e-38   
gi|473951311|gb|EMS50734.1| Meiotically up-regulated gene 70 pro...   164   1e-37   
gi|323452546|gb|EGB08420.1| hypothetical protein AURANDRAFT_2647...   163   2e-37   
gi|422295637|gb|EKU22936.1| hypothetical protein NGA_2021300 [Na...   163   2e-37   
gi|413920807|gb|AFW60739.1| hypothetical protein ZEAMMB73_016218...   162   4e-37   
gi|226501000|ref|NP_001145716.1| uncharacterized protein LOC1002...   161   6e-37   
gi|302815219|ref|XP_002989291.1| hypothetical protein SELMODRAFT...   161   6e-37   
gi|413920808|gb|AFW60740.1| hypothetical protein ZEAMMB73_016218...   161   6e-37   
gi|218185780|gb|EEC68207.1| hypothetical protein OsI_36187 [Oryz...   160   1e-36   
gi|359473429|ref|XP_002265656.2| PREDICTED: CBS domain-containin...   160   2e-36   
gi|422293264|gb|EKU20564.1| myosin-like protein, partial [Nannoc...   159   3e-36   
gi|422295638|gb|EKU22937.1| myosin-like protein, partial [Nannoc...   159   3e-36   
gi|474310959|gb|EMS61876.1| Meiotically up-regulated gene 70 pro...   158   6e-36   
gi|475479715|gb|EMT02803.1| hypothetical protein F775_03431 [Aeg...   155   3e-35   
gi|385302513|gb|EIF46642.1| cbs and pb1 domain-containing protei...   147   1e-32   
gi|242055665|ref|XP_002456978.1| hypothetical protein SORBIDRAFT...   145   4e-32   
gi|473945854|gb|EMS50548.1| Meiotically up-regulated gene 70 pro...   144   8e-32   
gi|297720703|ref|NP_001172713.1| Os01g0923300 [Oryza sativa Japo...   144   1e-31   
gi|45200750|ref|NP_986320.1| AGL347Cp [Ashbya gossypii ATCC 1089...   143   2e-31   
gi|413922419|gb|AFW62351.1| hypothetical protein ZEAMMB73_157791...   142   3e-31   
gi|475546251|gb|EMT10653.1| hypothetical protein F775_18899 [Aeg...   139   4e-30   
gi|147799151|emb|CAN63699.1| hypothetical protein VITISV_002255 ...   138   6e-30   
gi|485603151|gb|EOD03883.1| hypothetical protein EMIHUDRAFT_1080...   133   2e-28   
gi|485614685|gb|EOD12467.1| hypothetical protein EMIHUDRAFT_4522...   128   6e-27   
gi|485644754|gb|EOD38670.1| hypothetical protein EMIHUDRAFT_2517...   128   6e-27   
gi|224003561|ref|XP_002291452.1| hypothetical protein THAPSDRAFT...   127   1e-26   
gi|320583158|gb|EFW97374.1| Nuclear polyadenylated RNA-binding p...   123   2e-25   
gi|507106750|emb|CDF40347.1| TPR repeat-containing protein [Chon...   121   8e-25   
gi|226498664|ref|NP_001141602.1| uncharacterized protein LOC1002...   114   7e-23   
gi|357464825|ref|XP_003602694.1| Octicosapeptide/Phox/Bem1p doma...   109   3e-21   
gi|465795638|emb|CCV00130.1| unnamed protein product [Malassezia...   108   4e-21   
gi|238570457|ref|XP_002386849.1| hypothetical protein MPER_14730...   103   1e-19   
gi|226491131|ref|NP_001145822.1| uncharacterized protein LOC1002...   100   1e-18   
gi|242070995|ref|XP_002450774.1| hypothetical protein SORBIDRAFT...    95   5e-17   
gi|110740370|dbj|BAF02080.1| hypothetical protein [Arabidopsis t...    95   6e-17   
gi|298705826|emb|CBJ34183.1| conserved unknown protein [Ectocarp...    95   6e-17   
gi|26450828|dbj|BAC42522.1| unknown protein [Arabidopsis thaliana]     94   1e-16   
gi|288956922|ref|YP_003447263.1| hypothetical protein AZL_000810...    89   5e-15   
gi|374293294|ref|YP_005040329.1| hypothetical protein AZOLI_2946...    88   9e-15   
gi|374853591|dbj|BAL56495.1| hypothetical conserved protein [unc...    87   2e-14   
gi|83310691|ref|YP_420955.1| CBS domain-containing protein [Magn...    86   5e-14   
gi|397629836|gb|EJK69525.1| hypothetical protein THAOC_09208, pa...    85   9e-14   
gi|475608809|gb|EMT27156.1| hypothetical protein F775_22787 [Aeg...    84   1e-13   
gi|496228631|ref|WP_008942666.1| signal transduction protein wit...    84   2e-13   
gi|497233991|ref|WP_009548253.1| signal transduction protein [Bu...    84   2e-13   
gi|414868429|tpg|DAA46986.1| TPA: hypothetical protein ZEAMMB73_...    83   2e-13   
gi|494149299|ref|WP_007089044.1| hypothetical protein [Thalassos...    83   3e-13   
gi|83595073|ref|YP_428825.1| signal transduction protein [Rhodos...    82   4e-13   
gi|89901569|ref|YP_524040.1| signal-transduction protein [Rhodof...    82   4e-13   
gi|374293104|ref|YP_005040139.1| hypothetical protein AZOLI_2737...    82   4e-13   
gi|496165390|ref|WP_008889897.1| hypothetical protein [Thalassos...    82   5e-13   
gi|470252802|ref|XP_004359498.1| hypothetical protein DFA_01534 ...    82   6e-13   
gi|494944664|ref|WP_007670692.1| Predicted signal-transduction p...    80   2e-12   
gi|372486716|ref|YP_005026281.1| putative signal-transduction pr...    80   2e-12   
gi|319793129|ref|YP_004154769.1| signal transduction protein wit...    80   3e-12   
gi|114562724|ref|YP_750237.1| cyclic nucleotide-binding protein ...    79   5e-12   
gi|497228259|ref|WP_009542521.1| putative signal-transduction pr...    79   5e-12   
gi|403512449|ref|YP_006644087.1| CBS domain protein [Nocardiopsi...    79   6e-12   
gi|495897415|ref|WP_008621994.1| CBS domain-containing protein [...    79   6e-12   
gi|495108240|ref|WP_007833062.1| signal transduction protein [Va...    79   6e-12   
gi|392381228|ref|YP_005030425.1| conserved protein of unknown fu...    78   7e-12   
gi|491841376|ref|WP_005627590.1| hypothetical protein [Mycobacte...    78   1e-11   
gi|490384975|ref|WP_004264477.1| signal transduction protein [Th...    77   2e-11   
gi|239820152|ref|YP_002947337.1| putative signal transduction pr...    77   2e-11   
gi|71907424|ref|YP_285011.1| CBS [Dechloromonas aromatica RCB] >...    77   2e-11   
gi|294053802|ref|YP_003547460.1| putative signal transduction pr...    76   4e-11   


>gi|384501963|gb|EIE92454.1| hypothetical protein RO3G_16976 [Rhizopus delemar RA 99-880]
          Length = 719

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 315/644 (48%), Positives = 404/644 (62%), Gaps = 77/644 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SK+DEAIRKK+E EL+KK    +  +       RQ     GTV++L PSQALTV+
Sbjct: 31  SRQRQSKRDEAIRKKLEQELSKKKSGSNKKV-------RQTRKIAGTVSALRPSQALTVK 83

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+ LV+EA+QL+AAKR+DCVLV+D EEHLSGIFTAKDLA+RVV + LDAR TTVA IMT+
Sbjct: 84  ENMLVIEAAQLLAAKRSDCVLVVDDEEHLSGIFTAKDLAYRVVAESLDARNTTVAKIMTK 143

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
            PMCV +DTSATDALN MV+RGFRHLPVCNEEGD+ GLLDITKCLYEALDKMERA+GSS+
Sbjct: 144 GPMCVTSDTSATDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCLYEALDKMERAFGSSR 203

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGVE+EW+ N P Q++QYM+ LR+KM CPDLS+VLDG  P EV VKT+VR+ AR
Sbjct: 204 KLYDALEGVEKEWN-NSPIQLVQYMEALRDKMECPDLSTVLDGHAPPEVNVKTNVREVAR 262

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+EY TTAVLV +   +AGIFT+KD+VLRVIA GL+P  CSV+RVMTPHPDTAP Q SI
Sbjct: 263 MMKEYHTTAVLVTDREGLAGIFTTKDVVLRVIAPGLNPENCSVVRVMTPHPDTAPAQMSI 322

Query: 368 LDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
           +DAL+KM+DGHYLNLP+V+ G ++GMVDVLKLTYAT+EQ+ S+Q    GNDG GPMW++F
Sbjct: 323 MDALRKMHDGHYLNLPIVEEGDVVGMVDVLKLTYATLEQINSIQ----GNDGEGPMWSRF 378

Query: 428 WNSLA--NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPI---PEIHPSESAS 482
           W+S    ++ D ES +SDS                     S + S +    EI P+ESAS
Sbjct: 379 WDSFGATDNNDTESQLSDSQLLSATHSNNHHSNQIISPEPSTSFSQLQGFSEITPNESAS 438

Query: 483 AI---------DDGSMASFP-RGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASK 532
            +         D+ +   F  + + +  F+FKF   +GK+HR      S+  +  ++  K
Sbjct: 439 MVANNEECSTSDETTQHQFSIKENAQGTFSFKFTTTSGKTHRIACSSDSYSSLLKSIHQK 498

Query: 533 LPSNVRDF--------------TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
           +     D+              +I Y+                DAV++A++ G  RV L 
Sbjct: 499 VAGEHLDYLGVTEDNEPVESWLSISYLDDEDDHVLMTSDADVQDAVKLARKMGQDRVKLF 558

Query: 579 IQ--------------EIEK----------KSLRXXXXXXXXXXXXILEKRRR--RKRGK 612
           I               EIE           K               I  K+R   +K+ +
Sbjct: 559 INDTAAPVVPVTPIPTEIEHEEPQPVVEAIKEPEQEVQEEESVIESIKSKKRHSLKKKIE 618

Query: 613 HAPDYN----------LPIPHDLLLPGAVLTLAIAIIGVFALSR 646
            + D +          L IP DL+LP A+  L + I GVF LSR
Sbjct: 619 TSSDDDEEPEAKTKDVLGIPQDLVLPAAITFLGVVIAGVFVLSR 662



>gi|511011063|gb|EPB92277.1| hypothetical protein HMPREF1544_00846 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 676

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 322/662 (48%), Positives = 407/662 (61%), Gaps = 107/662 (16%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SK+DEAIRKK+E EL+KK +T S       K  RQ     GTV++L P+QALTV+
Sbjct: 33  SRQRQSKRDEAIRKKLESELSKK-KTGS-------KRVRQTRKIAGTVSALRPAQALTVK 84

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+ LV+EASQLMAAKR+DCVLV+D E+HLSGIFTAKDLA+RVV + LDAR TTVA IMT+
Sbjct: 85  ENMLVIEASQLMAAKRSDCVLVVDEEDHLSGIFTAKDLAYRVVAESLDARDTTVAKIMTK 144

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
            PMCV +DTSATDALN MV+RGFRHLPVCNEEGD+ GLLDITKCLYEALDKMERA+GSS+
Sbjct: 145 GPMCVTSDTSATDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCLYEALDKMERAFGSSR 204

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGVE+EWS N P Q++QYM+ LR+KM CPDL+SVLDG  PAEV VKT+VRD AR
Sbjct: 205 KLYDALEGVEKEWS-NSPIQLVQYMEALRDKMECPDLNSVLDGLAPAEVSVKTNVRDVAR 263

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+EY TTAVLV +   +AGIFT+KD+VLRVIAAGL P  CSV+RVMTPHPDTA PQ SI
Sbjct: 264 MMKEYHTTAVLVTDRDGLAGIFTTKDVVLRVIAAGLHPENCSVVRVMTPHPDTASPQMSI 323

Query: 368 LDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
           +DAL+KM+ G Y +      G ++G+VDVLKLTYATMEQ+ S+Q    GNDG GPMW +F
Sbjct: 324 MDALRKMH-GKYTD------GDVVGIVDVLKLTYATMEQINSIQ----GNDGEGPMWGRF 372

Query: 428 WNSL--ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN----ISPIP-------- 473
           W+S   A+  ++ES +SD ++                T G+G+    ISP P        
Sbjct: 373 WDSFGAADQHESESQLSDPLS----SQLLSAHSQNSNTNGNGSIARAISPEPSASFSQLQ 428

Query: 474 ---EIHPSESASAIDDG-----SMASFPR--GHDENFFTFKFKAPNGKSHRFTVDYTSF- 522
              EI P+ESAS + +      +M+   R  G  E+ F+FKF +  GK+HRF   Y S+ 
Sbjct: 429 GFSEITPNESASMVANNEENRSTMSEDTRAMGKGEDVFSFKFTSDGGKTHRFASVYNSYA 488

Query: 523 ---EHIRATVASK----LPSNVRD------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQR 569
              E +R  V  +    L +N  D       +I Y+                DAV++A++
Sbjct: 489 ALLEAVRQKVIGEHLAHLGANPDDVPVESWLSISYLDDEEDQVLITSDADVSDAVKLARK 548

Query: 570 QGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILE-------------------------- 603
            G  RV L + +  +K               ++E                          
Sbjct: 549 MGQDRVKLFVHDATEKEEVVVEAPAVIEPAVVVEEKVTEPVAPPVITPPPTIEVTEPHHE 608

Query: 604 -KRRRR------------------KRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFAL 644
            K +RR                   R K        IP +L+LP A+  L + I+GVFA 
Sbjct: 609 KKSKRRSVRKEVETSDSEDEDTHSSRHKQEGATVAGIPQELVLPAAIAFLGVVIVGVFAF 668

Query: 645 SR 646
           SR
Sbjct: 669 SR 670



>gi|384495647|gb|EIE86138.1| hypothetical protein RO3G_10849 [Rhizopus delemar RA 99-880]
          Length = 486

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 277/452 (61%), Positives = 340/452 (75%), Gaps = 27/452 (5%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR +K+DEAIRKK+E EL+KK +T S       K  RQ     GTV++L PSQALTV+
Sbjct: 29  SRQRQTKRDEAIRKKLEQELSKK-KTGS-------KRVRQTRKIAGTVSALRPSQALTVK 80

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+ LV+EA+QL+AAKR+DCVLV+D EEHLSGIFTAKDLA+RVV + LDAR TTVA IMT+
Sbjct: 81  ENMLVIEAAQLLAAKRSDCVLVVDDEEHLSGIFTAKDLAYRVVAECLDARNTTVAKIMTK 140

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
            PMCV +DTSATDALN MV+RGFRHLPVCNEEGD+ GLLDITKCLYEALDKMERA+GSS+
Sbjct: 141 GPMCVTSDTSATDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCLYEALDKMERAFGSSR 200

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGVE+EW+ N P Q++QYM+ LR+KM CPDL+SVLDG  PAEV VKT+VR+ AR
Sbjct: 201 KLYDALEGVEKEWN-NSPIQLVQYMEALRDKMECPDLNSVLDGQAPAEVSVKTNVREVAR 259

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M++Y TTAVLV +   +AGIFT+KD+VLRVIAAGL+P  CSV+RVMTPHPDTAPP  SI
Sbjct: 260 MMKDYHTTAVLVTDREGLAGIFTTKDVVLRVIAAGLNPENCSVVRVMTPHPDTAPPDMSI 319

Query: 368 LDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
           +DALKKM+DGHYLNLPVVD G +LG+VDVLKLTY T+EQ+ S+Q    G+DG GPMW++F
Sbjct: 320 MDALKKMHDGHYLNLPVVDNGDVLGIVDVLKLTYVTLEQINSIQ----GSDGEGPMWSRF 375

Query: 428 WNSL--ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           W+S   A+  D ES +S+S                  +     +    EI P+ESAS + 
Sbjct: 376 WDSFGAADHNDTESQLSESQLLSVYGTNHQRIISPEPSASFSQLQNFAEITPNESASMVA 435

Query: 486 DGSMASF-----------PRGHDENF-FTFKF 505
           +    SF           P+  +EN  F+FKF
Sbjct: 436 NNDETSFSDHQSHHLSHHPKEQEENHSFSFKF 467



>gi|511006225|gb|EPB87542.1| hypothetical protein HMPREF1544_05633 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 705

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 292/550 (53%), Positives = 372/550 (67%), Gaps = 54/550 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SKKDEAIRKK+E EL KK R  ST +       +Q     GTV++L P+QALTVR
Sbjct: 37  SRQRQSKKDEAIRKKIEQELMKK-RGGSTRI-------KQTKKIAGTVSALRPAQALTVR 88

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+ LV+EA+QLMAAKR+DCVLV+D EEHLSGIFTAKDLA+RVV D LDAR TTVA IMT+
Sbjct: 89  ETILVIEAAQLMAAKRSDCVLVVDDEEHLSGIFTAKDLAYRVVADNLDARATTVADIMTK 148

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPMCV  DTSA DALN MV+RGFRHLPVCNEEGD+ GLLDITKC+YEAL KME+AYGSS+
Sbjct: 149 NPMCVTADTSAQDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCIYEALHKMEKAYGSSR 208

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGVEREW+ N P Q +QYM+ LR+KM+CPDL++VLD + P +V VK  VR+ A+
Sbjct: 209 KLYDALEGVEREWA-NSPVQFVQYMEALRDKMSCPDLTTVLDQAGPVQVNVKAQVREVAK 267

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+EY TTAVLVM+H  +AGIFTSKDIVLRVIAAGL P  CSV+RVMTPHPDTA P TSI
Sbjct: 268 LMKEYHTTAVLVMDHGGLAGIFTSKDIVLRVIAAGLAPDNCSVVRVMTPHPDTALPSTSI 327

Query: 368 LDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
           LDALKKM+DGHYLNLPV+D   +I+G++DVL+LTYAT+EQ+ S++    GN G G    K
Sbjct: 328 LDALKKMHDGHYLNLPVLDEDKNIVGLIDVLRLTYATLEQINSIE----GNQGDG---GK 380

Query: 427 FWNSLA--NDGDNESTVSDSIAXXXXXXXXX-XXXXXXRTRGSGNISPIP---------- 473
           FW+S+A  +  + ES +SDS++                 +    + SP+P          
Sbjct: 381 FWSSIAAGDHTETESAISDSLSQAANSHMFQPSSPQYEHSSRLSSTSPMPGHAPTYTGLG 440

Query: 474 ---EIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVA 530
              E+ P++SAS + D + ++    H  N F+FKF   N K+HR   D ++F+ +   + 
Sbjct: 441 YAAELTPADSASVVHDDNHSTV-SSHINNTFSFKFNYGN-KTHRLRHDSSNFQGLLEVIQ 498

Query: 531 SKL----------------PSNVRD---FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQG 571
            K+                 ++  D    T+ Y+                DAV+IA++ G
Sbjct: 499 QKIMVEHLSISQSYIAVGKENDKHDEDWLTVAYLDDENDQVLMTCDSDLADAVQIARKSG 558

Query: 572 MSRVILHIQE 581
           + RV L + +
Sbjct: 559 LDRVRLFVHD 568



>gi|384499448|gb|EIE89939.1| hypothetical protein RO3G_14650 [Rhizopus delemar RA 99-880]
          Length = 594

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 292/597 (48%), Positives = 378/597 (63%), Gaps = 43/597 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SKKDEA+RKK+E E +KK+   S +L       R++PG   TV++L P+QA+TV+
Sbjct: 21  SRQRQSKKDEALRKKLEQEFSKKSNNSSRTLT------RRIPG---TVSALRPNQAVTVK 71

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           ES  V+E++Q M+AKR DCVLV++ E+ LSGIFTAKD+A+RVV +GLDARTT V+ IMT+
Sbjct: 72  ESMPVIESAQFMSAKRCDCVLVVNEEDQLSGIFTAKDIAYRVVAEGLDARTTIVSQIMTK 131

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+CV +DTSAT+AL+ MV RGFRHLPVCNEEGD+ GLLDITKCLYEAL+KMERA+GSS+
Sbjct: 132 NPLCVTSDTSATEALDLMVTRGFRHLPVCNEEGDIFGLLDITKCLYEALEKMERAFGSSR 191

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGVEREW+     Q+ +YM+ LRE M+CP L SVLDG+ PA+V  KT+V++ A 
Sbjct: 192 KLYDALEGVEREWAGESTGQMNEYMENLRESMSCPTLESVLDGTPPAQVRYKTNVKEIAV 251

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+E RTTAVLV + H + GIFTSKDIVLRVIAAGL+P  C+V RVMTP PDTA P+T++
Sbjct: 252 MMKELRTTAVLVTKSHKLQGIFTSKDIVLRVIAAGLNPENCTVARVMTPTPDTAAPETTV 311

Query: 368 LDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQENGNDG-GGPMWNK 426
           LDALK M +GHYLNLPV+  G+I+GMVDVLKLTY T+EQM ++Q    GN G GGPMW++
Sbjct: 312 LDALKLMNNGHYLNLPVIGHGTIIGMVDVLKLTYVTLEQMNTIQ----GNSGEGGPMWSR 367

Query: 427 FWNSLANDGD---NESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASA 483
           FW+S     D   NES +S+S                   + S +     +I PSESAS 
Sbjct: 368 FWDSFGAATDPMENESYLSES------SHQHLAPPPHLSPQPSTSFKSYSDILPSESASM 421

Query: 484 IDDGS-------MASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLP-- 534
           +++ S         + P   D   F FKF     K+HR  V    +  +   V  KLP  
Sbjct: 422 VNNNSNELTSSLTTAVPITEDT--FAFKFTLSEQKTHRV-VSKPIYSELLEAVRLKLPPS 478

Query: 535 ---SNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXX 591
              S     T+ Y+               IDAV++A + G S V L +Q+   K      
Sbjct: 479 EIESQTEWLTLSYLDDEQDQVLVTSDMDVIDAVQLAIKTGQSNVKLFVQDNRVKEQPKVV 538

Query: 592 XXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRSK 648
                    +      RK     P        +LLLP A+  L   IIG F  SR++
Sbjct: 539 PEDVRQVKKVPSAENTRKEKASKPKNT-----NLLLPAAIGVLGAVIIGAFVFSRAQ 590



>gi|510999790|gb|EPB81381.1| hypothetical protein HMPREF1544_11911 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 625

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 270/533 (50%), Positives = 356/533 (66%), Gaps = 44/533 (8%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
            RQR  K+DEAIRKK+E + +KK  + S +L ++  P        GTV++L P QALTV+
Sbjct: 23  GRQRQLKRDEAIRKKLEQDFSKKKGSSSRTLKSKRIP--------GTVSALRPGQALTVK 74

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+ LV+E++QLMAAKR DCVLVI+ ++HLSGIFTAKD+A+R+V + LDA+TT V  IMT+
Sbjct: 75  ENMLVIESAQLMAAKRCDCVLVINEDDHLSGIFTAKDIAYRLVAENLDAKTTPVIDIMTK 134

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPMCV +DTSAT+ALN MV++GFRHLPVCNE+GD+ GLLDITKCLY AL+KMERA+GSS+
Sbjct: 135 NPMCVTSDTSATEALNLMVSKGFRHLPVCNEDGDIFGLLDITKCLYGALEKMERAFGSSR 194

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
            LYDA+EGVE+EW+   P Q+ +YM+ LREKM+CP+L+SVLDG+ PAEV  +T+VRD A 
Sbjct: 195 VLYDAIEGVEKEWA-GTPAQLTEYMESLREKMSCPNLASVLDGTPPAEVKYRTNVRDIAI 253

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+E  TTAVLV +HH++AGIFTSKDIVLRVIAAGL+P  C+V+RVMTP+PDTA P+T++
Sbjct: 254 MMKELHTTAVLVQKHHNLAGIFTSKDIVLRVIAAGLNPENCTVVRVMTPNPDTATPETTV 313

Query: 368 LDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
           LDALK M +GHYLNLPV+D G + GMVDVLKLTY T+EQM  M+    G +G GPMW +F
Sbjct: 314 LDALKLMNEGHYLNLPVLDSGIVTGMVDVLKLTYVTLEQMSGME----GKEGEGPMWGRF 369

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP-----------EIH 476
           W+S       ES+   S                 R+  S  ISP P           +I 
Sbjct: 370 WDSFGAVDHAESSSQLSDT---------SSHHRSRSHLSNTISPQPSTSLSQLKSYSDIS 420

Query: 477 PSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLPSN 536
           P+ESAS ++  S          + FTFKF +   K+HR        + + A     LP +
Sbjct: 421 PNESASMVNQSSSVMEASS---DTFTFKFTSAGQKTHRVVCKPLYSDVLEAVRVKLLPEH 477

Query: 537 VRD------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQR--QGMSRVILHIQE 581
             D       +I YV               +DAV++A +  Q   ++I+H Q+
Sbjct: 478 GDDVGEEEWLSISYVDDEQDKVLISSDSDVVDAVQLALKLEQSNVKLIVHDQQ 530



>gi|384499555|gb|EIE90046.1| hypothetical protein RO3G_14757 [Rhizopus delemar RA 99-880]
          Length = 550

 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 279/569 (49%), Positives = 361/569 (63%), Gaps = 84/569 (14%)

Query: 139 MAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSA 198
           MAAKR+DCVLV+D EEHLSGIFTAKDLA+RVV D LDAR  TV+ IMTRNPMCV  DTSA
Sbjct: 1   MAAKRSDCVLVVDEEEHLSGIFTAKDLAYRVVADNLDARAITVSDIMTRNPMCVTADTSA 60

Query: 199 TDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVER 258
            DALN MV+RGFRHLPVCNEEGD+ GLLDITKC+YEAL KME+AY SS+KLYDALEGVER
Sbjct: 61  QDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCIYEALHKMEKAYSSSRKLYDALEGVER 120

Query: 259 EWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVL 318
           EW+ N P Q++QYM+ L++KM+CPDL++VLD + P +V +K  VR+ A+LM+EY TTAVL
Sbjct: 121 EWA-NSPVQLVQYMEALKDKMSCPDLTTVLDHAGPVQVTMKAQVREVAKLMKEYHTTAVL 179

Query: 319 VMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGH 378
           VM+H  +AGIFTSKDIVLRVIAAGL P +CSV+RVMTPHPDTA P TSILDALKKM+DGH
Sbjct: 180 VMDHGGLAGIFTSKDIVLRVIAAGLAPDSCSVVRVMTPHPDTALPSTSILDALKKMHDGH 239

Query: 379 YLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLA--NDG 435
           YLNLPV+D   +I+G++DVL+LTYAT+EQ+ S++    GN G G   +KFW+S+A  +  
Sbjct: 240 YLNLPVLDEDKNIVGLIDVLRLTYATLEQINSIE----GNQGDG---SKFWHSIAGGDQT 292

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP------------EIHPSESASA 483
           +++S +S+S++                 +    I P+P            E+ P++SAS 
Sbjct: 293 ESDSVISESLSHAANSPLF---------QNEHTILPMPGHAPTYTGLGYSELTPADSASG 343

Query: 484 IDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF-------------EHI---RA 527
           I D   AS    H  N F+FKF   N K+HRF  D  +F             EH+   ++
Sbjct: 344 IHDNDNASTVSSHINNTFSFKFNYAN-KTHRFRHDIGNFASFLETIQQKIMTEHLSLSQS 402

Query: 528 TVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE------ 581
            VA     +    T+ YV               ID+V+IA++ GM RV L + +      
Sbjct: 403 YVAVHHKEDENWLTVAYVDDENDQVLMTCDSDLIDSVQIAKKAGMDRVRLFVHDSMAEDQ 462

Query: 582 ------------------------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDY 617
                                   I+KKS++            + +K+R  K     P+Y
Sbjct: 463 SSIMDQQQLTIERPVTPPVIPEPVIQKKSVKRKENTEEKDRVSVEKKKRHVK-----PEY 517

Query: 618 NLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
           +LPIP DL+LP A+  L + I+GVF +SR
Sbjct: 518 DLPIPQDLVLPAAITFLGVVILGVFTISR 546



>gi|358059825|dbj|GAA94471.1| hypothetical protein E5Q_01123 [Mixia osmundae IAM 14324]
          Length = 676

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 300/663 (45%), Positives = 380/663 (57%), Gaps = 108/663 (16%)

Query: 69  RQRMSKKDEAIRKKVEHELNKK---NR----------TKSTSLNNRGKPQRQVPGAKGTV 115
           R R SK+DEAIRKK+E EL +K   NR          +++     RG        A GTV
Sbjct: 39  RSRQSKRDEAIRKKIETELARKRPSNRRAGSSNIPQPSQTNGNRRRGGQAGSSRRAAGTV 98

Query: 116 ASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLD 175
           ++L P  ALTV  +  VV+ASQL AAKR DCVLV+D EEHLSGIFTAKDLAFRV+GDGLD
Sbjct: 99  SALRPLPALTVPSTMSVVDASQLCAAKRTDCVLVVDEEEHLSGIFTAKDLAFRVIGDGLD 158

Query: 176 ARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEA 235
            R T V+ IMT+NPM  ++ TSATDAL TMV RGFRHLPVCNEEGDVVGLLDITK  +E+
Sbjct: 159 PRHTPVSAIMTKNPMVTRDTTSATDALQTMVTRGFRHLPVCNEEGDVVGLLDITKVFHES 218

Query: 236 LDKMERAYGSSKKLYDALEGVEREW---STNQPTQILQYMDMLREKMACPDLSSVLD-GS 291
           L+K+ERAYGSS+KLY ALEGV+ EW      Q + ++ Y++ LR+KM+ PD+ S+LD  +
Sbjct: 219 LEKLERAYGSSQKLYTALEGVQSEWGPQGAQQASGLMAYVEALRDKMSFPDIGSILDVRT 278

Query: 292 MPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS----IAGIFTSKDIVLRVIAAGLDPST 347
             A +GVKT+VRDAA++MRE RTTAV V+E       +AGIFTSKD+VLRVIAAGLD  T
Sbjct: 279 RAATIGVKTTVRDAAKIMRENRTTAVCVLEGDGSTGKLAGIFTSKDVVLRVIAAGLDAKT 338

Query: 348 CSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQ 406
           CSV+RVMTPHPDTA P  SI +AL+KM+DGHYLNLPV+ D G+++G VDVLKLTYAT+EQ
Sbjct: 339 CSVVRVMTPHPDTASPSLSIQEALRKMHDGHYLNLPVLDDAGALVGCVDVLKLTYATLEQ 398

Query: 407 MYSM---QNQENGNDGGGPMWNKFWNSLANDG---DNESTVSDSIAXXXXXXXXXXXXXX 460
           + S+        G+   GP W +F+NS        DNES  SD  A              
Sbjct: 399 VNSIGAEDGGSGGDGTDGPQWARFFNSFGAGSVQDDNESVFSDPQAAS------------ 446

Query: 461 XRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGH-----------------DENFFTF 503
                        E+HP++SAS + D   +   RG                  D+  + F
Sbjct: 447 -------------ELHPNDSASMLQDDDTSEVGRGANHHASSIGGLAVPGPAVDDGTYLF 493

Query: 504 KFKAPNGKSHRFTVDYTSFEHIRATVASKLPS-------------NVRDFTIYYVXXXXX 550
           KF AP G +HRF   Y   E IR  VA KL S             +  +F I Y      
Sbjct: 494 KFVAPGGTTHRFQARYDQHELIRDIVAGKLASDPFFTEADDGVHLDPSEFAISYHDDDGD 553

Query: 551 XXXXXXXXXXIDAVRIAQRQGMSRVILHI-------------------------QEIEKK 585
                      DAV  A++    RV+LH+                         ++I K 
Sbjct: 554 MVLMTSDRDVKDAVSTARKSSKDRVVLHLRGGKAWDEQLKKRGISLEAAAPAPPKKISKS 613

Query: 586 SLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALS 645
            +              + ++ RR+R   + +    +P D++LP A+  L I IIGVFALS
Sbjct: 614 IVESDEADDEGENSSQVARKARRRRQPDSDELVFGMPKDMILPAAIGFLGITIIGVFALS 673

Query: 646 RSK 648
           RSK
Sbjct: 674 RSK 676



>gi|225560596|gb|EEH08877.1| CBS and PB1 domain-containing protein [Ajellomyces capsulatus
           G186AR]
 gi|325088886|gb|EGC42196.1| CBS and PB1 domain-containing protein [Ajellomyces capsulatus H88]
          Length = 668

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 285/625 (45%), Positives = 383/625 (61%), Gaps = 61/625 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E +LNKK          R +  R+ P   GTV +L PSQAL ++
Sbjct: 57  SRQKQSKRDEAIRKKMEADLNKKRHGNPA----RSRHSRKAP--PGTVMALKPSQALQIK 110

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 111 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTK 170

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 171 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 230

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  +NQP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSVR+AA 
Sbjct: 231 KLYDALEGVQSELGSNQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVREAAT 290

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 291 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPNTCSVVRVMTPHPDFAPTDMSI 350

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SM   EN     GP WNK
Sbjct: 351 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNSMSTNEN----EGPAWNK 406

Query: 427 FWNSLANDGDNESTVSDSIAXX-XXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           FW S+ N+ D  S VS S +                R+ G    S    + P+ESAS   
Sbjct: 407 FWLSMDNESD--SMVSGSHSHHPHTPLRSVMSPDISRSHGDRENS----VLPNESASHNG 460

Query: 486 DGSMASF----PRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR-- 538
           D + +      P  H++  F FKFKAP+G+ HR  +  ++  E + + V+ KL + V   
Sbjct: 461 DEAASDVLDPRPVHHEDTSFPFKFKAPSGRVHRLHITPSAGVEDLVSQVSLKLGAEVEAV 520

Query: 539 --------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEK 584
                          + + Y+                DA+ +A+R    +V L + + EK
Sbjct: 521 GGNAIVEDGKMSHTGYALSYLDSEGDTVSITTDQDLWDAISLARRAKRDKVDLFVHDPEK 580

Query: 585 KSLRXXXXXXXXXXXXIL-------------EKRRRRKRGKHAPDYNLP---------IP 622
           + +                            +++   +R K+   +  P         +P
Sbjct: 581 QPIITAPEPQVPVTKSANLQESVPGSATGEDDEQNHVEREKNQTLFRSPPAEQQLINGVP 640

Query: 623 HDLLLPGAVLTLAIAIIGVFALSRS 647
           ++L+LPGA++TLA+AI+GVF L RS
Sbjct: 641 NELILPGAIVTLAVAIVGVFILGRS 665



>gi|388852932|emb|CCF53380.1| uncharacterized protein [Ustilago hordei]
          Length = 754

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 290/597 (48%), Positives = 371/597 (62%), Gaps = 88/597 (14%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQ---RQVPGAKGTVASLNPSQALT 125
           R+R SK+DEAIRKK+E EL +K+   ST +++R   +   R    A GTV++L P  ALT
Sbjct: 45  RKRQSKRDEAIRKKIEGELQRKSGKPSTPISSRRTNKHTARPPAAAAGTVSALRPLPALT 104

Query: 126 VRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIM 185
           V +S  V +ASQL AAKR DCVLV+D +EHL+GIFTAKDLAFRVV  GLDAR T V+ IM
Sbjct: 105 VPQSISVADASQLCAAKRTDCVLVVDEDEHLAGIFTAKDLAFRVVSAGLDARNTPVSAIM 164

Query: 186 TRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGS 245
           TR+PM  ++ TSAT+ALNTMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GS
Sbjct: 165 TRSPMVTRDTTSATEALNTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGS 224

Query: 246 SKKLYDALEGVEREWSTNQPTQ--ILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSV 302
           S+KLY+ALEGV+ EW  +   Q  +LQY++ LR+KM+ PDLSS+LD  ++P  +GV+T+V
Sbjct: 225 SQKLYNALEGVQSEWGGSAGPQQAMLQYIEALRQKMSIPDLSSILDSRTLPCCIGVRTTV 284

Query: 303 RDAARLMREYRTTAVLVMEHHS-----------------IAGIFTSKDIVLRVIAAGLDP 345
           R+AARLM+E+ TTAV VME                    IAGIFTSKD+VLRVIAAGLDP
Sbjct: 285 REAARLMKEHHTTAVCVMESTGTGPGTGQIGGGGAVSGKIAGIFTSKDVVLRVIAAGLDP 344

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATM 404
            TCSV+RVMTPHPDTA P  +I +AL+KM+DG YLNLPVVD  S ++G+VDVLKLTYAT+
Sbjct: 345 KTCSVVRVMTPHPDTALPSLTIQEALRKMHDGRYLNLPVVDVDSRLVGIVDVLKLTYATL 404

Query: 405 EQMYSMQNQE---NGNDGGGPMWNKFWNSLAND----GDNESTVSDSIAXXXXXXXXXXX 457
           EQ+ SM +++   +G   GGPMWN+FWNS        GD+ES VS S+            
Sbjct: 405 EQINSMNDEQGGADGGAAGGPMWNRFWNSFGQSNSIAGDDESAVSGSMRHSESQFEPPPT 464

Query: 458 XXXXRTRGSGNISPIPEIHPSESASAI------DDGSMA-SFPRG-----HDENFFTFKF 505
                  G+G      ++HP++SASA+      DDG+ A   P        D+  + FKF
Sbjct: 465 PSKV---GAGIADISSDLHPNDSASAVGQPVNGDDGASAIGLPSSAAAVEADDGTYLFKF 521

Query: 506 KAPNGKSHRFTVDYTSFEHIRATVASKL-------------------------------- 533
             P+G++HRF   Y S+E IR  V  KL                                
Sbjct: 522 VTPSGRTHRFQARYDSYETIREIVCIKLGGDPFFEPAPASCTVAAPAATGKGEANGDAHP 581

Query: 534 ---PSNV-------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
              PSN         DF + Y                 DAV++A++QG  RV+L +Q
Sbjct: 582 HQVPSNAAAELPDPNDFQLAYTDDEDDVVLITADGDVQDAVKVARKQGRDRVVLLLQ 638



>gi|402220904|gb|EJU00974.1| CBS-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 683

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 303/640 (47%), Positives = 387/640 (60%), Gaps = 72/640 (11%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R++ SK+DEAIR+K+E EL +K   ++ SL    K   +  G KGTVA+L PS ALTV E
Sbjct: 51  RRKQSKRDEAIRRKIEGELARK---RTISLAGTKKKTVKNDGRKGTVAALKPSPALTVPE 107

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           S  V +ASQL AAKR DCVLV+D +E LSGIFTAKDLAFRV  +GLD RTT V+TIMTR+
Sbjct: 108 SITVSDASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAFRVTAEGLDPRTTPVSTIMTRS 167

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSATDAL  MV+RGFRHLPVCNE+G+VVGLLDITK  +EALDK+ER   +S+K
Sbjct: 168 PMVTRDTTSATDALQLMVSRGFRHLPVCNEDGNVVGLLDITKVFHEALDKVERGSSASQK 227

Query: 249 LYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSV 302
           LY ALEGV+ E   N     Q   +L Y++ LR+K A PDL+SV+D  + PA V  KT+V
Sbjct: 228 LYSALEGVQSELGDNISANPQAAAMLAYVEALRDKTALPDLTSVMDARTRPAMVSPKTTV 287

Query: 303 RDAARLMREYRTTAVLVMEHHS------IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTP 356
           R+AA+LM+E RTT+V VME+        I GIFTSKD+VLRVIAAGL+P+ CSV+RVMTP
Sbjct: 288 REAAKLMKESRTTSVCVMENTGATSPPKIVGIFTSKDVVLRVIAAGLEPNRCSVVRVMTP 347

Query: 357 HPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQEN 415
           HPD APP  +I DALKKMY GHYLNLPVV + G ++ +VDVLKLTYAT+EQM +M  Q +
Sbjct: 348 HPDVAPPTMTIHDALKKMYTGHYLNLPVVEEDGRLVAIVDVLKLTYATLEQMTAMSAQTD 407

Query: 416 GNDG-GGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE 474
           G +   GPMW KF++S+A+D DNES +S S                  +    +I+ I E
Sbjct: 408 GEEQHTGPMWGKFFDSIAHD-DNESVMSGSNIQGEPTSPGLPRSPPLVSNMHRSIT-ISE 465

Query: 475 IHPSESASAIDD-------GSMASFPR-GHDEN-FFTFKFKAPNGKSHRFTVDYTSFEHI 525
           ++P +SAS +DD        + A  P   H E+  + FKF+ P+G++HRF   +  +E++
Sbjct: 466 VYPHDSASVVDDDQPTQNGAASAMMPADAHVEDGTYVFKFRTPSGRTHRFQARHDGYENL 525

Query: 526 RATVASKLP-------------------SNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRI 566
           R  V+ KL                     N  DFTI Y+                DAVR 
Sbjct: 526 RDIVSRKLALDPFFLRKTSTSDDEQLTMPNHEDFTIMYMDSEGDSVTISADNDVADAVRE 585

Query: 567 AQRQGMSRVILHIQ---EIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL---- 619
           A+     RV+L IQ     E  S              +   +  +K     PD  L    
Sbjct: 586 ARSSKQDRVLLIIQGGHGWESSSAEGEKEAKAQAQAAMEVVKELQK-----PDVELMPVV 640

Query: 620 -------------PIPHDLLLPGAVLTLAIAIIGVFALSR 646
                         IP DLLLP +V  LAIAIIGVF +SR
Sbjct: 641 PTPGLGITEDKVFGIPRDLLLPASVGALAIAIIGVFIVSR 680



>gi|320038151|gb|EFW20087.1| CBS and PB1 domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 655

 Score =  499 bits (1284), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 280/623 (44%), Positives = 377/623 (60%), Gaps = 62/623 (9%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIRKK+E +LNKK    + + + R  P        GTV +L PSQAL +
Sbjct: 49  VSRQKQSKRDEAIRKKMEADLNKKRYNPARARSTRKAP-------PGTVLALKPSQALQI 101

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT
Sbjct: 102 KPNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMT 161

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 162 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSS 221

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSV+DAA
Sbjct: 222 RKLYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLNGLPPITVSVRTSVKDAA 281

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LMRE+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   S
Sbjct: 282 ALMREHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMS 341

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +MQ  EN     GP WN
Sbjct: 342 IQAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTMQTNEN----EGPAWN 397

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASA-- 483
           KFW S+    D ES    S                 R RG   +      H  E A++  
Sbjct: 398 KFWLSM----DQESDSMVSGGGHSQNPRRSILSTDPRDRGDSVLPHESASHHGEDATSEL 453

Query: 484 IDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR---- 538
           +D   +A     +D++ F FKFKAP+G+ HR  V  ++    + A V+SKL S V     
Sbjct: 454 LDTRHLA-----NDDSPFPFKFKAPSGRVHRLQVIASAGVAELAANVSSKLGSEVEAVGG 508

Query: 539 ------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKS 586
                        + + Y+               +DA+  A++ G  +V L + + E   
Sbjct: 509 EAVVEDGKLSNSGYALSYLDNEGDTVSITTDQDLLDAIVQARKAGRDKVDLFVHDPESPP 568

Query: 587 LRXXXXXXXXXXX-------XILEKRRRRKRGKHAPDYNLP---------------IPHD 624
           +                     + +   +   +  P  +L                +P++
Sbjct: 569 VIAQEPQQATTQAPPEPVTRSPIPEEEEQSTDQARPQKSLSQTLTQSSAEQQLIAGVPNE 628

Query: 625 LLLPGAVLTLAIAIIGVFALSRS 647
           L+LPGA++TLA  I+GVF LSR+
Sbjct: 629 LILPGAIVTLAAVILGVFVLSRA 651



>gi|303316684|ref|XP_003068344.1| CBS/PB1 domain-containing protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|240108025|gb|EER26199.1| CBS domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 655

 Score =  499 bits (1284), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 280/623 (44%), Positives = 377/623 (60%), Gaps = 62/623 (9%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIRKK+E +LNKK    + + + R  P        GTV +L PSQAL +
Sbjct: 49  VSRQKQSKRDEAIRKKMEADLNKKRYNPARARSTRKAP-------PGTVLALKPSQALQI 101

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT
Sbjct: 102 KPNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMT 161

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 162 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSS 221

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSV+DAA
Sbjct: 222 RKLYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLNGLPPITVSVRTSVKDAA 281

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LMRE+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   S
Sbjct: 282 ALMREHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMS 341

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +MQ  EN     GP WN
Sbjct: 342 IQAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTMQTNEN----EGPAWN 397

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASA-- 483
           KFW S+    D ES    S                 R RG   +      H  E A++  
Sbjct: 398 KFWLSM----DQESDSMVSGGGHSQNPRRSILSTDPRDRGDSVLPHESASHHGEDATSEL 453

Query: 484 IDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR---- 538
           +D   +A     +D++ F FKFKAP+G+ HR  V  ++    + A V+SKL S V     
Sbjct: 454 LDTRHLA-----NDDSPFPFKFKAPSGRVHRLQVIASAGVAELAANVSSKLGSEVEAVGG 508

Query: 539 ------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKS 586
                        + + Y+               +DA+  A++ G  +V L + + E   
Sbjct: 509 EAVVEDGKLSNSGYALSYLDNEGDTVSITTDQDLLDAIVQARKAGRDKVDLFVHDPESPP 568

Query: 587 LRXXXXXXXXXXX-------XILEKRRRRKRGKHAPDYNLP---------------IPHD 624
           +                     + +   +   +  P  +L                +P++
Sbjct: 569 VIAQEPQQATTQAPPEPVTRSPIPEEEEQSMDQARPQKSLSQTLTQSSAEQQLIAGVPNE 628

Query: 625 LLLPGAVLTLAIAIIGVFALSRS 647
           L+LPGA++TLA  I+GVF LSR+
Sbjct: 629 LILPGAIVTLAAVILGVFVLSRA 651



>gi|258576507|ref|XP_002542435.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902701|gb|EEP77102.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 656

 Score =  498 bits (1283), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 283/628 (45%), Positives = 378/628 (60%), Gaps = 69/628 (10%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ +K+DEAIRKK+E +LNKK    + + + R  P        GTV SL PSQAL +
Sbjct: 47  VSRQKQTKRDEAIRKKMEADLNKKRYNPARARSTRKAP-------PGTVLSLKPSQALQI 99

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + S  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG G+ AR  T+A IMT
Sbjct: 100 KPSTTVAEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGIRARDITIAEIMT 159

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 160 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSS 219

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E   +QP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSV++AA
Sbjct: 220 RKLYDALEGVQSELGASQPQQIIQYVEALRQKMSGPTLESVLNGLPPITVSVRTSVKEAA 279

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LM+E+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   S
Sbjct: 280 ALMKEHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMS 339

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ ++Q  EN     GP WN
Sbjct: 340 IQAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTIQTNEN----EGPAWN 395

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           KFW S+    D+ES    S                 R RG         + P+ESAS   
Sbjct: 396 KFWLSM----DHESDSMVSGGGHSQNPRRSILSPDPRERGD-------SVLPNESASHHG 444

Query: 486 DGS----MASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNVR-- 538
           + +    M +    +D+  F FKFKAP G+ HR  V        + A V+SKL S V   
Sbjct: 445 EDAQSELMDTRQLANDDAPFPFKFKAPGGRVHRLQVIPSAGVADLVANVSSKLGSEVEAV 504

Query: 539 --------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEK 584
                          + + Y+               +DA+  A++ G  +V L + + EK
Sbjct: 505 GGEAVVENGKLSNSGYALSYLDNEGDTVSITTDQDLLDAIVQARKVGRDKVDLFVHDPEK 564

Query: 585 KSL----------RXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLP-------------- 620
             L          +            + E+ ++    + +P   L               
Sbjct: 565 PPLVVQDPQPAVTKPPTPPEPVLRSPVSEEDQQSPADRASPQKGLAQILTQPSTDQQLIT 624

Query: 621 -IPHDLLLPGAVLTLAIAIIGVFALSRS 647
            +P++L+LPGA++TLA  I+GVF LSR+
Sbjct: 625 GVPNELILPGAIVTLAAVILGVFVLSRA 652



>gi|331220075|ref|XP_003322713.1| hypothetical protein PGTG_04250 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309301703|gb|EFP78294.1| hypothetical protein PGTG_04250 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 746

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 297/668 (44%), Positives = 390/668 (58%), Gaps = 94/668 (14%)

Query: 69  RQRMSKKDEAIRKKVEHELNKK----NRTKSTSLNNRG--KPQRQVPGAKGTVASLNPSQ 122
           RQR  +KDEAIRKK+E+EL +K     RT +    + G  +P+RQ     GTV++L P  
Sbjct: 80  RQRQGRKDEAIRKKIENELQRKRPGQKRTNNQPAGSSGGPRPKRQA----GTVSALRPLP 135

Query: 123 ALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVA 182
           ALTV ++  V +ASQL AAKR DCVLV+D +EHL GIFTAKDLAFRV+GDG+D RTT V+
Sbjct: 136 ALTVPDNITVADASQLCAAKRTDCVLVVDEDEHLCGIFTAKDLAFRVIGDGMDPRTTPVS 195

Query: 183 TIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERA 242
            IMTRNPM  ++ TSAT+AL TMV RGFRHLPVCN+EGDV+GLLDITK  +E+L+K+ERA
Sbjct: 196 AIMTRNPMVTRDTTSATEALTTMVTRGFRHLPVCNDEGDVIGLLDITKVFHESLEKLERA 255

Query: 243 YGSSKKLYDALEGVEREWSTN----QPTQI---LQYMDMLREKMACPDLSSVLDG-SMPA 294
           YGSS+KLY+A+EGV+ E+ +      P  +   + Y++ LR KM+ PDL S+LD  +  A
Sbjct: 256 YGSSQKLYNAIEGVQSEFGSGGRGTTPGAVNPLMAYVEALRNKMSFPDLGSILDARTSAA 315

Query: 295 EVGVKTSVRDAARLMREYRTTAVLVMEHHS--IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            VGVKTSV++AA LMRE+ TTAV VME     IAGIFTSKDIVLRVIAAGLD  TCSV+R
Sbjct: 316 TVGVKTSVKEAAVLMREHHTTAVCVMESDGRRIAGIFTSKDIVLRVIAAGLDARTCSVVR 375

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTA P  SI +AL+KM+DGHYLNLPVVD  G + G VDVLKLTYAT+EQ+ S+ 
Sbjct: 376 VMTPHPDTALPSLSIQEALRKMHDGHYLNLPVVDEAGQLQGCVDVLKLTYATLEQVNSIS 435

Query: 412 NQENGNDGGGPMWNKFWNSLANDG----DNESTVSDS-IAXXXXXXXXXXXXXXXRTRGS 466
           ++   +D GGP+WN+F+ S    G    DN S VS S +A                 +  
Sbjct: 436 SEVTNDDSGGPVWNRFFASFGQAGSVDEDNTSIVSGSQLAHSETGPHTPRHKTGHDGQHP 495

Query: 467 GNISPIPEIHPSESASAIDDGSMASF-------------------PRGHDENFFTFKFKA 507
           G  +P  E+ P++SAS + +   ++                    P  +D+  + FKF A
Sbjct: 496 GLETPGSELAPNDSASVVQEDYESALAGRSTLQSVTSSQPFTGMVPLDYDDGTYLFKFIA 555

Query: 508 PNGKSHRFTVDYTSFEHIRATVASKL---------PSN-------VRDFTIYYVXXXXXX 551
           P+G +HRF   Y S++ +R  V  K+         PSN        +DF + Y+      
Sbjct: 556 PSGSAHRFQARYDSYDFVREIVVGKIESDPFIADHPSNATTIKPDAQDFQLAYLDDENDL 615

Query: 552 XXXXXXXXXIDAVRIAQRQGMSRVILHIQ--------EIEKK------SLRXXXXXXXXX 597
                     DAV  A++Q   RV+LH++        E+ KK      S R         
Sbjct: 616 VLITSDRDVTDAVNQAKKQRKDRVVLHLRGGKSWGDSELSKKKAAEVYSTRLKAVTEAEE 675

Query: 598 XXXI--------------LEKRRRRKRGKHA-----PDYNLPIPHDLLLPGAVLTLAIAI 638
                             L   R  K+  H      P     +P + +LP A+  L + I
Sbjct: 676 IENEELEERHSQAGSRDRLSTTRSSKKNAHNQTPVDPTLVAGVPKEFILPAAIGFLGVVI 735

Query: 639 IGVFALSR 646
           +GVF  S+
Sbjct: 736 LGVFLASK 743



>gi|295659197|ref|XP_002790157.1| CBS/PB1 domain-containing protein [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226281862|gb|EEH37428.1| CBS and PB1 domain-containing protein [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 671

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 290/658 (44%), Positives = 389/658 (59%), Gaps = 69/658 (10%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PRK  +P  P                   +RQ+ SK+DEAIRKK+E +LNKK    + + 
Sbjct: 29  PRKVETPPVP----QSTTSDVGSSSALSTSRQKQSKRDEAIRKKMEADLNKKRHNPARAR 84

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
           + R  P        GTV +L PS AL ++ +  V EA+QLMAAKR DCVLV D +E ++G
Sbjct: 85  HTRKAP-------PGTVMALKPSHALQIKPNTTVAEAAQLMAAKREDCVLVTDEDERIAG 137

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLAFRVVG G+ AR  T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 138 IFTAKDLAFRVVGAGIRARDVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 197

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  +NQP QI+QY++ LR+K
Sbjct: 198 NQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSNQPQQIIQYVEALRQK 257

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L +VL+G  P  V V+TSVR+AA LM+E  TTA+LV +  SI GIFTSKDIVLRV
Sbjct: 258 MSGPTLETVLNGLPPTTVSVRTSVREAAALMKENHTTALLVQDQGSITGIFTSKDIVLRV 317

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDVL
Sbjct: 318 IAPGLDPNTCSVVRVMTPHPDFAPTDMSIQAALRKMHDGHYLNLPVMNEAGEIVGMVDVL 377

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           KLTYAT+EQ+ +M    + N+  GP WNKFW  L+ D + +S VS S             
Sbjct: 378 KLTYATLEQVNTM----SSNESEGPAWNKFW--LSMDHETDSIVSGSHGGHQVSTPIRSV 431

Query: 458 XXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPR-GHDENF-FTFKFKAPNGKSH 513
                +R   ++     + P++SAS    D  S A  PR  H+E+  F FKFKAP+G+ H
Sbjct: 432 VSPELSR--THVERENSVLPNDSASHHGDDAASDALEPRVAHNEDTPFPFKFKAPSGRVH 489

Query: 514 RFTVDYTS-FEHIRATVASKLPSNVR----------------DFTIYYVXXXXXXXXXXX 556
           R  V  ++    + + V+ KL   V                  + + YV           
Sbjct: 490 RLHVTPSAGVSDLVSQVSRKLGPEVEAVGGYALVEDGKLSNSGYALSYVDNEGDTVSITT 549

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQEIEK-------------KSLRXXXXXXXXXXXXILE 603
                DAV +++   M +V L++ + EK             + +             I E
Sbjct: 550 DQDLWDAVTLSRNSNMDKVDLYVHDPEKQPVIATPPLPPVVQQVPSVSLKQATPPGAIEE 609

Query: 604 KRRRRKRGKHAPDYN-------LP--------IPHDLLLPGAVLTLAIAIIGVFALSR 646
           +  +   G  +   +       LP        +P++L+LPGA++TLA+AI+GVF LSR
Sbjct: 610 EEEQSNVGNRSSVTDRSQTIVRLPTAEQLINGVPNELILPGAIVTLAVAIVGVFVLSR 667



>gi|71006334|ref|XP_757833.1| hypothetical protein UM01686.1 [Ustilago maydis 521]
 gi|46097269|gb|EAK82502.1| hypothetical protein UM01686.1 [Ustilago maydis 521]
          Length = 708

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 303/695 (43%), Positives = 404/695 (58%), Gaps = 121/695 (17%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNR--GKPQRQVPGAKGTVASLNPSQALTV 126
           R+R SK+DEAIRKK+E EL +K+   ST +++R   +  R    A GTV++L P  ALTV
Sbjct: 14  RKRQSKRDEAIRKKIEGELQRKSGKPSTPMSSRRTKRTARPPAAAAGTVSALRPLPALTV 73

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            +S  V +ASQL AAKR DCVLV+D +EHL+GIFTAKDLAFRVV  GLDAR T V+ IMT
Sbjct: 74  PQSISVADASQLCAAKRTDCVLVVDEDEHLAGIFTAKDLAFRVVSAGLDARNTPVSAIMT 133

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           R+PM  ++ TSAT+ALNTMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS
Sbjct: 134 RSPMVTRDTTSATEALNTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSS 193

Query: 247 KKLYDALEGVEREWSTNQPTQ--ILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           +KLY+ALEGV+ EW  +   Q  +LQY++ LR+KM+ PDL+++LD  ++P  VGV+T+VR
Sbjct: 194 QKLYNALEGVQSEWGGSAGPQQAMLQYIEALRQKMSIPDLTTILDSRTLPCCVGVRTTVR 253

Query: 304 DAARLMREYRTTAVLVMEHHS-----------------IAGIFTSKDIVLRVIAAGLDPS 346
           +AARLM+E+ TTAV VME                    IAGIFTSKD+VLRVIAAGLDP 
Sbjct: 254 EAARLMKEHHTTAVCVMESTGSGPGTGQIGGGGAVSGKIAGIFTSKDVVLRVIAAGLDPK 313

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATME 405
           TCSV+RVMTPHPDTAPP  +I +AL+KM+DG YLNLPVVD  S ++G+VDVLKLTYAT+E
Sbjct: 314 TCSVVRVMTPHPDTAPPSLTIQEALRKMHDGRYLNLPVVDVDSRLVGVVDVLKLTYATLE 373

Query: 406 QMYSMQNQE--NGNDGGGPMWNKFWNSLAND----GDNESTVSDSIAXXXXXXXXXXXXX 459
           Q+ SM +++       GGPMWN+FWNS        GD+ES VS S+              
Sbjct: 374 QINSMNDEQAGGDGAAGGPMWNRFWNSFGQTNSIAGDDESAVSGSM-----RQSESQFEP 428

Query: 460 XXRTRGSGNISPI-PEIHPSESASAI------DDGSMA-SFPRG----HDENFFTFKFKA 507
              ++  G I+ I  ++HP++SASA+      DDG+ A   P       D+  + FKF  
Sbjct: 429 ATPSKVGGGIADISSDLHPNDSASAVGHHINGDDGASAIGLPSSAAVEADDGTYLFKFVT 488

Query: 508 PNGKSHRFTVDYTSFEHIRATVASKLPS-------------------------------- 535
           P+G++HRF   Y S+E IR  V  KL                                  
Sbjct: 489 PSGRTHRFQARYDSYETIREIVCIKLGGDPFFEPAAAVSSAPACDVGEMNGDAQSSSAVA 548

Query: 536 -------NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ-------- 580
                  +  DF + Y                 D+V++A++QG  RV+L +Q        
Sbjct: 549 SAVGEVPDPNDFQLAYTDDEDDVVLITADGDVQDSVKVARKQGRDRVVLLLQGGRGWEDA 608

Query: 581 -------------------------EIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAP 615
                                    E++ +S+                +R+ +K  K + 
Sbjct: 609 AARSVASTMSAGLAARKRQQAKENAEVQLQSVAEEEERENAVDEQADVRRKSKKHTKPSA 668

Query: 616 DYNL---PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
           D  L    +P DL LP A+  L +A++   A+++S
Sbjct: 669 DDELLFGVLPKDLALPAAIGFLGVAVLAAVAITKS 703



>gi|67539092|ref|XP_663320.1| hypothetical protein AN5716.2 [Aspergillus nidulans FGSC A4]
 gi|40743619|gb|EAA62809.1| hypothetical protein AN5716.2 [Aspergillus nidulans FGSC A4]
 gi|259484807|tpe|CBF81345.1| TPA: CBS and PB1 domain protein (AFU_orthologue; AFUA_1G06780)
           [Aspergillus nidulans FGSC A4]
          Length = 666

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 282/615 (45%), Positives = 369/615 (60%), Gaps = 56/615 (9%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK    + +   R  P        GTV +L PS AL ++ 
Sbjct: 69  RQNQSKRDEAIRRKLEADLNKKRSNPARANRTRKAP-------PGTVLALKPSSALQIKP 121

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           S  + EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL AR  TV+ IMT+N
Sbjct: 122 STTIAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKARDITVSEIMTKN 181

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 182 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 241

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVLDG  P  V V+T+V++AA L
Sbjct: 242 LYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLDGMPPTTVSVRTTVKEAAAL 301

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E+ TTA+LV +  SI GIFTSKDIVLRVIA GLDP+TCSV+RVMTPHPD AP   SI 
Sbjct: 302 MKEHHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPATCSVVRVMTPHPDFAPSDMSIQ 361

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ SM  Q    D  GP WNKF
Sbjct: 362 AALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINSMSTQ----DDEGPAWNKF 417

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDG 487
           W S+ ++ D+  + S S                   R S        + P+ESAS     
Sbjct: 418 WLSMDHESDSMVSGSQSHQPHRSIVNPESPKASFDARDS--------VLPNESASHHGGD 469

Query: 488 SMASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNVR-------- 538
             + F  G + + F FKFKAP+G+ HR  +        + A V +KL   V         
Sbjct: 470 EHSEFHHG-ELSPFPFKFKAPSGRVHRVNILPAAGIAELVAQVTAKLGPEVEAVGGAASC 528

Query: 539 --------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE--------- 581
                    + + YV               +DAV IA+     +V L + +         
Sbjct: 529 ADGVLSNTGYALSYVDNEGDTVSITTDQDLVDAVYIARHARRDKVDLFVHDPAQPPVIPA 588

Query: 582 -IEKKSLRXXXXXXXXXXXXILEK------RRRRKRGKHAPDYNL--PIPHDLLLPGAVL 632
            +E   ++            + E+      R  +    H P+  L   +P+DLLLPGA++
Sbjct: 589 PVEPAPVKPVEVKTPASDDQLSEESPIPKPRATQAYPAHPPEEQLIAGVPNDLLLPGAIV 648

Query: 633 TLAIAIIGVFALSRS 647
           TLA  I GVF LSR+
Sbjct: 649 TLAAVIAGVFILSRA 663



>gi|328854683|gb|EGG03814.1| hypothetical protein MELLADRAFT_117255 [Melampsora larici-populina
           98AG31]
          Length = 720

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 296/678 (43%), Positives = 397/678 (58%), Gaps = 104/678 (15%)

Query: 69  RQRMSKKDEAIRKKVEHELNKK----NRTKSTSLNNRG-KPQRQVPGAKGTVASLNPSQA 123
           RQR S+KDEAIRKK+E+EL +K     R  +  L + G +P+RQ     GTV++L P  A
Sbjct: 44  RQRQSRKDEAIRKKIENELQRKRPGQKRGPTGGLGHPGPRPRRQA----GTVSALRPLPA 99

Query: 124 LTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVAT 183
           LTV ++  V +ASQL AAKR DCVLV+D +EHL GIFTAKDLAFRV+GDGLD R+T V+ 
Sbjct: 100 LTVPDNITVADASQLCAAKRTDCVLVVDEDEHLCGIFTAKDLAFRVIGDGLDPRSTLVSE 159

Query: 184 IMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAY 243
           IMT+NPM  ++ TSAT+AL TMV RGFRHLPVCNEEGDV+GLLDITK  +E+L+K+ERAY
Sbjct: 160 IMTKNPMVTRDTTSATEALTTMVTRGFRHLPVCNEEGDVIGLLDITKVFHESLEKLERAY 219

Query: 244 GSSKKLYDALEGVEREWS-------TNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAE 295
           GSS+KLY+A+EGV+ E+         NQP  ++ Y++ LR+KM+ PDL S+LD  +  A 
Sbjct: 220 GSSQKLYNAIEGVQSEFGGSSNATHINQPNPLMAYVEALRDKMSFPDLGSILDARTTAAT 279

Query: 296 VGVKTSVRDAARLMREYRTTAVLVMEHHS--IAGIFTSKDIVLRVIAAGLDPSTCSVIRV 353
           VGVKTSV++AA+LMR++ TTAV VME+    IAGIFTSKD+VLRVIAAGLD  TCSV+RV
Sbjct: 280 VGVKTSVKEAAKLMRDHHTTAVCVMENDGKKIAGIFTSKDVVLRVIAAGLDARTCSVVRV 339

Query: 354 MTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQN 412
           MTPHPDTA P  SI +AL+KM+DGHYLNLPVVD  G + G VDVLKLTYAT+EQ+ S+  
Sbjct: 340 MTPHPDTALPSLSIQEALRKMHDGHYLNLPVVDEAGQLQGCVDVLKLTYATLEQVNSISA 399

Query: 413 QENGNDGGGPMWNKFWNSLANDG--DNESTVSDSIAXXXXXXXXXXXXXXXRTRGS---- 466
               ++ GGP+W++F+ SL   G  D+++  + S +               R +G     
Sbjct: 400 DGQTDESGGPVWSRFFASLGQAGSVDDDAGSAISGSHLDASELPPRTPTSNRFKGQRHAS 459

Query: 467 -GNISPIPEIHPSESASAIDD---------GSMASFPRGH-------DENFFTFKFKAPN 509
            G  +P  E+ P++SAS I D           + SF  G        D+  + FKF AP+
Sbjct: 460 RGPDTPGSELAPNDSASVIHDEADSALMSKSGVMSFANGRGGAPIEFDDGTYLFKFIAPS 519

Query: 510 GKSHRFTVDYTSFEHIRATVASK-------LPS-------------NVRDFTIYYVXXXX 549
           G +HRF   Y S++ +R  +  K       LPS             +  DF + Y     
Sbjct: 520 GSAHRFQARYDSYDFVREIIQGKLQTDPFILPSEDSSGITDQTLRPDSNDFQMSYFDDDN 579

Query: 550 XXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE---------IEKKSLRXXXXXXXXXXXX 600
                       D+V +A++Q   RV++H++          I+KK++             
Sbjct: 580 DLVLMTSDQDITDSVNLAKKQSKDRVVIHLKGGKTWGDLDLIKKKNVNSIIRLKAVSEAE 639

Query: 601 ILE-------------------------------KRRRRKRGKHAPDYNLP-IPHDLLLP 628
             E                               KR ++ +  H  D  +  IP DL+LP
Sbjct: 640 EKEESNGIHQNDLQQEDQDDEDDEDQTMKIETTRKRVKKVQKDHQKDELVAGIPKDLVLP 699

Query: 629 GAVLTLAIAIIGVFALSR 646
            A+  L   I+GVF  S+
Sbjct: 700 AAIGFLGFVILGVFLASK 717



>gi|482813228|gb|EOA89932.1| hypothetical protein SETTUDRAFT_167648 [Setosphaeria turcica Et28A]
          Length = 666

 Score =  496 bits (1276), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 288/630 (45%), Positives = 384/630 (60%), Gaps = 70/630 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R +MSK+D+AIR+K+E +LNKK      +++ R +P ++ P   GTV +L PS AL ++
Sbjct: 54  SRAKMSKRDDAIRRKIESDLNKKK-----TISGRVRPSKKAP--PGTVLALKPSPALQIK 106

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG+G+ AR  T+  IMT+
Sbjct: 107 PSTTVAEAAQLMAAKREDCVLVTDEDDRIAGIFTAKDLAFRVVGNGIKARDVTIEEIMTK 166

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 167 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYASSR 226

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R+KM+ P L SVL G  P  V V+TSV++AA 
Sbjct: 227 KLYDALEGVQAEMGSSQPQQIIQYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVKEAAA 286

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV ++ SI GIFTSKD+VLRVIAAGLDP TCSV+RVMTPHPD AP   SI
Sbjct: 287 LMKENHTTAVLVQDNGSITGIFTSKDVVLRVIAAGLDPMTCSVVRVMTPHPDFAPVDMSI 346

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WNK
Sbjct: 347 QSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTTDSEGPAWNK 402

Query: 427 FWNSLANDGDNESTVSD---SIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASA 483
           FW SL  D + ES +S    S                   RG         + P+ESAS 
Sbjct: 403 FWLSL--DNETESMMSGEGGSRHPDHRSYVSHHDRPGLMDRGD-------SVMPNESASH 453

Query: 484 IDDGS-----MASFPRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSN 536
             + S     +AS P  H E+  F FKFKAP+G+ HR  V  ++  E +   VA+KL S 
Sbjct: 454 HGEDSPPPSHVASIPPTHIEDMPFPFKFKAPSGRVHRLQVVISAGIEELITNVANKLGSE 513

Query: 537 VR----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
           V                  F + Y+               ++AV +++     +V L + 
Sbjct: 514 VETLGGIPSFEGGKLSRAGFALSYLDNEGDTISITTNDDLVEAVSLSRMAHREKVDLFVH 573

Query: 581 EIEKKSL------RXXXXXXXXXXXXILEKRRR----------RKRGKH--APDYNLP-- 620
             +K  +      +             L +R++          R RG+H  AP    P  
Sbjct: 574 HPDKAPMSAEVNPQPALSKPPTPPESTLRERKQFFDDDVEDTPRSRGRHQPAPVSQQPEI 633

Query: 621 ---IPHDLLLPGAVLTLAIAIIGVFALSRS 647
              +P+DLLLPGA+  LA+ I+GVF L R+
Sbjct: 634 IAGVPNDLLLPGAIGVLAVVIVGVFVLGRA 663



>gi|119187931|ref|XP_001244572.1| CBS/PB1 domain-containing protein [Coccidioides immitis RS]
 gi|392871287|gb|EAS33178.2| CBS and PB1 domain-containing protein [Coccidioides immitis RS]
          Length = 655

 Score =  495 bits (1275), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 279/623 (44%), Positives = 376/623 (60%), Gaps = 62/623 (9%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIRKK+E +LNKK    + + + R  P        GTV +L PSQAL +
Sbjct: 49  VSRQKQSKRDEAIRKKMEADLNKKRYNPARARSTRKAP-------PGTVLALKPSQALQI 101

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT
Sbjct: 102 KPNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMT 161

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 162 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSS 221

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSV+DAA
Sbjct: 222 RKLYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLNGLPPITVSVRTSVKDAA 281

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LMRE+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   S
Sbjct: 282 ALMREHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMS 341

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+ GHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +MQ  EN     GP WN
Sbjct: 342 IQAALRKMHYGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTMQTNEN----EGPAWN 397

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASA-- 483
           KFW S+    D ES    S                 R RG   +      H  E A++  
Sbjct: 398 KFWLSM----DQESDSMVSGGGHSQNPRRSILSTDPRDRGDSVLPHESASHHGEDATSEL 453

Query: 484 IDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR---- 538
           +D   +A     +D++ F FKFKAP+G+ HR  V  ++    + A V+SKL S V     
Sbjct: 454 LDTRHLA-----NDDSPFPFKFKAPSGRVHRLQVIASAGVAELAANVSSKLGSEVEAVGG 508

Query: 539 ------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKS 586
                        + + Y+               +DA+  A++ G  +V L + + E   
Sbjct: 509 EAVVEDGKLSNSGYALSYLDNEGDTVSITTDQDLLDAIVQARKAGRDKVDLFVHDPESPP 568

Query: 587 LRXXXXXXXXXXX-------XILEKRRRRKRGKHAPDYNLP---------------IPHD 624
           +                     + +   +   +  P  +L                +P++
Sbjct: 569 VIAQEPQQATTQAPPEPVTRSPIPEEEEQSTDQARPQKSLSQTLTQSSAEQQLIAGVPNE 628

Query: 625 LLLPGAVLTLAIAIIGVFALSRS 647
           L+LPGA++TLA  I+GVF LSR+
Sbjct: 629 LILPGAIVTLAAVILGVFVLSRA 651



>gi|449550757|gb|EMD41721.1| hypothetical protein CERSUDRAFT_110295 [Ceriporiopsis subvermispora
           B]
          Length = 704

 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 297/653 (45%), Positives = 389/653 (59%), Gaps = 82/653 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQR-QVPGAKGTVASLNPSQALTV 126
           +R++ S++DEAIRKK+E EL++K RT ST+    G+ +  +    KGTVA+L PS ALTV
Sbjct: 57  SRRKQSRRDEAIRKKIESELSRK-RTISTTQGQSGRKRGGKANVQKGTVAALKPSPALTV 115

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            E+  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  +GLD  TT V+TIMT
Sbjct: 116 PENITVSEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVTAEGLDPHTTQVSTIMT 175

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           RNPM  ++ TSAT+AL  MV R FRHLPVCNEEG+VVGLLDITK  +EALDK+ER+  +S
Sbjct: 176 RNPMVTRDTTSATEALQLMVQRHFRHLPVCNEEGNVVGLLDITKVFHEALDKVERSSSAS 235

Query: 247 KKLYDALEGVERE----WSTN-QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKT 300
           +KLY AL GV+ E     STN Q   +L Y++ LREK A PDL+S++D  + PA VG KT
Sbjct: 236 EKLYSALAGVQSELGGGLSTNPQAAAMLSYVEALREKTALPDLTSIMDSRTQPATVGPKT 295

Query: 301 SVRDAARLMREYRTTAVLVMEHHS--------IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           +VR+ A+LM+E RTTAV VME           IAGIFTSKDIVLRVIAAGLD + CSV+R
Sbjct: 296 TVREVAKLMKERRTTAVCVMEPSGAAPGTPSKIAGIFTSKDIVLRVIAAGLDATRCSVVR 355

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTAPP T+  DALKKM++GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM ++ 
Sbjct: 356 VMTPHPDTAPPTTTCHDALKKMHNGHYLNLPVVEADGRLVAIVDVLKLTYATLEQMNAIS 415

Query: 412 NQENGNDG---GGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
            + +G      GGPMW +F+ SL    D ES +S S                  +R   +
Sbjct: 416 AEASGEAAEHEGGPMWGRFFESLGGGDDTESMLSGS-------NFPGDTHSRTMSRSMSH 468

Query: 469 ISP--IPEIHPSESASAIDDGSMASFPRGH-----------------DENFFTFKFKAPN 509
           + P    E+HP++SAS ID+ S ++    H                 D+  + FKF+ P+
Sbjct: 469 VMPSDYSEVHPNDSASVIDEESASALQGYHRSEVHSANGPSNPLPAVDDGTYVFKFRTPS 528

Query: 510 GKSHRFTVDYTSFEHIRATVASKLPS----------------NVRDFTIYYVXXXXXXXX 553
           G++HRF   + + E++R  VA KL +                +  DF + Y         
Sbjct: 529 GRTHRFQARHDNIENLRDIVAGKLATDPFFTNLKTEDGAEAPDPNDFLLSYTDADGDIVL 588

Query: 554 XXXXXXXIDAVRIAQRQGMSRVILHIQ------EIEKKSLRXXXXXXXXXXXXILEKRRR 607
                   DAV+IA+   + RV+L +Q      ++ +KS                E  + 
Sbjct: 589 ITSDTDVTDAVKIARSADLDRVVLFVQGGKGWSDVVEKSAAQAAEVKAAAQEETKEVEKA 648

Query: 608 R-------KRGKHAP-------DYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
                   K    AP       +  L IP DLLLP ++  LA  IIGVF +SR
Sbjct: 649 ESVLPEVVKTAPPAPVHVHVEEEKVLGIPKDLLLPASIGALAAVIIGVFTISR 701



>gi|452005050|gb|EMD97506.1| hypothetical protein COCHEDRAFT_1190356 [Bipolaris maydis C5]
 gi|477584263|gb|ENI01356.1| hypothetical protein COCC4DRAFT_204067 [Bipolaris maydis ATCC
           48331]
          Length = 665

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 285/627 (45%), Positives = 383/627 (61%), Gaps = 65/627 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R +MSK+D+AIR+K+E +LNKK      +++ R +P ++ P   GTV +L PS AL ++
Sbjct: 54  SRAKMSKRDDAIRRKIETDLNKKK-----NISGRVRPSKKAP--PGTVLALKPSPALQIK 106

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG+G+ AR  T+  IMT+
Sbjct: 107 PSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGNGIKARDVTIEEIMTK 166

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 167 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYASSR 226

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R+KM+ P L SVL G  P  V V+TSV++AA 
Sbjct: 227 KLYDALEGVQAEMGSSQPQQIIQYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVKEAAA 286

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV ++ SI GIFTSKD+VLRVIAAGLDP TCSV+RVMTPHPD AP   SI
Sbjct: 287 LMKENHTTAVLVQDNGSITGIFTSKDVVLRVIAAGLDPMTCSVVRVMTPHPDFAPVDMSI 346

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WNK
Sbjct: 347 QSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTTDSEGPAWNK 402

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES +S   +                    G+      + P+ESAS   D
Sbjct: 403 FWLSL--DNETESVMSGEGSRHPDHRSYISHHDRPGLMDRGD-----SVMPNESASHNGD 455

Query: 487 GS-----MASFPRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVRD 539
            S     +AS    H E+  F FKFKAP+G+ HR  V  ++  E +  +VA+KL S V  
Sbjct: 456 DSPPPSAVASNHPVHMEDMPFPFKFKAPSGRVHRLQVVISAGLEELINSVANKLGSEVES 515

Query: 540 ----------------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++AV +++     +V L +   +
Sbjct: 516 LGGAPSFEGGRLSREGFALSYLDNEGDTISITTNDDLVEAVSLSRMAHREKVDLFVHHPD 575

Query: 584 KKSLRXXXXXXXXXXXXI------LEKRRR----------RKRGKH-------APDYNLP 620
           K  +             I      L +R++          R RG+H        P+    
Sbjct: 576 KPPMSAEVNPQPGLSKPITPPESTLRERKQFFDDDAEEKPRSRGRHQSIPLSQQPEIIAG 635

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P+DLLLPGA+  LA+ I+GVF L R+
Sbjct: 636 VPNDLLLPGAIGVLAVVIVGVFVLGRA 662



>gi|384494220|gb|EIE84711.1| hypothetical protein RO3G_09421 [Rhizopus delemar RA 99-880]
          Length = 370

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/345 (68%), Positives = 288/345 (83%), Gaps = 10/345 (2%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQR SKKDEAIRKK+E EL++K R+  T +       RQ     GTV++L P+QALT++E
Sbjct: 34  RQRQSKKDEAIRKKIEQELSRK-RSNPTRI-------RQTKKIAGTVSALRPAQALTLKE 85

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           + LV+EA+QLMAAKR+DCVLV+D EEHL+GIFTAKDLA+RVV D LDAR+TTV+ IMTRN
Sbjct: 86  NILVIEAAQLMAAKRSDCVLVVDDEEHLNGIFTAKDLAYRVVADNLDARSTTVSDIMTRN 145

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PMCV  DT A DALN MV+RGFRHLPVCNEEGD+ GLLDITKC+YEAL KME+AYGSS+K
Sbjct: 146 PMCVTADTCAQDALNLMVSRGFRHLPVCNEEGDIFGLLDITKCIYEALHKMEKAYGSSRK 205

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGVEREW+ N P Q++QYM+ L++KM+CPDL+SVL    P +V +KT VR+ A+L
Sbjct: 206 LYDALEGVEREWA-NSPVQLVQYMETLKDKMSCPDLTSVLTHHEPVQVSLKTQVREVAKL 264

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+EY TTAVLVM+H+ +AGIFTSKDI LRVIAAGL P  CSV+RVMTPHPDTA P TSIL
Sbjct: 265 MKEYHTTAVLVMDHNGLAGIFTSKDIALRVIAAGLAPDNCSVVRVMTPHPDTALPSTSIL 324

Query: 369 DALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQN 412
           DALKKM+DGHYLNLPV+D   +++G++DVL+LTYAT+EQ+ +  N
Sbjct: 325 DALKKMHDGHYLNLPVLDEDKNLVGLIDVLRLTYATLEQVRATCN 369



>gi|358373443|dbj|GAA90041.1| CBS and PB1 domain protein [Aspergillus kawachii IFO 4308]
          Length = 609

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 288/621 (46%), Positives = 377/621 (60%), Gaps = 65/621 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK    + +  +R  P        GTV +L PSQAL ++ 
Sbjct: 9   RQNQSKRDEAIRRKLEADLNKKRHAPARANRSRKAP-------PGTVLALKPSQALQIKP 61

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  + EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL AR  TV+ IMT+N
Sbjct: 62  NTSIAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGTGLKAREITVSEIMTKN 121

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 122 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 181

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR KM+ P L +VLDG  P  V V+T+V+DAA L
Sbjct: 182 LYDALEGVQTELGSSQPQQIIQYVEALRHKMSGPTLETVLDGMPPTTVSVRTTVKDAAAL 241

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           MRE+ TTA+LV +  SI GIFTSKDIVLRVIA GLDPSTCSV+RVMTPHPD AP   SI 
Sbjct: 242 MREHHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQ 301

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ+    +D  GP WNKF
Sbjct: 302 AALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMQS----HDDEGPAWNKF 357

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AID 485
           W S+    D+E   SDS+                  + S +      + P+ESAS    D
Sbjct: 358 WLSM----DHE---SDSMVSGSQQPAQRSVLSPESPKASYDAR--DSVLPNESASHHGGD 408

Query: 486 DGSMASFPRGHDENF-FTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKL---------- 533
           + S       H E+  F FKFKAP+G+ HR  V        + A V++KL          
Sbjct: 409 EHSEYHVDPHHGEHVPFPFKFKAPSGRVHRVNVFPSAGIAELVAQVSAKLGPEADAVGGV 468

Query: 534 PS------NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE------ 581
           PS      +   + + Y+                DAV +A++    +V L + +      
Sbjct: 469 PSCDEGKLSNTGYALSYLDNEGDTVSITTDQDLADAVSLARQSHRDKVDLFVHDPTQPPI 528

Query: 582 -------------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL--PIPHDLL 626
                        IE+KS              ++ K R +    H P+      +P+DLL
Sbjct: 529 PATVEPQPVPARPIEEKS---PISEDRSEEESVVAKPRAQSFPVHQPEEQFIAGVPNDLL 585

Query: 627 LPGAVLTLAIAIIGVFALSRS 647
           LPGA++TLA  I GVF LSR+
Sbjct: 586 LPGAIVTLAAVIAGVFILSRA 606



>gi|212528298|ref|XP_002144306.1| CBS/PB1 domain-containing protein [Talaromyces marneffei ATCC
           18224]
 gi|210073704|gb|EEA27791.1| CBS and PB1 domain protein [Talaromyces marneffei ATCC 18224]
          Length = 675

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 293/639 (45%), Positives = 379/639 (59%), Gaps = 87/639 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK        +NR  P        GTV +L PSQAL ++ 
Sbjct: 59  RQNQSKRDEAIRRKMEADLNKKRHHVQRPRHNRKAP-------PGTVLALKPSQALQIKP 111

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL AR  T+A IMT+N
Sbjct: 112 NTTVAEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGLKAREVTIAEIMTKN 171

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 172 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRK 231

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVLDG  P  V V+TSV++AA L
Sbjct: 232 LYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLDGMPPTTVSVRTSVKEAAAL 291

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI 
Sbjct: 292 MKEHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMSIQ 351

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SM    N  D  GP WNKF
Sbjct: 352 AALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINSM----NTGDDEGPAWNKF 407

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP---------EIHPS 478
           W  L+ D +++S VS                    T     +SP P          + P+
Sbjct: 408 W--LSMDHESDSMVSGG------------GSHRPHTPHRSVLSPEPSKAGFDRGDSVLPN 453

Query: 479 ESASAIDDGSMASFPRGHDENF---FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL- 533
           +SAS   D   +     HD++    F FKFKAP+G+ HR  V  +     + A+V +KL 
Sbjct: 454 DSASHHGDDMHSELLEQHDDDANTPFAFKFKAPSGRVHRVNVVISEGLSALVASVVAKLG 513

Query: 534 ---------PSNVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
                    PS V D       F + Y+                DAV  A++    +V L
Sbjct: 514 QEAEAVGGEPS-VEDGKLSSTGFALSYLDNEGDTVSITTDQDLSDAVHQARKLHHEKVDL 572

Query: 578 HIQEIEKKSLRXXXX------XXXXXXXXILEKR----------------RRRKRGKHA- 614
            + +  +  +                   +L++R                R  +  KHA 
Sbjct: 573 FVHDPSQPPIPATSEPLPAPSKPPSPPESVLKERAPRHIEEDEEEEEDFSRSTRTTKHAV 632

Query: 615 PDYNLP-------IPHDLLLPGAVLTLAIAIIGVFALSR 646
           P   LP       +P+DLLLPGA++TLA  I GVF LSR
Sbjct: 633 PQQRLPEEQLIAGVPNDLLLPGAIVTLAAVIAGVFILSR 671



>gi|406864620|gb|EKD17664.1| ribosomal protein subunit S4 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 672

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 286/628 (45%), Positives = 376/628 (59%), Gaps = 63/628 (10%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ +KKDEAIR+K+E +L+KK  T S     R +  R+ P   GTV +L PSQAL +
Sbjct: 55  VSRQKQTKKDEAIRRKIETDLSKKRHTTS-----RARQTRKAP--PGTVLALRPSQALQI 107

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D E+ ++GIFTAKDLAFRVVG G+ A   T+A IMT
Sbjct: 108 KPNTTVAEAAQLMAAKREDCVLVTDDEDRIAGIFTAKDLAFRVVGAGIKAGNVTIAEIMT 167

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 168 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSS 227

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSVR+AA
Sbjct: 228 RKLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLDGKPPTTVSVRTSVREAA 287

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LM+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   S
Sbjct: 288 ALMKENHTTAVLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMS 347

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +M       D  GP WN
Sbjct: 348 IQAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINTMST----GDSEGPAWN 403

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           KFW SL N  + ES +S                    +RG   I     + P +SAS I 
Sbjct: 404 KFWLSLEN--ETESIMSGE-GSHHHTQGARSLMSPDMSRGHERIVDA-SVAPGDSASHIG 459

Query: 486 ----DGSMASFP--RGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNV- 537
                 S+ + P  +  DE  F FKFKAP+G+ HR  V        +   V SKL + V 
Sbjct: 460 VESPPHSVVTSPAEQNVDEIPFPFKFKAPSGRVHRLQVIAANGVAELIDAVISKLGAEVD 519

Query: 538 ---------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEI 582
                            F + Y+               +DA+ +A++    +V L + + 
Sbjct: 520 AVGGMATSENGKVGASGFALSYLDDDGDTVAITTDHDLLDAIILARQGHRDKVDLFVHDP 579

Query: 583 EKKSL------RXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLP---------------- 620
           EK  +      R             + +R++        D  LP                
Sbjct: 580 EKPPISATLDPRLVIPNEPTPPPSSIRERKKIISEDDESDEELPVKRRKNTSPPVQQQAV 639

Query: 621 --IPHDLLLPGAVLTLAIAIIGVFALSR 646
             +P++LLLPGA++TLA+ I+GVF L+R
Sbjct: 640 AGVPNELLLPGAIVTLAVVIVGVFTLTR 667



>gi|255935165|ref|XP_002558609.1| Pc13g01640 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583229|emb|CAP91233.1| Pc13g01640 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 615

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 285/623 (45%), Positives = 371/623 (59%), Gaps = 65/623 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +L+KK    + S N+R  P        GTV +L PSQAL ++ 
Sbjct: 9   RQNQSKRDEAIRRKMEADLSKKRNAPAKSRNSRKAP-------PGTVLALKPSQALQIKP 61

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           S  + EA+QLMAAKR DCVLV D  E ++GIFTAKDLAFRVVG GL AR  +VA IMT+N
Sbjct: 62  SMSIAEAAQLMAAKREDCVLVTDDNERIAGIFTAKDLAFRVVGLGLKAREVSVAEIMTKN 121

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 122 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 181

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP Q++QY++ LR KM+ P L +VLDG  P  V V+T+V+DAA L
Sbjct: 182 LYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLDGLPPVTVSVRTTVKDAAAL 241

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E  TTA+LV +  SI GIFTSKDIVLRVIA GLDPSTCSV+RVMTPHPD AP   SI 
Sbjct: 242 MKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQ 301

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ +M  Q    D  GP WNKF
Sbjct: 302 AALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINTMSTQ----DDEGPAWNKF 357

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDG 487
           W  L+ D +++S VS   +                  G  N      + P++SAS   D 
Sbjct: 358 W--LSMDHESDSMVSGGHSQQLNTPHRSVMSPDLARSGYDN-----SLLPNDSASHHGDE 410

Query: 488 SMASFPRGHDEN-----FFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR--- 538
                 + H         F FKFKAP G+ HR  V  T+    + + V +KL   V    
Sbjct: 411 HSEVISQHHPAEPAAPTPFPFKFKAPGGRVHRVNVLTTNGVTDLVSQVTAKLGKEVEAVG 470

Query: 539 -------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE---- 581
                         + + Y+                DA+ +A+R    +V L + +    
Sbjct: 471 GEPTVEEGRLSNTGYALSYMDNEGDTVSITTDQDMTDAIDLARRTHRDKVNLFVHDPAQP 530

Query: 582 ----------------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL--PIPH 623
                           IE++S+              L +++      HAP+  L   +P+
Sbjct: 531 PIPAPVEPQHVKIVTPIEEQSVVEESASQESPVSKALPQQQAVP--AHAPEEQLIAGVPN 588

Query: 624 DLLLPGAVLTLAIAIIGVFALSR 646
           DLLLPGA++TLA  I GVF LSR
Sbjct: 589 DLLLPGAIVTLAAVIAGVFILSR 611



>gi|343428370|emb|CBQ71900.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 753

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 308/708 (43%), Positives = 402/708 (56%), Gaps = 135/708 (19%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNR--GKPQRQVPGAKGTVASLNPSQALTV 126
           R+R SK+DEAIRKK+E EL +K+   +T +++R   +  R    A GTV++L P  ALTV
Sbjct: 46  RKRQSKRDEAIRKKIEGELQRKSGKPATPISSRRTKRTARPPAAAAGTVSALRPLPALTV 105

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            +S  V +ASQL AAKR DCVLV+D +EHL+GIFTAKDLAFRVV  GLDAR T V+ IMT
Sbjct: 106 PQSISVADASQLCAAKRTDCVLVVDEDEHLAGIFTAKDLAFRVVSAGLDARNTPVSAIMT 165

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           R+PM  ++ TSAT+ALNTMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS
Sbjct: 166 RSPMVTRDTTSATEALNTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSS 225

Query: 247 KKLYDALEGVEREWSTNQPTQ--ILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           +KLY+ALEGV+ EW  +   Q  +LQY++ LR+KM+ PDLSS+LD  ++P  VGV+T+VR
Sbjct: 226 QKLYNALEGVQSEWGGSAGPQQAMLQYIEALRQKMSIPDLSSILDSRTLPCCVGVRTTVR 285

Query: 304 DAARLMREYRTTAVLVMEHHS-----------------IAGIFTSKDIVLRVIAAGLDPS 346
           +AARLM+E+ TTAV VME                    IAGIFTSKD+VLRVIAAGLDP 
Sbjct: 286 EAARLMKEHHTTAVCVMESTGTGPGNGQIGGGGAVSGKIAGIFTSKDVVLRVIAAGLDPK 345

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATME 405
           TCSV+RVMTPHPDTAPP  +I +AL+KM+DG YLNLPVVD  S ++G+VDVLKLTYAT+E
Sbjct: 346 TCSVVRVMTPHPDTAPPSLTIQEALRKMHDGRYLNLPVVDVDSRLVGVVDVLKLTYATLE 405

Query: 406 QMYSMQNQE--NGNDGGGPMWNKFWNSLAND----GDNESTVSDSIAXXXXXXXXXXXXX 459
           Q+ SM +++       GGPMWN+FWNS        GD+ES VS S+              
Sbjct: 406 QINSMNDEQAGGDGAAGGPMWNRFWNSFGQSNSIAGDDESIVSGSMRQSESQFEPPTP-- 463

Query: 460 XXRTRGSGNISPI-PEIHPSESASAI------DDGSMA-----SFPRGHDENFFTFKFKA 507
              ++  G I+ I  ++HP++SASA+      DDG+ A     S     D+  + FKF  
Sbjct: 464 ---SKLGGTIADISSDLHPNDSASAVGHQVNGDDGASAVGVPSSAAVEADDGTYLFKFVT 520

Query: 508 PNGKSHRFTVDYTSFEHIRATVASKLPSN------------------------------- 536
           P+G++HRF   Y S+E IR  V  KL  +                               
Sbjct: 521 PSGRTHRFQARYDSYETIREIVCIKLGGDPFFEPVPVASTTPAYEIGEPNGNGDAPPAPS 580

Query: 537 -----------VRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ----- 580
                        DF + Y                 DAV++A++QG  RV+L +Q     
Sbjct: 581 AAAAPPAEVPDPNDFQLAYTDDEDDVVLITADGDVQDAVKVARKQGRDRVVLLLQGGRGW 640

Query: 581 --------------------------------------EIEKKSLRXXXXXXXXXXXXIL 602
                                                 E E+K                 
Sbjct: 641 EDATARAAAAASTSTSGLAARKRQQARESAEAQLQSVAEEEEKETHADDDADDDESSKRR 700

Query: 603 EKRRRRKRGKHAPDYNL---PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
             ++  KRG  APD  L    +P DL LP A+  L +A++   A+++S
Sbjct: 701 PAKKSAKRGS-APDDELLFGVLPKDLALPAAIGFLGVAVLAAVAITKS 747



>gi|451855607|gb|EMD68899.1| hypothetical protein COCSADRAFT_135182 [Bipolaris sorokiniana
           ND90Pr]
          Length = 665

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 284/627 (45%), Positives = 383/627 (61%), Gaps = 65/627 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R +MSK+D+AIR+K+E +LNKK      +++ R +P ++ P   GTV +L PS AL ++
Sbjct: 54  SRAKMSKRDDAIRRKIETDLNKKK-----NISGRVRPSKKAP--PGTVLALKPSPALQIK 106

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG+G+ AR  T+  IMT+
Sbjct: 107 PSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGNGIKARDVTIEEIMTK 166

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 167 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYASSR 226

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R+KM+ P L SVL G  P  V V+TSV++AA 
Sbjct: 227 KLYDALEGVQAEMGSSQPQQIIQYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVKEAAA 286

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV ++ SI GIFTSKD+VLRVIAAGLDP TCSV+RVMTPHPD AP   SI
Sbjct: 287 LMKENHTTAVLVQDNGSITGIFTSKDVVLRVIAAGLDPMTCSVVRVMTPHPDFAPVDMSI 346

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WNK
Sbjct: 347 QSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTTDSEGPAWNK 402

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES +S   +                    G+      + P+ESAS   D
Sbjct: 403 FWLSL--DNETESVMSGEGSRHPDHRSHISHHDRPGLMDRGD-----SVMPNESASHNGD 455

Query: 487 GS-----MASFPRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVRD 539
            S     +AS    H E+  F FKFKAP+G+ HR  V  ++  E +  +VA+KL S V  
Sbjct: 456 DSPPPSAVASNHPIHMEDMPFPFKFKAPSGRVHRLQVVISAGLEELINSVANKLGSEVES 515

Query: 540 ----------------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++AV +++     +V L +   +
Sbjct: 516 LGGAPSFEDGRLSREGFALSYLDNEGDTISITSNDDLVEAVSLSRMAHREKVDLFVHHPD 575

Query: 584 KKSL------RXXXXXXXXXXXXILEKRRR----------RKRGKH-------APDYNLP 620
           K  +      +             L +R++          R RG+H        P+    
Sbjct: 576 KPPMSAEVNPQPGLSKPATPPESTLRERKQFFDDDADEKPRSRGRHQSIPLSQQPEIIAG 635

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P+DLLLPGA+  LA+ I+GVF L R+
Sbjct: 636 VPNDLLLPGAIGVLAVVIVGVFVLGRA 662



>gi|317037370|ref|XP_001399033.2| CBS/PB1 domain-containing protein [Aspergillus niger CBS 513.88]
          Length = 662

 Score =  493 bits (1268), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 295/654 (45%), Positives = 387/654 (59%), Gaps = 68/654 (10%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRM--SKKDEAIRKKVEHELNKKNRTKS 95
           RPR  +S +  TP Q               +RQR   SK+DEAIR+K+E +LNKK    +
Sbjct: 30  RPRPETSSTTHTP-QTASSDIGSSTMSAASSRQRQNQSKRDEAIRRKLEADLNKKRHAPA 88

Query: 96  TSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEH 155
            +  +R  P        GTV +L PSQAL ++ +  + EA+QLMAAKR DCVLV D ++ 
Sbjct: 89  RANRSRKAP-------PGTVLALKPSQALQIKPNTSIAEAAQLMAAKREDCVLVTDDDDR 141

Query: 156 LSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPV 215
           ++GIFTAKDLAFRVVG GL AR  TV+ IMT+NP+C + DTSATDAL+ MV +GFRHLPV
Sbjct: 142 IAGIFTAKDLAFRVVGTGLKAREITVSEIMTKNPLCARTDTSATDALDLMVRKGFRHLPV 201

Query: 216 CNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDML 275
            +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ L
Sbjct: 202 MDENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQIIQYVEAL 261

Query: 276 REKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIV 335
           R KM+ P L +VLDG  P  V V+T+V+DAA LMRE+ TTA+LV +  SI GIFTSKDIV
Sbjct: 262 RHKMSGPTLETVLDGMPPTTVSVRTTVKDAAALMREHHTTALLVQDQGSITGIFTSKDIV 321

Query: 336 LRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMV 394
           LRVIA GLDPSTCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ D G I+GMV
Sbjct: 322 LRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQAALRKMHDGHYLNLPVMNDAGEIVGMV 381

Query: 395 DVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXX 454
           DVLKLTYAT+EQ+ +MQ+    +D  GP WNKFW S+    D+E   SDS+         
Sbjct: 382 DVLKLTYATLEQINTMQS----HDDEGPAWNKFWLSM----DHE---SDSMVSGSQQPAQ 430

Query: 455 XXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDENF-FTFKFKAPNGK 511
                    + S +      + P+ESAS    D+ S       H E+  F FKFKAP+G+
Sbjct: 431 RSVLSPESPKASYDAR--DSVLPNESASHHGGDEHSEYHVDPHHGEHIPFPFKFKAPSGR 488

Query: 512 SHRFTV-DYTSFEHIRATVASKL----------PS------NVRDFTIYYVXXXXXXXXX 554
            HR  V        + A V++KL          PS      +   + + Y+         
Sbjct: 489 VHRVNVFPSAGIAELVAQVSAKLGPEAEAVGGVPSCDEGKLSNTGYALSYLDNEGDTVSI 548

Query: 555 XXXXXXIDAVRIAQRQGMSRVILHIQE-------------------IEKKSLRXXXXXXX 595
                  DAV +A++    +V L + +                   +E+KS         
Sbjct: 549 TTDQDLADAVSLARQSHRDKVDLFVHDPTQPPIPATVEPQPAPARPVEEKS---AISEDR 605

Query: 596 XXXXXILEKRRRRKRGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
                ++ K R      H P+      +P+DLLLPGA++TLA  I GVF LSR+
Sbjct: 606 SEEESLVAKPRAPSFPVHQPEEQFIAGVPNDLLLPGAIVTLAAVIAGVFILSRA 659



>gi|440634832|gb|ELR04751.1| hypothetical protein GMDG_06979 [Geomyces destructans 20631-21]
          Length = 675

 Score =  492 bits (1267), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 282/637 (44%), Positives = 382/637 (59%), Gaps = 78/637 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK +T       R +  ++ P   GTV +L PSQAL ++
Sbjct: 57  SRQKQSKRDEAIRRKIETDLSKKTKT-----TGRARQSKRAP--LGTVMALRPSQALQIK 109

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RVVG G+ A + T+A IMT+
Sbjct: 110 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRVVGAGIKANSITIAEIMTK 169

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 170 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 229

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA 
Sbjct: 230 KLYDALEGVQSELGSSQPQQIIQYVEALRLKMSGPTLESVLDGRPPTTVSVRTSVKEAAM 289

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA G+DP+ CSV+RVMTPHPD AP + +I
Sbjct: 290 LMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGMDPANCSVVRVMTPHPDFAPMEMTI 349

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+    N  +  D  GP WNK
Sbjct: 350 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQI----NTISTGDSEGPAWNK 405

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D D ES +S   +               +  G  + S    + P +SAS    
Sbjct: 406 FWLSL--DNDTESMMSGEGSHHQVASRSLMSPDHSKHAGMMDTS----VSPGDSASH--- 456

Query: 487 GSMASFPRGHDEN--------FFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV 537
            + A  P  H E          F FKFKAP+G+ HR  +  ++    + A V  KL + V
Sbjct: 457 -TGAESPARHLEEPALPVEDIPFPFKFKAPSGRVHRLHITASNGMAELIALVTDKLGAEV 515

Query: 538 R----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+                +A+ IA++ G  +V L + +
Sbjct: 516 EAVGGAASFEYGKLGASGFALSYLDDEGDTVSITTDHDLKEAIAIARQGGRDKVDLFVHD 575

Query: 582 IEKKSLRXXXXXXXXXXXX----ILEKRRRRKR--------------------------- 610
            EK ++                 +   RRRR+R                           
Sbjct: 576 PEKPAITATVEPVPVIAELPTPPMSTIRRRRERVISEEDEESDEEDHHRLHSRSRRQQPV 635

Query: 611 GKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
            + AP     +P+DLLLPGA++TLA+AIIGVFA++++
Sbjct: 636 VQEAPQIIAGVPNDLLLPGAIVTLAVAIIGVFAITKA 672



>gi|134084625|emb|CAK97501.1| unnamed protein product [Aspergillus niger]
          Length = 609

 Score =  492 bits (1266), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 287/621 (46%), Positives = 376/621 (60%), Gaps = 65/621 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK    + +  +R  P        GTV +L PSQAL ++ 
Sbjct: 9   RQNQSKRDEAIRRKLEADLNKKRHAPARANRSRKAP-------PGTVLALKPSQALQIKP 61

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  + EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL AR  TV+ IMT+N
Sbjct: 62  NTSIAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGTGLKAREITVSEIMTKN 121

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 122 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 181

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR KM+ P L +VLDG  P  V V+T+V+DAA L
Sbjct: 182 LYDALEGVQTELGSSQPQQIIQYVEALRHKMSGPTLETVLDGMPPTTVSVRTTVKDAAAL 241

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           MRE+ TTA+LV +  SI GIFTSKDIVLRVIA GLDPSTCSV+RVMTPHPD AP   SI 
Sbjct: 242 MREHHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQ 301

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ+    +D  GP WNKF
Sbjct: 302 AALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMQS----HDDEGPAWNKF 357

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AID 485
           W S+    D+E   SDS+                  + S +      + P+ESAS    D
Sbjct: 358 WLSM----DHE---SDSMVSGSQQPAQRSVLSPESPKASYDAR--DSVLPNESASHHGGD 408

Query: 486 DGSMASFPRGHDENF-FTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKL---------- 533
           + S       H E+  F FKFKAP+G+ HR  V        + A V++KL          
Sbjct: 409 EHSEYHVDPHHGEHIPFPFKFKAPSGRVHRVNVFPSAGIAELVAQVSAKLGPEAEAVGGV 468

Query: 534 PS------NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE------ 581
           PS      +   + + Y+                DAV +A++    +V L + +      
Sbjct: 469 PSCDEGKLSNTGYALSYLDNEGDTVSITTDQDLADAVSLARQSHRDKVDLFVHDPTQPPI 528

Query: 582 -------------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL--PIPHDLL 626
                        +E+KS              ++ K R      H P+      +P+DLL
Sbjct: 529 PATVEPQPAPARPVEEKS---AISEDRSEEESLVAKPRAPSFPVHQPEEQFIAGVPNDLL 585

Query: 627 LPGAVLTLAIAIIGVFALSRS 647
           LPGA++TLA  I GVF LSR+
Sbjct: 586 LPGAIVTLAAVIAGVFILSRA 606



>gi|501307313|dbj|GAC96281.1| hypothetical protein PHSY_003861 [Pseudozyma hubeiensis SY62]
          Length = 729

 Score =  491 bits (1265), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 287/587 (48%), Positives = 368/587 (62%), Gaps = 79/587 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNR--GKPQRQVPGAKGTVASLNPSQALTV 126
           R+R SK+DEAIRKK+E EL +K+   ST +++R   +  R    A GTV++L P  ALTV
Sbjct: 46  RKRQSKRDEAIRKKIEGELQRKSGKPSTPMSSRRTKRTARPPAAAAGTVSALRPLPALTV 105

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            +S  V +ASQL AAKR DCVLV+D +EHL+GIFTAKDLAFRVV  GLDAR T V+ IMT
Sbjct: 106 PQSISVADASQLCAAKRTDCVLVVDEDEHLAGIFTAKDLAFRVVSAGLDARNTPVSAIMT 165

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           R+PM  ++ TSAT+ALNTMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS
Sbjct: 166 RSPMVTRDTTSATEALNTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSS 225

Query: 247 KKLYDALEGVEREWSTNQPTQ--ILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           +KLY+ALEGV+ EW  +   Q  +LQY++ LR+KM+ PDL+++LD  ++P  VGV+T+VR
Sbjct: 226 QKLYNALEGVQSEWGGSAGPQQAMLQYIEALRQKMSIPDLTTILDSRTLPCCVGVRTTVR 285

Query: 304 DAARLMREYRTTAVLVMEHHS-----------------IAGIFTSKDIVLRVIAAGLDPS 346
           +AARLM+E+ TTAV VME                    IAGIFTSKD+VLRVIAAGLDP 
Sbjct: 286 EAARLMKEHHTTAVCVMESTGSGPGTGQIGGGGAVSGKIAGIFTSKDVVLRVIAAGLDPK 345

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATME 405
           TCSV+RVMTPHPDTAPP  +I +AL+KM+DG YLNLPVVD  S ++G+VDVLKLTYAT+E
Sbjct: 346 TCSVVRVMTPHPDTAPPSLTIQEALRKMHDGRYLNLPVVDVDSRLVGVVDVLKLTYATLE 405

Query: 406 QMYSMQNQE--NGNDGGGPMWNKFWNSLAND----GDNESTVSDSIAXXXXXXXXXXXXX 459
           Q+ SM  ++       GGPMWN+FWNS        GD+ES VS S+              
Sbjct: 406 QINSMNEEQGGADGAAGGPMWNRFWNSFGQTNSIAGDDESIVSGSMRQSESQFEPPTPSK 465

Query: 460 XXRTRGSGNISPIPEIHPSESASAI------DDGSMA-----SFPRGHDENFFTFKFKAP 508
                G G      ++HP++SASA+      DDG+ A     S     D+  + FKF  P
Sbjct: 466 V----GGGVADLSSDLHPNDSASAVGHQVNGDDGASAVGVPSSAAVEADDGTYLFKFVTP 521

Query: 509 NGKSHRFTVDYTSFEHIRATVASKL---------------------------PS------ 535
           +G++HRF   Y S+E IR  V  KL                           PS      
Sbjct: 522 SGRTHRFQARYDSYETIREIVCIKLGGDPFFDPVSASSAPAYDLGEANGDAQPSTPGAAE 581

Query: 536 --NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
             +  DF + Y                 D+V++A++QG  RV+L +Q
Sbjct: 582 VPDPNDFQLAYTDDEDDVVLITADGDVQDSVKVARKQGRDRVVLLLQ 628



>gi|471563439|gb|EMR64693.1| putative mitochondrial ribosomal protein subunit s4 protein [Eutypa
           lata UCREL1]
          Length = 670

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 287/634 (45%), Positives = 376/634 (59%), Gaps = 72/634 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E++L+KK       L  R +  R+ P   GTV +L PS AL ++
Sbjct: 50  SRQKQSKRDEAIRRKLENDLSKKKH-----LTGRARHTRKAP--PGTVLALKPSPALQIK 102

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+
Sbjct: 103 PATTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGTGQKASNITIAEIMTK 162

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  ++ G+LDITKC Y+A++K+ERAY SS 
Sbjct: 163 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQEISGILDITKCFYDAMEKLERAYASST 222

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLY ALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 223 KLYAALEGVQSELGSSQPQQIIQYVEALRHKMSGPTLESVLNGMPPTTVSVRTSVKEAAI 282

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +   I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 283 LMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMSI 342

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGG-GPMWN 425
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+    NQ + ND   GP WN
Sbjct: 343 QAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATLEQV----NQMSTNDSSEGPAWN 398

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           KFW SL  D ++ES VS   +                TR   N S    + P +SAS + 
Sbjct: 399 KFWLSL--DNESESMVSGEGSHHHGTIPSRSMISPDMTRERINNS----VAPEDSASHVG 452

Query: 486 DGSMASFPRGHDEN-----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR- 538
              + S+   H E       F FKFKAP+G+ HR  V  +   E +   VASKL   V  
Sbjct: 453 GSPVHSYLAPHPEQPPAEYPFAFKFKAPSGRVHRLQVVASHGIEELVMNVASKLGGEVEA 512

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++AV +A++    +V L + + E
Sbjct: 513 IGGVPVAEDGVLSSGGFAVSYLDDEGDTVSITTDQDLLEAVLLARQNHRDKVDLFVHDPE 572

Query: 584 KKSLRXXXXXXXXXXXXILEK------RRRR-------------------KRGKHAPDYN 618
           K  +               E       RRRR                   +R K AP ++
Sbjct: 573 KAPVTISVPQPEQALPTPPESSVPSAVRRRRHVVEDEEEEDSEEEDHAAVRRRKRAPTHS 632

Query: 619 LP------IPHDLLLPGAVLTLAIAIIGVFALSR 646
            P      +P+DLLLPGA++TLA+ I+GVF + R
Sbjct: 633 EPEQLIAGVPNDLLLPGAIVTLAVVIVGVFTIGR 666



>gi|342874129|gb|EGU76199.1| hypothetical protein FOXB_13271 [Fusarium oxysporum Fo5176]
 gi|475671238|gb|EMT68591.1| Meiotically up-regulated protein 70 protein [Fusarium oxysporum f.
           sp. cubense race 4]
 gi|477516075|gb|ENH68356.1| Meiotically up-regulated protein 70 protein [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 668

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 292/664 (43%), Positives = 390/664 (58%), Gaps = 87/664 (13%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PR    PS PT                  +RQ+ SK+DEAIRKK+E++L+KK       L
Sbjct: 32  PRPVLEPSPPT----------ETGSAVSASRQKQSKRDEAIRKKLENDLSKKKH-----L 76

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
            +R +  R+ P   GTV +L PSQAL ++    V EA+QLMAAKR DCVLV D ++ ++G
Sbjct: 77  TSRARHSRKAP--PGTVLALKPSQALQIKPGTTVSEAAQLMAAKREDCVLVTDDDDRIAG 134

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLAFRVVG G  A   T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 135 IFTAKDLAFRVVGAGAKASAITIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 194

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  + QP QI+QY++ LR K
Sbjct: 195 NQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSTQPQQIIQYVEALRSK 254

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L +VL+G  P  V V+TSV++AA+LM+E RTTAVLV +  +I GIFTSKD+VLRV
Sbjct: 255 MSGPTLETVLNGVPPTTVSVRTSVKEAAQLMKENRTTAVLVQDQGAITGIFTSKDVVLRV 314

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IA GLDP+ CSV+RVMTPHPD AP   ++  AL+KM+DGHYLNLPV+ DGG I+GMVDVL
Sbjct: 315 IAPGLDPANCSVVRVMTPHPDFAPMDMTLQAALRKMHDGHYLNLPVMNDGGEIVGMVDVL 374

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           KLTYAT++Q+ +M N    ND  GP WNKFW SL  D + ES +S   +           
Sbjct: 375 KLTYATLDQINAMSNT---ND-EGPAWNKFWLSL--DAETESMMSGEGSAAHHTNLGSRL 428

Query: 458 XXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRG----------HDENFFTFKFKA 507
                 RG  +      + P +SAS +    M S PR            +E  F FKFKA
Sbjct: 429 TSPDMHRGIND-----SLAPGDSASHV---GMESPPRSVLPDVLEHQLPEELPFPFKFKA 480

Query: 508 PNGKSHRFTVDYT-SFEHIRATVASKLPSN---------VRD-------FTIYYVXXXXX 550
           P+G+ HR  V  T   E     VASKL +          V D       F + ++     
Sbjct: 481 PSGRVHRLKVTATEGIEVFVNAVASKLGAEADSIGGVPPVSDGKIVGPGFAMSFLDDEGD 540

Query: 551 XXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRR---- 606
                     ++AV +A++    +V L + + EK  +              L +RR    
Sbjct: 541 SISITADHDLLEAVILARQAHHDKVDLFVHDPEKPPVSGAPATPSVSTGAGLRERRKWWP 600

Query: 607 -----------------RRKRGKHA------PDYNLP-IPHDLLLPGAVLTLAIAIIGVF 642
                            RR++G+ A      P+  +  +P++L+LPGA++TLA+ IIGVF
Sbjct: 601 EEEDDDSEDEDDEDEPVRRRKGRAAHTHAQGPEQLIAGVPNELILPGAIVTLAVTIIGVF 660

Query: 643 ALSR 646
            ++R
Sbjct: 661 TIAR 664



>gi|119496427|ref|XP_001264987.1| CBS/PB1 domain-containing protein [Neosartorya fischeri NRRL 181]
 gi|119413149|gb|EAW23090.1| CBS and PB1 domain protein [Neosartorya fischeri NRRL 181]
          Length = 661

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 287/656 (43%), Positives = 384/656 (58%), Gaps = 78/656 (11%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTS 97
           RPR  ++ S  TP+                 RQ  SK+DEAIR+K+E +LNKK      +
Sbjct: 35  RPRPETAASTHTPSSDVGSSTMSAASRQ---RQNQSKRDEAIRRKMEADLNKKRHQAPRA 91

Query: 98  LNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLS 157
              R  P        GTV +L PSQAL ++ +  V EA+Q+MAAKR DCVLV D ++ ++
Sbjct: 92  HRTRKAP-------PGTVLALKPSQALQIKPNTTVAEAAQMMAAKREDCVLVTDDDDRIA 144

Query: 158 GIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCN 217
           GIFTAKDLAFRVVG+G  AR  TVA IMT+NP+C + DTSATDAL+ MV +GFRHLPV +
Sbjct: 145 GIFTAKDLAFRVVGNGQKAREITVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD 204

Query: 218 EEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLRE 277
           E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  + QP QI+QY++ LR 
Sbjct: 205 ENQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSTQPQQIIQYVEALRS 264

Query: 278 KMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLR 337
           KM+ P L +VLDG  P  V V+TSVRDAA LM+E+ TTA+LV +  SI GIFTSKDIVLR
Sbjct: 265 KMSGPTLETVLDGMPPTTVSVRTSVRDAAALMKEHHTTALLVQDQGSITGIFTSKDIVLR 324

Query: 338 VIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDV 396
           VIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDV
Sbjct: 325 VIAPGLDPATCSVVRVMTPHPDFAPADMSIQAALRKMHDGHYLNLPVMNETGEIVGMVDV 384

Query: 397 LKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           LKLTYAT+EQ+ SMQ+    +D  GP WNKFW  L+ D +++S VS S            
Sbjct: 385 LKLTYATLEQINSMQS----HDDEGPAWNKFW--LSMDHESDSMVSGS------------ 426

Query: 457 XXXXXRTRGSGNISP------IPEIHPSESASAIDDGSMASF---PRGHDENF-FTFKFK 506
                +      +SP      +  + P+ESAS      ++ +      HDE+  F FKFK
Sbjct: 427 ----HQAPNRSVLSPESPRQGVDSVLPNESASHHGGDELSEYHDHHHNHDESTPFPFKFK 482

Query: 507 APNGKSHRFTVDYTS-FEHIRATVASKLPSNVR----------------DFTIYYVXXXX 549
           AP+G+ HR  V  ++    + A V +KL + +                  + + Y+    
Sbjct: 483 APSGRVHRVNVVTSAGVADLVAQVTAKLGNELEAVGGAATVEEGKLSNTGYALSYLDNEG 542

Query: 550 XXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRK 609
                       DAV +A+R    +V L + +  +  +             + EK     
Sbjct: 543 DTVSITTDQDLADAVSLARRSHRDKVDLFVHDPAQPPIPATLDPQPAPAKVVEEKSSVVA 602

Query: 610 RGKHAPDYNLP------------------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
             + + +  +P                  +P++LLLPGA++TLA  I GVF LSR+
Sbjct: 603 EERLSEEPLIPKAHQSYPTRPTEEQFIAGVPNELLLPGAIVTLAAVIAGVFILSRA 658



>gi|261206284|ref|XP_002627879.1| CBS/PB1 domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239592938|gb|EEQ75519.1| CBS and domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239610889|gb|EEQ87876.1| CBS and domain-containing protein [Ajellomyces dermatitidis ER-3]
          Length = 666

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 284/627 (45%), Positives = 378/627 (60%), Gaps = 64/627 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E +LNKK          R +  R+ P   GTV +L PSQAL ++
Sbjct: 54  SRQKQSKRDEAIRKKMEADLNKKRHGNPA----RSRHSRKPP--PGTVMALKPSQALQIK 107

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 108 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTK 167

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 168 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 227

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  +NQP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSVR+AA 
Sbjct: 228 KLYDALEGVQSELGSNQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVREAAA 287

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 288 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPNTCSVVRVMTPHPDFAPTDMSI 347

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +M      N+  GP WNK
Sbjct: 348 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNTMST----NESEGPAWNK 403

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW S+ N+ D  S VS S                 R+ G    S    + P+ESAS   D
Sbjct: 404 FWLSMDNESD--SMVSGS-HQPHTSHRSVMSPDMSRSHGDRENS----VLPNESASHHGD 456

Query: 487 GSMASFPRGHD----ENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR--- 538
            +++           +  F FKFKAP+G+ HR  V  ++    + + V+ KL + V    
Sbjct: 457 EAVSDILGARSVHNVDTPFPFKFKAPSGRVHRLHVTPSAGVADLVSQVSLKLGAEVEAVG 516

Query: 539 -------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK 585
                         + + Y+                DA+ +A+R    +V L + + EK+
Sbjct: 517 GQAAVEDGKMSHTGYALSYLDSEGDTVSITTDQDLFDAITLARRASQDKVDLFVHDPEKQ 576

Query: 586 S------------------------LRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL-P 620
                                    LR              EK +   R   A    +  
Sbjct: 577 PIITPPPAPEPQPPVAKSATPAGSVLRSTTGEDDEPSISEREKPQTLVRPPTAEQQLING 636

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P++L+LPGA++TLA+AI+GVF LSR+
Sbjct: 637 VPNELILPGAIVTLAVAIVGVFILSRA 663



>gi|317142635|ref|XP_001818994.2| CBS/PB1 domain-containing protein [Aspergillus oryzae RIB40]
          Length = 666

 Score =  489 bits (1259), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 288/650 (44%), Positives = 379/650 (58%), Gaps = 60/650 (9%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTS 97
           RPR  ++ S P P                  RQ  SK+DEAIR+K+E +LNKK +  + +
Sbjct: 34  RPRPETASSTPNPHTPSSDIGSSTMSAASRQRQNQSKRDEAIRRKMEADLNKKKQAPTRA 93

Query: 98  LNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLS 157
             +R  P        GTV +L PSQAL ++ +  + EA+QLMAAKR DCVLV D ++ ++
Sbjct: 94  HRSRKAP-------PGTVLALKPSQALQIKPNMTIAEAAQLMAAKREDCVLVTDDDDRIA 146

Query: 158 GIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCN 217
           GIFTAKDLAFRVVG G  AR  TVA IMT+NP+C + DTSATDAL+ MV +GFRHLPV +
Sbjct: 147 GIFTAKDLAFRVVGAGQKARDITVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD 206

Query: 218 EEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLRE 277
           E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR 
Sbjct: 207 ENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQIIQYVEALRS 266

Query: 278 KMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLR 337
           KM+ P L +VLDG  P  V V+TSV+DAA +M+E+ TTA+LV +  SI GIFTSKDIVLR
Sbjct: 267 KMSGPTLETVLDGLPPVTVSVRTSVKDAAAMMKEHHTTALLVQDQGSITGIFTSKDIVLR 326

Query: 338 VIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDV 396
           VIA GLDPSTCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDV
Sbjct: 327 VIAPGLDPSTCSVVRVMTPHPDFAPADMSIQAALRKMHDGHYLNLPVMNETGEIVGMVDV 386

Query: 397 LKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           LKLTYAT+EQ+ SM      +D  GP WNKFW S+    D+E   SDS+           
Sbjct: 387 LKLTYATLEQINSMST----HDDEGPAWNKFWLSM----DHE---SDSMVSGSQQPNHRS 435

Query: 457 XXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDENF-FTFKFKAPNGKSH 513
                  + S +      + P+ESAS    D+ S       H E+  F FKFKAP+G+ H
Sbjct: 436 VLSPESPKASYDAR--DSVLPNESASHHGGDEHSEYIDHHHHGEHVPFPFKFKAPSGRVH 493

Query: 514 RFTVDYTS-FEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXXXXXX 556
           R  V  ++    + A V +KL S                    + + Y+           
Sbjct: 494 RVNVLTSAGIADLVAQVTAKLGSEADAVGGAATCEEGKLSNTGYALSYLDNEGDTVSITT 553

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILE------------- 603
                DAV +A++    +V L + +  +  +             + E             
Sbjct: 554 DQDLADAVTLARQSRRDKVDLFVHDPTQPPIPATLEPQPAPVKPVEEKPSPVPEEQLSEE 613

Query: 604 ----KRRRRKRGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
               K R +    H P+      +P+DLLLPGA++TLA  I GVF LSR+
Sbjct: 614 PYMSKPRSQTFSSHHPEEQFIAGVPNDLLLPGAIVTLAAVIAGVFILSRA 663



>gi|238501480|ref|XP_002381974.1| CBS/PB1 domain-containing protein [Aspergillus flavus NRRL3357]
 gi|220692211|gb|EED48558.1| CBS and PB1 domain protein [Aspergillus flavus NRRL3357]
 gi|391863760|gb|EIT73059.1| CBS and PB1 domain protein [Aspergillus oryzae 3.042]
          Length = 666

 Score =  489 bits (1259), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 288/650 (44%), Positives = 379/650 (58%), Gaps = 60/650 (9%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTS 97
           RPR  ++ S P P                  RQ  SK+DEAIR+K+E +LNKK +  + +
Sbjct: 34  RPRPETASSTPNPHTPSSDIGSSTMSAASRQRQNQSKRDEAIRRKMEADLNKKKQAPTRA 93

Query: 98  LNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLS 157
             +R  P        GTV +L PSQAL ++ +  + EA+QLMAAKR DCVLV D ++ ++
Sbjct: 94  HRSRKAP-------PGTVLALKPSQALQIKPNMTIAEAAQLMAAKREDCVLVTDDDDRIA 146

Query: 158 GIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCN 217
           GIFTAKDLAFRVVG G  AR  TVA IMT+NP+C + DTSATDAL+ MV +GFRHLPV +
Sbjct: 147 GIFTAKDLAFRVVGAGQKARDITVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD 206

Query: 218 EEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLRE 277
           E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR 
Sbjct: 207 ENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQIIQYVEALRS 266

Query: 278 KMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLR 337
           KM+ P L +VLDG  P  V V+TSV+DAA +M+E+ TTA+LV +  SI GIFTSKDIVLR
Sbjct: 267 KMSGPTLETVLDGLPPVTVSVRTSVKDAAAMMKEHHTTALLVQDQGSITGIFTSKDIVLR 326

Query: 338 VIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDV 396
           VIA GLDPSTCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDV
Sbjct: 327 VIAPGLDPSTCSVVRVMTPHPDFAPADMSIQAALRKMHDGHYLNLPVMNETGEIVGMVDV 386

Query: 397 LKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           LKLTYAT+EQ+ SM      +D  GP WNKFW S+    D+E   SDS+           
Sbjct: 387 LKLTYATLEQINSMST----HDDEGPAWNKFWLSM----DHE---SDSMVSGSQQPNHRS 435

Query: 457 XXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDENF-FTFKFKAPNGKSH 513
                  + S +      + P+ESAS    D+ S       H E+  F FKFKAP+G+ H
Sbjct: 436 VLSPESPKASYDAR--DSVLPNESASHHGGDEHSEYIDHHHHGEHVPFPFKFKAPSGRVH 493

Query: 514 RFTVDYTS-FEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXXXXXX 556
           R  V  ++    + A V +KL S                    + + Y+           
Sbjct: 494 RVNVLTSAGIADLVAQVTAKLGSEADAVGGAATCEEGKLSNTGYALSYLDNEGDTVSITT 553

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILE------------- 603
                DAV +A++    +V L + +  +  +             + E             
Sbjct: 554 DQDLADAVTLARQSRRDKVDLFVHDPTQPPIPATLEPQPAPVKPVEEKPSPVPEEQLSEE 613

Query: 604 ----KRRRRKRGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
               K R +    H P+      +P+DLLLPGA++TLA  I GVF LSR+
Sbjct: 614 PYMSKPRSQTFSSHHPEEQFIAGVPNDLLLPGAIVTLAAVIAGVFILSRA 663



>gi|378725744|gb|EHY52203.1| hypothetical protein HMPREF1120_00418 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 673

 Score =  488 bits (1257), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 285/637 (44%), Positives = 377/637 (59%), Gaps = 75/637 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK    S + + R  P        GTV +L PSQAL ++
Sbjct: 52  SRQKQSKRDEAIRRKMEADLSKKKHVPSRARHTRKAP-------PGTVLALKPSQALQIK 104

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A   T+  IMT+
Sbjct: 105 PSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKANQVTIEQIMTK 164

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC YEA++K+ERAY SS+
Sbjct: 165 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYEAMEKLERAYSSSR 224

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 225 KLYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVKEAAQ 284

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDPSTCSV+RVMTPHPD AP   SI
Sbjct: 285 LMKENHTTAVLVQDQGSITGIFTSKDVVLRVIAPGLDPSTCSVVRVMTPHPDFAPTDMSI 344

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +M    N  +  GP WNK
Sbjct: 345 QAALRKMHDGHYLNLPVMNETGEIVGMVDVLKLTYATLEQINTM----NTGESEGPAWNK 400

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS---GNISPIPEIHPSESASA 483
           FW  L+ D D ES VS   +                TR     G+      + P +SAS 
Sbjct: 401 FW--LSMDNDTESMVSGEGSHRPTTPGHRSVMESEMTRPGMERGD-----SVLPQDSASH 453

Query: 484 I-DDGSMASFP--RGHDENFFTFKFKAPNGKSHRFT-VDYTSFEHIRATVASKL------ 533
             DD      P     ++  F FKFKAP+G+ HR   V       + + V SKL      
Sbjct: 454 RGDDAQSEVLPSIEAPEDTPFPFKFKAPSGRVHRIQLVPRNGIAELVSLVTSKLGGEIDA 513

Query: 534 ---PSNVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
               + V D       + + Y+               IDAV +A++    +V L + +  
Sbjct: 514 VGGEATVEDGKLGKTGYALSYLDDEGDTVSITTDQDLIDAVLLARQGKRDKVDLFVHDPS 573

Query: 584 KKSL------RXXXXXXXXXXXXILEK---------------------RRRR------KR 610
           +  +      R            +L++                     R RR      + 
Sbjct: 574 QPPIVATIDPRPQLSKPPTPPESVLKEVPPVEGADSEEEEEIPKAKTLRMRRSPVVPTQI 633

Query: 611 GKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
            +  P     IP+DLLLPGA++TLA+ I+GVFA+ R+
Sbjct: 634 KEEQPQLIQGIPNDLLLPGAIVTLAVVIVGVFAIGRA 670



>gi|393218841|gb|EJD04329.1| CBS-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 677

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 293/670 (43%), Positives = 384/670 (57%), Gaps = 101/670 (15%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNN-RGKPQ-RQVPGA-KGTVASLNPSQALT 125
           R++ +K+DEAIRKK+E +L +K   ++ SLNN + +P  R+ P A KG+VA+L PS ALT
Sbjct: 14  RKKQAKRDEAIRKKIESDLARK---RTISLNNTQSRPSGRKKPSAPKGSVAALKPSPALT 70

Query: 126 VRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIM 185
           V E   V +ASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD R+T V+ IM
Sbjct: 71  VPEGITVSDASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAYRVTAEGLDPRSTPVSAIM 130

Query: 186 TRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGS 245
           TRNPM  ++ TSAT+AL  MV R FRHLPVCNEEG+VVGLLDITK  +EALDK+ER+  +
Sbjct: 131 TRNPMVTRDTTSATEALQLMVTRHFRHLPVCNEEGNVVGLLDITKVFHEALDKVERSSSA 190

Query: 246 SKKLYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVK 299
           S+KLY AL GV+ E   N     Q   +L Y+D LREK A PDL+SV+D  + PA V  K
Sbjct: 191 SEKLYHALTGVQTELGPNMSANPQAAAMLAYVDALREKTALPDLTSVMDSRTHPATVSPK 250

Query: 300 TSVRDAARLMREYRTTAVLVMEHHS-------IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           T+V++AA+LM+E RTTAV VME+         IAGIFTSKDIVLRVIAAGL+PS CSV+R
Sbjct: 251 TTVKEAAKLMKENRTTAVCVMENTGVPGAPPRIAGIFTSKDIVLRVIAAGLEPSRCSVVR 310

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTA P   + DALKKMY+GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM  M 
Sbjct: 311 VMTPHPDTAAPTMIVQDALKKMYNGHYLNLPVVEADGRLVAIVDVLKLTYATLEQMDQMA 370

Query: 412 NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP 471
            +   ++ GGPMW +F+ S+ +D DN+S +S S                 R     +++ 
Sbjct: 371 AETGVDNSGGPMWGRFFESIGHD-DNDSAISGSNVPTDIHSPPPYPDSPMR-----HLAQ 424

Query: 472 IPEIHPSESASAIDD----------GSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS 521
            PE+ P++SAS +DD          G+    P   D+  + FKF  P+ ++HRF   Y  
Sbjct: 425 TPEVGPNDSASVVDDDHDHGVGGFSGAGVGEPAPVDDGTYVFKFSTPSKRTHRFQARYDD 484

Query: 522 FEHIRATVASKLPSN-----------------------------------VRDFTIYYVX 546
            EH+R  +  KL  +                                     DF +YY  
Sbjct: 485 VEHLREIIIGKLQMDPYFTSSTTTSSASPAAAAGGDGSASAAQATENAPKTEDFQMYYKD 544

Query: 547 XXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE----------------------- 583
                          DAV+IA+R G+ RV+L +                           
Sbjct: 545 ADGDDVYISHSEDLSDAVKIARRAGVDRVVLFLHGGSSWVLPKPAQPEPTPAPVITATPK 604

Query: 584 -KKSLRXXXXXXXXXXXXILEKRRRRKRGKHAP------DYNLPIPHDLLLPGAVLTLAI 636
            + ++             +  K+    +   A       D  L IP DLLLP ++  LA+
Sbjct: 605 GEATIAPASELSASAVPSVDTKQSETSKTTSASVPGGADDGVLGIPRDLLLPASIGALAV 664

Query: 637 AIIGVFALSR 646
           AII VF +SR
Sbjct: 665 AIIAVFTISR 674



>gi|353227418|emb|CCA77926.1| hypothetical protein PIIN_00640 [Piriformospora indica DSM 11827]
          Length = 672

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 299/677 (44%), Positives = 386/677 (57%), Gaps = 95/677 (14%)

Query: 48  PTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQ 107
           PTP                  R++ SK+DEAIRKK+E EL +K RT ST+++   K  + 
Sbjct: 10  PTPKHQSSVTLSTVSSSNTDTRKKQSKRDEAIRKKIESELARK-RTISTTVSKHNKKGKS 68

Query: 108 VPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAF 167
              AKGTVA+L PSQALTV ++  V +ASQL AAKR DCVLV+D EE LSGIFTAKDLAF
Sbjct: 69  --AAKGTVAALKPSQALTVPDNMTVADASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAF 126

Query: 168 RV------------------VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARG 209
           RV                     GLD RTT V+TIMT NPM  ++ TSAT+AL  MV RG
Sbjct: 127 RVSLPSSFECQPTDRVFEQVTAMGLDPRTTLVSTIMTPNPMVTRDTTSATEALQLMVQRG 186

Query: 210 FRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREW----STNQP 265
           FRHLPVCN++G+VVGLLDITK  +EALDK+ER   +S+KLY ALE V+ E     S  Q 
Sbjct: 187 FRHLPVCNDDGNVVGLLDITKVFHEALDKIERGSSASQKLYSALESVQTELDGVASNPQA 246

Query: 266 TQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS 324
             ++ +++ LR+K A PDLS+V+D  + PA VG +T+VRDAARLM+E RTTAV VME  +
Sbjct: 247 AAMMAFVESLRDKTALPDLSTVMDSRTQPATVGPRTTVRDAARLMKENRTTAVCVMEGGA 306

Query: 325 ------------IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALK 372
                       IAGIFTSKDIVLRVIAAGLDP  CSV+RVMTPHPD APP  +I DALK
Sbjct: 307 NTAGQPTGAPAKIAGIFTSKDIVLRVIAAGLDPGRCSVVRVMTPHPDVAPPSMTIQDALK 366

Query: 373 KMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSL 431
           KMY+GHYLNLPVV+  G ++ ++DVLKLTYAT+EQM ++ +       GGPMW +F+ S+
Sbjct: 367 KMYNGHYLNLPVVESDGRLVAIIDVLKLTYATLEQMNALADASQPEQEGGPMWGRFFESI 426

Query: 432 ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGS--- 488
            +D DN+S VS S                  T    N+S + E+HP++SAS +DD S   
Sbjct: 427 GHD-DNDSVVSGS------------HILREVTSPGYNMS-MSEVHPNDSASMVDDESEMP 472

Query: 489 -----MASFPRGH------DENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKL---- 533
                M+S  + +      D+  + FKF  P+G++HRF      +EH+R  VA KL    
Sbjct: 473 GAHAAMSSVSKDNVAPPPVDDGTYVFKFSTPSGRTHRFQSRKDDYEHLREIVAGKLATDP 532

Query: 534 ------------PSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                       P +  DF I Y                 D+V +A++ G  RV+L +Q 
Sbjct: 533 FFTEYAPPEGGVPRDPLDFQIMYKDSDGDVVVMTSDTDVSDSVAVARKGGSDRVVLTLQG 592

Query: 582 IEKKSL----------RXXXXXXXXXXXXILEKRRRRKRGKH--APDYNLPIPHDLLLPG 629
            +  SL                              + +  H  A D    IP DL+LP 
Sbjct: 593 GKGWSLDDPSAAAAAEEAARKLKDDAERAEAAAAEPKAKSVHFDAGDDIFGIPRDLVLPA 652

Query: 630 AVLTLAIAIIGVFALSR 646
           ++  LA+ II VF + R
Sbjct: 653 SLGALAVVIIAVFTIHR 669



>gi|472236462|gb|EMR81395.1| putative cbs pb1 domain-containing protein [Botryotinia fuckeliana
           BcDW1]
          Length = 680

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 284/636 (44%), Positives = 382/636 (60%), Gaps = 76/636 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIR+K+E +L+KK++T       R +  R+ P   GTV +L PSQAL ++
Sbjct: 62  SRAKQSKRDEAIRRKIETDLSKKSKT-----TGRARQTRKAP--PGTVLALRPSQALQIK 114

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A   T+A IMT+
Sbjct: 115 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKAANITIAEIMTK 174

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 175 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 234

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 235 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVTVRTSVKEAAA 294

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDPS CSV+RVMTPHPD AP   +I
Sbjct: 295 LMKENHTTAVLVQDGGSITGIFTSKDVVLRVIAPGLDPSNCSVVRVMTPHPDFAPMDMTI 354

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ  E+ +   GP WNK
Sbjct: 355 QAALRKMHDGHYLNLPVMNDQGEIVGMVDVLKLTYATLEQINTMQTGESDS---GPAWNK 411

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE------IHPSES 480
           FW SL +  DNES +S                   R+  S +IS   E      + P++S
Sbjct: 412 FWMSLEH--DNESMISGE--------GSHHHTTGGRSLMSPDISRSHERQVDASVAPNDS 461

Query: 481 AS--AIDDGSMASFPRGHD---ENF-FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL 533
           AS   +D  S +   R +D   E+  F FKFKAP+G+ HR  V  +     + + V  KL
Sbjct: 462 ASHVGVDSPSHSHLSRHNDIPPEDVPFAFKFKAPSGRVHRVQVTASHGLAELISAVTGKL 521

Query: 534 PSNV----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
            S +                  F + Y+               ++A+ +A+     +V L
Sbjct: 522 GSEIDAVGGVASVEDGKIGSSGFALSYLDDEGDSVSITTDEDLLEAIVLARSGHRDKVDL 581

Query: 578 HIQEIEKKSLRXXXXXXXXXXXXILEK-----RRRRKRGKHAPDYNLP------------ 620
            + + EK  +                      RRRR         + P            
Sbjct: 582 FVHDPEKPPMAATLDPQPPIIQIATPPASSTIRRRRVVDSDDESDDEPRVKSKSRKAAAP 641

Query: 621 ---------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
                    +P++LLLPGA++TLA+ I+GVFAL+R+
Sbjct: 642 PPAAEVIQGVPNELLLPGAIVTLAVVIVGVFALTRA 677



>gi|350630805|gb|EHA19177.1| hypothetical protein ASPNIDRAFT_54229 [Aspergillus niger ATCC 1015]
          Length = 672

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 294/660 (44%), Positives = 386/660 (58%), Gaps = 70/660 (10%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRM--SKKDEAIRKKVEHELNKKNRTKS 95
           RPR  +S +  TP Q               +RQR   SK+DEAIR+K+E +LNKK    +
Sbjct: 30  RPRPETSSTTHTP-QTASSDIGSSTMSAASSRQRQNQSKRDEAIRRKLEADLNKKRHAPA 88

Query: 96  TSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEH 155
            +  +R  P        GTV +L PSQAL ++ +  + EA+QLMAAKR DCVLV D ++ 
Sbjct: 89  RANRSRKAP-------PGTVLALKPSQALQIKPNTSIAEAAQLMAAKREDCVLVTDDDDR 141

Query: 156 LSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPV 215
           ++GIFTAKDLAFRVVG GL AR  TV+ IMT+NP+C + DTSATDAL+ MV +GFRHLPV
Sbjct: 142 IAGIFTAKDLAFRVVGTGLKAREITVSEIMTKNPLCARTDTSATDALDLMVRKGFRHLPV 201

Query: 216 CNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDML 275
            +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ L
Sbjct: 202 MDENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQIIQYVEAL 261

Query: 276 REKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIV 335
           R KM+ P L +VLDG  P  V V+T+V+DAA LMRE+ TTA+LV +  SI GIFTSKDIV
Sbjct: 262 RHKMSGPTLETVLDGMPPTTVSVRTTVKDAAALMREHHTTALLVQDQGSITGIFTSKDIV 321

Query: 336 LRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMV 394
           LRVIA GLDPSTCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ D G I+GMV
Sbjct: 322 LRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQAALRKMHDGHYLNLPVMNDAGEIVGMV 381

Query: 395 DVLKLTYATMEQMYSMQ------NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXX 448
           DVLKLTYAT+EQ  +++      N    +D  GP WNKFW S+    D+E   SDS+   
Sbjct: 382 DVLKLTYATLEQDRAIRLTGKQINTMQSHDDEGPAWNKFWLSM----DHE---SDSMVSG 434

Query: 449 XXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDENF-FTFKF 505
                          + S +      + P+ESAS    D+ S       H E+  F FKF
Sbjct: 435 SQQPAQRSVLSPESPKASYDAR--DSVLPNESASHHGGDEHSEYHVDPHHGEHIPFPFKF 492

Query: 506 KAPNGKSHRFTV-DYTSFEHIRATVASKL----------PS------NVRDFTIYYVXXX 548
           KAP+G+ HR  V        + A V++KL          PS      +   + + Y+   
Sbjct: 493 KAPSGRVHRVNVFPSAGIAELVAQVSAKLGPEAEAVGGVPSCDEGKLSNTGYALSYLDNE 552

Query: 549 XXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE-------------------IEKKSLRX 589
                        DAV +A++    +V L + +                   +E+KS   
Sbjct: 553 GDTVSITTDQDLADAVSLARQSHRDKVDLFVHDPTQPPIPATVEPQPAPARPVEEKS--- 609

Query: 590 XXXXXXXXXXXILEKRRRRKRGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
                      ++ K R      H P+      +P+DLLLPGA++TLA  I GVF LSR+
Sbjct: 610 AISEDRSEEESLVAKPRAPSFPVHQPEEQFIAGVPNDLLLPGAIVTLAAVIAGVFILSRA 669



>gi|240280165|gb|EER43669.1| CBS and PB1 protein [Ajellomyces capsulatus H143]
          Length = 612

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 279/616 (45%), Positives = 376/616 (61%), Gaps = 61/616 (9%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIRKK+E +LNKK        + R +  R+ P   GTV +L PSQAL ++ +  V EA+
Sbjct: 10  QAIRKKMEADLNKKRHGN----HARSRHSRKAP--PGTVMALKPSQALQIKPNTTVAEAA 63

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT+NP+C + DT
Sbjct: 64  QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTKNPLCARTDT 123

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV
Sbjct: 124 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGV 183

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  +NQP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSVR+AA LM+E  TTA
Sbjct: 184 QSELGSNQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVREAATLMKENHTTA 243

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           +LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+D
Sbjct: 244 LLVQDQGSITGIFTSKDVVLRVIAPGLDPNTCSVVRVMTPHPDFAPTDMSIQAALRKMHD 303

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SM   EN     GP WNKFW S+ N+ 
Sbjct: 304 GHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNSMSTNEN----EGPAWNKFWLSMDNES 359

Query: 436 DNESTVSDSIAXX-XXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASF-- 492
           D  S VS S +                R+ G    S    + P+ESAS   D + +    
Sbjct: 360 D--SMVSGSHSHHPHTPLRSVMSPDISRSHGDRENS----VLPNESASHNGDEAASDVLD 413

Query: 493 --PRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR----------- 538
             P  H++  F FKFKAP+G+ HR  +  ++  E + + V+ KL + V            
Sbjct: 414 PRPVHHEDTSFPFKFKAPSGRVHRLHITPSAGVEDLVSQVSLKLGAEVEAVGGNAIVEDG 473

Query: 539 -----DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXX 593
                 + + Y+                DA+ +A+R    +V L + + EK+ +      
Sbjct: 474 KMSHTGYALSYLDSEGDTVSITTDQDLWDAISLARRAKRDKVDLFVHDPEKQPIITAPEP 533

Query: 594 XXXXXXXIL-------------EKRRRRKRGKHAPDYNLP---------IPHDLLLPGAV 631
                                 +++   +R K+   +  P         +P++L+LPGA+
Sbjct: 534 QVPVTKSANLQESVPGSATGEDDEQNHVEREKNQTLFRSPPAEQQLINGVPNELILPGAI 593

Query: 632 LTLAIAIIGVFALSRS 647
           +TLA+AI+GVF L RS
Sbjct: 594 VTLAVAIVGVFILGRS 609



>gi|225680402|gb|EEH18686.1| CBS and PB1 domain-containing protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 676

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 287/670 (42%), Positives = 388/670 (57%), Gaps = 88/670 (13%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PRK  +P  P  A                +RQ+ +K+DEAIRKK+E +LNKK    + + 
Sbjct: 29  PRKVETPPVPQSA----TSDVGSSSALSTSRQKQTKRDEAIRKKMEADLNKKRHNPTRAR 84

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
           + R  P        GTV +L PS AL ++ +  V EA+QLMAAKR DCVLV D +E ++G
Sbjct: 85  HTRKAP-------PGTVMALKPSHALQIKPNTTVAEAAQLMAAKREDCVLVTDEDERIAG 137

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLAFRVVG G+ AR  T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 138 IFTAKDLAFRVVGAGIRARDVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 197

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  +NQP QI+QY++ LR+K
Sbjct: 198 NQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSNQPQQIIQYVEALRQK 257

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L +VL+G  P  V V+TSVR+AA LM+E  TTA+LV +  SI GIFTSKDIVLRV
Sbjct: 258 MSGPTLETVLNGLPPTTVSVRTSVREAAALMKENHTTALLVQDQGSITGIFTSKDIVLRV 317

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMY------------DGHYLNLPVV- 385
           IA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+            DGHYLNLPV+ 
Sbjct: 318 IAPGLDPNTCSVVRVMTPHPDFAPTDMSIQAALRKMHGAEETGLTISKLDGHYLNLPVMN 377

Query: 386 DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSI 445
           + G I+GMVDVLKLTYAT+EQ+ +M +    N+  GP WNKFW  L+ D +++S +S S 
Sbjct: 378 EAGEIVGMVDVLKLTYATLEQVNTMSS----NESEGPAWNKFW--LSMDHESDSIISGST 431

Query: 446 AXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASF--PR-GHDENF-F 501
           A               R            + P++SAS   D + +    PR  H+E+  F
Sbjct: 432 AAIRSRPPSAPSTHVERENS---------VLPNDSASHHGDDAASDVLEPRVAHNEDTPF 482

Query: 502 TFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR----------------DFTIYY 544
            FKFKAP+G+ HR  V  ++    + + V+ KL   V                  + + Y
Sbjct: 483 PFKFKAPSGRVHRLHVTPSAGVSDLVSQVSLKLGPEVEAVGGYALVEDGKLSNSGYALSY 542

Query: 545 VXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK------------------S 586
           V                DAV +++   M +V L++ + EK+                  S
Sbjct: 543 VDNEGDTVSITTDQDLWDAVTLSRSSNMDKVDLYVHDPEKQPVIATPPPPPVAQQVPSVS 602

Query: 587 LR----------XXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAI 636
           L+                      + ++ +   R   A      +P++L+LPGA++TLA+
Sbjct: 603 LKPATPPGAIEEEEEQSNVGNRSSVTDRSQTIVRFPTAEQLINGVPNELILPGAIVTLAV 662

Query: 637 AIIGVFALSR 646
           AI+GVF LSR
Sbjct: 663 AIVGVFVLSR 672



>gi|154301338|ref|XP_001551082.1| CBS/PB1 domain-containing protein [Botryotinia fuckeliana B05.10]
          Length = 622

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 284/636 (44%), Positives = 382/636 (60%), Gaps = 76/636 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIR+K+E +L+KK++T       R +  R+ P   GTV +L PSQAL ++
Sbjct: 4   SRAKQSKRDEAIRRKIETDLSKKSKT-----TGRARQTRKAP--PGTVLALRPSQALQIK 56

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A   T+A IMT+
Sbjct: 57  PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKAANITIAEIMTK 116

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 117 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 176

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 177 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVTVRTSVKEAAA 236

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDPS CSV+RVMTPHPD AP   +I
Sbjct: 237 LMKENHTTAVLVQDGGSITGIFTSKDVVLRVIAPGLDPSNCSVVRVMTPHPDFAPMDMTI 296

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ  E+ +   GP WNK
Sbjct: 297 QAALRKMHDGHYLNLPVMNDQGEIVGMVDVLKLTYATLEQINTMQTGESDS---GPAWNK 353

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE------IHPSES 480
           FW SL +  DNES +S                   R+  S +IS   E      + P++S
Sbjct: 354 FWMSLEH--DNESMISGE--------GSHHHTTGGRSLMSPDISRSHERQVDASVAPNDS 403

Query: 481 AS--AIDDGSMASFPRGHD---ENF-FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL 533
           AS   +D  S +   R +D   E+  F FKFKAP+G+ HR  V  +     + + V  KL
Sbjct: 404 ASHVGVDSPSHSHLSRHNDIPPEDVPFAFKFKAPSGRVHRVQVTASHGLAELISAVTGKL 463

Query: 534 PSNV----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
            S +                  F + Y+               ++A+ +A+     +V L
Sbjct: 464 GSEIDAVGGVASVEDGKIGSSGFALSYLDDEGDSVSITTDEDLLEAIVLARSGHRDKVDL 523

Query: 578 HIQEIEKKSLRXXXXXXXXXXXXILEK-----RRRRKRGKHAPDYNLP------------ 620
            + + EK  +                      RRRR         + P            
Sbjct: 524 FVHDPEKPPMAATLDPQPPIIQIATPPASSTIRRRRVVDSDDESDDEPRVKSKSRKAAAP 583

Query: 621 ---------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
                    +P++LLLPGA++TLA+ I+GVFAL+R+
Sbjct: 584 PPAAEVIQGVPNELLLPGAIVTLAVVIVGVFALTRA 619



>gi|164656969|ref|XP_001729611.1| hypothetical protein MGL_3155 [Malassezia globosa CBS 7966]
 gi|159103504|gb|EDP42397.1| hypothetical protein MGL_3155 [Malassezia globosa CBS 7966]
          Length = 681

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 284/664 (42%), Positives = 380/664 (57%), Gaps = 102/664 (15%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R+R S++DEAIRK++E EL++K    ST    R + Q Q     GTV++L P  ALTV +
Sbjct: 16  RKRQSRRDEAIRKRIETELSRKTGKPSTPQPGRRRNQVQA----GTVSALRPLPALTVPQ 71

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  + +ASQL AAKR DCVLV+D EEHL+GIFTAKDLA+R+V  G+D R T V++IMT +
Sbjct: 72  TMSITDASQLCAAKRTDCVLVVDDEEHLAGIFTAKDLAYRIVAGGIDPRMTPVSSIMTVS 131

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL+TMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS+K
Sbjct: 132 PMVTRDTTSATEALSTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSSQK 191

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAAR 307
           LY ALEGV+ EW       ++QY+  LRE+M+ P+L+S+LD  +MP  VGV+T+VRDAAR
Sbjct: 192 LYHALEGVQNEWGGGPQQAMMQYVQSLRERMSMPELASILDSRTMPCTVGVRTTVRDAAR 251

Query: 308 LMREYRTTAVLVMEHHS------------IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMT 355
           LM+++RTTAV VME+ S            IAGIFTSKD+VLRVIAAGLDP  CSV+RVMT
Sbjct: 252 LMKQHRTTAVCVMENASGAQGERGIATGKIAGIFTSKDVVLRVIAAGLDPERCSVVRVMT 311

Query: 356 PHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQE 414
           PHPDTA P  SI +AL+KM+DG YLNLPVVD    ++G+VDVLKLTYAT+EQ+ SM + +
Sbjct: 312 PHPDTASPSLSIQEALRKMHDGRYLNLPVVDVDARLVGVVDVLKLTYATLEQINSMNSGD 371

Query: 415 NGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE 474
             +  GGPMWN+FWNS    G   +   +S++                    G +    +
Sbjct: 372 ESD--GGPMWNRFWNSFGQ-GTGSAFGEESMSAMSGSQRIGNDSLMS-PPAPGCVDLSSD 427

Query: 475 IHPSESASAIDDGSM-------ASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRA 527
           +HP++SASA+ + +         S P   D+  + FKF  P+G+ HRF   Y SF+ I  
Sbjct: 428 VHPNDSASAVGESTHEGGSALGGSAPFETDDGTYLFKFVTPSGRVHRFQARYDSFDIIHE 487

Query: 528 TVASKL-----------------------------------------------PSNVRDF 540
            V  KL                                               P +VRDF
Sbjct: 488 IVLIKLSSDPFFAKPSNTQIVEPVEPVRSELDEDGRLPQQIFTPPMPSGTQVNPPDVRDF 547

Query: 541 TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ---EIEKKSLRXXXXXXXXX 597
           T+ +                 D+V++A+ QG  RV+L +Q     ++   R         
Sbjct: 548 TLAFKDDDDDLVLMTSDSDVCDSVKVARHQGRDRVLLVLQGGKTWDEAVARDGLYGDYAT 607

Query: 598 XXXILEKRRRRKR----------------------GKHAPDYNLPIPHDLLLPGAVLTLA 635
                   RRR+R                      G H P + + IP D+ LP A+   +
Sbjct: 608 ASSATAANRRRQRELADAQVQRAENASVNHRASPSGTHEPLFGI-IPRDMALPAAIGFAS 666

Query: 636 IAII 639
           +A I
Sbjct: 667 VAGI 670



>gi|494828397|gb|EON65238.1| hypothetical protein W97_04475 [Coniosporium apollinis CBS 100218]
          Length = 674

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 285/641 (44%), Positives = 380/641 (59%), Gaps = 82/641 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIRKK+E +LNKK          R +P R+ P   GTV +L PS AL ++
Sbjct: 52  SRAKQSKRDEAIRKKIETDLNKKKNP-----GGRVRPTRKAP--PGTVLALKPSPALQIK 104

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 105 PNTTVAEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGIKARDVTIAEIMTK 164

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 165 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSSR 224

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R KM+ P L SVL G  P  V V+TSV++AA+
Sbjct: 225 KLYDALEGVQAELGSSQPQQIIQYVEAIRTKMSGPTLESVLTGLPPTTVSVRTSVKEAAQ 284

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LMR+  TTAVLV +  SI GIFTSKD+VLRVIAAGLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 285 LMRDNHTTAVLVQDQGSITGIFTSKDVVLRVIAAGLDPATCSVVRVMTPHPDFAPMDMSI 344

Query: 368 LDALKKMY-DGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+ DGHYLNLPV+ + G I+GMVDVLKLTYAT++Q+ SM  +++     GP WN
Sbjct: 345 QAALRKMHADGHYLNLPVMSEAGEIVGMVDVLKLTYATLDQINSMSTEKD----EGPAWN 400

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP----------EI 475
           KFW SL N+ D ES +S                          +SP P           +
Sbjct: 401 KFWLSLDNN-DTESMMSGEGGSSRMPHTPDARSL---------MSPDPMMRPGIERGDSV 450

Query: 476 HPSESASAIDDGS-----MASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATV 529
            P+ESAS  +D         + P   +E  F FKFKAP+G+ HR  V   +    + ++V
Sbjct: 451 FPNESASHHEDSPDHSAVAGAQPTPSEEIPFPFKFKAPSGRVHRLQVAAAAGMTELISSV 510

Query: 530 ASKLPSNVR----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMS 573
           A KL + +                  F + Y+               +DA+ +A++    
Sbjct: 511 AEKLGNEIEAVGGVPSLEDGKLGASGFALSYLDNEGDTVSITTDRDLLDAISLARQTHRD 570

Query: 574 RVILHIQEIEKKSLRXX------XXXXXXXXXXILEKRRRRK-------------RGKHA 614
           +V L + +  +  L                    L+ RRR +             R K  
Sbjct: 571 KVDLFVHDPSQPPLSAMLDPHPGLAKPPTPPESTLKHRRRYEEDEEAEESPERPVREKKQ 630

Query: 615 PDYNLP--------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           P  ++         +P++LLLPGAV+TLA+ +I VFAL R+
Sbjct: 631 PSASVKQDEQIIAGVPNELLLPGAVVTLAVVVIAVFALGRA 671



>gi|326472832|gb|EGD96841.1| CBS and PB1 domain-containing protein [Trichophyton tonsurans CBS
           112818]
          Length = 659

 Score =  486 bits (1251), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 285/654 (43%), Positives = 382/654 (58%), Gaps = 73/654 (11%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PRK   P  P+ A                +RQ+ SK+DEAIR+K+E +L+KK    S + 
Sbjct: 29  PRKVEHPIPPSVASDIGASSTLST-----SRQKQSKRDEAIRRKMEADLSKKKFNPSKAR 83

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
           + R  P        GTV +L PSQAL ++ +  V EA+QLMAAKR DCVLV D ++ ++G
Sbjct: 84  HTRKAP-------PGTVLALKPSQALQIKPNTTVSEAAQLMAAKREDCVLVTDDDDRIAG 136

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLA+RVVG G+ AR  T+  IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 137 IFTAKDLAYRVVGAGIRARDVTIVEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 196

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR K
Sbjct: 197 NQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSSQPQQIIQYVEALRSK 256

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L SVL+G  P  V V+TSV++AA LM+E  TTA+LV +  SI GIFTSKD+VLRV
Sbjct: 257 MSGPTLESVLNGLPPTTVSVRTSVKEAAALMKENHTTALLVQDQGSITGIFTSKDVVLRV 316

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDVL
Sbjct: 317 IAPGLDPATCSVVRVMTPHPDFAPTDMSIQAALRKMHDGHYLNLPVMNESGEIVGMVDVL 376

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           KLTYAT+EQ+ ++Q     N+  GP WNKFW S+ N+ D  S VS S             
Sbjct: 377 KLTYATLEQINTIQT----NESEGPAWNKFWLSMDNESD--SMVSGS-------QPHHRS 423

Query: 458 XXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFP----RGHDENFFTFKFKAPNGKSH 513
                 RG    S +P  + S S    +D  ++  P     G  +  F FKFKAP+G+ H
Sbjct: 424 LLSPDHRGHTGDSVLP--NDSASHHGGEDAPVSEVPERPVEGKLDPSFPFKFKAPSGRVH 481

Query: 514 RFTVDYTS-FEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXXXXXX 556
           R  VD ++    +   V++KL + V                  F + Y+           
Sbjct: 482 RLHVDPSAGIAELVQNVSAKLGAEVDTIGGQAVVEDGKLSNTGFAMSYLDSEGDTVSITA 541

Query: 557 XXXXIDAVRIAQRQGMSRVILHI----------QEIEKKSLRXXXXXXXXXXXXILEKRR 606
               +DA+ IA++    +V L +          +E E  +                E+  
Sbjct: 542 DQDLVDAISIARKASQDKVDLFVHSPDSTPVVAKEPESAAAAKTASPPESVTVAAEEETV 601

Query: 607 RRKRGKHAP------------DYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
            R+    +P            D  L   IP++L+LPGA++TLA  I+GVF LSR
Sbjct: 602 HREELASSPKSVAQSLVQPSTDQQLINGIPNELILPGAIVTLAAVIVGVFVLSR 655



>gi|242766797|ref|XP_002341242.1| CBS/PB1 domain-containing protein [Talaromyces stipitatus ATCC
           10500]
 gi|218724438|gb|EED23855.1| CBS and PB1 domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 674

 Score =  486 bits (1250), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 288/639 (45%), Positives = 376/639 (58%), Gaps = 85/639 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK        +NR  P        GTV +L PSQAL ++ 
Sbjct: 58  RQNQSKRDEAIRRKMEADLNKKRHHVQRPRHNRKAP-------PGTVLALKPSQALQIKP 110

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL AR  T+A IMT+N
Sbjct: 111 NTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKAREVTIAEIMTKN 170

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 171 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRK 230

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR+KM+ P L SVLDG  P  V V+TSV++AA L
Sbjct: 231 LYDALEGVQSELGSSQPQQIIQYVEALRQKMSGPTLESVLDGMPPTTVSVRTSVKEAAAL 290

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E+ TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI 
Sbjct: 291 MKEHHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMSIQ 350

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SM    N  D  GP WNKF
Sbjct: 351 AALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINSM----NTGDDEGPAWNKF 406

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP---------EIHPS 478
           W  L+ D +++S VS                    T     +SP P          + P+
Sbjct: 407 W--LSMDHESDSMVSGG------------GSHRPHTPHRSVLSPDPSKPGFDRGDSVLPN 452

Query: 479 ESASAIDDGSMASFPRGHDENF---FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL- 533
           ESAS   D   +     H ++    F FKFKAP+G+ HR  V  +     + A+V +KL 
Sbjct: 453 ESASHHGDDMHSELLDHHVDDVNTPFAFKFKAPSGRVHRVNVIISEGLSALVASVVAKLG 512

Query: 534 ---------PS------NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
                    PS      +   F + Y+                DAV  A++    +V L 
Sbjct: 513 QESEAVGGVPSVEEGKLSSTGFALSYLDNEGDTVSITTDQDLSDAVHQARKLHHEKVDLF 572

Query: 579 IQEIEKKSL------RXXXXXXXXXXXXILEKR-----------------RRRKRGKHAP 615
           I +  +  +      +            +L++R                 R  +  K   
Sbjct: 573 IHDPSQPPIPTTVEPQPVLSKPPTPPESVLKERAPKHIEEDEEEDEEKYSRSTRASKQQI 632

Query: 616 DYNLP-------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
              LP       +P+DLLLPGA++TLA  I GVF LSR+
Sbjct: 633 PQRLPEEQLIAGVPNDLLLPGAIVTLAAVIAGVFILSRA 671



>gi|392597207|gb|EIW86529.1| CBS-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 656

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/564 (48%), Positives = 355/564 (62%), Gaps = 63/564 (11%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLN---NRGKPQRQVPGAKGTVASLNPSQALT 125
           R++ SK+DEAIRKK+E EL++K RT ST+     +R K   ++  AKGTVA+L PS ALT
Sbjct: 12  RRKQSKRDEAIRKKIEGELSRK-RTISTAQQLGGSRTKRGTKLQVAKGTVAALKPSAALT 70

Query: 126 VRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIM 185
           V E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD   T V+ IM
Sbjct: 71  VPETITVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRVTAEGLDPHATPVSQIM 130

Query: 186 TRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGS 245
           TR PM  ++ TSAT+AL  MV R FRHLPVCNEEG+VVGLLDITK  +EAL+K+ER+  +
Sbjct: 131 TRGPMVTRDSTSATEALQLMVQRHFRHLPVCNEEGNVVGLLDITKVFHEALNKVERSSSA 190

Query: 246 SKKLYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVK 299
           S+KLY AL GV+ E   N     Q   +L Y++ LREK A PDL++++D  + PA V  K
Sbjct: 191 SEKLYSALAGVQSELGPNMSTNPQAAAMLAYVEALREKTALPDLTTIMDSRTHPATVTPK 250

Query: 300 TSVRDAARLMREYRTTAVLVMEHHS-----IAGIFTSKDIVLRVIAAGLDPSTCSVIRVM 354
           T+VR+ ARLM+E RTTAV VME+H      IAGIFTSKD+VLRVIAAGLD + CSVIRVM
Sbjct: 251 TTVREVARLMKERRTTAVCVMENHGGIHPKIAGIFTSKDVVLRVIAAGLDANMCSVIRVM 310

Query: 355 TPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQ 413
           TPHPDTAPP T++ DALKKM++GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM +M  +
Sbjct: 311 TPHPDTAPPTTTVHDALKKMHNGHYLNLPVVETDGRLVAIVDVLKLTYATLEQMNTMTTE 370

Query: 414 ENGNDG---GGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNIS 470
             G +    GGPMW +F++SL    D ES +S S A                       S
Sbjct: 371 AAGGNADAEGGPMWGRFFDSLGGGEDTESMISGSRAPTDGMSLTNHNMRLQ--------S 422

Query: 471 PIPEIHPSESASAIDDGSM-------------------ASFPRGHDENFFTFKFKAPNGK 511
           P  E+HP++SAS +D+ S+                   +S P+  D+  + FKF+ P+G+
Sbjct: 423 PQSEVHPNDSASVVDEESVLEGYARRRGDISAPSITGFSSVPQ--DDGTYVFKFRTPSGR 480

Query: 512 SHRFTVDYTSFEHIRATVASKLPS---------------NVRDFTIYYVXXXXXXXXXXX 556
           +HRF   + S E +R  V  KL +               +  DF + Y            
Sbjct: 481 THRFQARHDSIEMLREIVRGKLATDPFFIEYEGDPEGRPDPTDFLLSYTDADGDSVLMTS 540

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQ 580
                DAV+IA+  G  RV+L IQ
Sbjct: 541 DTDIADAVKIARTTGSDRVVLFIQ 564



>gi|407923859|gb|EKG16922.1| Phox/Bem1p [Macrophomina phaseolina MS6]
          Length = 663

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/628 (44%), Positives = 375/628 (59%), Gaps = 61/628 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIRKK+E++LNKK          RG  QR      GTV +L PS AL ++
Sbjct: 46  SRAKQSKRDEAIRKKIENDLNKKRAP------TRGV-QRARKAPPGTVLALKPSSALQIK 98

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 99  PHTTVAEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGIKARDITIAEIMTK 158

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 159 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDIAGILDITKCFYDAMEKLERAYSSSR 218

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP Q++QY++ +R KM+ P L SVL G  P  V V+TSV++AA+
Sbjct: 219 KLYDALEGVQAELGSSQPQQVIQYVEAIRAKMSGPTLESVLTGLPPTTVSVRTSVKEAAQ 278

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIAAGLDP TCSV+RVMTPHPD AP   SI
Sbjct: 279 LMKENHTTAVLVQDQGSITGIFTSKDVVLRVIAAGLDPGTCSVVRVMTPHPDFAPIDMSI 338

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT++Q+ +MQ+     D  GP WNK
Sbjct: 339 QAALRKMHDGHYLNLPVMSEAGEIVGMVDVLKLTYATLDQINTMQS----GDSEGPAWNK 394

Query: 427 FWNSLANDGDNESTVSDSIAXXX--XXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAI 484
           FW SL  D ++ES VS                       R S ++     + P++SAS +
Sbjct: 395 FWLSL--DHESESMVSGEGGSHHPRTEISRSHVMSPGLERHSSHLDRGESVMPNDSASHV 452

Query: 485 -----DDGSMASFPR-GHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV 537
                +  ++A+ P    +E  F FKFKAP+G++HRF    ++        V  KL + +
Sbjct: 453 GMETPEHSAVAASPGLPLEEMPFAFKFKAPSGRTHRFQATPSAGLGEFILLVIDKLGAEI 512

Query: 538 ----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+               ++AV +A      +V L +  
Sbjct: 513 DAVGGAPTFEDGHLSNSGFALSYLDNEGDSVSITTNHDLLEAVSLAHMHHTEKVDLFVHH 572

Query: 582 IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKH---------------------APDYNLP 620
            E   L                +   R+R K+                     AP+  + 
Sbjct: 573 PEHPPLPGTVAPQGAPATATPPESSVRERKKYVDDEESDEEVERRRRKKQQAAAPEQVIQ 632

Query: 621 -IPHDLLLPGAVLTLAIAIIGVFALSRS 647
            +P++LLLPGA++TLA+ IIGVFAL R+
Sbjct: 633 GVPNELLLPGAIVTLAVVIIGVFALGRA 660



>gi|46123863|ref|XP_386485.1| hypothetical protein FG06309.1 [Fusarium graminearum PH-1]
          Length = 680

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/640 (44%), Positives = 386/640 (60%), Gaps = 81/640 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E++L+KK       L +R +  R+ P   GTV +L PSQAL ++
Sbjct: 57  SRQKQSKRDEAIRKKLENDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSQALQIK 109

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+
Sbjct: 110 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGAKASAVTIAEIMTK 169

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 170 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 229

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ LR KM+ P L +VL+G  P  V V+TSVR+AA+
Sbjct: 230 KLYDALEGVQSELGSTQPQQIIQYVEALRSKMSGPTLETVLNGVPPTTVSVRTSVREAAQ 289

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E RTTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   ++
Sbjct: 290 LMKENRTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTL 349

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT++Q+ +M N    N+  GP WNK
Sbjct: 350 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLDQINAMSN----NNDEGPAWNK 405

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES +S   +                 R   N +    + P +SAS +  
Sbjct: 406 FWLSL--DAETESMMSGEGSQAQHTNLGSRLTSPDMVRDRLNDT----VAPGDSASHV-- 457

Query: 487 GSMASFPRG----------HDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPS 535
             M S PR            +E  F FKFKAP+G+ HR  +  T   E     +ASKL +
Sbjct: 458 -GMESPPRSILPDVLEHQLPEELPFPFKFKAPSGRVHRMKIVATDGIEAFVEAIASKLGA 516

Query: 536 ---------NVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
                    +V D       F + ++               ++AV +A++    +V L +
Sbjct: 517 EADNIGGVPDVEDGKIVGSGFALSFLDDEGDSISITADHDLLEAVILARQAHHDKVDLFV 576

Query: 580 QEIEKKSL-----RXXXXXXXXXXXXILEKRR--------------------RRKRGKHA 614
            + EK  +     R            + E+R+                    RR++ + A
Sbjct: 577 HDPEKPPVSAADPRHPATPSVSTGAGLRERRKWWPEEEEEEDDDDSEDEHPARRRKSRAA 636

Query: 615 PDYNLP--------IPHDLLLPGAVLTLAIAIIGVFALSR 646
             +           +P++L+LPGA++TLA+AI+GVF ++R
Sbjct: 637 HTHAHAHEEQIIAGVPNELILPGAIVTLAVAIVGVFTIAR 676



>gi|425769641|gb|EKV08130.1| hypothetical protein PDIP_69880 [Penicillium digitatum Pd1]
 gi|425771276|gb|EKV09724.1| hypothetical protein PDIG_60470 [Penicillium digitatum PHI26]
          Length = 613

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 280/618 (45%), Positives = 366/618 (59%), Gaps = 55/618 (8%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +L+KK  T + S ++R  P        GTV +L PSQAL ++ 
Sbjct: 9   RQNQSKRDEAIRRKMEADLSKKRNTPAKSRSSRKAP-------PGTVLALKPSQALQIKP 61

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  + EA+QLMAAKR DCVLV D  E ++GIFTAKDLAFRVVG GL AR  +VA IMT+N
Sbjct: 62  AMSIAEAAQLMAAKREDCVLVTDDNERIAGIFTAKDLAFRVVGMGLKAREVSVAEIMTKN 121

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 122 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 181

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP Q++QY++ LR KM+ P L +VLDG  P  V V+T+V+DAA L
Sbjct: 182 LYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLDGLPPVTVSVRTTVKDAAAL 241

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E  TTA+LV +  SI GIFTSKDIVLRVIA GLDPSTCSV+RVMTPHPD AP   SI 
Sbjct: 242 MKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSIQ 301

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ +M  Q    D  GP WNKF
Sbjct: 302 AALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINNMSTQ----DEEGPAWNKF 357

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDG 487
           W  L+ D +++S VS                    TR   + S +P    S       + 
Sbjct: 358 W--LSMDHESDSMVS---GGHSQQPNTRSVVSPDLTRSGYDNSLLPTDSASHHGDEHSEV 412

Query: 488 SMASFP-RGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNVR------- 538
               FP        F FKFKAP G+ HR  V        + A V +KL   V        
Sbjct: 413 VSQHFPAEPAAPTPFPFKFKAPGGRVHRVNVLSINGVTDLVAQVTAKLGKEVEAVGGEAT 472

Query: 539 ---------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRX 589
                     + + Y+                DA+ +A+R    +VIL + +  +  +  
Sbjct: 473 VEEGCLSNTGYALSYLDNEGDTVSITTDQDMADAIDLARRTYRDKVILFVHDPTQPPIPA 532

Query: 590 XXXXXXXXXXXILEKR------------------RRRKRGKHAPDYNL--PIPHDLLLPG 629
                        E++                  +++     AP+ +L   +P+DLLLPG
Sbjct: 533 AAEPHHVKIVTPSEEQSVAEEPASQESPVSKAIPQQQAIPSRAPNEHLIAGVPNDLLLPG 592

Query: 630 AVLTLAIAIIGVFALSRS 647
           A++TLA  I GVF L RS
Sbjct: 593 AIVTLAAVIAGVFILGRS 610



>gi|156039609|ref|XP_001586912.1| CBS/PB1 domain-containing protein [Sclerotinia sclerotiorum 1980
           UF-70]
 gi|154697678|gb|EDN97416.1| hypothetical protein SS1G_11941 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 680

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 283/639 (44%), Positives = 381/639 (59%), Gaps = 84/639 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIR+K+E +L+KK++T       R +  R+ P   GTV +L PSQAL ++
Sbjct: 62  SRAKQSKRDEAIRRKIETDLSKKSKT-----TGRARQTRKAP--PGTVLALRPSQALQIK 114

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A   T+A IMT+
Sbjct: 115 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKAANITIAEIMTK 174

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 175 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 234

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL G  P  V V+TSV++AA 
Sbjct: 235 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLTGIPPTTVTVRTSVKEAAA 294

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDPS CSV+RVMTPHPD AP   SI
Sbjct: 295 LMKENHTTAVLVQDGGSITGIFTSKDVVLRVIAPGLDPSNCSVVRVMTPHPDFAPMDMSI 354

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ  E+ +   GP WNK
Sbjct: 355 QAALRKMHDGHYLNLPVMNDQGEIVGMVDVLKLTYATLEQINTMQTGESDS---GPAWNK 411

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP----------IPEIH 476
           FW SL +  + ES VS                    T G   +SP             + 
Sbjct: 412 FWMSLEH--ETESMVSGE------------GSHHHTTGGRSLMSPDMSRGHERQVDASVA 457

Query: 477 PSESASAID-DGSMASFPRGHD---ENF-FTFKFKAPNGKSHRFTVDYT-SFEHIRATVA 530
           P++SAS +  D   +   R +D   E+  F FKFKAP+G+ HR  V  +     + + VA
Sbjct: 458 PNDSASHVGLDSPRSQLSRHNDIPPEDVPFAFKFKAPSGRVHRIQVTASHGLAELISAVA 517

Query: 531 SKLPSNV----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSR 574
           +KL + V                  F + Y+               ++A+ IA+     +
Sbjct: 518 NKLGAEVDAVGGVAIVEDGKLGSSGFALSYLDDEGDSISITTDEDLLEAIVIARNGHRDK 577

Query: 575 VILHIQEIEK---------------------------KSLRXXXXXXXXXXXXILEKRRR 607
           V L + + EK                           + +             +  K R+
Sbjct: 578 VDLFVHDPEKPPMAATLEPQPPVIQVTTPPGSATIRRRRVVADDEEESDDEPRVKSKSRK 637

Query: 608 RKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
               + AP+    +P++LLLPGA++TLA+ I+GVFAL+R
Sbjct: 638 AAAPQPAPEVIQGVPNELLLPGAIVTLAVVIVGVFALTR 676



>gi|408399597|gb|EKJ78696.1| hypothetical protein FPSE_01184 [Fusarium pseudograminearum CS3096]
          Length = 682

 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/640 (44%), Positives = 386/640 (60%), Gaps = 81/640 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E++L+KK       L +R +  R+ P   GTV +L PSQAL ++
Sbjct: 59  SRQKQSKRDEAIRKKLENDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSQALQIK 111

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+
Sbjct: 112 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGAKASAVTIAEIMTK 171

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 172 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 231

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ LR KM+ P L +VL+G  P  V V+TSVR+AA+
Sbjct: 232 KLYDALEGVQSELGSTQPQQIIQYVEALRSKMSGPTLETVLNGVPPTTVSVRTSVREAAQ 291

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E RTTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   ++
Sbjct: 292 LMKENRTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTL 351

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT++Q+ +M N    N+  GP WNK
Sbjct: 352 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLDQINAMSN----NNDEGPAWNK 407

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES +S   +                 R   N +    + P +SAS +  
Sbjct: 408 FWLSL--DAETESMMSGEGSQAQHTNLGSRLTSPDMVRDRLNDT----VAPGDSASHV-- 459

Query: 487 GSMASFPRG----------HDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPS 535
             M S PR            +E  F FKFKAP+G+ HR  +  T   E     +ASKL +
Sbjct: 460 -GMESPPRSILPDVLEHQLPEELPFPFKFKAPSGRVHRMKIVATDGIEAFVEAIASKLGA 518

Query: 536 ---------NVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
                    +V D       F + ++               ++AV +A++    +V L +
Sbjct: 519 ETDNIGGVPDVEDGKIVGSGFALSFLDDEGDSISITADHDLLEAVILARQAHHDKVDLFV 578

Query: 580 QEIEKKSL-----RXXXXXXXXXXXXILEKRR--------------------RRKRGKHA 614
            + EK  +     R            + E+R+                    RR++ + A
Sbjct: 579 HDPEKPPVSAADPRHPATPSVSTGAGLRERRKWWPEEEEEEDDDDSEDEHPARRRKSRAA 638

Query: 615 PDYNLP--------IPHDLLLPGAVLTLAIAIIGVFALSR 646
             +           +P++L+LPGA++TLA+AI+GVF ++R
Sbjct: 639 HTHAHAHEEQIIAGVPNELILPGAIVTLAVAIVGVFTIAR 678



>gi|169618018|ref|XP_001802423.1| hypothetical protein SNOG_12196 [Phaeosphaeria nodorum SN15]
 gi|160703532|gb|EAT80608.2| hypothetical protein SNOG_12196 [Phaeosphaeria nodorum SN15]
          Length = 671

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 284/633 (44%), Positives = 377/633 (59%), Gaps = 73/633 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R +MSK+DEAIR+K+E +LNKK    S     R +  ++ P   GTV +L PS AL ++
Sbjct: 56  SRAKMSKRDEAIRRKIETDLNKKKTPGS-----RARLSKKAP--PGTVLALKPSPALQIK 108

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+  IMT+
Sbjct: 109 PSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKARDVTIEEIMTK 168

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 169 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSSR 228

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R+KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 229 KLYDALEGVQAEMGSSQPQQIIQYVEAIRQKMSGPTLESVLNGLPPVTVSVRTSVKEAAS 288

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIAAGLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 289 LMKENHTTAVLVQDQGSITGIFTSKDVVLRVIAAGLDPATCSVVRVMTPHPDFAPMDMSI 348

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WNK
Sbjct: 349 QSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTGDSEGPAWNK 404

Query: 427 FWNSLANDGDNESTVS---DSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS- 482
           FW SL  D + ES +S    S                   RG         + P++SAS 
Sbjct: 405 FWLSL--DAETESMMSGEGGSRLPDHRSVMSHDNRPGIHDRGD-------SVLPNDSASH 455

Query: 483 -AIDDGSMASFPRGH---DENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV 537
              D  S +     H   ++  F FKFKAP+G+ HR  V  ++  E + A VASKL S V
Sbjct: 456 HGGDSPSQSGIGGRHTPIEDLPFPFKFKAPSGRVHRLQVTASAGIEELIANVASKLGSEV 515

Query: 538 R----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+               ++A+ +++     +V L + +
Sbjct: 516 EAIGGTPTFEFGKISLSGFALSYLDNEGDTVSITTNDDLVEAISLSRLAHREKVDLFVHD 575

Query: 582 IEKKSL------RXXXXXXXXXXXXILEKRRR-----------RKRGKHAPDYNLP---- 620
            EK  +      +            +L  R++           R + K      +P    
Sbjct: 576 PEKPPMVAEVNPQPALAKPVTPPESVLRDRKKYFQEEEEEEEARPKSKRQNQQPVPFGQQ 635

Query: 621 ------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
                 +P+DLLLPGA+  LA+ IIGVF L R+
Sbjct: 636 PEIIQGVPNDLLLPGAIGVLAVVIIGVFVLGRA 668



>gi|426201879|gb|EKV51802.1| hypothetical protein AGABI2DRAFT_190012 [Agaricus bisporus var.
           bisporus H97]
          Length = 698

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 283/639 (44%), Positives = 378/639 (59%), Gaps = 69/639 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R++ S++DEAIRKK   +L++K    +T  + R K   +   AKGTVA+L P+ ALTV E
Sbjct: 62  RKKQSRRDEAIRKKATSDLSRKRTISTTFQSGRSKRGGKTTAAKGTVAALKPTPALTVPE 121

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  + LD  TT V  IMTRN
Sbjct: 122 NISVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRVTAESLDPHTTPVNQIMTRN 181

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL  MV+R FRHLPVCNE+G+VVGLLDITK  +EALDK+ER+  +S++
Sbjct: 182 PMVTRDTTSATEALQLMVSRHFRHLPVCNEDGNVVGLLDITKVFHEALDKVERSSAASEQ 241

Query: 249 LYDALEGVEREW----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           L++A+ GV+ E     S  Q T +L + + LR+K A PDL++++D  + PA VG KT+VR
Sbjct: 242 LFNAMAGVQTELGAVGSNPQATAMLAWAEKLRQKTALPDLTTIMDSRTDPATVGPKTNVR 301

Query: 304 DAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           + A+LM+E RTTAV V+E   I GIFTSKD+VLRVIAAGLD + CSVIRVMTPHPDTAPP
Sbjct: 302 EVAKLMKERRTTAVCVIEGGRIVGIFTSKDVVLRVIAAGLDANRCSVIRVMTPHPDTAPP 361

Query: 364 QTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDG-GG 421
             ++ DALKKM+ GHYLNLPVV + GS++ +VDVLKLTYAT+EQM  M   E G D  GG
Sbjct: 362 TMTVHDALKKMHIGHYLNLPVVEEDGSLVAVVDVLKLTYATLEQMNVMAGGEAGADNEGG 421

Query: 422 PMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESA 481
           PMW +F++S  ++ D+ S VS S A               +       SP  ++HP++SA
Sbjct: 422 PMWGRFFDSFGHE-DDGSMVSGSHAASRSHFSAGDLSHIQQ-------SPPFDLHPNDSA 473

Query: 482 SAIDDGSMA------------SFPRGH-----DENFFTFKFKAPNGKSHRFTVDYTSFEH 524
           S +DD   A            S P G      D+  + FKF+ P+G++HRF   +    H
Sbjct: 474 SVMDDDDHASALSGFARKKGVSIPSGPALIPVDDGTYVFKFRTPSGRTHRFQSRHDDVAH 533

Query: 525 IRATVASKL-----------------PSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIA 567
           +R  +A KL                 P++  DF + Y                 DAV+IA
Sbjct: 534 LREIIAGKLATDPFFTELQLEQDGGPPADPNDFHLSYTDADGDTVLITSDDDVTDAVKIA 593

Query: 568 QRQGMSRVILHIQ-------------EIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHA 614
           +  G+ RV+L++Q             E + K L              +    ++      
Sbjct: 594 RTAGLDRVVLYVQGGKGWKDVKAETGEEKVKDLPQPTKVEEEQVEKTIAPPEKQAPPPPP 653

Query: 615 PDYN-------LPIPHDLLLPGAVLTLAIAIIGVFALSR 646
                        +P DLLLP ++  LA+ IIGVFA+SR
Sbjct: 654 AAAAPPAPEQVFGLPKDLLLPASIGALAVVIIGVFAISR 692



>gi|400601710|gb|EJP69335.1| CBS domain-containing protein [Beauveria bassiana ARSEF 2860]
          Length = 664

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/634 (44%), Positives = 375/634 (59%), Gaps = 75/634 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E++L+KK       L NR +  R+ P   GTV +L PSQAL ++
Sbjct: 49  SRQKQSKRDEAIRRKMENDLSKKKH-----LTNRARHSRKAP--PGTVMALKPSQALQIK 101

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  +   T+A IMT+
Sbjct: 102 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGTGQKSSNVTIAEIMTK 161

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 162 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 221

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV  E  TNQP QI+QY++ LR KM+ P L +VL+G  P  V V+TSV++AA 
Sbjct: 222 KLYDALEGVHSELGTNQPQQIIQYVEALRSKMSGPTLETVLNGIPPTTVSVRTSVKEAAA 281

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I
Sbjct: 282 LMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTI 341

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ SM       DG GP W+K
Sbjct: 342 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINSMST----GDGEGPAWSK 397

Query: 427 FWNSLANDGDNESTVS-DSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           FW S+  D + ES VS D                  R R   +++      P +SAS + 
Sbjct: 398 FWLSI--DNETESMVSGDGSQHHTNLGSRMMTPDVARDRLGDSVA------PGDSASHVG 449

Query: 486 DGSMASFPRGHDENFFTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNVRD----- 539
               A  P    +  F FKFKAP+ + HR   V     E   A VASKL + V       
Sbjct: 450 SHHDAEIPPA--DVPFPFKFKAPSNRVHRLQVVASQGIEAFVAAVASKLGNEVESIGGVP 507

Query: 540 -----------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLR 588
                      F + Y+               ++A+ +A++    +V L + + EK  + 
Sbjct: 508 TAEDGKLGNTGFAVSYMDDEGDTVSITTDNDLLEAILLARQGRRDKVELFVHDPEKPPVA 567

Query: 589 XXXXXXX-------XXXXXILEKRRR------------RKRGKHAP--------DYNLP- 620
                              ++ +RRR                  AP        +   P 
Sbjct: 568 PIAPVETPVIATPPTSTAPVVRERRRAYDDEDEDDDDEDDEDGPAPVRRSRRNRNAAAPV 627

Query: 621 -------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
                  +P+DLLLPGA++TLA+ I+GVF ++R+
Sbjct: 628 QEQIIAGVPNDLLLPGAIVTLAVVIVGVFTIARA 661



>gi|115389224|ref|XP_001212117.1| CBS/PB1 domain-containing protein [Aspergillus terreus NIH2624]
 gi|114194513|gb|EAU36213.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 668

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/616 (45%), Positives = 369/616 (59%), Gaps = 57/616 (9%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ  SK+DEAIR+K+E +LNKK    + +  +R  P        GTV +L PSQAL ++ 
Sbjct: 70  RQNQSKRDEAIRRKMEADLNKKRHNPARAHRSRKAP-------PGTVLALKPSQALQIKP 122

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  + EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  AR  TV+ IMT+N
Sbjct: 123 NTTIAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKAREITVSEIMTKN 182

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 183 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 242

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA L
Sbjct: 243 LYDALEGVQTELGSSQPQQIIQYVEALRSKMSGPTLESVLDGMPPTTVSVRTSVKEAAAL 302

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E+ TTA+LV +  SI GIFTSKDIVLRVIA GLDP+TCSV+RVMTPHPD AP   SI 
Sbjct: 303 MKEHHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMSIQ 362

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SMQ Q    D  GP WNKF
Sbjct: 363 AALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINSMQTQ----DDEGPAWNKF 418

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDG 487
           W S+    D+ES   DS+                             + P+ESAS     
Sbjct: 419 WLSM----DHES---DSMVSGSHRPHTPHRSVMSPEDPKAGYDARDSVLPNESASHHGGD 471

Query: 488 SMASF-PRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKL---------PS 535
             + +    H E+  F FKFKAP+G+ HR  V  T+    + A V +KL          S
Sbjct: 472 EHSEYIDHHHGESVPFPFKFKAPSGRVHRVNVLPTAGIAELVAQVTAKLGPECEAVGGAS 531

Query: 536 NVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE------- 581
            V D       + + Y+                DA+ +A++    +V L + +       
Sbjct: 532 VVEDGVLSNTGYALSYLDNEGDTVSITTDQDLADAIHVARQARRDKVDLFVHDPTHPPVP 591

Query: 582 --------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL--PIPHDLLLPGAV 631
                   +E+K                  K R +    H P+      +P++LLLPGA+
Sbjct: 592 APVEAPKPVEEKPATPASEETVEEVPAA--KPRVQTYPSHHPEEQFIAGVPNELLLPGAI 649

Query: 632 LTLAIAIIGVFALSRS 647
           +TLA  I GVF LSR+
Sbjct: 650 VTLAAVIAGVFVLSRA 665



>gi|327294133|ref|XP_003231762.1| CBS/PB1 domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326465707|gb|EGD91160.1| CBS and PB1 domain-containing protein [Trichophyton rubrum CBS
           118892]
          Length = 660

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 281/625 (44%), Positives = 374/625 (59%), Gaps = 67/625 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK    S + + R  P        GTV +L PSQAL ++
Sbjct: 53  SRQKQSKRDEAIRRKMEADLSKKKFNPSKARHTRKAP-------PGTVLALKPSQALQIK 105

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RVVG G+ AR  T+A IMT+
Sbjct: 106 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRVVGAGIRARDVTIAEIMTK 165

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 166 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 225

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 226 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTVSVRTSVKEAAA 285

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 286 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMSI 345

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ ++Q     N+  GP WNK
Sbjct: 346 QAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTIQT----NESEGPAWNK 401

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI----HPSESAS 482
           FW S+ N+ D  S VS S                   RG    S +P      H  E A 
Sbjct: 402 FWLSMDNESD--SMVSGS-------QPHHRSLLSPDHRGHTGDSVLPNDSASHHGGEDAP 452

Query: 483 AIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV---- 537
             +     S  R  D + F FKFKAP+G+ HR  VD ++    +   V++KL + V    
Sbjct: 453 VSEVQERPSVERKLDPS-FPFKFKAPSGRVHRLHVDPSAGIAELVQNVSAKLGAEVDTIG 511

Query: 538 ------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI------ 579
                         F + Y+               +DA+ IA++    +V L +      
Sbjct: 512 GQAVVEDGKLSNTGFAMSYLDSEGDTVSITADQDLVDAISIARKASQDKVDLFVHNPDST 571

Query: 580 ----QEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAP------------DYNL--PI 621
               +E E  +                E+   R+    +P            D  L   I
Sbjct: 572 PVVAKEPEPVAAAKAASPPESVTVAAEEEAVHREELASSPKSVAQSLVQPSTDQQLINGI 631

Query: 622 PHDLLLPGAVLTLAIAIIGVFALSR 646
           P++L+LPGA++TLA  I+GVF LSR
Sbjct: 632 PNELILPGAIVTLAAVIVGVFVLSR 656



>gi|330932518|ref|XP_003303808.1| CBS/PB1 domain-containing protein [Pyrenophora teres f. teres 0-1]
 gi|311319951|gb|EFQ88097.1| hypothetical protein PTT_16169 [Pyrenophora teres f. teres 0-1]
          Length = 666

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 282/633 (44%), Positives = 379/633 (59%), Gaps = 76/633 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKK-NRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +R +MSK+D+AIR+K+E +LNKK N +    L+ +  P        GTV +L PS AL +
Sbjct: 54  SRAKMSKRDDAIRRKIESDLNKKKNHSGRVRLSKKAPP--------GTVLALKPSPALQI 105

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+  IMT
Sbjct: 106 KPSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKARDVTIEEIMT 165

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 166 KNPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSS 225

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP +I+ Y++ +R+KM+ P L SVL G  P  V V+TSVR+AA
Sbjct: 226 RKLYDALEGVQAEMGSSQPAEIINYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVREAA 285

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LM+E+ TTAVLV ++ SI GIFTSKD+VLRVIAAGLDPSTCSV+RVMTPHPD AP   S
Sbjct: 286 ALMKEHHTTAVLVQDNGSITGIFTSKDVVLRVIAAGLDPSTCSVVRVMTPHPDFAPMDMS 345

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WN
Sbjct: 346 IQSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTTDSEGPAWN 401

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP-----IPEIHPSES 480
           KFW SL  D + ES +S                   R+  S N  P        + P+ES
Sbjct: 402 KFWLSL--DNETESMMSGE---------GGSRHPDHRSHVSHNDRPGLMDRGDSVLPNES 450

Query: 481 ASAIDDGS------MASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL 533
           AS     S       ++ P   ++  F FKFKAP+G+ HR  V  +   E + + VA+KL
Sbjct: 451 ASHHGGDSPPQSAVASNHPAPMEDMPFPFKFKAPSGRVHRLQVVASHGIEELISNVANKL 510

Query: 534 PSNVR----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
              V                  F + Y+               ++A+ +++     +V L
Sbjct: 511 GGEVEALGGIPTYDEGKISRAGFALSYLDNEGDTISITTHDDLVEAISLSRMAHREKVDL 570

Query: 578 HIQEIEKKSLRXXXXXXXXXXXXI------LEKRRR----------RKRGKH-------A 614
            + + EK  +             +      L +R++          R RG++        
Sbjct: 571 FVHDPEKAPMSAEVNPQPALPKPVTPPESTLRERKQFFDDEEDETPRSRGRNQPVPLSQQ 630

Query: 615 PDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
           P+    +P+DLLLPGA+  LA+ IIGVF L R+
Sbjct: 631 PEIIAGVPNDLLLPGAIGVLAVVIIGVFVLGRA 663



>gi|485928003|gb|EOD51829.1| putative cbs and pb1 domain containing protein [Neofusicoccum
           parvum UCRNP2]
          Length = 665

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 285/657 (43%), Positives = 377/657 (57%), Gaps = 61/657 (9%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           P   S    P P+                +R + SK+DEAIRKK+E++LNKK      + 
Sbjct: 19  PSYNSPSGIPRPSDHHAPSEVGGSSTLSASRAKQSKRDEAIRKKIENDLNKKR-----AP 73

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
            NR +  R+ P   GTV +L PS AL ++    V EA+QLMAAKR DCVLV D EE ++G
Sbjct: 74  TNRIQRARKAP--PGTVLALKPSSALQIKPHITVAEAAQLMAAKREDCVLVTDDEERIAG 131

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLAFRVVG G+ AR  T+A IMT+NP+C K DTSATDAL+ MV +GFRHLPV +E
Sbjct: 132 IFTAKDLAFRVVGAGIKARDITIAEIMTKNPLCAKTDTSATDALDLMVRKGFRHLPVMDE 191

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP Q++QY++ +R K
Sbjct: 192 NHDIAGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQAELGSSQPQQVIQYVEAIRAK 251

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L SVL G  P  V V+TSV++AA+LM+E  TTAVLV +  SI GIFTSKD+VLRV
Sbjct: 252 MSGPTLESVLTGLPPTTVSVRTSVKEAAQLMKENHTTAVLVQDQGSITGIFTSKDVVLRV 311

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IAAGLDP TCSV+RVMTPHPD A    SI  AL+KM+DGHYLNLPV+ + G I+GMVDVL
Sbjct: 312 IAAGLDPGTCSVVRVMTPHPDFAAIDMSIQAALRKMHDGHYLNLPVMSEAGEIVGMVDVL 371

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           KLTYAT++Q+ +M       D  GP WNKFW SL  D ++ES VS               
Sbjct: 372 KLTYATLDQINTMST----GDSEGPAWNKFWLSL--DHESESMVSGDGGSHHPRTEISRS 425

Query: 458 XXXXR--TRGSGNISPIPEIHPSESASAI-----DDGSMASFPRGHDENF-FTFKFKAPN 509
                   R + ++     + P++SAS +     +  ++A+ P    E   F FKFKAP+
Sbjct: 426 HVMSPGLDRHNTHLDRGESVMPNDSASHVGMETPEHSAVAASPALPIEEMPFAFKFKAPS 485

Query: 510 GKSHRF-TVDYTSFEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXX 552
           G++HRF        E   A V  KL S +                  F + Y+       
Sbjct: 486 GRTHRFQATPAAGLEEFIALVIDKLGSEIDAVGGAPTFENGRLSNSGFALSYLDNEGDSV 545

Query: 553 XXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGK 612
                   ++AV +A      +V L +   E   L                +   R+R K
Sbjct: 546 SITTNTDLLEAVSLAHMHHTEKVDLFVHHPEHPPLPGTMNPQGAPATATPPESSVRERKK 605

Query: 613 HAPDYNLP----------------------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +  D +                        +P++LLLPGA++TLA+ I+GVFAL R+
Sbjct: 606 YVDDEDSDEEVERRRRRKQQPAVQEQVIQGVPNELLLPGAIVTLAVVIVGVFALGRA 662



>gi|390604204|gb|EIN13595.1| CBS-domain-containing protein [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 665

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 288/657 (43%), Positives = 385/657 (58%), Gaps = 85/657 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPG-AKGTVASLNPSQALTVR 127
           R++ SK+DEAIR+K+E EL +K RT ST+     + +R  P  AKGTVA+L PS ALTV 
Sbjct: 12  RKKQSKRDEAIRRKIESELARK-RTISTTHTQNQRSRRGKPAVAKGTVAALKPSPALTVP 70

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  +GLD   T V+ IMTR
Sbjct: 71  ENITVSEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVTAEGLDPHITPVSQIMTR 130

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPM  ++ TSAT+AL  MV + FRHLPVCNEEG+VVGLLDITK  +EALDK+ER+  +S+
Sbjct: 131 NPMVTRDTTSATEALQLMVQKHFRHLPVCNEEGNVVGLLDITKVFHEALDKVERSSSASE 190

Query: 248 KLYDALEGVEREW-----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTS 301
           KLY AL GV+ E      +  Q   +L Y++ LREK A PDL++V+D  + PA VG +T+
Sbjct: 191 KLYSALAGVQSELGPGVTANPQTAAMLAYVESLREKTALPDLTTVMDSRTQPATVGPRTT 250

Query: 302 VRDAARLMREYRTTAVLVMEHHS---------IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           V++ A+LM+E R TAV VME  +         IAGIFTSKD+VLRVIAAGL+ + CSV+R
Sbjct: 251 VKEVAKLMKERRVTAVCVMESSTGQGATSPQRIAGIFTSKDVVLRVIAAGLEAARCSVVR 310

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTAPP  S+ DALKKM++GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM  M 
Sbjct: 311 VMTPHPDTAPPTMSVHDALKKMHNGHYLNLPVVETDGRLVAIVDVLKLTYATLEQMNQMT 370

Query: 412 NQENG--NDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNI 469
           ++  G   + GGPMW +F+ S+ ++ D ES +S S                 + +     
Sbjct: 371 SEAAGESENQGGPMWGRFFESIGHE-DTESVLSGSNMPSEPFHTRSSYMNLSQVQQ---- 425

Query: 470 SPIPEIHPSESASAIDDGSMASFPRGH--------------------DENFFTFKFKAPN 509
           SP  E+HP++SAS +DD   AS   G+                    D+  + FKF+ P+
Sbjct: 426 SPFSEVHPNDSASVVDDDGPASVLDGYPKNGRTNVPSIMGAEALVPVDDGTYVFKFRTPS 485

Query: 510 GKSHRFTVDYTSFEHIRATVASKL----------PSN-------VRDFTIYYVXXXXXXX 552
           G++HRF     + E++   V+ KL          P N         DFT++Y        
Sbjct: 486 GRTHRFQARNDNLENLHEIVSGKLAADPFFRDFKPQNEDDPVPDPSDFTVFYTDADGDAV 545

Query: 553 XXXXXXXXIDAVRIAQRQGMSRVILHIQ------------EIEKKSLRXXXXXXXXXXXX 600
                    DAV+IA+  G  RV+L +Q            E  ++               
Sbjct: 546 FMTSDADVTDAVKIARAAGTDRVVLFVQGGKGWADAGASKEKSEEKAAEAAAAVKEEVKQ 605

Query: 601 ILEKRRRRKRGKH-----------APDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
           + +   +   G H           A +  + IP DLLLP ++  LA++II VF LSR
Sbjct: 606 VEKAEAQLPEGVHLAPPTHVHVPPAEELVMGIPKDLLLPASIGALAVSIIAVFTLSR 662



>gi|395334117|gb|EJF66493.1| CBS-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 717

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 297/668 (44%), Positives = 377/668 (56%), Gaps = 99/668 (14%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNR-------GKPQRQVPGAKGTVASLNPS 121
           R++ +K+DEAIRKK+E EL +K RT ST+            KP  Q    KGTVA+L PS
Sbjct: 56  RRKQNKRDEAIRKKIEGELARK-RTISTTGPGAGGGRRRRDKPNVQ----KGTVAALKPS 110

Query: 122 QALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTV 181
            ALTV E+  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  +GLD  TT V
Sbjct: 111 PALTVPENITVSEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVTAEGLDPHTTQV 170

Query: 182 ATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMER 241
           + IMTRNPM  ++ TSAT+AL  MV + FRHLPVCNEEG+VVGLLDITK  +EALDK+ER
Sbjct: 171 SVIMTRNPMVTRDTTSATEALQLMVQKHFRHLPVCNEEGNVVGLLDITKVFHEALDKVER 230

Query: 242 AYGSSKKLYDALEGVEREW-----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAE 295
           +  +S+KLY AL GV+ E      S  Q   +L Y++ LREK A PDL++V+D  + PA 
Sbjct: 231 SSSASEKLYSALAGVQSELGAGLGSNPQAAAMLSYVEALREKTALPDLTTVMDSRTQPAT 290

Query: 296 VGVKTSVRDAARLMREYRTTAVLVMEHHS--------IAGIFTSKDIVLRVIAAGLDPST 347
           VG KT+VR+ A+LM+E RTTAV VME  +        IAGIFTSKDIVLRVIAAGLD + 
Sbjct: 291 VGPKTTVREVAKLMKERRTTAVCVMEPAAPGHTTAAKIAGIFTSKDIVLRVIAAGLDATR 350

Query: 348 CSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQ 406
           CSV+RVMTPHPDTAPP  +I DALKKM+ GHYLNLPVV+  G ++ +VDVLKLTYAT+EQ
Sbjct: 351 CSVVRVMTPHPDTAPPTMTIHDALKKMHIGHYLNLPVVEADGRLVAIVDVLKLTYATLEQ 410

Query: 407 MYSMQNQENGND--GGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
           M +M  +  G +   GGPMW +F+ SL    D ES +S S                 R+ 
Sbjct: 411 MNAMSVEAGGENEPEGGPMWGRFFESLGAGDDTESVLSGS---HYHADSVSHSRKFSRSM 467

Query: 465 GSGNISPIPEIHPSESASAIDD-------------------GSMASFPRGHDENFFTFKF 505
                SP  E+HP++SAS +DD                   G  AS P   D+  + FKF
Sbjct: 468 SHLVQSPHSEVHPNDSASVVDDDQESALAGYGKQDGVPSIVGPPASIP-PVDDGTYVFKF 526

Query: 506 KAPNGKSHRFTVDYTSFEHIRATVASKLPSN-----------------VRDFTIYYVXXX 548
           + P+G++HRF   + + E +R  V  KL ++                   DFT+ Y    
Sbjct: 527 RTPSGRTHRFQARHDNVETLREIVGGKLATDPFFTNYKNEDPNEPPPDPTDFTLSYTDAD 586

Query: 549 XXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ---------------------------- 580
                        DAV+IA+     RV+L IQ                            
Sbjct: 587 GDVVLITSDSDVSDAVKIARAASQDRVVLFIQGGRGWADAMAEKSARQAEAVAAAAAQEV 646

Query: 581 -EIEKKSLR-XXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAI 638
            E+EK  +              +             P+  L IP DLLLP ++  LA  I
Sbjct: 647 KEVEKTEVAPAPTPSVVTPAPSVYAPPPYVPHPPAEPELVLGIPKDLLLPASIGALAAVI 706

Query: 639 IGVFALSR 646
           +GVF +SR
Sbjct: 707 LGVFTISR 714



>gi|409083070|gb|EKM83427.1| hypothetical protein AGABI1DRAFT_81204 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 652

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 285/638 (44%), Positives = 378/638 (59%), Gaps = 68/638 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R++ S++DE IRKK   +L++K    +T  + R K   +   AKGTVA+L P+ ALTV E
Sbjct: 17  RKKQSRRDEVIRKKATSDLSRKRTISTTFQSGRSKRGGKTTAAKGTVAALKPTPALTVPE 76

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  + LD  TT V  IMTRN
Sbjct: 77  NISVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRVTAESLDPHTTPVNQIMTRN 136

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL  MV+R FRHLPVCNE+G+VVGLLDITK  +EALDK+ER+  +S++
Sbjct: 137 PMVTRDTTSATEALQLMVSRHFRHLPVCNEDGNVVGLLDITKVFHEALDKVERSSAASEQ 196

Query: 249 LYDALEGVEREW----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           L++A+ GV+ E     S  Q T +L + + LR+K A PDL++++D  + PA VG KT+VR
Sbjct: 197 LFNAMAGVQTELGAVGSNPQATAMLAWAEKLRQKTALPDLTTIMDSRTDPATVGPKTNVR 256

Query: 304 DAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           + A+LM+E RTTAV V+E   I GIFTSKD+VLRVIAAGLD + CSVIRVMTPHPDTAPP
Sbjct: 257 EVAKLMKERRTTAVCVIEGGRIVGIFTSKDVVLRVIAAGLDANRCSVIRVMTPHPDTAPP 316

Query: 364 QTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDG-GG 421
             ++ DALKKM+ GHYLNLPVV + GS++ +VDVLKLTYAT+EQM  M   E G D  GG
Sbjct: 317 TMTVHDALKKMHIGHYLNLPVVEEDGSLVAVVDVLKLTYATLEQMNVMAGGEAGVDNEGG 376

Query: 422 PMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESA 481
           PMW +F++S  ++ D+ S VS S A               +       SP  ++HP++SA
Sbjct: 377 PMWGRFFDSFGHE-DDGSMVSGSHAASRSHFSAGDLSHIQQ-------SPPFDLHPNDSA 428

Query: 482 SAIDDGSMA------------SFPRGH-----DENFFTFKFKAPNGKSHRFTVDYTSFEH 524
           S +DD   A            S P G      D+  + FKF+ P+G++HRF   +    H
Sbjct: 429 SVMDDDDHASALSGFARKKGVSIPSGPALIPVDDGTYVFKFRTPSGRTHRFQSRHDDVAH 488

Query: 525 IRATVASKL-----------------PSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIA 567
           +R  VA KL                 P++  DF + Y                 DAV+IA
Sbjct: 489 LREIVAGKLATDPFFTELQLEQDGGPPADPNDFHLSYTDADGDTVLITSDDDVTDAVKIA 548

Query: 568 QRQGMSRVILHIQ-------------EIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHA 614
           +  G+ RV+L++Q             E + K L             I    ++      A
Sbjct: 549 RTAGLDRVVLYVQGGKGWKDVKAETGEEKVKDLPQPTKVEEQVEKTIAPPEKQAPPPPPA 608

Query: 615 PDYN------LPIPHDLLLPGAVLTLAIAIIGVFALSR 646
                       +P DLLLP ++  LA+ IIGVFA+SR
Sbjct: 609 AAAPPAPEQVFGLPKDLLLPASIGALAVVIIGVFAISR 646



>gi|302503214|ref|XP_003013567.1| hypothetical protein ARB_00014 [Arthroderma benhamiae CBS 112371]
 gi|291177132|gb|EFE32927.1| hypothetical protein ARB_00014 [Arthroderma benhamiae CBS 112371]
          Length = 648

 Score =  483 bits (1242), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 282/658 (42%), Positives = 377/658 (57%), Gaps = 80/658 (12%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PRK   P  P+ A                +RQ+ SK+DEAIR+K+E +L+KK    S + 
Sbjct: 17  PRKVEHPIPPSVASDIGGSSTLST-----SRQKQSKRDEAIRRKMEADLSKKKFNPSKAR 71

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
           + R  P        GTV +L PSQAL ++ +  V EA+QLMAAKR DCVLV D ++ ++G
Sbjct: 72  HTRKAP-------PGTVLALKPSQALQIKPNTTVSEAAQLMAAKREDCVLVTDDDDRIAG 124

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLA+RVVG G+ AR  T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 125 IFTAKDLAYRVVGAGIRARDVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 184

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR K
Sbjct: 185 NQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSSQPQQIIQYVEALRSK 244

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L SVL+G  P  V V+TSV++AA LM+E  TTA+LV +  SI GIFTSKD+VLRV
Sbjct: 245 MSGPTLESVLNGLPPTTVSVRTSVKEAATLMKENHTTALLVQDQGSITGIFTSKDVVLRV 304

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IA GLDPSTCSV+RVMTPHPD AP   +I  AL+KM+DGHYLNLPV+ + G I+GMVDVL
Sbjct: 305 IAPGLDPSTCSVVRVMTPHPDFAPTDMTIQAALRKMHDGHYLNLPVMNESGEIVGMVDVL 364

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXX---- 453
           KLTYAT+EQ+ ++Q     N+  GP WNKFW S+ N+ D  S VS S             
Sbjct: 365 KLTYATLEQINTIQT----NESEGPAWNKFWLSMDNESD--SMVSGSQPHHRSLLSPDHR 418

Query: 454 ----XXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPN 509
                        +   G  +P+ E+    SA    D S            F FKFKAP+
Sbjct: 419 GHTGDSVLPNDSASHHGGEEAPVSEVQERPSAEEKLDPS------------FPFKFKAPS 466

Query: 510 GKSHRFTVDYTS-FEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXX 552
           G+ HR  VD ++    +   V++KL + V                  F + Y+       
Sbjct: 467 GRVHRLHVDPSAGIAELVQNVSAKLGAEVDTIGGQAVVEDGKLSNTGFAMSYLDSEGDTV 526

Query: 553 XXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSL----------RXXXXXXXXXXXXIL 602
                   +DA+ IA++    +V L +   +   +                         
Sbjct: 527 SITADQDLVDAISIARKASQDKVDLFVHSPDSTPIVAKEPEPAAAAKAASPPESVTVAAE 586

Query: 603 EKRRRRKRGKHAP------------DYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
           E+   R+    +P            D  L   IP++L+LPGA++TLA  I+GVF LSR
Sbjct: 587 EETAHREESTSSPKSVAQSLVQPSTDQQLINGIPNELILPGAIVTLAAVIVGVFVLSR 644



>gi|500253651|gb|EON97320.1| putative mitochondrial ribosomal protein subunit s4 protein
           [Togninia minima UCRPA7]
          Length = 678

 Score =  482 bits (1241), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 286/637 (44%), Positives = 381/637 (59%), Gaps = 75/637 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E++L+KK       L +R +  R+ P   GTV +L PSQAL ++
Sbjct: 55  SRQKQSKRDEAIRRKMENDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSQALQIK 107

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A + T+A IMT+
Sbjct: 108 PQTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKATSVTIAEIMTK 167

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 168 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASSR 227

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +L+DALEGV+ E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 228 RLHDALEGVQSELGASQPQQIIQYVEALRSKMSGPTLESVLNGMPPTTVSVRTSVKEAAQ 287

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E+ TTAVLV +H +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 288 LMKEHHTTAVLVQDHDAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 347

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ +M      +D  GP WNK
Sbjct: 348 QAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINTM----GSSDSEGPAWNK 403

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AI 484
           FW SL  D + ES VS   +                TR   N S    + P +SAS   I
Sbjct: 404 FWLSL--DHETESMVSGDGSHHHTNMGSRSLMSPDITRERVNDS----VAPGDSASHAGI 457

Query: 485 DDGS---MASFPR-GHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR- 538
           +  +   +A  P     E  F FKFKAP+G+ HR  V      E   A V +KL S V  
Sbjct: 458 ESPAHSVVAGTPELPPSEIPFPFKFKAPSGRVHRLQVTAAQGIEAFVANVTAKLGSEVEA 517

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           + + Y+               ++A+ +A++    +V L + + E
Sbjct: 518 IGGAPTVEDGKLSGAGYALSYLDDEGDSVSITTDHDLLEAIILARQNRRDKVDLFVHDPE 577

Query: 584 KKSLRXXX--------XXXXXXXXXILEKRRR-----------------------RKRGK 612
           +  +                     +L +RRR                       R R  
Sbjct: 578 QPPITVAAPQPALPVEAVPTPPASSVLRERRRGYDGEDDSEEDEEENESTIRRSRRTRTA 637

Query: 613 HAPDYNLPI---PHDLLLPGAVLTLAIAIIGVFALSR 646
            AP     I   P++LLLPGA++TLA+ IIGVF +SR
Sbjct: 638 TAPTQEQVIAGVPNELLLPGAIVTLAVVIIGVFTISR 674



>gi|299755073|ref|XP_001828409.2| CBS and PB1 domain-containing protein [Coprinopsis cinerea
           okayama7#130]
 gi|298411057|gb|EAU93401.2| CBS and PB1 domain-containing protein [Coprinopsis cinerea
           okayama7#130]
          Length = 719

 Score =  482 bits (1241), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 299/658 (45%), Positives = 385/658 (58%), Gaps = 98/658 (14%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKST------SLNNRGKPQRQVPGAKGTVASLNPSQ 122
           R++ +++DEAIRKK+E EL +K RT ST      S + RGK     P  KGTVA+L PS 
Sbjct: 73  RKKTNRRDEAIRKKIESELARK-RTISTHQPQPPSRSRRGK---NAP-TKGTVAALKPSP 127

Query: 123 ALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVA 182
           ALTV E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD  +T VA
Sbjct: 128 ALTVPENITVAEASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAYRVTAEGLDPHSTPVA 187

Query: 183 TIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERA 242
            IMTRNPM  ++ TSAT+AL  MV+R FRHLPVCNE+G+VVGLLDITK  +EAL K+ER+
Sbjct: 188 QIMTRNPMVTRDTTSATEALQLMVSRHFRHLPVCNEDGNVVGLLDITKVFHEALGKVERS 247

Query: 243 YGSSKKLYDALEGVEREW----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVG 297
             +S++L++A+ GV+ E     S  Q   +L + + LREK A PDL++V+D  + PA VG
Sbjct: 248 SAASEQLFNAMAGVQSELGGVGSNPQAAAMLAWAEKLREKTALPDLTTVMDSRTHPATVG 307

Query: 298 VKTSVRDAARLMREYRTTAVLVME-------HHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
            KT+VRD A+LM+E RTTAV VME       H  IAGIFTSKD+VLRVIAAGLD   CSV
Sbjct: 308 PKTTVRDVAKLMKERRTTAVCVMEPPGPGTPHPRIAGIFTSKDVVLRVIAAGLDAGRCSV 367

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYS 409
           +RVMTPHPDTAPP  ++ DALKKM++GHYLNLPVV + G ++ +VDVLKLTYAT+EQM +
Sbjct: 368 VRVMTPHPDTAPPTMTVHDALKKMHNGHYLNLPVVEEDGRLVAIVDVLKLTYATLEQMNA 427

Query: 410 MQNQENGNDG-GGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
           M  +   +D  GGPMW +F++SL  D D ES  S S A                  GS +
Sbjct: 428 MSGEAAASDNEGGPMWGRFFDSLGQD-DTESVFSGSHATGSVLP------------GSMH 474

Query: 469 I--SPIPEIHPSESASAIDD--GSMASFPRGH-------------DENFFTFKFKAPNGK 511
           +  SP  E+HP++SAS +DD  GSM S+ R               D+  + FKF+ P+G+
Sbjct: 475 LAQSPHSEVHPNDSASVVDDDNGSMLSYSRKKGVSVPLGSAPVQPDDGTYVFKFRTPSGR 534

Query: 512 SHRFTVDYTSFEHIRATVASKLP----------------SNVRDFTIYYVXXXXXXXXXX 555
           +HRF   +   + +R  VA KL                  +  DF + Y           
Sbjct: 535 THRFQSRHDDIQLLREIVAGKLAIDPFFTEFTGNPGDEVPDPNDFHLSYTDDDGDSVLMT 594

Query: 556 XXXXXIDAVRIAQRQGMSRVILHI-----------------QEIEKKSLRXXXXXXXXXX 598
                 DAV IA+     RV+L I                 QE+   +L+          
Sbjct: 595 TDSDVADAVTIARNHNQQRVVLFIQGGKGWAEAGDKSEAKAQEVSAAALKEVKEVEKAEE 654

Query: 599 --------XXILEKRRRRKRG-KHAPDYNL-PIPHDLLLPGAVLTLAIAIIGVFALSR 646
                       +      RG  H P   +  IP DLLLP ++  LA+ IIGVF +SR
Sbjct: 655 EAEDTPLVQTPPKATTPPTRGVVHNPQEEVFGIPKDLLLPASIGALAVVIIGVFTISR 712



>gi|70991156|ref|XP_750427.1| CBS and PB1 domain protein [Aspergillus fumigatus Af293]
 gi|66848059|gb|EAL88389.1| CBS and PB1 domain protein [Aspergillus fumigatus Af293]
 gi|159130901|gb|EDP56014.1| CBS and PB1 domain protein [Aspergillus fumigatus A1163]
          Length = 661

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 285/656 (43%), Positives = 381/656 (58%), Gaps = 78/656 (11%)

Query: 38  RPRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTS 97
           RPR  ++ S  TP+                 RQ  SK+DEAIR+K+E +LNKK      +
Sbjct: 35  RPRPETTASTHTPSSDVGSSTMSAASRQ---RQNQSKRDEAIRRKMEADLNKKRHHAPRA 91

Query: 98  LNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLS 157
              R  P        GTV +L PSQAL ++ +  V EA+Q+MAAKR DCVLV D ++ ++
Sbjct: 92  HRTRKAP-------PGTVLALKPSQALQIKPNTTVAEAAQMMAAKREDCVLVTDDDDRIA 144

Query: 158 GIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCN 217
           GIFTAKDLAFRVVG+G  AR  TVA IMT+NP+C + DTSATDAL+ MV +GFRHLPV +
Sbjct: 145 GIFTAKDLAFRVVGNGQKAREITVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD 204

Query: 218 EEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLRE 277
           E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  + QP QI+QY++ LR 
Sbjct: 205 ENQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSTQPQQIIQYVEALRS 264

Query: 278 KMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLR 337
           KM+ P L SVLDG  P  V V+TSVRDAA LM+E+ TTA+LV +  SI GIFTSKDIVLR
Sbjct: 265 KMSGPTLESVLDGLPPTTVSVRTSVRDAATLMKEHHTTALLVQDQGSITGIFTSKDIVLR 324

Query: 338 VIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDV 396
           VIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDV
Sbjct: 325 VIAPGLDPATCSVVRVMTPHPDFAPADMSIQAALRKMHDGHYLNLPVMNETGEIVGMVDV 384

Query: 397 LKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           LKLTYAT+EQ+ SMQ+    +D  GP WNKFW  L+ D +++S VS S            
Sbjct: 385 LKLTYATLEQINSMQS----HDDEGPAWNKFW--LSMDHESDSMVSGS------------ 426

Query: 457 XXXXXRTRGSGNISP------IPEIHPSESASAIDDGSMASFPRGHDENF----FTFKFK 506
                +      +SP      +  + P+ESAS      ++ +   H  +     F FKFK
Sbjct: 427 ----HQAPNRSVLSPESPRHGVDSVLPNESASHHGGDELSEYHDHHHNHDENTPFPFKFK 482

Query: 507 APNGKSHRFTVDYTS-FEHIRATVASKLPSNVR----------------DFTIYYVXXXX 549
           AP+G+ HR  V  ++    + A V +KL + +                  + + Y+    
Sbjct: 483 APSGRVHRVNVVTSAGVADLVAQVTAKLGNELEAVGGGATVEEGKLSNTGYALSYLDNEG 542

Query: 550 XXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRK 609
                       DAV +A+R    +V L + +  +  +             + EK     
Sbjct: 543 DTVSITTDQDLADAVSLARRSHRDKVDLFVHDPSQPPIPATLDPQPAPAKVVEEKSSVVA 602

Query: 610 RGKHAPDYNLP------------------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
             + + +  +P                  +P++LLLPGA++TLA  I GVF L R+
Sbjct: 603 EERLSEEPLIPKARQLYPTRPAEEQFIAGVPNELLLPGAIVTLAAVIAGVFILGRA 658



>gi|396483815|ref|XP_003841796.1| similar to CBS and PB1 domain containing protein [Leptosphaeria
           maculans JN3]
 gi|312218371|emb|CBX98317.1| similar to CBS and PB1 domain containing protein [Leptosphaeria
           maculans JN3]
          Length = 666

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 275/624 (44%), Positives = 374/624 (59%), Gaps = 57/624 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R +MSK+D+AIR+K+E +LNKK      S + R +P ++ P   GTV +L PS AL ++
Sbjct: 53  SRAKMSKRDDAIRRKIETDLNKKK-----SQSGRVRPSKKAP--PGTVLALKPSPALQIK 105

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+  IMT+
Sbjct: 106 PNTTVAEAAQLMAAKREDCVLVTDEDDRIAGIFTAKDLAFRVVGAGIKARDVTIEEIMTK 165

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 166 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSSR 225

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+ Y++ +R+KM+ P L SVL G  P  V V+TSV++AA 
Sbjct: 226 KLYDALEGVQAEMGSSQPQQIISYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVKEAAA 285

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  SI GIFTSKD+VLRVIAAGLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 286 LMKENHTTAVLVQDQGSITGIFTSKDVVLRVIAAGLDPATCSVVRVMTPHPDFAPMDMSI 345

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+ ++   +N     GP WNK
Sbjct: 346 QSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQINNISTTDN----EGPAWNK 401

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW  L+ D   ES +S                           S +P    S    +   
Sbjct: 402 FW--LSMDDGTESMMSGEGGSRVHDHRSVMSHDNRPNLLDRGESVLPGDSASHHGDSPSH 459

Query: 487 GSMASFPRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVRD----- 539
            ++A  P    E+  F FKFKAP+G+ HR  V  ++  E +   VASKL + V       
Sbjct: 460 SAVAGMPPTPLEDLPFPFKFKAPSGRVHRLQVVASAGIEELIQNVASKLGAEVDSIGGCP 519

Query: 540 -----------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSL- 587
                      F + Y+                +A+ ++++    +V L + + EK  + 
Sbjct: 520 TFDGGKISKGGFALSYLDNEGDTVSITTYDDLYEAISLSRQAHREKVDLFVHDPEKPPMA 579

Query: 588 -----RXXXXXXXXXXXXILEKRRR------------RKRGKHAP-------DYNLPIPH 623
                +            +L +R++            R RG++ P       +    +P+
Sbjct: 580 AEVNPQPALAKPATPPDSVLRQRKQFFDEEEEEEAKPRSRGRNQPVPRAEQAEVIPGVPN 639

Query: 624 DLLLPGAVLTLAIAIIGVFALSRS 647
           DLLLPGA+  LA+ I+GVF L RS
Sbjct: 640 DLLLPGAIGVLAVVIVGVFILGRS 663



>gi|189194755|ref|XP_001933716.1| CBS/PB1 domain-containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187979280|gb|EDU45906.1| CBS and PB1 domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 666

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 280/633 (44%), Positives = 379/633 (59%), Gaps = 76/633 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKK-NRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +R +MSK+D+AIR+K+E +LNKK N +    L+ +  P        GTV +L PS AL +
Sbjct: 54  SRAKMSKRDDAIRRKIESDLNKKKNHSGRVRLSKKAPP--------GTVLALKPSPALQI 105

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+  IMT
Sbjct: 106 KPSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKARDVTIEEIMT 165

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 166 KNPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSS 225

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           +KLYDALEGV+ E  ++QP +I+ Y++ +R+KM+ P L SVL G  P  V V+TSVR+AA
Sbjct: 226 RKLYDALEGVQAEMGSSQPAEIINYVEAIRQKMSGPTLESVLTGLPPTTVSVRTSVREAA 285

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
            LM+E+ TTAVLV ++ SI GIFTSKD+VLRVIAAGLDPSTCSV+RVMTPHPD AP   S
Sbjct: 286 ALMKEHHTTAVLVQDNGSITGIFTSKDVVLRVIAAGLDPSTCSVVRVMTPHPDFAPMDMS 345

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT++Q+    N  +  D  GP WN
Sbjct: 346 IQSALRKMHDGHYLNLPVMSDAGEIVGMVDVLKLTYATLDQI----NNISTTDSEGPAWN 401

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP-----IPEIHPSES 480
           KFW SL  D + ES +S                   R+  S N  P        + P+ES
Sbjct: 402 KFWLSL--DNETESMMSGE---------GGSRHPDHRSYVSHNDRPGLMDRGDSVLPNES 450

Query: 481 ASAIDDGS------MASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL 533
           AS     S       ++ P   ++  F FKFKAP+G+ HR  V  +   E + + VA+KL
Sbjct: 451 ASHHGGDSPPQSAVASNHPATMEDMPFPFKFKAPSGRVHRLQVVASHGIEELISNVANKL 510

Query: 534 PSNVR----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
              V                  F + Y+               ++A+ +++     +V L
Sbjct: 511 GGEVEALGGIPTFDEGKISRAGFALSYLDNEGDTISITTHDDLVEAISLSRMAHREKVDL 570

Query: 578 HIQEIEKKSLRXXXXXXXXXXXXI------LEKRRR----------RKRGKH-------A 614
            + + +K  +             +      L +R++          R RG++        
Sbjct: 571 FVHDPDKAPMSAEVNPQPGLPKPVTPPESTLRERKQFFDDEEDETPRSRGRNQPVPLSQQ 630

Query: 615 PDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
           P+    +P+DLLLPGA+  LA+ I+GVF L R+
Sbjct: 631 PEIIAGVPNDLLLPGAIGVLAVVIVGVFVLGRA 663



>gi|320590954|gb|EFX03395.1| cbs and pb1 domain containing protein [Grosmannia clavigera kw1407]
          Length = 692

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 282/648 (43%), Positives = 380/648 (58%), Gaps = 90/648 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +LNKKN+      N +G+  R      GTV +L PS AL ++
Sbjct: 63  SRQKQSKRDEAIRRKLESDLNKKNK------NPQGRAGRSRKAPPGTVLALKPSPALQIK 116

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RVVG G  A + T+A IMT+
Sbjct: 117 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRVVGAGTKANSVTIAEIMTK 176

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 177 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 236

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  T+QP Q++QY++ LR KM+ P L +VL+G  P  V V+TSV++AA+
Sbjct: 237 KLYDALEGVQSELGTSQPQQVIQYVEALRSKMSGPTLETVLNGLPPTTVSVRTSVKEAAQ 296

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 297 LMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMSI 356

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +     D  GP WNK
Sbjct: 357 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMAS----GDSEGPAWNK 412

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP-------IPEIHPSE 479
           FW SL  D + ES VS   +                  GS  +SP       +  + P +
Sbjct: 413 FWLSL--DHETESMVSGDGSHHHTHNTNL---------GSRMMSPELNRHQRVDSVAPGD 461

Query: 480 SASAID-DGSMASF---PRGH---DENFFTFKFKAPNGKSHRFTVDYTSFEHIRA-TVAS 531
           SAS +  +    SF   P       E  F FKFK P+G+ HR  V  T    +    +A+
Sbjct: 462 SASHVGIESPTRSFLAPPTPELPPSETPFPFKFKTPSGRVHRLQVTATHGVAVFVDNLAA 521

Query: 532 KL----------PSNVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSR 574
           KL            +V D       F I Y+               ++A+ +A++    +
Sbjct: 522 KLGLAEVLSIGGKPDVEDGKILGSGFAISYLDDEGDSVSITADQDLLEAILLARQSHQEK 581

Query: 575 VILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKR------------------------ 610
           V L + + EK  +              + +RRR  R                        
Sbjct: 582 VDLFVHDPEKPPMASTPVITLEPAPSSIRERRRGGRSTIDTSDSEEEDDRSHHNKRRHHR 641

Query: 611 ----------GKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
                     G +  +  L   +P+DLLLPGA+++LA+ I+GVF +SR
Sbjct: 642 GGHSQLGGPGGAYGAEEQLIAGVPNDLLLPGAIVSLAVVILGVFTISR 689



>gi|226287801|gb|EEH43314.1| CBS and PB1 domain-containing protein [Paracoccidioides
           brasiliensis Pb18]
          Length = 661

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 280/641 (43%), Positives = 383/641 (59%), Gaps = 77/641 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ +K+DEAIRKK+E +LNKK    + + + R  P        GTV +L PS AL ++
Sbjct: 32  SRQKQTKRDEAIRKKMEADLNKKRHNPTRARHTRKAP-------PGTVMALKPSHALQIK 84

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 85  PNTTVAEAAQLMAAKREDCVLVTDEDERIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTK 144

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 145 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 204

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  +NQP QI+QY++ LR+KM+ P L +VL+G  P  V V+TSVR+AA 
Sbjct: 205 KLYDALEGVQSELGSNQPQQIIQYVEALRQKMSGPTLETVLNGLPPTTVSVRTSVREAAA 264

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKDIVLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 265 LMKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPNTCSVVRVMTPHPDFAPTDMSI 324

Query: 368 LDALKKMY------------DGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQE 414
             AL+KM+            DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +M    
Sbjct: 325 QAALRKMHGAEETGLTISKLDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNTM---- 380

Query: 415 NGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE 474
           + N+  GP WNKFW  L+ D +++S +S S                  +R   ++     
Sbjct: 381 SSNESEGPAWNKFW--LSMDHESDSIISGSHGGHQVSTPIRSVVSPELSR--THVERENS 436

Query: 475 IHPSESASAIDDGSMASF--PR-GHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATV 529
           + P++SAS   D + +    PR  H+E+  F FKFKAP+G+ HR  V  ++    + + V
Sbjct: 437 VLPNDSASHHGDDAASDVLEPRVAHNEDTPFPFKFKAPSGRVHRLHVTPSAGVSDLVSQV 496

Query: 530 ASKLPSNVR----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMS 573
           + KL   V                  + + YV                DAV +++   M 
Sbjct: 497 SLKLGPEVEAVGGYALVEDGKLSNSGYALSYVDNEGDTVSITTDQDLWDAVTLSRSSNMD 556

Query: 574 RVILHIQEIEKK------------------SLR----------XXXXXXXXXXXXILEKR 605
           +V L++ + EK+                  SL+                      + ++ 
Sbjct: 557 KVDLYVHDPEKQPVIATPPPPPVAQQVPSVSLKPATPPGAIEEEEEQSNVGNRSSVTDRS 616

Query: 606 RRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
           +   R   A      +P++L+LPGA++TLA+AI+GVF LSR
Sbjct: 617 QTIVRFPTAEQLINGVPNELILPGAIVTLAVAIVGVFVLSR 657



>gi|302697565|ref|XP_003038461.1| hypothetical protein SCHCODRAFT_46524 [Schizophyllum commune H4-8]
 gi|300112158|gb|EFJ03559.1| hypothetical protein SCHCODRAFT_46524 [Schizophyllum commune H4-8]
          Length = 658

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 283/646 (43%), Positives = 375/646 (58%), Gaps = 77/646 (11%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQR-QVPGAKGTVASLNPSQALTVR 127
           R++ S++DEAIRKK+E EL++K    +T   ++   +R Q    KGTVA+L PS ALTV 
Sbjct: 16  RKKQSRRDEAIRKKIESELSRKRTISTTHQQSKSTSKRKQRSAPKGTVAALKPSPALTVP 75

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD  TT V  IMTR
Sbjct: 76  ENITVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRVTAEGLDPHTTPVHAIMTR 135

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPM  ++ TSAT+AL  MV R FRHLPVCNE+G+VVGLLDI K   EAL K+ER+  +S+
Sbjct: 136 NPMVTRDTTSATEALELMVTRHFRHLPVCNEDGNVVGLLDIAKVFQEALGKVERSSTASE 195

Query: 248 KLYDALEGVEREWS----TNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSV 302
           +L  A+ GV+ E        Q   +L +++ LREK A PDL++++D  ++PA VG KT+V
Sbjct: 196 QLMSAMAGVQSEMGNIGHNPQAAAMLAWVEKLREKTALPDLTTLMDARTLPATVGPKTTV 255

Query: 303 RDAARLMREYRTTAVLVME-----------HHSIAGIFTSKDIVLRVIAAGLDPSTCSVI 351
           RDAARLM+E+RTTAV VME              IAGIFTSKD+VLRV+AAGLD   CSV+
Sbjct: 256 RDAARLMKEHRTTAVCVMEGLPASPGMHPNSAKIAGIFTSKDVVLRVVAAGLDAGRCSVV 315

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQM--Y 408
           RVMTPHPDTAPP  SI DALKKM+ GHYLNLPVV+  G+++ ++DVL LTYAT+EQM   
Sbjct: 316 RVMTPHPDTAPPNMSIHDALKKMHTGHYLNLPVVEADGTLVAIIDVLTLTYATLEQMNAV 375

Query: 409 SMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
           S +     ++ GGPMW +F++S+ N+ D ES +S S                 R+     
Sbjct: 376 SQEAAPAADNEGGPMWGRFFDSIGNE-DTESYISGS--------HGMPEFGSMRSLSQIQ 426

Query: 469 ISPIPEIHPSESASAIDD-----------GSMASFPR-GHDENFFTFKFKAPNGKSHRFT 516
            SP  E+HP++SAS +DD           G+ A  P    D+  + FKF+ P+G++HRF 
Sbjct: 427 QSPHSEVHPNDSASVMDDAPSQISGYNRHGAAAPPPELPVDDGTYVFKFRTPSGRTHRFQ 486

Query: 517 VDYTSFEHIRATVASKLPSNVR----------------DFTIYYVXXXXXXXXXXXXXXX 560
             +   EH+R  V  KL ++                  DF + Y                
Sbjct: 487 SRHDDVEHLREIVMGKLATDPFFTEYRPEDGGPRPDPIDFVLSYTDADGDTVLITSDHDV 546

Query: 561 IDAVRIAQRQGMSRVILHIQ------EIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHA 614
            +AV+IA+  G  RV+L +Q           +                E     K G  A
Sbjct: 547 AEAVKIARETGEDRVVLFVQGGKGWERAAPAAEAKAAEVAEAAHKAKSEVEHSEKVGAEA 606

Query: 615 PDYNLP--------------IPHDLLLPGAVLTLAIAIIGVFALSR 646
           P ++ P              IP DLLLP ++  LA+ I+G+F +SR
Sbjct: 607 PPHHTPAHRGKYDDVDEVMGIPRDLLLPASIGALAVVIVGIFTISR 652



>gi|472585909|gb|EMS23451.1| CBS and PB1 domain containing protein [Rhodosporidium toruloides
           NP11]
          Length = 750

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 296/659 (44%), Positives = 382/659 (57%), Gaps = 80/659 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R+R S++DEAIRKK+E EL +K      S    G   R     +GTV++L P  ALTV  
Sbjct: 87  RKRQSRRDEAIRKKIESELARKRPPSKRSGTTGGTSHRAPKPKQGTVSALRPLPALTVPA 146

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V +ASQL AAKR DCVLV+D  EHL GIFTAKDLAFRVVGDGLD R T V+ IMT N
Sbjct: 147 AMSVADASQLCAAKRTDCVLVVDENEHLCGIFTAKDLAFRVVGDGLDPRNTPVSAIMTPN 206

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL TMV RGFRHLPVCNE+GDVVGLLDITK  +E+L+K+E+AYGSS++
Sbjct: 207 PMVTRDTTSATEALQTMVTRGFRHLPVCNEDGDVVGLLDITKVFHESLEKLEKAYGSSQR 266

Query: 249 LYDALEGVEREWS---TNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRD 304
           LY ALEG + ++    T     +L Y+  LR+KM+ PDL S+LD  +  A VGVKTSVR+
Sbjct: 267 LYSALEGAQEQFGAVDTGAANPLLAYVQALRDKMSFPDLGSILDARTTAATVGVKTSVRE 326

Query: 305 AARLMREYRTTAVLVMEHHS--IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAP 362
           AA+LMRE RTTAV+V+E     IAGIFTSKD+VLRVIAAGLD  TCSV+RVMTPHPD A 
Sbjct: 327 AAKLMREKRTTAVVVVEGDGKKIAGIFTSKDVVLRVIAAGLDSKTCSVVRVMTPHPDVAL 386

Query: 363 PQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGG 421
           P  SI DAL+KM DGHYLNLPVVD  G+++G+VDVLKLTYAT+EQ+ S+  +   +  GG
Sbjct: 387 PSLSIQDALRKMNDGHYLNLPVVDEAGALIGIVDVLKLTYATLEQVNSLHVEGGADAAGG 446

Query: 422 PMWNKFWN----SLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRT---RGSGNI-SPIP 473
           P+W +F++    +  +D D ES VS                   R    R   +I +P  
Sbjct: 447 PLWGRFFSAAAQAAGDDDDTESMVSGVNGSEAASSQAPPFQTPTRPGYHRSKDSIDTPGS 506

Query: 474 EIHPSESASAI-DDGS--MASFPR--GH---------------DENFFTFKFKAPNGKSH 513
           E++P++SAS I DDG+  +A  PR  G                D+  + FKF AP G +H
Sbjct: 507 ELYPNDSASVIHDDGASDLAPAPRRPGQASSVGGASSQALPIVDDGTYLFKFVAPGGTTH 566

Query: 514 RFTVDYTSFEHIRATVASKLPS----------------NVRDFTIYYVXXXXXXXXXXXX 557
           RF   Y S E +   V+ KL S                + +DF+I Y             
Sbjct: 567 RFQARYDSHEFLLDIVSGKLSSDPFFAEQSEDEALPKADPKDFSISYRDDDGDLVLMTAD 626

Query: 558 XXXIDAVRIAQRQGMSRVILHIQ--EIEKKSLRXXXXXXXXXXXXILEKR---------- 605
               DAV+ A++QG  RV+LH+   +  K +L                K+          
Sbjct: 627 RDVTDAVQTAKQQGKDRVVLHVSGGQSWKAALAAKEDAAAAAPAVATTKKLVVVEEGDEE 686

Query: 606 -------------RRRKRGKHAPDYNLPI----PHDLLLPGAVLTLAIAIIGVFALSRS 647
                         +RK  K AP  +  +    P + LLP ++  L + I GVF  SR+
Sbjct: 687 RIEEEEQDAAAEPTKRKSSKKAPAGDELVGGVLPKEYLLPASIGFLGVVIAGVFIASRA 745



>gi|302652051|ref|XP_003017887.1| hypothetical protein TRV_08098 [Trichophyton verrucosum HKI 0517]
 gi|291181469|gb|EFE37242.1| hypothetical protein TRV_08098 [Trichophyton verrucosum HKI 0517]
          Length = 648

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 284/654 (43%), Positives = 378/654 (57%), Gaps = 72/654 (11%)

Query: 39  PRKTSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSL 98
           PRK   P  P+ A                +RQ+ SK+DEAIR+K+E +L+KK    S + 
Sbjct: 17  PRKVEHPIPPSVASDIGGSSTLST-----SRQKQSKRDEAIRRKMEADLSKKKFNPSKAR 71

Query: 99  NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSG 158
           + R  P        GTV +L PSQAL ++ +  V EA+QLMAAKR DCVLV D ++ ++G
Sbjct: 72  HTRKAP-------PGTVLALKPSQALQIKPNTTVSEAAQLMAAKREDCVLVTDDDDRIAG 124

Query: 159 IFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNE 218
           IFTAKDLA+RVVG G+ AR  T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E
Sbjct: 125 IFTAKDLAYRVVGAGIRARDVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDE 184

Query: 219 EGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREK 278
             D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR K
Sbjct: 185 NQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGVQSELGSSQPQQIIQYVEALRSK 244

Query: 279 MACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
           M+ P L SVL+G  P  V V+TSV++AA LM+E  TTA+LV +  SI GIFTSKD+VLRV
Sbjct: 245 MSGPTLESVLNGLPPTTVSVRTSVKEAATLMKENHTTALLVQDQGSITGIFTSKDVVLRV 304

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVL 397
           IA GLDPSTCSV+RVMTPHPD AP   +I  AL+KM+DGHYLNLPV+ + G I+GMVDVL
Sbjct: 305 IAPGLDPSTCSVVRVMTPHPDFAPTDMTIQAALRKMHDGHYLNLPVMNESGEIVGMVDVL 364

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           KLTYAT+EQ+ ++Q     N+  GP WNKFW S+ N+ D  S VS S             
Sbjct: 365 KLTYATLEQINTIQT----NESEGPAWNKFWLSMDNESD--SMVSGS-------QPHHRS 411

Query: 458 XXXXRTRGSGNISPIPEI----HPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSH 513
                 RG    S +P      H  E A   +     S     D + F FKFKAP+G+ H
Sbjct: 412 LLSPDHRGHTGDSVLPNDSASHHGGEEAPVSEVQERPSVEEKLDPS-FPFKFKAPSGRVH 470

Query: 514 RFTVDYTS-FEHIRATVASKLPSNV----------------RDFTIYYVXXXXXXXXXXX 556
           R  VD ++    +   V++KL + V                  F + Y+           
Sbjct: 471 RLHVDPSAGIAELVQNVSAKLGAEVDTIGGQAVVEDGKLSNTGFAMSYLDSEGDTVSITA 530

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQEIEKKSL----------RXXXXXXXXXXXXILEKRR 606
               +DA+ IA++    +V L +   +   +                         E+  
Sbjct: 531 DQDLVDAISIARKASQDKVDLFVHSPDSTPVVAKEPEPAAAAKAASPPESVTVAAEEETA 590

Query: 607 RRKRGKHAP------------DYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
            R+    +P            D  L   IP++L+LPGA++TLA  I+GVF LSR
Sbjct: 591 HREELASSPKSVAQSLVQPSTDQQLINGIPNELILPGAIVTLAAVIVGVFVLSR 644



>gi|336467143|gb|EGO55307.1| mitochondrial ribosomal protein subunit S4 [Neurospora tetrasperma
           FGSC 2508]
          Length = 687

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 275/636 (43%), Positives = 377/636 (59%), Gaps = 71/636 (11%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIR+K+E +L+KK       L +R +  R+ P   GTV +L PS AL +
Sbjct: 62  VSRQKQSKRDEAIRRKMESDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQI 114

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL A T T+A IMT
Sbjct: 115 KAATTVSEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGGGLKANTVTIAEIMT 174

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 175 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASS 234

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           ++LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA
Sbjct: 235 RRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAA 294

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           +LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   +
Sbjct: 295 QLMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMT 354

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M    +G D  GP WN
Sbjct: 355 IQAALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMG---SGTDNEGPAWN 411

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--A 483
           KFW SL  D + ES VS   +                 R    +     + P +SAS   
Sbjct: 412 KFWLSL--DHETESMVSGDGSLHHTHHGPRSLMSPDIARSERIVD---SVAPGDSASHAG 466

Query: 484 IDDGSMASFPRGHDEN----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR 538
           ++  S +      + N     F FKFKAP+G+ HR  V  +       A VA+KL + V 
Sbjct: 467 VESPSHSQLGGIQEVNPADIPFPFKFKAPSGRVHRLQVTASHGMAEFVAAVAAKLGAEVD 526

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++A+ +A+     +V L + +  
Sbjct: 527 AIGGTPEVENGRLSGGFALSYLDDEGDSVSITTDQDLLEAILLARHGLREKVDLFVHDPS 586

Query: 584 KKSLRXX--------XXXXXXXXXXILEKRRRR-------------------------KR 610
           + ++                     ++ +RR++                          +
Sbjct: 587 EPAISHAPTPAPVIETIPATPPASSVVRERRKKVEEESEEVSEEEEPVHRRPTRTRTMSQ 646

Query: 611 GKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
            +  P     +P++LLLPGA++TLA+ I+ VF +SR
Sbjct: 647 PQEQPRVIAGVPNELLLPGAIVTLAVVIVSVFTVSR 682



>gi|315056125|ref|XP_003177437.1| CBS/PB1 domain-containing protein [Arthroderma gypseum CBS 118893]
 gi|311339283|gb|EFQ98485.1| meiotically up-regulated 70 protein [Arthroderma gypseum CBS
           118893]
          Length = 660

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 278/629 (44%), Positives = 374/629 (59%), Gaps = 75/629 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK    S + + R  P        GTV +L PSQAL ++
Sbjct: 53  SRQKQSKRDEAIRRKMEADLSKKKFNPSKARHTRKAP-------PGTVLALKPSQALQIK 105

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RVVG G+ AR  T+A IMT+
Sbjct: 106 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRVVGAGIRARDVTIAEIMTK 165

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 166 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 225

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 226 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTVSVRTSVKEAAA 285

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDPSTCSV+RVMTPHPD AP   SI
Sbjct: 286 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPSTCSVVRVMTPHPDFAPTDMSI 345

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ ++Q     N+  GP WNK
Sbjct: 346 QAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQINTIQT----NESEGPAWNK 401

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW S+ N+ D  S VS S                   RG    S +P  + S S    +D
Sbjct: 402 FWLSMDNESD--SMVSGS-------QPHHRSLLSPDHRGHAGDSVLP--NDSASHHGGED 450

Query: 487 GSMASFPRGHDENF--------FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV 537
           G ++     H+           F FKFKAP+G+ HR  VD ++    +   V++KL + V
Sbjct: 451 GPVSEL---HERPLVEEKVDPSFPFKFKAPSGRVHRLHVDPSAGIAELVQNVSAKLGAEV 507

Query: 538 ----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+               +DA+ IA++    +V L +  
Sbjct: 508 DTIGGLAVVEDGKLSNNGFAMSYLDSEGDTVSITADQDLVDAISIARKAKSDKVDLFVHS 567

Query: 582 IEK--------------------KSLRXXXXXXXXXXXXILEKRRRRKRGKHAP--DYNL 619
            +                     +S+              +   +   +    P  D  L
Sbjct: 568 PDSTPVVAKEPEPVAAAKVASPAESVTVAAEEENTRREETVSSPKSVAQSLVQPPTDQQL 627

Query: 620 --PIPHDLLLPGAVLTLAIAIIGVFALSR 646
              IP++L+LPGA++TLA  I+GVF LSR
Sbjct: 628 INGIPNELILPGAIVTLAAVIVGVFVLSR 656



>gi|346327044|gb|EGX96640.1| mitochondrial ribosomal protein subunit S4 [Cordyceps militaris
           CM01]
          Length = 687

 Score =  479 bits (1233), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 284/654 (43%), Positives = 375/654 (57%), Gaps = 93/654 (14%)

Query: 68  ARQRMSKKDE----------------------AIRKKVEHELNKKNRTKSTSLNNRGKPQ 105
           +RQ+ SK+DE                      AIR+K+E++L+KK      +L NR +  
Sbjct: 50  SRQKQSKRDEWQPPQNPNRVRNKVADSNPHRQAIRRKIENDLSKKK-----NLTNRARHS 104

Query: 106 RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDL 165
           R+ P   GTV +L PSQAL ++    V EA+QLMAAKR DCVLV D ++ ++GIFTAKDL
Sbjct: 105 RKAP--PGTVMALKPSQALQIKPGTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDL 162

Query: 166 AFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGL 225
           AFRVVG GL + + T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+
Sbjct: 163 AFRVVGAGLKSSSVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGV 222

Query: 226 LDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLS 285
           LDITKC Y+A++K+ERAY SS+KLYDALEGV  E  TNQP QI+QY++ LR KM+ P L 
Sbjct: 223 LDITKCFYDAMEKLERAYSSSRKLYDALEGVHSELGTNQPQQIIQYVEALRSKMSGPTLE 282

Query: 286 SVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDP 345
           +VL+G  P  V V+TSVR+AA LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP
Sbjct: 283 TVLNGIPPTTVSVRTSVREAAALMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDP 342

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATM 404
           + CSV+RVMTPHPD AP   +I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+
Sbjct: 343 TNCSVVRVMTPHPDFAPMDMTIQAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATL 402

Query: 405 EQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
           EQ+ SM       DG GP W+KFW S+ N  + ES +S   +                TR
Sbjct: 403 EQINSMST----GDGEGPAWSKFWLSIEN--ETESMISGDGSQHHNTNLGSRMMTPDVTR 456

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFE 523
                S    + P +SAS +  GS         +  F FKFKAP+ + HR  V  +   E
Sbjct: 457 DRLGDS----VAPGDSASHV--GSQHDLEVPPADVPFPFKFKAPSNRVHRLQVIASQGIE 510

Query: 524 HIRATVASKLPSNVRD----------------FTIYYVXXXXXXXXXXXXXXXIDAVRIA 567
              A VASKL + V                  F + Y+               ++A+ +A
Sbjct: 511 IFVAAVASKLGNEVESVGGVPTAEDGKLGNTGFAVSYMDDEGDTVSITTDNDLLEAILLA 570

Query: 568 QRQGMSRVILHIQEIEKK-------SLRXXXXXXXXXXXXILEKRR-------------- 606
           ++    +V L + + EK                       + E+RR              
Sbjct: 571 RQGQRDKVELFVHDPEKPLATPAAVETPVLATPPTSTAPVVRERRRAYDEEEEEEEEDDD 630

Query: 607 ----------RRKRGKHAPDYN---LPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
                     RR R   AP        +P+DLLLPGA++TLA+ I+GVF ++R+
Sbjct: 631 EDGPTPVRRSRRTRNAAAPAQEQLIAGVPNDLLLPGAIVTLAVVIVGVFTIARA 684



>gi|392571726|gb|EIW64898.1| CBS-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 698

 Score =  479 bits (1233), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 286/663 (43%), Positives = 377/663 (56%), Gaps = 99/663 (14%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNN--------RGKPQRQVPGAKGTVASLNPSQALTVRE 128
           +AIRKK+E EL++K    +T +          + KP  Q    KGTVA+L PS ALTV E
Sbjct: 39  QAIRKKIEGELSRKRTISTTQMQGGGGGGRRRKDKPNVQ----KGTVAALKPSPALTVPE 94

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  +GLD   T V+TIMTRN
Sbjct: 95  NITVSEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVSAEGLDPHITPVSTIMTRN 154

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL  MV + FRHLPVCNEEG+VVGLLDITK  +EALDK+ER+  +S+K
Sbjct: 155 PMVTRDTTSATEALQLMVTKHFRHLPVCNEEGNVVGLLDITKVFHEALDKVERSSSASEK 214

Query: 249 LYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSV 302
           LY AL GV+ E  +      Q   +L Y++ LREK A PDL++++D  + PA VG KT+V
Sbjct: 215 LYSALAGVQSELGSGLGANPQAAAMLSYVEALREKTALPDLTTIMDSRTQPATVGPKTTV 274

Query: 303 RDAARLMREYRTTAVLVMEHHS--------IAGIFTSKDIVLRVIAAGLDPSTCSVIRVM 354
           R+ A+LM+E RTTAV VME  +        IAGIFTSKDIVLRVIAAGLD + CSV+RVM
Sbjct: 275 REVAKLMKERRTTAVCVMEPAAPGQPGAAKIAGIFTSKDIVLRVIAAGLDATRCSVVRVM 334

Query: 355 TPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQ 413
           TPHPDTAPP  +I DALKKM++GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM +M  +
Sbjct: 335 TPHPDTAPPTLTIHDALKKMHNGHYLNLPVVEADGRLVAIVDVLKLTYATLEQMNAMSTE 394

Query: 414 ENG--NDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP 471
             G     GGPMW +F++SL  + D ES +S S                 R++     SP
Sbjct: 395 APGEAEAEGGPMWGRFFDSLGANEDTESMLSGS--HYPTTDTHSHQRRFSRSQSHLVASP 452

Query: 472 IPEIHPSESASAIDD---GSMASFPRGHDEN----------------FFTFKFKAPNGKS 512
             E+HP++SAS +DD    ++A +P+  +++                 + FKF+ P+G++
Sbjct: 453 HSEVHPNDSASVVDDDQESALAGYPKNGEQHPSVLGPPVPIPPVDDGTYVFKFRTPSGRT 512

Query: 513 HRFTVDYTSFEHIRATVASKL-----------------PSNVRDFTIYYVXXXXXXXXXX 555
           HRF   + + EH+R  V+ KL                 P +  DFT+ Y           
Sbjct: 513 HRFQARHDNVEHMREIVSGKLATDPFFTGYKTADPSEPPPDPTDFTLSYTDEDGDIVLIT 572

Query: 556 XXXXXIDAVRIAQRQGMSRVILHIQ--------------------------------EIE 583
                 DAV+IA+   + RV+L IQ                                E+E
Sbjct: 573 SDSDVSDAVKIARAAKIDRVVLFIQGGRGWSDVMAEKSAAQAEAVAAAAAQDMKDMKEVE 632

Query: 584 KKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFA 643
           K                              P+  + IP DLLLP ++  LA  I+GVF 
Sbjct: 633 KVEAVVAAPPPPIALPSPYAPPPYAPPPPVEPELVMGIPKDLLLPASIGALAAVILGVFT 692

Query: 644 LSR 646
           +SR
Sbjct: 693 ISR 695



>gi|350288234|gb|EGZ69470.1| hypothetical protein NEUTE2DRAFT_159933 [Neurospora tetrasperma
           FGSC 2509]
          Length = 1132

 Score =  479 bits (1233), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 275/636 (43%), Positives = 377/636 (59%), Gaps = 71/636 (11%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIR+K+E +L+KK       L +R +  R+ P   GTV +L PS AL +
Sbjct: 62  VSRQKQSKRDEAIRRKMESDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQI 114

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL A T T+A IMT
Sbjct: 115 KAATTVSEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGGGLKANTVTIAEIMT 174

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 175 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASS 234

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           ++LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA
Sbjct: 235 RRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAA 294

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           +LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   +
Sbjct: 295 QLMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMT 354

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M    +G D  GP WN
Sbjct: 355 IQAALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMG---SGTDNEGPAWN 411

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--A 483
           KFW SL  D + ES VS   +                 R    +     + P +SAS   
Sbjct: 412 KFWLSL--DHETESMVSGDGSLHHTHHGPRSLMSPDIARSERIVD---SVAPGDSASHAG 466

Query: 484 IDDGSMASFPRGHDEN----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR 538
           ++  S +      + N     F FKFKAP+G+ HR  V  +       A VA+KL + V 
Sbjct: 467 VESPSHSQLGGIQEVNPADIPFPFKFKAPSGRVHRLQVTASHGMAEFVAAVAAKLGAEVD 526

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++A+ +A+     +V L + +  
Sbjct: 527 AIGGTPEVENGRLSGGFALSYLDDEGDSVSITTDQDLLEAILLARHGLREKVDLFVHDPS 586

Query: 584 KKSLRXX--------XXXXXXXXXXILEKRRRR-------------------------KR 610
           + ++                     ++ +RR++                          +
Sbjct: 587 EPAISHAPTPAPVIETIPATPPASSVVRERRKKVEEESEEVSEEEEPVHRRPTRTRTMSQ 646

Query: 611 GKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
            +  P     +P++LLLPGA++TLA+ I+ VF +SR
Sbjct: 647 PQEQPRVIAGVPNELLLPGAIVTLAVVIVSVFTVSR 682



>gi|310791950|gb|EFQ27477.1| hypothetical protein GLRG_01972 [Glomerella graminicola M1.001]
          Length = 682

 Score =  479 bits (1232), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 280/638 (43%), Positives = 376/638 (58%), Gaps = 79/638 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ +K+DEAIRKK+E +L+KK       L +R +  R+ P   GTV +L PSQAL ++
Sbjct: 61  SRQKQTKRDEAIRKKMESDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSQALQIK 113

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G      T+A IMT+
Sbjct: 114 PGTSVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKPSHITIAEIMTK 173

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 174 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 233

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSVR+AA+
Sbjct: 234 RLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLDGRPPTTVSVRTSVREAAQ 293

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M++ RTTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 294 MMKDNRTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 353

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M      +D  GP WNK
Sbjct: 354 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMST----SDSEGPAWNK 409

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL +  ++  +   S                 R R   +++      P +SAS +  
Sbjct: 410 FWLSLDDGTESMMSGEGSHTHHTNLGSRIMSPDISRERIGDSVA------PGDSASHV-- 461

Query: 487 GSMASFPR----GHD-------ENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLP 534
             + S PR    GH        E  F FKFKAP+G+ HR  V  +     +   V SKL 
Sbjct: 462 -GLESPPRSAITGHSPVHQSPAELPFPFKFKAPSGRVHRLQVIASQGIAAMVTNVISKLG 520

Query: 535 SNVRD---------------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
           S V                 F + Y+               ++++ +A++    +V L +
Sbjct: 521 SEVDSIGGAPTVEEGRISGGFALSYLDDEGDSVSITTDNDLLESILLARQGHREKVDLFV 580

Query: 580 QEIEKKSLRXXXXXXXXXX------XXILEKRRRR------------------------K 609
            + EK  +                     + RRRR                         
Sbjct: 581 HDPEKPPVSAAPPTIEPVALPTPPISATPDLRRRRAYDDEDDEAEDEDDDVSHVRRSRRA 640

Query: 610 RGKHAPDYNLP-IPHDLLLPGAVLTLAIAIIGVFALSR 646
           R    P+  +  +P++LLLPGA++TLA+ I+GVF +SR
Sbjct: 641 RHAAEPEQVIAGVPNELLLPGAIVTLAVVIVGVFTISR 678



>gi|345568238|gb|EGX51135.1| hypothetical protein AOL_s00054g511 [Arthrobotrys oligospora ATCC
           24927]
          Length = 637

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 287/627 (45%), Positives = 376/627 (59%), Gaps = 67/627 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R  K+DEAIR+K+E +L KK   + +S  +RG  ++  PG   TV +L P QAL ++
Sbjct: 28  SRRRQIKRDEAIRRKMEQDLGKKK--QQSSARSRGS-RKATPG---TVMALKPGQALQIK 81

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+Q+MAAKR DCVLV D ++ ++GIFTAKDLAFRVVG  +DAR   VA IMT+
Sbjct: 82  PHVTVAEAAQMMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGGAIDARDVAVADIMTK 141

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC YEA++K+ER+Y  S+
Sbjct: 142 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYEAMEKLERSYSMSR 201

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E    QPTQI+QY++ LR KMA P L +VL G  P  V V+TSVR+AA 
Sbjct: 202 KLYDALEGVQ-ELGGAQPTQIIQYVEALRSKMAGPTLETVLSGVPPTTVNVRTSVREAAA 260

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD A    SI
Sbjct: 261 LMKENHTTAVLVQDQGNITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFASMDLSI 320

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +MQ  +N     GP WNK
Sbjct: 321 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINTMQTPDN----EGPAWNK 376

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW S+ ND ++  + S S                 +    G  S    + P++SAS   D
Sbjct: 377 FWLSMDNDSESVVSDSVSHHMSMMGSESPSMLRHPQYERPGT-SHSHSVLPNDSASHAGD 435

Query: 487 GS------------MASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKL 533
            S            M S      EN FTFKFKAP+G+ HRF V     F  + ATV+ KL
Sbjct: 436 DSPPHSQVMLTPSQMPSL----SENPFTFKFKAPSGRVHRFAVIPSAGFAGLVATVSQKL 491

Query: 534 ---------PSNVRD--------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVI 576
                    P+ V +        F I Y+                 A+ +A+RQG  +V 
Sbjct: 492 GGEVSQVGGPTTVTEDGQLDKQGFAISYLDDEMDPVSITTDHDLSHAISLARRQGKDKVD 551

Query: 577 LHIQEIEKKSLRXXX-------------XXXXXXXXXILEKRRRRK---RGKHAPDYNLP 620
           +++ + +                              +L+ +R+ +     +H P     
Sbjct: 552 IYVHDADHPPNIEIPLPPPPPPPPAPVDTEKLDAAEEVLKLQRQAELLSEKQHIPG---- 607

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P+DLLLPGAV TLA+AII VF  SRS
Sbjct: 608 VPNDLLLPGAVATLAVAIIIVFVFSRS 634



>gi|327357586|gb|EGE86443.1| CBS and PB1 domain-containing protein [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 663

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 281/627 (44%), Positives = 375/627 (59%), Gaps = 67/627 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DE   KK+E +LNKK          R +  R+ P   GTV +L PSQAL ++
Sbjct: 54  SRQKQSKRDE---KKMEADLNKKRHGNPA----RSRHSRKPP--PGTVMALKPSQALQIK 104

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 105 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTK 164

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 165 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 224

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  +NQP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSVR+AA 
Sbjct: 225 KLYDALEGVQSELGSNQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVREAAA 284

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 285 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPNTCSVVRVMTPHPDFAPTDMSI 344

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ +M      N+  GP WNK
Sbjct: 345 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNTMST----NESEGPAWNK 400

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW S+ N+ D  S VS S                 R+ G    S    + P+ESAS   D
Sbjct: 401 FWLSMDNESD--SMVSGS-HQPHTSHRSVMSPDMSRSHGDRENS----VLPNESASHHGD 453

Query: 487 GSMASFPRGHD----ENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR--- 538
            +++           +  F FKFKAP+G+ HR  V  ++    + + V+ KL + V    
Sbjct: 454 EAVSDILGARSVHNVDTPFPFKFKAPSGRVHRLHVTPSAGVADLVSQVSLKLGAEVEAVG 513

Query: 539 -------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK 585
                         + + Y+                DA+ +A+R    +V L + + EK+
Sbjct: 514 GQAAVEDGKMSHTGYALSYLDSEGDTVSITTDQDLFDAITLARRASQDKVDLFVHDPEKQ 573

Query: 586 S------------------------LRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNL-P 620
                                    LR              EK +   R   A    +  
Sbjct: 574 PIITPPPAPEPQPPVAKSATPAGSVLRSTTGEDDEPSISEREKPQTLVRPPTAEQQLING 633

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P++L+LPGA++TLA+AI+GVF LSR+
Sbjct: 634 VPNELILPGAIVTLAVAIVGVFILSRA 660



>gi|389751715|gb|EIM92788.1| CBS-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 668

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 292/670 (43%), Positives = 391/670 (58%), Gaps = 107/670 (15%)

Query: 68  ARQRMSKK---DEAIRKKVEHELNKKNRTKSTSLNN----------RGKPQRQVPGAKGT 114
           +R++++K+   DEA+RK++E+EL++K RT ST+ NN          RGKP      AKGT
Sbjct: 11  SRKKLNKRAMGDEALRKRIENELSRK-RTISTTYNNSLPPPAGGRRRGKPS----AAKGT 65

Query: 115 VASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGL 174
           VA+L PS ALTV E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+R+  +G+
Sbjct: 66  VAALKPSPALTVPETITVAEASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAYRITAEGV 125

Query: 175 DARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYE 234
           D   T V+ +MTRNPM  ++ TSAT+AL  MV R FRHLPVCNEEG+VVGLLDITK  ++
Sbjct: 126 DPHVTAVSQVMTRNPMVTRDTTSATEALQLMVTRNFRHLPVCNEEGNVVGLLDITKVFHD 185

Query: 235 ALDKMERAYGSSKKLYDALEGVEREW----STN-QPTQILQYMDMLREKMACPDLSSVLD 289
           ALDK+ER+  +S+KLY AL GV+ E     +TN Q   +L Y+D LREK A PDL++V+D
Sbjct: 186 ALDKVERSSSASEKLYSALAGVQTELGGGIATNPQAAAMLAYVDALREKTALPDLTTVMD 245

Query: 290 G-SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS-------IAGIFTSKDIVLRVIAA 341
             + PA VG KT+V++ A+LM+E RTTAV VME  +       +AGIFTSKD+VLRVIAA
Sbjct: 246 SRTQPATVGPKTTVKEVAKLMKERRTTAVCVMEGTTGINNVPRVAGIFTSKDVVLRVIAA 305

Query: 342 GLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLT 400
           GLD S CSV+RVMTPHPDTAPP   + DALKKM++GHYLNLPV++  G ++ +VDVLKLT
Sbjct: 306 GLDASRCSVVRVMTPHPDTAPPTMFVHDALKKMHNGHYLNLPVLEADGRLVAIVDVLKLT 365

Query: 401 YATMEQMYSMQNQENGNDG----GGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           YAT+EQM +M  +  G       GGPMW +F++S+ +D D ES +S S            
Sbjct: 366 YATLEQMNTMTAESAGETAGETEGGPMWGRFFDSIGHD-DTESVMSGS----------HL 414

Query: 457 XXXXXRTRGSGNI--SPIPEIHPSESASAIDDGSMASFPRGH-------------DENFF 501
                 T  S  I  SP  E+HP++SAS +D+    S   GH             D+  +
Sbjct: 415 PSEFRDTSFSSQIQQSPHSEVHPNDSASVVDEDPHGSVINGHKGAPSITGAVPAVDDGTY 474

Query: 502 TFKFKAPNGKSHRFTVDYTSFEHIRATVASKL----------PSNVR-------DFTIYY 544
            FKF+ P+G +HRF   + + E++R  V+ KL          P N         DF + Y
Sbjct: 475 VFKFRTPSGNTHRFQARHDNVENLRDIVSGKLSVDPFFASFRPENEDDPIPDPLDFQLAY 534

Query: 545 VXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE----IEKKSLRXXXXXXXXXXXX 600
                            D+V+ A++    RV++ IQ      E  + +            
Sbjct: 535 TDADGDTVLMTSDNDVSDSVKNARQTHADRVVIIIQGGKGWAEAGAGKSEAKAQEASAKA 594

Query: 601 ILEKRRRRKR------GKHAP-----DYNLP-------------IPHDLLLPGAVLTLAI 636
             E R   K       G + P      Y+ P             IP D++LP ++  LA+
Sbjct: 595 AKEIREVEKTESTPVGGGNVPLPEGVAYSAPTPAHVIPQDEIFGIPRDMVLPASIGALAV 654

Query: 637 AIIGVFALSR 646
            I+ VF +SR
Sbjct: 655 VILSVFTISR 664



>gi|347835680|emb|CCD50252.1| similar to CBS and PB1 domain-containing protein [Botryotinia
           fuckeliana T4]
          Length = 716

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 279/627 (44%), Positives = 373/627 (59%), Gaps = 76/627 (12%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIR+K+E +L+KK++T       R +  R+ P   GTV +L PSQAL ++ +  V EA+
Sbjct: 107 QAIRRKIETDLSKKSKT-----TGRARQTRKAP--PGTVLALRPSQALQIKPNTTVAEAA 159

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A   T+A IMT+NP+C + DT
Sbjct: 160 QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKAANITIAEIMTKNPLCARTDT 219

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV
Sbjct: 220 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGV 279

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA LM+E  TTA
Sbjct: 280 QSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVTVRTSVKEAAALMKENHTTA 339

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  SI GIFTSKD+VLRVIA GLDPS CSV+RVMTPHPD AP   +I  AL+KM+D
Sbjct: 340 VLVQDGGSITGIFTSKDVVLRVIAPGLDPSNCSVVRVMTPHPDFAPMDMTIQAALRKMHD 399

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +MQ    G    GP WNKFW SL +  
Sbjct: 400 GHYLNLPVMNDQGEIVGMVDVLKLTYATLEQINTMQ---TGESDSGPAWNKFWMSLEH-- 454

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE------IHPSESAS--AIDDG 487
           DNES +S                   R+  S +IS   E      + P++SAS   +D  
Sbjct: 455 DNESMISGE--------GSHHHTTGGRSLMSPDISRSHERQVDASVAPNDSASHVGVDSP 506

Query: 488 SMASFPRGHD---ENF-FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNV----- 537
           S +   R +D   E+  F FKFKAP+G+ HR  V  +     + + V  KL S +     
Sbjct: 507 SHSHLSRHNDIPPEDVPFAFKFKAPSGRVHRVQVTASHGLAELISAVTGKLGSEIDAVGG 566

Query: 538 -----------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKS 586
                        F + Y+               ++A+ +A+     +V L + + EK  
Sbjct: 567 VASVEDGKIGSSGFALSYLDDEGDSVSITTDEDLLEAIVLARSGHRDKVDLFVHDPEKPP 626

Query: 587 LRXXXXXXXXXXXXILEK-----RRRRKRGKHAPDYNLP--------------------- 620
           +                      RRRR         + P                     
Sbjct: 627 MAATLDPQPPIIQIATPPASSTIRRRRVVDSDDESDDEPRVKSKSRKAAAPPPAAEVIQG 686

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +P++LLLPGA++TLA+ I+GVFAL+R+
Sbjct: 687 VPNELLLPGAIVTLAVVIVGVFALTRA 713



>gi|403415486|emb|CCM02186.1| predicted protein [Fibroporia radiculosa]
          Length = 663

 Score =  475 bits (1223), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 294/657 (44%), Positives = 384/657 (58%), Gaps = 87/657 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGA-KGTVASLNPSQALTVR 127
           R++ SK+DEAIRKK+E EL++K RT ST+ +   + +   P   KGTVA+L PS ALTV 
Sbjct: 12  RKKQSKRDEAIRKKIESELSRK-RTISTTQHTPSRRRGHKPNVQKGTVAALKPSPALTVP 70

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  DGLD  TT V+TIMTR
Sbjct: 71  ENITVAEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVTADGLDPHTTPVSTIMTR 130

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           +PM  ++ TSAT+AL  MV R FRHLPVCNEEG+VVGLLDITK  +EALDK+ER+  +S+
Sbjct: 131 SPMVTRDTTSATEALQLMVQRHFRHLPVCNEEGNVVGLLDITKVFHEALDKVERSSSASE 190

Query: 248 KLYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTS 301
           KLY AL GV+ E  T      Q   +L Y++ LREK A PDL++V+D  + PA V  KT+
Sbjct: 191 KLYSALAGVQSELGTGMGANPQAAAMLSYVEALREKTALPDLTTVMDSRTQPATVSPKTT 250

Query: 302 VRDAARLMREYRTTAVLVMEHHS------------IAGIFTSKDIVLRVIAAGLDPSTCS 349
           VR+ A+LM+E RTTAV VME+ S            IAGIFTSKDIVLRVIAAGLD + CS
Sbjct: 251 VREVAKLMKERRTTAVCVMENISHPPGTVGAELPRIAGIFTSKDIVLRVIAAGLDATRCS 310

Query: 350 VIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMY 408
           V+RVMTPHPDTAPP  +  DALKKM++GHYLNLPVV+  G ++ +VDVLKLTYAT+EQM 
Sbjct: 311 VVRVMTPHPDTAPPTMTCHDALKKMHNGHYLNLPVVETDGRLVAIVDVLKLTYATLEQMN 370

Query: 409 SM--QNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
           ++  +N +     GGPMW +F+ SL  D D ES +S S                 R+   
Sbjct: 371 TITAENADANEAEGGPMWGRFFESLGGD-DAESAISGS-----NFTTDLHSRHLSRSVSH 424

Query: 467 GNISPIPEIHPSESA-------SAIDD-------------GSMASFPRGHDENFFTFKFK 506
              SP  E+HP +SA       SA+++             G  A+ P   D+  + FKF+
Sbjct: 425 FVQSPHSEVHPDDSASAIDDDHSALEEYSRRRGEPLPSIVGPTAAVPPV-DDGTYVFKFR 483

Query: 507 APNGKSHRFTVDYTSFEHIRATVASKLPSN-----------------VRDFTIYYVXXXX 549
            P+G++HRF   + + E++R  V  KL ++                   DF + Y     
Sbjct: 484 TPSGRTHRFQARHDNVENLREIVGGKLATDPFFTNYKTSEPSDPPPDPADFLLSYTDADG 543

Query: 550 XXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ-------EIEKKSLRXXXXXXXXXXXXIL 602
                       DAV+IA+  G+ RV+L IQ        I +KS              + 
Sbjct: 544 DIVLITSDTDVTDAVKIARNAGLDRVVLFIQGGKGWADAIAEKSAAQAAEVAAAADRELK 603

Query: 603 EKRRRRKRGKHAPDYNLP-------------IPHDLLLPGAVLTLAIAIIGVFALSR 646
           E  +         + + P             +P DLLLP ++  LA  I+GVF +SR
Sbjct: 604 EVEKTETVPSEPVNVDPPLPVHIAEDEKILGLPKDLLLPASIGALAAVILGVFTISR 660



>gi|512207091|gb|EPE35909.1| CAD & PB1 [Glarea lozoyensis ATCC 20868]
          Length = 680

 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 276/635 (43%), Positives = 370/635 (58%), Gaps = 72/635 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK  T       R +  R+ P   GTV +L PSQAL ++
Sbjct: 59  SRQKQSKRDEAIRRKIETDLSKKKHT-----TGRARQTRKAP--PGTVLALRPSQALQIK 111

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A    ++ IMT+
Sbjct: 112 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKASNVMISEIMTK 171

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 172 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 231

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA 
Sbjct: 232 KLYDALEGVQSELGSTQPQQIIQYVEALRSKMSGPTLESVLDGRPPVTVSVRTSVKEAAA 291

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
            M+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 292 KMKENHTTAVLVQDQDSITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMSI 351

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ +M       D  GP W K
Sbjct: 352 QAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINTMST----GDSEGPAWGK 407

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID- 485
           FW +L N  + ES +S                    +RG      +  + P +SAS +  
Sbjct: 408 FWMALEN--ETESIMSGE-GSHHHTTGGRSLMSPDLSRGHERTVDV-SVAPGDSASHVGM 463

Query: 486 -------DGSMASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNV 537
                      A  P   +E  F FKFKAP+G+ HR  V        +   V SKL S V
Sbjct: 464 DSPSRSVVSRSADVPA--EEVPFPFKFKAPSGRVHRLQVIGAHGLAELITAVISKLGSEV 521

Query: 538 R----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+               ++A+ +A++    +V L + +
Sbjct: 522 EAVGGAATFEDGHLGGSGFALSYLDDDGDTVSITTDQDLLEAILLARQGHRDKVDLFVHD 581

Query: 582 IEKKSLRXX---------XXXXXXXXXXILEKRRR--------------RKRGKHAPDYN 618
            EK  +                      + E++R               R R + A    
Sbjct: 582 PEKAPISATLDPHPVISSQAPSPPPSHTVRERKRVVSDEDDESEEEVHVRSRSRKATAKP 641

Query: 619 LP------IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           +       +P++LLLPGA++TLA+ I+GVFAL+R+
Sbjct: 642 IEAQVIAGVPNELLLPGAIVTLAVVIVGVFALTRA 676



>gi|471910424|emb|CCO27785.1| CBS domain-containing protein CBSCBSPB3 [Rhizoctonia solani AG-1
           IB]
          Length = 546

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 266/540 (49%), Positives = 347/540 (64%), Gaps = 41/540 (7%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R++ +K+DEAIRKK+E EL++K RT ST++    KP +    AKGTVA+L PS ALTV E
Sbjct: 5   RKKQNKRDEAIRKKIEGELSRK-RTISTNVPKSRKPGKST-AAKGTVAALRPSPALTVPE 62

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V +ASQL AAKR DCVLV+D EE LSGIFTAKDLAFRV  +GLD RTT V+ IMTR 
Sbjct: 63  NMTVSDASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAFRVTAEGLDPRTTPVSQIMTRG 122

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ TSAT+AL  MV RGFRHLPVCN+EG+VVGLLDITK  +EAL+K+ER   +S K
Sbjct: 123 PMVTRDTTSATEALQLMVQRGFRHLPVCNDEGNVVGLLDITKVFHEALEKLERGSSASAK 182

Query: 249 LYDALEGVEREW---STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRD 304
           L+ ALEGV+ E    S  Q   ++ Y+  LREK   PDL++V+D  + PA V ++++VR+
Sbjct: 183 LHAALEGVQSELGNSSNPQAMAMMSYVASLREKTTLPDLTTVMDSRTRPATVNIRSNVRE 242

Query: 305 AARLMREYRTTAVLVMEHHS-----IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPD 359
           AA+LM+E RTTAV +ME H      IAGIFTSKD+VLRVIAAGLDP  C+VIRVMTPHPD
Sbjct: 243 AAKLMKENRTTAVCIMEAHQGGPAKIAGIFTSKDVVLRVIAAGLDPDRCTVIRVMTPHPD 302

Query: 360 TAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGND 418
            A P T++ DALKKMY G YLNLPVV+G G ++ +VDVLKLTYAT+EQ+ S+   E   D
Sbjct: 303 VAEPSTTVHDALKKMYVGRYLNLPVVEGDGKLVAIVDVLKLTYATLEQINSLNGGEQTED 362

Query: 419 GGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPS 478
             GPMW +F++S  +  DNES VS S                    G G  SP  E+HP+
Sbjct: 363 -SGPMWGRFFDSFQHGDDNESAVSGSNMPLDTSSSYIDPGRL----GVGGRSPNSEVHPN 417

Query: 479 ESASAIDD-----GSMASFPRGH--DENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVAS 531
           +SAS +++       + + P     D+  + FKF+ P+G++HRF     +FE++R  +A 
Sbjct: 418 DSASVVEEHHHHSSILEAMPAYEPIDDGTYVFKFRTPSGRTHRFQARQDNFENLRDIIAG 477

Query: 532 KLPS-----------------NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSR 574
           KL S                 +  DFT+ Y                +DAV+ A++    R
Sbjct: 478 KLESDPFFEVPEGAPESAPHPDAHDFTMSYTDSDGDTVELTSDSDVVDAVQHARQAKEDR 537



>gi|389643690|ref|XP_003719477.1| mitochondrial ribosomal protein subunit S4 [Magnaporthe oryzae
           70-15]
 gi|351639246|gb|EHA47110.1| mitochondrial ribosomal protein subunit S4 [Magnaporthe oryzae
           70-15]
          Length = 701

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 283/651 (43%), Positives = 369/651 (56%), Gaps = 92/651 (14%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ +K+DEAIR+K+E++L KK       +  R +  R+ P   GTV +L PSQAL ++
Sbjct: 65  SRQKQTKRDEAIRRKMENDLAKKKH-----VTGRARHSRKAP--PGTVLALKPSQALQIK 117

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A   T+A IMT+
Sbjct: 118 PGTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKATNVTIAEIMTK 177

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 178 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 237

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E   +QP QI+QY++ LR KM+ P L SVL+G  P  VGVKTSV++AA+
Sbjct: 238 KLYDALEGVQSELGASQPQQIIQYVEALRTKMSGPTLESVLNGMPPTTVGVKTSVKEAAQ 297

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+E  TTAVLV +   I GIFTSKD+VLRVIA GLDP  CSV+RVMTPHPD AP   SI
Sbjct: 298 MMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAPGLDPGNCSVVRVMTPHPDFAPMDMSI 357

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M + +N     GP WNK
Sbjct: 358 QAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATLEQINTMSSGDNE----GPAWNK 413

Query: 427 FWNSLANDGDNESTVSD----SIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS 482
           FW SL  D + ES VS       +               R R       +  + P +SAS
Sbjct: 414 FWLSL--DNETESMVSGDGSHHHSHSHIHHRSVMSPDLTRER-------LDSVAPGDSAS 464

Query: 483 AIDDGSMASFPRGHDENF------FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL-- 533
                S       H          F FKFKAP+G+ HR  V  +         V SKL  
Sbjct: 465 HAGVESPGHSIVQHSPELPVSEIPFPFKFKAPSGRVHRLQVIASHGVAAFITNVTSKLGG 524

Query: 534 --------PSNVRD------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
                   P    D      F + Y+               ++A+ +A++ G  +V L +
Sbjct: 525 EIEAVGGAPEVTEDGQVRGGFALSYLDNEGDSVSITADQDLLEAILLARQSGRDKVDLFV 584

Query: 580 QEIEK--------------KSLRXXXXXXXXXXXXILEKRRRRK---------------- 609
            + EK               S              +  +RRRRK                
Sbjct: 585 HDPEKPPVAVAAPAAVPPAPSEPVSVPIPTPPASSVARERRRRKSPASDESDEEEESEDD 644

Query: 610 ------------RGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
                       R   A    L   +P++LLLPGA++TLA+ I+GVF +SR
Sbjct: 645 GSSTLRRPRRHQRAAAAQQEPLIAGVPNELLLPGAIVTLAVVIVGVFTISR 695



>gi|121702431|ref|XP_001269480.1| CBS/PB1 domain-containing protein [Aspergillus clavatus NRRL 1]
 gi|119397623|gb|EAW08054.1| CBS and PB1 domain protein [Aspergillus clavatus NRRL 1]
          Length = 587

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 274/604 (45%), Positives = 360/604 (59%), Gaps = 59/604 (9%)

Query: 83  VEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAK 142
           +E +LNKK   ++ +  +R  P        GTV +L PSQAL ++    V EA+QLMAAK
Sbjct: 1   MEADLNKKKHHQTKAHRSRKAP-------PGTVMALKPSQALQIKPGTTVAEAAQLMAAK 53

Query: 143 RADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDAL 202
           R DCVLV D +E ++GIFTAKDLAFRVVG G  AR  TVA IMT+NP+C + DTSATDAL
Sbjct: 54  REDCVLVTDDDERIAGIFTAKDLAFRVVGMGQKARDITVAEIMTKNPLCARTDTSATDAL 113

Query: 203 NTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWST 262
           + MV +GFRHLPV +E  D+ G+LDIT+C Y+A++K+ERAY SS+KLYDALEGV+ E  +
Sbjct: 114 DLMVRKGFRHLPVMDENQDISGILDITRCFYDAMEKLERAYSSSRKLYDALEGVQTELGS 173

Query: 263 NQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEH 322
           +QP QI+QY++ LR KM+ P L +VLDG  P  V V+TSVRDAA LM+E+ TTA+LV + 
Sbjct: 174 SQPQQIIQYVEALRSKMSGPTLETVLDGLPPTTVSVRTSVRDAAALMKEHHTTALLVQDQ 233

Query: 323 HSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNL 382
            SI GIFTSKDIVLRVIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+DGHYLNL
Sbjct: 234 GSITGIFTSKDIVLRVIAPGLDPATCSVVRVMTPHPDFAPTDMSIQAALRKMHDGHYLNL 293

Query: 383 PVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTV 441
           PV+ + G I+GMVDVLKLTYAT+EQ+ SMQ     +D  GP WNKFW S+ N+ D  S V
Sbjct: 294 PVMNEAGEIVGMVDVLKLTYATLEQINSMQT----HDDEGPAWNKFWLSMDNESD--SMV 347

Query: 442 SDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDEN 499
           S S                 R    G  S    + P+ESAS    D+ S    PR  +  
Sbjct: 348 SGS---QRAPNRSVLSPESPRHHLEGRDS----VLPNESASHHGGDEHSEYHEPRPEEST 400

Query: 500 FFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR----------------DFTI 542
            F FKFKAP+G+ HR  V  ++    + A V +KL + +                  + +
Sbjct: 401 SFPFKFKAPSGRMHRVNVLTSAGVADLVAQVTAKLGNELEAVGGAATVEEGKLSDTGYAL 460

Query: 543 YYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXIL 602
            Y+                DAV++A+R    +V L + +  +  +             + 
Sbjct: 461 SYMDNEGDTVSITTDQDLTDAVKLARRSHRDKVDLFLHDPNQPPIPATLDPQPAPARPVQ 520

Query: 603 EKRRRRKRGKHAPDYNLP-------------------IPHDLLLPGAVLTLAIAIIGVFA 643
           EK       + + +  +P                   +P++LLLPGA++TLA  I GVF 
Sbjct: 521 EKPVSVVDDRLSEEPPVPKVRPQAFPARQPEEQFISGVPNELLLPGAIVTLAAVIAGVFV 580

Query: 644 LSRS 647
           L R+
Sbjct: 581 LGRA 584



>gi|340966856|gb|EGS22363.1| putative 40S ribosomal protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 1118

 Score =  473 bits (1216), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 280/622 (45%), Positives = 367/622 (59%), Gaps = 68/622 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R++ SK+DEAIR+K+E +L KK       L  R +  R+ P   GTV +L PSQAL ++
Sbjct: 43  SREKQSKRDEAIRRKMEKDLQKKKH-----LTARTRTTRKAP--PGTVLALKPSQALQIK 95

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A    VA IMT+
Sbjct: 96  PSTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKATNVAVAEIMTK 155

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 156 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYASSR 215

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +LYDALEGV+ E  T+ P  ++QY++ LR KM+ P L S+LDG  P  V V+TSVR+AA+
Sbjct: 216 RLYDALEGVQSELGTSHPQHLIQYVEALRHKMSGPTLESILDGRPPVTVNVRTSVREAAQ 275

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LMRE  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 276 LMRENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 335

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ SM    N  D  GP WNK
Sbjct: 336 QAALRKMHDGHYLNLPVMNDAGEIIGMVDVLKLTYATLEQINSM----NTTDNEGPAWNK 391

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES VS   +                   + +++P      S S + +DD
Sbjct: 392 FWLSL--DHETESMVSGDGSFQHTHHTRSLVSPDMGRHITDSVAP----GDSASRAGLDD 445

Query: 487 GSM----ASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR--- 538
           GS        P G  +  FTFKFKAP+G+ HR  V          A V  KL   V    
Sbjct: 446 GSALGPSPDIPPG--DVPFTFKFKAPSGRVHRLQVIAAHGIAEFVANVVGKLGDEVEAIG 503

Query: 539 ------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI---QEIE 583
                        F + Y+               ++A+  A+     +V L +   +E+ 
Sbjct: 504 GAPMVEEGKVSGGFALSYLDDEGDPVSITTDQDLLEAIITARHGHRDKVDLFVHDPKEMP 563

Query: 584 KKSLRXXXXXXXXXXXXILEKRR--------------------RRKRGK----HAPDYNL 619
            KS              +L +R+                    RR+ G+       +  +
Sbjct: 564 VKSQPVAEPLPTPPESSVLRRRKVVESEDEDEEELSDEEDIPVRRRHGRTRTVQPVEQVI 623

Query: 620 P-IPHDLLLPGAVLTLAIAIIG 640
           P +P++LLLPGA+  LA+AI+G
Sbjct: 624 PGVPNELLLPGAIAMLAVAIVG 645



>gi|340518860|gb|EGR49100.1| predicted protein [Trichoderma reesei QM6a]
          Length = 606

 Score =  473 bits (1216), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 274/624 (43%), Positives = 364/624 (58%), Gaps = 75/624 (12%)

Query: 78  AIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQ 137
           AIR+K+E++L+KK      +L  R +  R+ P   GTV +L PSQAL ++ +  V EA+Q
Sbjct: 1   AIRRKMENDLSKKK-----TLTGRSRQIRRAP--PGTVLALKPSQALQIKPATTVSEAAQ 53

Query: 138 LMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTS 197
           LMAAKR DCVLV D E+ ++GIFTAKDLAFRVVG GL A   T+A IMT+NP+C + DTS
Sbjct: 54  LMAAKREDCVLVTDDEDRIAGIFTAKDLAFRVVGAGLKAANVTIAEIMTKNPLCARTDTS 113

Query: 198 ATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVE 257
           ATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+
Sbjct: 114 ATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQ 173

Query: 258 REWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAV 317
            E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA +M+E  TTAV
Sbjct: 174 SELGASQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAAMMKENHTTAV 233

Query: 318 LVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDG 377
           LV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I  AL+KM+DG
Sbjct: 234 LVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQAALRKMHDG 293

Query: 378 HYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGD 436
           HYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +    ++G GP WNKFW S+  D +
Sbjct: 294 HYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----DNGEGPAWNKFWLSI--DHE 347

Query: 437 NESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGH 496
            ES +S   +                    G+      + P++SAS I    M S PR  
Sbjct: 348 TESMLSGDGSHSHHHHHLGSRMMSPEANRLGD-----SVAPNDSASHI---GMDSPPRSV 399

Query: 497 DENF------FTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNVRD---------- 539
             +       F FKFKAP+G+ HR   V     E     VASKL   V            
Sbjct: 400 APDVTTADVPFAFKFKAPSGRVHRLQVVASQGIEAFVHAVASKLGHEVESIGGMPEVYEG 459

Query: 540 ------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXX 593
                 F + Y+               ++A+ +A++  + +V L + + EK         
Sbjct: 460 RIEGGGFALSYMDNEGDTVSITTDNDLLEAILLARQAHLEKVDLFVHDSEKPPTTPSVDA 519

Query: 594 XXXXXXXILEKRRRRKRGK------------------------------HAPDYNLPIPH 623
                      R RR+                                 H       +P+
Sbjct: 520 LPTPASSSTGLRERRRTTYEEEESESEEEESEEEEERPARRTRRSRTVVHQEQLIAGVPN 579

Query: 624 DLLLPGAVLTLAIAIIGVFALSRS 647
           DLLLPGA++TLA+ IIGVF ++R+
Sbjct: 580 DLLLPGAIVTLAVVIIGVFTIARA 603



>gi|402080513|gb|EJT75658.1| mitochondrial ribosomal protein subunit S4 [Gaeumannomyces graminis
           var. tritici R3-111a-1]
          Length = 705

 Score =  472 bits (1215), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 248/455 (54%), Positives = 314/455 (69%), Gaps = 21/455 (4%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E++L KK       +  R +  R+ P   GTV +L PSQAL ++
Sbjct: 69  SRQKQSKRDEAIRRKMENDLQKKK----VHIPGRARSSRKAP--PGTVLALKPSQALQIK 122

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A   T+A IMT+
Sbjct: 123 PATTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKATNVTIAEIMTK 182

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 183 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 242

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  VGVKTSVR+AA+
Sbjct: 243 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGKPPTTVGVKTSVREAAQ 302

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +MRE  TTAVLV +   I GIFTSKD+VLRVIA GLDP  CSV+RVMTPHPD AP   SI
Sbjct: 303 IMRENHTTAVLVQDQGQITGIFTSKDVVLRVIAPGLDPGNCSVVRVMTPHPDFAPMDMSI 362

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M +     D  GP WNK
Sbjct: 363 QAALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMSS----GDSEGPAWNK 418

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AI 484
           FW SL  D + ES +S   +                TRG      +  + P +SAS    
Sbjct: 419 FWLSL--DNETESVMSGEGSHHPSHMPPRSVISPDMTRGDR----LDSVAPGDSASHAGF 472

Query: 485 DDGSM--ASFPRGHDENFFTFKFKAPNGKSHRFTV 517
           D+GS+   +      E  F FKFKAP+G+ HR  V
Sbjct: 473 DEGSIVGGTPDLSPSEIPFPFKFKAPSGRVHRLQV 507



>gi|171679826|ref|XP_001904859.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939539|emb|CAP64766.1| unnamed protein product [Podospora anserina S mat+]
          Length = 677

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 257/504 (50%), Positives = 331/504 (65%), Gaps = 24/504 (4%)

Query: 42  TSSPSYPTPAQXXXXXXXXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNR 101
           ++S + P P +                RQ+ +K+DEAIR+K+E +L+KK       L +R
Sbjct: 31  SASSAIPRPVETTHAAPSESGASLSAGRQKQAKRDEAIRRKLESDLSKKKH-----LTSR 85

Query: 102 GKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFT 161
            +  R+ P   GTV +L PS AL ++ +  V EA+QLMAAKR DCVLV D +E ++GIFT
Sbjct: 86  ARHSRKAP--PGTVLALKPSPALQIKPATTVSEAAQLMAAKREDCVLVTDDDERIAGIFT 143

Query: 162 AKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGD 221
           AKDLAFRVVG GL A   T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E  D
Sbjct: 144 AKDLAFRVVGAGLKAANVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQD 203

Query: 222 VVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMAC 281
           + G+LDITKC YEA++K+ERAY SS++LYDALEGV+ E  T+QP QI+QY++ LR KM+ 
Sbjct: 204 ISGVLDITKCFYEAMEKLERAYSSSRRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSG 263

Query: 282 PDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAA 341
           P L SVL+G  P  V V+TSV++AA+LM+E  TTAVLV +  +I GIFTSKD+VLRVIA 
Sbjct: 264 PTLESVLNGIPPTTVSVRTSVKEAAQLMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAP 323

Query: 342 GLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLT 400
           GLDP+TCSV+RVMTPHPD AP   +I  AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLT
Sbjct: 324 GLDPATCSVVRVMTPHPDFAPMDMTIQAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLT 383

Query: 401 YATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVS-DSIAXXXXXXXXXXXXX 459
           YAT+EQ+ +M     G D  GP WNKFW SL  D + ES VS D                
Sbjct: 384 YATLEQINTMG---TGADNEGPAWNKFWLSL--DHETESMVSGDGSHHHTHHTRSVMSPD 438

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDDGSMASF----PR-GHDENFFTFKFKAPNGKSHR 514
             R R + +++P      S S + +D    ++     P     E  F FKFKAP+G+ HR
Sbjct: 439 MSRDRINDSVAP----GDSASHAGVDSPPHSAVAPITPELPPSEIPFAFKFKAPSGRVHR 494

Query: 515 FTVDYT-SFEHIRATVASKLPSNV 537
             V      E   A VA+KL + V
Sbjct: 495 LQVTAAHGMEEFVANVAAKLGAEV 518



>gi|296419865|ref|XP_002839512.1| CBS/PB1 domain-containing protein [Tuber melanosporum Mel28]
 gi|295635673|emb|CAZ83703.1| unnamed protein product [Tuber melanosporum]
          Length = 642

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 285/655 (43%), Positives = 372/655 (56%), Gaps = 95/655 (14%)

Query: 39  PRKTSSPSYPTPAQXXXXXX-XXXXXXXXIARQRMSKKDEAIRKKVEHELNKKNRTKSTS 97
           P   S P  P PA                 +R+R SK+DEAIR+K+E++LNKK  T S  
Sbjct: 26  PPTPSGPGIPVPAPSPGGPAHSEAGSSVSDSRKRQSKRDEAIRRKIENDLNKKKHTVS-- 83

Query: 98  LNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLS 157
              R +  R+V  A GTV +L PSQAL ++ +  V EA+Q+MAAKR DCVLV D E+ +S
Sbjct: 84  ---RARHTRKV--APGTVMALRPSQALQIKPNTTVAEAAQIMAAKREDCVLVTDDEDRIS 138

Query: 158 GIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCN 217
           GIFTAKDLAFRVVG G++AR  T+A IMT+NP+C + DTSATDAL+ MV +GFRHLPV +
Sbjct: 139 GIFTAKDLAFRVVGAGVNARDVTIAQIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD 198

Query: 218 EEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLRE 277
           E  D+ G+LDITKC YEA++K+ERAY SS+KLYDALEGV+ E  ++QP QI+ Y++ LR+
Sbjct: 199 ENQDISGILDITKCFYEAMEKLERAYASSRKLYDALEGVQSELGSSQPQQIIHYVEALRQ 258

Query: 278 KMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLR 337
           KM+ PDL SVLDG+ P  V V+T+V+DAA +M+E  TTAVLV +  SI GIFTSKD+VLR
Sbjct: 259 KMSGPDLQSVLDGNPPTVVSVRTTVKDAAAMMKENHTTAVLVQDSGSITGIFTSKDVVLR 318

Query: 338 VIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDV 396
           VIAAGLDP+ CSV+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ +   I+GMVDV
Sbjct: 319 VIAAGLDPANCSVVRVMTPHPDFAPMDMSIQAALRKMHDGHYLNLPVMNEAAEIVGMVDV 378

Query: 397 LKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXX 456
           LKLTYAT+EQ+ SM       D  GP WNKFW SL  D D ES VSD             
Sbjct: 379 LKLTYATLEQINSMGT----TDSEGPAWNKFWMSL--DNDTESAVSDG------------ 420

Query: 457 XXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFT 516
                 TR +G     P I P +  S I    + S P  H       +     G+ HR  
Sbjct: 421 ------TRHTG-----PPIRPHQPDSPIR--VLFSLPTLHLTTAVPPQLL--YGRMHRCQ 465

Query: 517 VDYT-SFEHIRATVASKLPSNVRD-----------------FTIYYVXXXXXXXXXXXXX 558
           V  +     + A V  KL S V++                 F + YV             
Sbjct: 466 VAASGGLIELLAAVVQKLGSEVQNVGGEPEFGADGKLEKQGFAMSYVDSEGDIVSITSDR 525

Query: 559 XXIDAVRIAQRQGMSRVILHIQEIEKKSL---------------------------RXXX 591
             IDA+ +A+  G  +V L++ + +  ++                               
Sbjct: 526 DLIDAIEMARNGGRDKVDLYVHDPDSPAVIATAEPKPVIDTPTEPILHSRRRRRHEEEDT 585

Query: 592 XXXXXXXXXILEKRRRRKRGKH--------APDYNLPIPHDLLLPGAVLTLAIAI 638
                    I+  R+ +K             P+    +P++LLLPGA++TLA+ I
Sbjct: 586 EESSEEEEEIVAHRKAKKNAVSQIPALAPVQPEVIPGVPNELLLPGALVTLAVVI 640



>gi|58261286|ref|XP_568053.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57230135|gb|AAW46536.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 704

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 356/569 (62%), Gaps = 66/569 (11%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKN-RTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           R++ SK+DE++RKK+E EL++K   + +T  +N GK   + P  KGTVA L PS ALTV 
Sbjct: 37  RRKQSKRDESLRKKIESELSRKRPGSNATQQSNGGKRSSKRP-QKGTVAGLRPSPALTVP 95

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E   V +ASQL AAKRADCVLV+D EE LSGIFTAKDLAFRV  +GLD R+T+VA IMT+
Sbjct: 96  EGMSVADASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTK 155

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPM  ++ T+AT+AL  MV+RGFRHLPVCNE+GDVVGLLDITK  +EAL K+ER   ++ 
Sbjct: 156 NPMVTRDTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATS 215

Query: 248 KLYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTS 301
           +L  AL GV+ E         Q   +L Y++ LRE+MA PDL++V+D  S P  V  +T+
Sbjct: 216 QLSAALAGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTT 275

Query: 302 VRDAARLMREYRTTAVLVMEHHS----------------IAGIFTSKDIVLRVIAAGLDP 345
           VR+AARLM+E RTTAV VME ++                IAGIFTSKDIVLRVIAAGLD 
Sbjct: 276 VREAARLMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKDIVLRVIAAGLDA 335

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATM 404
           S CSV+RVMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+
Sbjct: 336 SRCSVVRVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTYATL 395

Query: 405 EQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
           EQ+ SM N++  N+  GPMW++F+  L   G ++ T   SI                  R
Sbjct: 396 EQIESM-NEDRSNE-SGPMWSRFFEGLPGAGGDDDTA--SIVSASERPDTPSRSHLGHGR 451

Query: 465 G-SGNISPIPEIHPSESASAIDD------------GSMASFPRGHDENFFTFKFKAPNGK 511
           G S   SPI EI P++SAS +DD             S+A+     D+  + FKF+ P+G+
Sbjct: 452 GLSSMTSPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPIDDGTYIFKFRTPSGR 511

Query: 512 SHRFTVDYTSFEHIRATVASKL---------------------PSNVRDFTIYYVXXXXX 550
           +HRF   + S+E +R  VA KL                     PSN   FT++Y      
Sbjct: 512 THRFQARHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSN---FTLHYTDDEGD 568

Query: 551 XXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
                      DAVRIA+ Q   R++L +
Sbjct: 569 LVTMTADSDVADAVRIARGQKSDRIVLLV 597



>gi|380494191|emb|CCF33335.1| hypothetical protein CH063_05547 [Colletotrichum higginsianum]
          Length = 707

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 275/629 (43%), Positives = 368/629 (58%), Gaps = 79/629 (12%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIRKK+E +L+KK       L +R +  R+ P   GTV +L PSQAL ++    V EA+
Sbjct: 95  KAIRKKMESDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSQALQIKPGTTVAEAA 147

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G      T+A IMT+NP+C + DT
Sbjct: 148 QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKPNHITIAEIMTKNPLCARTDT 207

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV
Sbjct: 208 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRRLYDALEGV 267

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  T+QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA++M+E RTTA
Sbjct: 268 QSELGTSQPQQIIQYVEALRSKMSGPTLESVLDGRPPTTVSVRTSVKEAAQMMKENRTTA 327

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+D
Sbjct: 328 VLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSIQAALRKMHD 387

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M      +D  GP WNKFW SL +  
Sbjct: 388 GHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMST----SDSEGPAWNKFWLSLDDGT 443

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRG 495
           ++  +   S                 R R   +++      P +SAS +    + S PR 
Sbjct: 444 ESLMSGEGSHTHHTNLGSRIMSPDISRERIGDSVA------PGDSASHV---GIESPPRS 494

Query: 496 H-----------DENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR----- 538
                        E  F FKFKAP+G+ HR  V  +     +   V +KL S V      
Sbjct: 495 AVTGNSPAQQSPAELPFPFKFKAPSGRVHRLQVIASQGIAAMVTNVLAKLGSEVDAIGGA 554

Query: 539 ----------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLR 588
                      F + Y+               ++++ +A++    +V L + + EK  + 
Sbjct: 555 PTVEEGKISGGFALSYLDDEGDSVSITTDNDLLESILLARQGRREKVDLFVHDPEKPPVS 614

Query: 589 XXXXXXXXXXXXI--------LEKR--------------------RRRKRGKHAPDYNLP 620
                                L +R                    RR +R KH P+    
Sbjct: 615 AAPPTIETIALPTPPISATPDLRRRRAYDDEDDEAEDEDDDVSHVRRSRRAKHTPEPEQV 674

Query: 621 I---PHDLLLPGAVLTLAIAIIGVFALSR 646
           I   P++LLLPGA++TLA+ I+GVF +SR
Sbjct: 675 IAGVPNELLLPGAIVTLAVVIVGVFTISR 703



>gi|322708062|gb|EFY99639.1| ribosomal protein subunit S4 [Metarhizium anisopliae ARSEF 23]
          Length = 666

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 279/639 (43%), Positives = 374/639 (58%), Gaps = 80/639 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ+ +K+DEAIR+K+E++L+KK       L NR +  R+ P   GTV +L PSQAL ++ 
Sbjct: 45  RQKQTKRDEAIRRKMENDLSKKKH-----LTNRARHSRKAP--PGTVLALKPSQALQIKP 97

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
              V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+N
Sbjct: 98  QTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGHKAANITIADIMTKN 157

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 158 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 217

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV  E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA L
Sbjct: 218 LYDALEGVHSELGASQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAAL 277

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I 
Sbjct: 278 MKENHTTAVLVQDAGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQ 337

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +     DG GP WNKF
Sbjct: 338 AALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----GDGEGPAWNKF 393

Query: 428 WNSLANDGDNESTVSDSIAXX---XXXXXXXXXXXXXRTRGSGNISPIP-------EIHP 477
           W S+  D + ES +S   +                  R R   +++P         E  P
Sbjct: 394 WLSI--DNETESMMSGEGSHSHHHTNLGSRMMSPDVTRDRHGDSVAPGDSASHVGVESPP 451

Query: 478 SESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSN 536
              A  I + + A  P       F FKFKAP+G+ HR  V          + VA+KL + 
Sbjct: 452 RSIAPEIPEQNPADVP-------FPFKFKAPSGRVHRLQVIAAQGMGAFVSAVAAKLGAE 504

Query: 537 V----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
           V                  F + Y+               ++A+ +A++    +V L+  
Sbjct: 505 VDAIGGVPAVEDGKMSGAGFALSYMDNEGDTVSITTDNDLLEAIILARQSRHDKVDLYAH 564

Query: 581 EIEKKSLRXXXXXX--------XXXXXXILEKRR---------------------RRKRG 611
           + EK  +                     + E+RR                     R +R 
Sbjct: 565 DPEKPPVAPPAPVETPVIPTPPTSTAAGLRERRRLYDDDEDEDEDEDESDGAPVRRSRRT 624

Query: 612 KHAP---DYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
           + AP        +P+DLLLPGA++TLA+ I+GVF ++R+
Sbjct: 625 RSAPVQEQLIAGVPNDLLLPGAIVTLAVVIVGVFTIARA 663



>gi|358394371|gb|EHK43764.1| hypothetical protein TRIATDRAFT_171851, partial [Trichoderma
           atroviride IMI 206040]
          Length = 1006

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 259/542 (47%), Positives = 346/542 (63%), Gaps = 45/542 (8%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK      +L  R +P R+ P   GTV +L PSQAL ++
Sbjct: 45  SRQKQSKRDEAIRRKMESDLSKKK-----TLTGRSRPNRRAP--PGTVLALKPSQALQIK 97

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D E+ ++GIFTAKDLAFRVVG GL A   T+A IMT+
Sbjct: 98  PATTVSEAAQLMAAKREDCVLVTDDEDRIAGIFTAKDLAFRVVGAGLKAANVTIAEIMTK 157

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 158 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 217

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E   +QP QI+QY++ LR KM+ P L +VL+G  P  V V+TSV++AA 
Sbjct: 218 KLYDALEGVQSELGASQPQQIIQYVEALRSKMSGPTLETVLNGIPPTTVSVRTSVKEAAA 277

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I
Sbjct: 278 MMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTI 337

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +    + G GP WNK
Sbjct: 338 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----DSGEGPAWNK 393

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAI-- 484
           FW S+  D + ES VS   +                    G+      + P++SAS I  
Sbjct: 394 FWLSI--DHETESMVSGDGSLSHHPHHGGSRMMSPEANRLGD-----SVAPNDSASHIGL 446

Query: 485 DDGSMASFPRGHDENF-FTFKFKAPNGKSHRFTV----DYTSFEHIRATVASKLPSNVR- 538
           D    +  P     +  F FKFKAP+G+ HR  V       SF H    VASKL + +  
Sbjct: 447 DSPPHSIIPEHTPGDIPFAFKFKAPSGRVHRLQVVASQGIESFVH---AVASKLGNEIET 503

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++A+ +A++  + +V L++ + E
Sbjct: 504 LGGMPDVYDGRIEGAGFALSYMDNEGDTVSITTDNDLLEAILLARQALLEKVDLYVHDSE 563

Query: 584 KK 585
           K+
Sbjct: 564 KQ 565



>gi|367048487|ref|XP_003654623.1| hypothetical protein THITE_136351 [Thielavia terrestris NRRL 8126]
 gi|347001886|gb|AEO68287.1| hypothetical protein THITE_136351 [Thielavia terrestris NRRL 8126]
          Length = 1055

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 259/489 (52%), Positives = 321/489 (65%), Gaps = 45/489 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK       L  R +  R+ P   GTV +L PSQAL ++
Sbjct: 55  SRQKQSKRDEAIRRKMESDLSKKKH-----LTTRARQSRKAP--PGTVLALKPSQALQIK 107

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL A   T+A IMT+
Sbjct: 108 PTTSVAEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGLKANNVTIAEIMTK 167

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 168 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYASSR 227

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G+ P  V V+TSVR+AA+
Sbjct: 228 RLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGTPPTTVSVRTSVREAAQ 287

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 288 LMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 347

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ SM    N  D  GP WNK
Sbjct: 348 QAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATLEQINSM----NSADSEGPAWNK 403

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSE-----SA 481
           FW SL  D + ES VS                    T G       P++  SE     S 
Sbjct: 404 FWLSL--DHETESMVSGD-------------GSHHHTHGGPRSLVSPDVSRSERLVTDSV 448

Query: 482 SAIDDGSMASFPRGH------------DENFFTFKFKAPNGKSHRFTVDYT-SFEHIRAT 528
           +  D  S A     H             E  F FKFKAP+G+ HR  V          A 
Sbjct: 449 APGDSASHAGLESPHHSAVGVSPELPPSEIPFPFKFKAPSGRVHRLQVIAAHGMAEFVAN 508

Query: 529 VASKLPSNV 537
           VA+KL S V
Sbjct: 509 VAAKLGSEV 517



>gi|399168714|emb|CCE30500.1| uncharacterized protein CPUR_04348 [Claviceps purpurea 20.1]
          Length = 679

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 280/642 (43%), Positives = 374/642 (58%), Gaps = 82/642 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ+ +K+DEAIR+K+E +L+KK       L +R +  R+ P   GTV +L PS AL ++ 
Sbjct: 54  RQKQTKRDEAIRRKMESDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSPALQMKP 106

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG G  A   T+A IMT+N
Sbjct: 107 NTTVSEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGHKAANVTIAEIMTKN 166

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 167 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRK 226

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV  E  + QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA +
Sbjct: 227 LYDALEGVHSELGSTQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAAM 286

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I 
Sbjct: 287 MKENHTTAVLVQDAGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQ 346

Query: 369 DALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV++G G I+GMVDVLKLTYAT+EQ+ +M +     DG GP WNKF
Sbjct: 347 AALRKMHDGHYLNLPVMNGEGEIVGMVDVLKLTYATLEQINTMSS----GDGEGPAWNKF 402

Query: 428 WNSLANDGDNESTVS--DSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           W S+  D + ES VS   S +               R R   +++      P +SAS + 
Sbjct: 403 WLSI--DHETESIVSGDGSHSHHHTNMGSRLMSDVNRDRIGDSVA------PGDSASHVG 454

Query: 486 DGSMA-----SFPRGH-DENFFTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNV- 537
             S A       P  + D+  F FKFKAP+G+ HR   V     E +   VA KL + V 
Sbjct: 455 AESPAHSIAPEVPEQNPDDVPFAFKFKAPSGRVHRLQVVASQGMEALITAVAGKLGNEVD 514

Query: 538 ----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
                             F + Y+                +A+ +A +    +V L + +
Sbjct: 515 SIGGAPSVDVEGKMSYSGFALSYMDDEGDSVSITTNNDLREAIVLAHQGRRDKVDLFVHD 574

Query: 582 IEKKSLRXXXXXX--------XXXXXXILEKRR------------------------RRK 609
            EK  +                     + E+ R                        R +
Sbjct: 575 PEKPPIAATPVVETPVVCTPPTSTASGLRERNRAYNDDDDEDEDEDEEAEQDYATIRRPR 634

Query: 610 RGKHAPDYNLP----IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           R K AP         +P+DLLLPGA++TLA+ I+GVF ++R+
Sbjct: 635 RIKTAPAQQAQLIAGVPNDLLLPGAIVTLAVVIVGVFTIARA 676



>gi|336269220|ref|XP_003349371.1| CBS/PB1 domain-containing protein [Sordaria macrospora k-hell]
          Length = 681

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 251/479 (52%), Positives = 327/479 (68%), Gaps = 23/479 (4%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIR+K+E +L+KK       L +R +  R+ P   GTV +L PS AL +
Sbjct: 54  VSRQKQSKRDEAIRRKMESDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQI 106

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL + T T+A IMT
Sbjct: 107 KAATTVSEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGLKSNTVTIAEIMT 166

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 167 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASS 226

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           ++LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA
Sbjct: 227 RRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAA 286

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           +LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP + +
Sbjct: 287 QLMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMEMT 346

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M    +G+D  GP WN
Sbjct: 347 IQAALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMG---SGSDNEGPAWN 403

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--A 483
           KFW SL  D + ES VS   +                 R    +     + P +SAS   
Sbjct: 404 KFWLSL--DHETESMVSGDGSHHHTHHGPRSLMSPDIARSERIVD---SVAPGDSASHAG 458

Query: 484 IDDGSMASFPRGHDEN----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNV 537
           I+  S +      + N     F FKFKAP+G+ HR  V  +       A VA+KL + V
Sbjct: 459 IESPSHSQLGGIQEVNPADIPFPFKFKAPSGRVHRLQVTASHGMAEFVAAVAAKLGAEV 517



>gi|342320856|gb|EGU12794.1| Hypothetical Protein RTG_00812 [Rhodotorula glutinis ATCC 204091]
          Length = 1571

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 277/573 (48%), Positives = 354/573 (61%), Gaps = 62/573 (10%)

Query: 69   RQRMSKKDE-----------AIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVAS 117
            R+R S++DE           AIRKK+E EL +K      S  + G   R     +GTV++
Sbjct: 853  RKRQSRRDEVSQFGARSCAQAIRKKIESELARKRPPSKRSGTSGGTSHRAPKPKQGTVSA 912

Query: 118  LNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDAR 177
            L P  ALTV  +  V +ASQL AAKR DCVLV+D  EHL GIFTAKDLAFRVVGDGLD R
Sbjct: 913  LRPLPALTVPAAMSVADASQLCAAKRTDCVLVVDENEHLCGIFTAKDLAFRVVGDGLDPR 972

Query: 178  TTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALD 237
            +T V+ IMT NPM  ++ TSAT+AL TMV RGFRHLPVCNE+GDVVGLLDITK  +E+L+
Sbjct: 973  STPVSAIMTPNPMVTRDTTSATEALQTMVTRGFRHLPVCNEDGDVVGLLDITKVFHESLE 1032

Query: 238  KMERAYGSSKKLYDALEGVEREWS---TNQPTQILQYMDMLREKMACPDLSSVLDG-SMP 293
            K+E+AYGSS++LY ALEG + ++    T     +L Y+  LR+KM+ PDL S+LD  +  
Sbjct: 1033 KLEKAYGSSQRLYSALEGAQEQFGAVDTGAANPLLAYVQALRDKMSFPDLGSILDARTTA 1092

Query: 294  AEVGVKTSVRDAARLMREYRTTAVLVMEHHS--IAGIFTSKDIVLRVIAAGLDPSTCSVI 351
            A VGVKTSVR+AA+LMRE RTTAV+V+E     IAGIFTSKD+VLRVIAAGLD  TCSV+
Sbjct: 1093 ATVGVKTSVREAAKLMREKRTTAVVVVEGDGKKIAGIFTSKDVVLRVIAAGLDSKTCSVV 1152

Query: 352  RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSM 410
            RVMTPHPD A P  SI DAL+KM DGHYLNLPVVD  G+++G+VDVLKLTYAT+EQ+ S+
Sbjct: 1153 RVMTPHPDVALPSLSIQDALRKMNDGHYLNLPVVDEAGALIGIVDVLKLTYATLEQVNSL 1212

Query: 411  QNQENGNDGGGPMWNKFWN----SLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRT--- 463
              +   +  GGP+W +F++    +  +D D ES VS                   R    
Sbjct: 1213 HVEGGADAAGGPLWGRFFSAAAQAAGDDDDTESMVSGVNGSEAASSQAPPFQTPTRPGYH 1272

Query: 464  RGSGNI-SPIPEIHPSESASAI-DDGS--MASFPR--GH---------------DENFFT 502
            R   +I +P  E++P++SAS I DDG+  +A  PR  G                D+  + 
Sbjct: 1273 RSKDSIDTPGSELYPNDSASVIHDDGASDLAPAPRRPGQASSVGGASSQAVPIVDDGTYL 1332

Query: 503  FKFKAPNGKSHRFTVDYTSFEHIRATVASKLPS----------------NVRDFTIYYVX 546
            FKF AP G +HRF   Y S E +   V+ KL S                + +DF+I Y  
Sbjct: 1333 FKFVAPGGTTHRFQARYDSHEFLLDIVSGKLSSDPFFAEQSEDEALPKADPKDFSISYRD 1392

Query: 547  XXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
                           DAV+ A++QG  RV+LH+
Sbjct: 1393 DDGDLVLMTADRDVTDAVQTAKQQGKDRVVLHV 1425



>gi|380089158|emb|CCC12924.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 689

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 251/479 (52%), Positives = 327/479 (68%), Gaps = 23/479 (4%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           ++RQ+ SK+DEAIR+K+E +L+KK       L +R +  R+ P   GTV +L PS AL +
Sbjct: 62  VSRQKQSKRDEAIRRKMESDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQI 114

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + +  V EA+QLMAAKR DCVLV D +E ++GIFTAKDLAFRVVG GL + T T+A IMT
Sbjct: 115 KAATTVSEAAQLMAAKREDCVLVTDDDERIAGIFTAKDLAFRVVGAGLKSNTVTIAEIMT 174

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS
Sbjct: 175 KNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASS 234

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAA 306
           ++LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA
Sbjct: 235 RRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAA 294

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           +LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP + +
Sbjct: 295 QLMKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMEMT 354

Query: 367 ILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           I  AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M    +G+D  GP WN
Sbjct: 355 IQAALRKMHDGHYLNLPVMNDAGEIVGMVDVLKLTYATLEQINTMG---SGSDNEGPAWN 411

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--A 483
           KFW SL  D + ES VS   +                 R    +     + P +SAS   
Sbjct: 412 KFWLSL--DHETESMVSGDGSHHHTHHGPRSLMSPDIARSERIVD---SVAPGDSASHAG 466

Query: 484 IDDGSMASFPRGHDEN----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNV 537
           I+  S +      + N     F FKFKAP+G+ HR  V  +       A VA+KL + V
Sbjct: 467 IESPSHSQLGGIQEVNPADIPFPFKFKAPSGRVHRLQVTASHGMAEFVAAVAAKLGAEV 525



>gi|449304257|gb|EMD00265.1| hypothetical protein BAUCODRAFT_30741 [Baudoinia compniacensis UAMH
           10762]
          Length = 669

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 269/633 (42%), Positives = 372/633 (58%), Gaps = 67/633 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + +K+DEAIR K+E +LNKK          R +  R+ P   GTV +L P+QAL ++
Sbjct: 48  SRAKQTKRDEAIRNKLEKDLNKKR-----GAAGRARQTRKAP--PGTVLALKPNQALQIK 100

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A   T+A IMT+
Sbjct: 101 PNTTVTEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKANNVTIAEIMTK 160

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SSK
Sbjct: 161 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSSK 220

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R++M+ P L SVL+G  P  V V+TSVR+AA+
Sbjct: 221 KLYDALEGVQAELGSSQPQQIIQYVEAVRQRMSGPTLESVLNGLPPTTVSVRTSVREAAQ 280

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +   I GIFTSKD+VLRVIAAGLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 281 LMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAAGLDPANCSVVRVMTPHPDFAPLDMSI 340

Query: 368 LDALKKMYDGHYLNLPVV--DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+DGHYLNLPV+  +   I+GMVDVLKLTYAT++Q+ SM       D  GP WN
Sbjct: 341 QQALRKMHDGHYLNLPVMNKENDEIVGMVDVLKLTYATLDQINSMST----GDSEGPAWN 396

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS-GNISPIPEIHPSESAS-- 482
           KFW S+ + GD ES +S                      G    +  +  + P +SAS  
Sbjct: 397 KFWMSM-DQGDTESMMSGEGGSHAAHTQDGRSAMMSPEHGQRPGMDRLDSVLPGDSASHN 455

Query: 483 ---AIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR 538
               +D+ S  +     ++  FTFKFKAP G+ HR  V  ++    + A VA KL + V 
Sbjct: 456 GVPELDEHS--ALAGAVEDTPFTFKFKAPGGRVHRLQVVASAGLAELIAVVAEKLGAEVD 513

Query: 539 D----------------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEI 582
                            F + Y+               ++A+ +A++ G  +V L + + 
Sbjct: 514 SIGGMPSFEDGRLSYTGFALSYMDNEGDTVSLTTDADLLEAITLARQAGKDKVDLFVHDP 573

Query: 583 EKKSL--------------------------RXXXXXXXXXXXXILEKRRRRKRGKHAPD 616
           EK ++                          R            + E+R+ +K  +    
Sbjct: 574 EKPAMTATVEPQPVYAANPPTPPESAIRQRKRVDEEEDEEDMPNVTERRKEKKSAQPKQQ 633

Query: 617 YNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
             +   +P+++LLPGA++ L + I+  F + R+
Sbjct: 634 EQIIQGVPNEMLLPGALVVLGVVIVVTFVIGRA 666



>gi|170086117|ref|XP_001874282.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651834|gb|EDR16074.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 700

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 271/567 (47%), Positives = 352/567 (62%), Gaps = 64/567 (11%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGK--PQRQVPGAKGTVASLNPSQALTV 126
           R++ SK+DEAIRKK+E EL++K RT ST+   R K    +  P AKGTVA+L PS ALTV
Sbjct: 39  RKKQSKRDEAIRKKIESELSRK-RTISTTQGQRSKRGVGKATP-AKGTVAALKPSPALTV 96

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD  TT V+ IMT
Sbjct: 97  PENITVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRVTAEGLDPHTTPVSQIMT 156

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           RNPM  ++ TSAT+AL  MV+R FRHLPVCNE+G+VVGLLDITK  +EAL K+ER+  +S
Sbjct: 157 RNPMVTRDSTSATEALQLMVSRHFRHLPVCNEDGNVVGLLDITKVFHEALGKVERSSAAS 216

Query: 247 KKLYDALEGVEREW-----STNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKT 300
           ++L+ A+ GV+ E      S  Q   +L + + LREK A PDL++V+D  + PA VG KT
Sbjct: 217 EQLFSAMAGVQSELGGAVGSNPQAAAMLAWAEKLREKTALPDLTTVMDSRTQPATVGPKT 276

Query: 301 SVRDAARLMREYRTTAVLVMEHHS-----------IAGIFTSKDIVLRVIAAGLDPSTCS 349
           +VR+ A+LM+E RTTAV VME              IAGIFTSKD+VLRVIAAGLD   CS
Sbjct: 277 TVREVAKLMKERRTTAVCVMETAGPASPGLPAGSRIAGIFTSKDVVLRVIAAGLDAGRCS 336

Query: 350 VIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMY 408
           V+RVMTPHPDTAPP  S+ DALKKM++GHYLNLPV+ + G ++ +VDVLKLTYAT+EQM 
Sbjct: 337 VVRVMTPHPDTAPPTMSVHDALKKMHNGHYLNLPVIEEDGRLVAIVDVLKLTYATLEQMN 396

Query: 409 SMQNQENGND--GGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
           +M   +  +    GGPMW +F++S+ ++ D ES  S S                 +    
Sbjct: 397 AMAGGDTTSTEAEGGPMWGRFFDSIGHE-DTESLFSGSHVTRDHRSFSSINDLHLQQ--- 452

Query: 467 GNISPIPEIHPSESASAIDDGSMA---SFPRGH-------------DENFFTFKFKAPNG 510
              SP  E+HP++SAS IDD  ++    +PR               D+  + FKF+ P+G
Sbjct: 453 ---SPHSEVHPNDSASVIDDDPVSVLDGYPRHKGLNIPSGAAPIPVDDGTYVFKFRTPSG 509

Query: 511 KSHRFTVDYTSFEHIRATVASKL----------PSNVR-------DFTIYYVXXXXXXXX 553
           ++HRF   +   EH+R  V+ KL          P N         DF + Y         
Sbjct: 510 RTHRFQARHDDVEHLREIVSGKLATDPFFTEFQPKNEDSPKPDPIDFHLSYTDADGDTVL 569

Query: 554 XXXXXXXIDAVRIAQRQGMSRVILHIQ 580
                   DAV+IA+  G  RV+L +Q
Sbjct: 570 ITSDDDITDAVKIARTAGTDRVVLFVQ 596



>gi|296822790|ref|XP_002850342.1| CBS/PB1 domain-containing protein [Arthroderma otae CBS 113480]
 gi|238837896|gb|EEQ27558.1| CBS and PB1 domain-containing protein [Arthroderma otae CBS 113480]
          Length = 658

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 276/633 (43%), Positives = 367/633 (57%), Gaps = 83/633 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DE     +E +L+KK    S + + R  P        GTV +L PSQAL ++
Sbjct: 53  SRQKQSKRDE-----MEADLSKKKFNPSKARHTRKAP-------PGTVLALKPSQALQIK 100

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RVVG G+ AR  T+A IMT+
Sbjct: 101 PNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRVVGAGIRARDVTIAEIMTK 160

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 161 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 220

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA 
Sbjct: 221 KLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTVSVRTSVKEAAA 280

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDPSTCSV+RVMTPHPD AP   +I
Sbjct: 281 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPSTCSVVRVMTPHPDFAPTDMTI 340

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ ++Q     N+  GP WNK
Sbjct: 341 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQINTIQT----NESEGPAWNK 396

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS-----------GNISPIPEI 475
           FW S+ N+ D  S VS S                  T  S           G   P  E+
Sbjct: 397 FWLSMDNESD--SVVSGSQPSHMHHRSLLSPDHRGHTVDSVLPNDSASHHGGEEVPASEL 454

Query: 476 HPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLP 534
              ++A    D S            F FKFKAP+G+ HR  VD T+    +   V++KL 
Sbjct: 455 QERQAAEEKADPS------------FPFKFKAPSGRVHRLHVDPTAGIAELVRNVSAKLG 502

Query: 535 SNV----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
           + V                  F + YV               +DA+ IA++    +V L 
Sbjct: 503 AEVDAIGGQAVVDDGKLSNTGFAMSYVDSESDTVSITADQDLVDAISIARKANRDKVDLF 562

Query: 579 I----------QEIEKKSLRXXXXXXXXXXXXILEKRRRRKR------------GKHAPD 616
           +          +E E  +                E    R+              + + D
Sbjct: 563 VHSPDSTPVIPKEPEPVAAAKAVSPPESVTVAAEEDNAHREEFTTNSKPAAQPLVQPSTD 622

Query: 617 YNL--PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
             L   IP++L+LPGA++TLA  I+GVF LSR+
Sbjct: 623 QQLINGIPNELILPGAIVTLAAVIVGVFVLSRA 655



>gi|453080833|gb|EMF08883.1| CBS-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 662

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 271/633 (42%), Positives = 369/633 (58%), Gaps = 73/633 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIR K+E +L K+          R +  R+ P   GTV +L P+QAL ++
Sbjct: 48  SRAKQSKRDEAIRSKLEKDLGKRR-----GPAGRARQSRKAP--PGTVLALKPNQALQIK 100

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+Q+MAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL+AR  T+A IMT+
Sbjct: 101 PGTTVTEAAQMMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLNARNVTIAEIMTK 160

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC YEA++K+ERAY SSK
Sbjct: 161 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGVLDITKCFYEAMEKLERAYTSSK 220

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP Q++QY++ +R++M+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 221 KLYDALEGVQAELGSSQPQQVIQYVEAVRQRMSGPTLESVLNGLPPTTVSVRTSVKEAAQ 280

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +   I GIFTSKD+VLRVIAAGLDP+ CSVIRVMTPHPD AP   SI
Sbjct: 281 LMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAAGLDPANCSVIRVMTPHPDFAPMDMSI 340

Query: 368 LDALKKMYDGHYLNLPVVDGGS--ILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+DGHYLNLPV++  S  I+GMVDVLKLTYAT++Q+  M       D  GP WN
Sbjct: 341 QQALRKMHDGHYLNLPVMNKESDEIVGMVDVLKLTYATLDQINGMA----AGDSEGPAWN 396

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXR---TRGSGNISPIPEIHPSESAS 482
           KFW S+ N  + ES +S                   R   TRG         + P++SAS
Sbjct: 397 KFWMSMEN--ETESMMSGEGGSHAPHADRSAIMSPDRAEFTRGD-------SVLPTDSAS 447

Query: 483 --AIDDGSMASFPRGHDENFFTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNVR- 538
              I+    ++     ++  FTFKFKAP G+ HR   V       + +T+A KL      
Sbjct: 448 HNGIEHEEASALAGAVEDVPFTFKFKAPGGRVHRLHVVASQGMPELVSTIADKLGHEAEV 507

Query: 539 ---------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++A+ +A+     +V L + + E
Sbjct: 508 IGGVPAFENGKLQHAGFALSYLDNEGDTVSITTDHDLLEAIMLAKDARKDKVDLFVHDPE 567

Query: 584 KKSL------------------------RXXXXXXXXXXXXILEKRRRRK----RGKHAP 615
           K ++                        +            + ++RR RK    +G  A 
Sbjct: 568 KPAIPATLDPQPAIIPPTPTESSVRRRRQQESSEDEDEEQSVTQRRRDRKAAASQGAKAQ 627

Query: 616 DYNLP-IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           D  +  +P+++LLPGA+  LA+ I+  F   RS
Sbjct: 628 DQIIQGVPNEVLLPGAIGVLAVVILVTFMAGRS 660



>gi|358385733|gb|EHK23329.1| hypothetical protein TRIVIDRAFT_79905 [Trichoderma virens Gv29-8]
          Length = 670

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 256/537 (47%), Positives = 341/537 (63%), Gaps = 39/537 (7%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           RQ+ SK+DEAIR+K+E +L+KK      +L  R +  R+ P   GTV +L PSQAL ++ 
Sbjct: 57  RQKQSKRDEAIRRKLESDLSKKK-----TLTGRSRQIRRAP--PGTVLALKPSQALQIKP 109

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +  V EA+QLMAAKR DCVLV D E+ ++GIFTAKDLAFRVVG GL A   T+A IMT+N
Sbjct: 110 ATTVSEAAQLMAAKREDCVLVTDDEDRIAGIFTAKDLAFRVVGAGLKAANVTIAEIMTKN 169

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+K
Sbjct: 170 PLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRK 229

Query: 249 LYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARL 308
           LYDALEGV+ E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA +
Sbjct: 230 LYDALEGVQSELGASQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAAM 289

Query: 309 MREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSIL 368
           M+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I 
Sbjct: 290 MKENHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQ 349

Query: 369 DALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKF 427
            AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +    ++G GP WNKF
Sbjct: 350 AALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----DNGEGPAWNKF 405

Query: 428 WNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAI--D 485
           W S+  D + ES VS   +                    G+      + P++SAS I  D
Sbjct: 406 WLSI--DHETESMVSGDGSHSHHHAHHGSRMMSPEANRLGD-----SVAPNDSASHIGLD 458

Query: 486 DGSMASFPRGHDENF-FTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNVRD---- 539
               +  P     +  F FKFKAP+G+ HR   V     E     VA+KL + +      
Sbjct: 459 SPPHSIAPEVTTGDVPFAFKFKAPSGRVHRLQVVASQGIEAFVHAVAAKLGNEIESIGGM 518

Query: 540 ------------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEK 584
                       F + Y+               ++A+ +A++  + +V L + + EK
Sbjct: 519 PDVLEGRIDGAGFALSYMDNEGDTVSITTDNDLLEAILLARQAHLEKVDLFVHDSEK 575



>gi|322697495|gb|EFY89274.1| ribosomal protein subunit S4 [Metarhizium acridum CQMa 102]
          Length = 694

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 274/636 (43%), Positives = 370/636 (58%), Gaps = 80/636 (12%)

Query: 72  MSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESAL 131
           ++ + +AIR+K+E++L+KK       L NR +  R+ P   GTV +L PSQAL ++    
Sbjct: 76  LTARLQAIRRKMENDLSKKKH-----LTNRARHSRKAP--PGTVLALKPSQALQIKPQTT 128

Query: 132 VVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMC 191
           V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+NP+C
Sbjct: 129 VSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGHKAANITIADIMTKNPLC 188

Query: 192 VKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYD 251
            + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYD
Sbjct: 189 ARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRKLYD 248

Query: 252 ALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMRE 311
           ALEGV  E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA LM+E
Sbjct: 249 ALEGVHSELGASQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAALMKE 308

Query: 312 YRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDAL 371
             TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   +I  AL
Sbjct: 309 NHTTAVLVQDAGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQAAL 368

Query: 372 KKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNS 430
           +KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +     DG GP WNKFW S
Sbjct: 369 RKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----GDGEGPAWNKFWLS 424

Query: 431 LANDGDNESTVSDSIAXX---XXXXXXXXXXXXXRTRGSGNISPIP-------EIHPSES 480
           +  D + ES +S   +                  R R   +++P         E  P   
Sbjct: 425 I--DNETESMMSGEGSHSHHHTNLGSRMMSPDVTRDRHGDSVAPGDSASHVGVESPPRSI 482

Query: 481 ASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNV-- 537
           A  I + + A  P       F FKFKAP+G+ HR   V         + VA+KL + V  
Sbjct: 483 APEIPEQNPADVP-------FPFKFKAPSGRVHRLQVVAAQGMGAFVSAVAAKLGAEVDA 535

Query: 538 --------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                           F + Y+               ++A+ +A++    +V L+  + E
Sbjct: 536 IGGVPVVEDGKMSGTGFALSYMDNEGDTVSITTDNDLLEAIILARQSRHDKVDLYAHDPE 595

Query: 584 KKSLRXXXXXX--------XXXXXXILEKR---------------------RRRKRGKHA 614
           K  +                     + E+R                     RR +R + A
Sbjct: 596 KPPVALPAPVETPVIPTPPTSTAPGLRERRRPYDDDEDEDEDEDEDDGAPVRRSRRTRSA 655

Query: 615 P---DYNLPIPHDLLLPGAVLTLAIAIIGVFALSRS 647
           P        +P+DLLLPGA++TLA+ I+GVF ++R+
Sbjct: 656 PVQEQLIAGVPNDLLLPGAIVTLAVVIVGVFTIARA 691



>gi|367031380|ref|XP_003664973.1| hypothetical protein MYCTH_2135067 [Myceliophthora thermophila ATCC
           42464]
 gi|347012244|gb|AEO59728.1| hypothetical protein MYCTH_2135067 [Myceliophthora thermophila ATCC
           42464]
          Length = 1103

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 322/482 (66%), Gaps = 30/482 (6%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E++L+KK       L  R +  R+ P   GTV +L PSQAL ++
Sbjct: 55  SRQKQSKRDEAIRRKMENDLSKKKH-----LTTRARQSRKAP--PGTVLALRPSQALQIK 107

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL     T+A IMT+
Sbjct: 108 PQTTVAEAAQLMAAKREDCVLVTDEDDRIAGIFTAKDLAFRVVGAGLKPTNVTIAEIMTK 167

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 168 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYASSR 227

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 228 RLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTVTVRTSVKEAAQ 287

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 288 LMKENHTTAVLVTDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 347

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M    N  D  GP WNK
Sbjct: 348 QAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATLEQINTM----NTTDNEGPAWNK 403

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESA----- 481
           FW SL  D + ES VS   +                TR   +++    + P +SA     
Sbjct: 404 FWLSL--DHETESMVSGDGSHHHTNTNARSLMSPDMTRSERHVT--DSVAPGDSASHAGL 459

Query: 482 -----SAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPS 535
                SA+  G+    P    E  F FKFKAP+G+ HR  V          A V +KL S
Sbjct: 460 ESPRHSAVGAGTPELPP---SEVPFPFKFKAPSGRVHRLQVIAAHGMAEFVANVTAKLGS 516

Query: 536 NV 537
            V
Sbjct: 517 EV 518



>gi|321255198|ref|XP_003193342.1| hypothetical protein CGB_D1880W [Cryptococcus gattii WM276]
 gi|317459812|gb|ADV21555.1| Hypothetical protein CGB_D1880W [Cryptococcus gattii WM276]
          Length = 803

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 268/562 (47%), Positives = 345/562 (61%), Gaps = 64/562 (11%)

Query: 75  KDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVE 134
           K +++RKK+E EL++K    +T+  + G  +      KGTVA L PS ALTV E   V +
Sbjct: 142 KLQSLRKKIESELSRKRPGSNTNQQSNGSKRTSKRAQKGTVAGLRPSPALTVPEGMSVAD 201

Query: 135 ASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKN 194
           ASQL AAKRADCVLV+D EE LSGIFTAKDLAFRV  +GLD R+T VA IMT+NPM  ++
Sbjct: 202 ASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTNVAQIMTKNPMVTRD 261

Query: 195 DTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALE 254
            T+AT+AL  MV+RGFRHLPVCNE+GDVVGLLDITK  +EAL K+ER   ++ +L  AL 
Sbjct: 262 TTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATNQLSAALA 321

Query: 255 GVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARL 308
           GV+ E         Q   +L Y++ LRE+MA PDL++V+D  S P  V  +T+VR+AARL
Sbjct: 322 GVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTVREAARL 381

Query: 309 MREYRTTAVLVMEHHS----------------IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           M+E RTTAV VME ++                IAGIFTSKDIVLRVIAAGLD S CSV+R
Sbjct: 382 MKERRTTAVCVMEANAGTSAVSGVSGGNVIPKIAGIFTSKDIVLRVIAAGLDASRCSVVR 441

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+EQ+ SM 
Sbjct: 442 VMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTYATLEQIESM- 500

Query: 412 NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG-SGNIS 470
             E+ +D  GPMW++F+  L   G ++ T   SI                  RG S   S
Sbjct: 501 -NEDRSDESGPMWSRFFEGLPGAGGDDDTA--SIVSASERPDTPSRSHLGHGRGLSSMTS 557

Query: 471 PIPEIHPSESASAIDD------------GSMASFPRGHDENFFTFKFKAPNGKSHRFTVD 518
           PI EI P++SAS +DD             S+A+     D+  + FKF+ P+G++HRF   
Sbjct: 558 PISEIMPNDSASVVDDNISDLGGKHGPASSVAAPALPVDDGTYIFKFRTPSGRTHRFQAR 617

Query: 519 YTSFEHIRATVASKL---------------------PSNVRDFTIYYVXXXXXXXXXXXX 557
           + S+E +R  VA KL                     PSN   FT++Y             
Sbjct: 618 HDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSN---FTLHYTDDEGDLVTMTAD 674

Query: 558 XXXIDAVRIAQRQGMSRVILHI 579
               DAVRIA+ Q   R++L +
Sbjct: 675 SDVADAVRIARGQKSDRIVLLV 696



>gi|501752936|emb|CCG83283.1| CBS and PB1 domain protein [Taphrina deformans PYCC 5710]
          Length = 577

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 272/590 (46%), Positives = 355/590 (60%), Gaps = 40/590 (6%)

Query: 83  VEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAK 142
           +E +L KK  T +   ++R         A GTV+SL P+  +TV     V EA+QLMAAK
Sbjct: 1   MEKDLAKKKPTAARQRSSRK-------SAPGTVSSLKPTAPMTVPTDMTVHEAAQLMAAK 53

Query: 143 RADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDAL 202
           R DCVLVI  E HL+GIFTAKDLAFRVV    +  +T V+ IMT NPMC + DTSAT+AL
Sbjct: 54  REDCVLVISPESHLAGIFTAKDLAFRVVSQNKNPASTLVSEIMTPNPMCTRIDTSATEAL 113

Query: 203 NTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREW-S 261
           + MV +GFRHLPV +E+GDV G+LDITKC YEA++K+ERAY SSKKLYDALEGV  E  +
Sbjct: 114 DLMVTKGFRHLPVVDEDGDVSGVLDITKCFYEAMEKLERAYSSSKKLYDALEGVHSEMGA 173

Query: 262 TNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVME 321
           ++QP  I++Y++ LR+KM+ P L S+LDG+ P  V VKTSVR+A  LMRE  TTAVLVM+
Sbjct: 174 SHQPAPIIEYVETLRKKMSGPQLESILDGTAPTWVTVKTSVREATTLMRENHTTAVLVMD 233

Query: 322 HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLN 381
             ++AGIFTSKD+VLRVIA GLD   CSV+RVMTPHPD A    SI D L+KM DGHYLN
Sbjct: 234 GQNLAGIFTSKDVVLRVIAPGLDSGVCSVVRVMTPHPDCAASTLSIQDGLRKMNDGHYLN 293

Query: 382 LPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNEST 440
           LPV D   +I+GMVDVLKLTYAT+EQ++SM    N +   GPMWNKFW S+ +D +  S 
Sbjct: 294 LPVTDEEDNIIGMVDVLKLTYATLEQVHSM----NTSGEEGPMWNKFWTSVGDDNEG-SV 348

Query: 441 VSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIP---EIHPSESASAIDDGSMASFPRGHD 497
           VS S                     S +ISP+P   E+H  E  S +  G   S  R  +
Sbjct: 349 VSASDTPSRQSHRAESHSSRAIDPFSSDISPLPITHEVH--EYDSPVKPGDSISAHREDE 406

Query: 498 ENF------FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNV----RDFTIYYVX 546
                    F FKFKAP+GK HR T+  ++     R+ +  KL + V     DF + YV 
Sbjct: 407 PAVPDADAPFVFKFKAPSGKVHRLTLAPSAGLAAFRSLLTDKLGAEVSEVTEDFGVSYVD 466

Query: 547 XXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXX---------XXXXXX 597
                          ++V +A R    +V L++   E  ++                   
Sbjct: 467 DDGDVVSITTDEDLAESVSLAMRTKKDKVDLYVHHPEGAAVPVVKPAPAHSPFIEKLEDA 526

Query: 598 XXXILEKRRRRKRGKHAPDYNLP-IPHDLLLPGAVLTLAIAIIGVFALSR 646
              + EK   R +     +  +P + +DLL+PGA++ LA+ I+GVFA+SR
Sbjct: 527 TADVKEKIADRVQAATGKEPMVPGVSNDLLIPGALVALAVVIVGVFAISR 576



>gi|512189410|gb|EPE05177.1| mitochondrial ribosomal protein subunit s4 [Ophiostoma piceae UAMH
           11346]
          Length = 724

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 257/560 (45%), Positives = 347/560 (61%), Gaps = 60/560 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ +K+DEAIR+K+E++L+KK++T  +    R +  R+ P   GTV +L P+ AL ++
Sbjct: 64  SRQKQTKRDEAIRRKLENDLSKKSKTTPS---GRARHSRKAP--PGTVLALKPTPALQIK 118

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A T T+A IMT+
Sbjct: 119 PGTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGMKANTVTIAEIMTK 178

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 179 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 238

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E   +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 239 KLYDALEGVQSELGASQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTVSVRTSVKEAAQ 298

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM++  TTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 299 LMKDNHTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMSI 358

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M +     D  GP WNK
Sbjct: 359 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMSS----GDSEGPAWNK 414

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXX-------XXRTRGSGNISPIPEIHPSE 479
           FW SL  D + ES +S                           + G+   S +  + P++
Sbjct: 415 FWLSL--DHETESMMSGEGGSHSHNHGHHGAGSRIMSPELTRDSHGNNFHSRVDSVAPND 472

Query: 480 SASAIDDGSMASFPR-------GHD-----------ENFFTFKFKAPNGKSHRFTV---- 517
           SAS +    M S PR       GH+           E  F FKFKAP+G+ HR  V    
Sbjct: 473 SASHV---GMDSPPRSALGFGSGHNGTPLSPDINPAEVPFPFKFKAPSGRVHRLQVTAAQ 529

Query: 518 ----------------DYTSFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXI 561
                           +Y +   I A V  K+ +    F I Y+               +
Sbjct: 530 GIAIFVENVASKLGAAEYETIGGIPAVVEGKIVTAGTGFAISYLDDEGDSVSITADQDLL 589

Query: 562 DAVRIAQRQGMSRVILHIQE 581
           +A+ +A++    +V L + +
Sbjct: 590 EAILLARQGHRDKVDLFVHD 609



>gi|470316596|gb|EMR08342.1| hypothetical protein PNEG_03182 [Pneumocystis murina B123]
          Length = 598

 Score =  463 bits (1191), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 253/532 (47%), Positives = 339/532 (63%), Gaps = 38/532 (7%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R+R S+KD+AIR+K+E+EL+KK  T +     R  P +       TV SL PS  LTV+ 
Sbjct: 28  RKRQSRKDDAIRRKIENELSKKRPTAA-----RLHPCKL---DSKTVLSLKPSPPLTVQI 79

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
              V EASQLMAAKR DCVLV+D ++HL GIFTAKDLAFRVVG  +D R+  +  IMT N
Sbjct: 80  GITVSEASQLMAAKREDCVLVVDDDQHLIGIFTAKDLAFRVVGMDMDPRSLLIEDIMTVN 139

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C +NDTSATDAL+ MV +GFRHLPVC+E G+V G+LDITKC +EA+ K+ERAY SS++
Sbjct: 140 PLCARNDTSATDALDLMVHKGFRHLPVCDENGNVSGILDITKCFHEAMKKVERAYSSSQQ 199

Query: 249 LYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           LYDALEGV+ EWS   QP QI QY++ L+++M+ P+L+S LDG+ P  V ++TSVRDAA 
Sbjct: 200 LYDALEGVQTEWSQIQQPEQIFQYIETLKQRMSGPNLASALDGTTPITVNIRTSVRDAAF 259

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LMRE  TTAVLVM+  +I+GIFTSKDIVLRVIA GLDP+ CSV+RVMTPHPD AP   S+
Sbjct: 260 LMRENNTTAVLVMDQMNISGIFTSKDIVLRVIAPGLDPANCSVVRVMTPHPDCAPMDMSV 319

Query: 368 LDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
            +AL+KM +GHYLNLPV+D  S ++GMVDV+KLTY  +EQ+ ++    + +DG GP+WNK
Sbjct: 320 QEALRKMDEGHYLNLPVLDQESQVIGMVDVMKLTYLILEQIKNI----SSSDGEGPIWNK 375

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FWN++  +GD ES +SD+                  T  S N   +  + P  S + +  
Sbjct: 376 FWNTIG-EGDTESVLSDN-----QLSASQPYQSFSCTPLSENQQNLQILSPEVSPTKLTQ 429

Query: 487 GSMASFPR-----------GHDENFFTFKFKAPNGKSHRFT-VDYTSFEHIRATVASKLP 534
            +  +FP              ++  F FKF +P GK+HR   +    F  +R  V  ++ 
Sbjct: 430 KNKWTFPTETPVLLNKNTLSLNQAPFVFKFTSPYGKTHRIQHIPQAGFLSLRQIVIERVK 489

Query: 535 SNV------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
             +       D  I ++               + AV +A + G  +V L IQ
Sbjct: 490 LELDKLGQSEDLAINFIDDDGDVVAITTDEDLLHAVELAYKNGEDKVNLIIQ 541



>gi|116204175|ref|XP_001227898.1| hypothetical protein CHGG_09971 [Chaetomium globosum CBS 148.51]
 gi|88176099|gb|EAQ83567.1| hypothetical protein CHGG_09971 [Chaetomium globosum CBS 148.51]
          Length = 1086

 Score =  462 bits (1190), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 249/479 (51%), Positives = 320/479 (66%), Gaps = 24/479 (5%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ +K+DEAIR+K+E++L+KK       L  R +  R+ P   GTV +L PSQAL ++
Sbjct: 59  SRQKQTKRDEAIRRKLENDLSKKKH-----LTGRARQSRKAP--PGTVLALKPSQALQIK 111

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL     T+A IMT+
Sbjct: 112 PQTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKPNNVTIAEIMTK 171

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 172 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 231

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           +LYDALEGV+ E  T+QP QI+QY++ LR KM+ P L SVL+G+ P  V V+TSV++AA+
Sbjct: 232 RLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGTPPTTVSVRTSVKEAAQ 291

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M+E  TTA+LV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI
Sbjct: 292 MMKENHTTAILVTDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSI 351

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M   +N     GP WNK
Sbjct: 352 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMGTGDN----EGPAWNK 407

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDD 486
           FW SL  D + ES VS   +                 R    +S    + P +SAS +  
Sbjct: 408 FWLSL--DHETESMVSGDGSLHHTNPGPRSLMSPDMGRSDRLVS--DSVAPGDSASHVGA 463

Query: 487 GSMASFPRG-------HDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNV 537
            S      G         E  F FKFKAP+G+ HR  V          A V SKL + V
Sbjct: 464 DSPHHSAVGIHTPELPPSEVPFPFKFKAPSGRVHRLQVTAAHGMAEFVANVTSKLGAEV 522



>gi|443899306|dbj|GAC76637.1| predicted dehydrogenase [Pseudozyma antarctica T-34]
          Length = 650

 Score =  462 bits (1189), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 262/526 (49%), Positives = 329/526 (62%), Gaps = 77/526 (14%)

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           ES  V +ASQL AAKR DCVLV+D EEHL+GIFTAKDLAFRVV  GLDAR T V+TIMTR
Sbjct: 22  ESISVADASQLCAAKRTDCVLVVDEEEHLAGIFTAKDLAFRVVSAGLDARNTPVSTIMTR 81

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           +PM  ++ TSAT+ALNTMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS+
Sbjct: 82  SPMVTRDTTSATEALNTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSSQ 141

Query: 248 KLYDALEGVEREWSTNQPTQ--ILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRD 304
           KLY+ALEGV+ EW  +   Q  +LQY++ LR+KM+ PDLSS+LD  ++P  VGV+T+VR+
Sbjct: 142 KLYNALEGVQSEWGGSAGPQQAMLQYIEALRQKMSIPDLSSILDSRTLPCCVGVRTTVRE 201

Query: 305 AARLMREYRTTAVLVMEHHS-----------------IAGIFTSKDIVLRVIAAGLDPST 347
           AARLM+E+ TTAV VME                    IAGIFTSKD+VLRVIAAGLDP T
Sbjct: 202 AARLMKEHHTTAVCVMESTGTGPGTGQIGGGGAVSGKIAGIFTSKDVVLRVIAAGLDPKT 261

Query: 348 CSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATMEQ 406
           CSV+RVMTPHPDTAPP  +I +AL+KM+DG YLNLPVVD  S ++G+VDVLKLTYAT+EQ
Sbjct: 262 CSVVRVMTPHPDTAPPSLTIQEALRKMHDGRYLNLPVVDVDSRLVGVVDVLKLTYATLEQ 321

Query: 407 MYSMQNQE--NGNDGGGPMWNKFWNSLAND----GDNESTVSDSIAXXXXXXXXXXXXXX 460
           + SM +++       GGPMWN+FWNS        GD+ES VS S+               
Sbjct: 322 INSMNDEQAGGDGAAGGPMWNRFWNSFGQSNSIAGDDESAVSGSMRHSESQFEPPTPSKL 381

Query: 461 XRTRGSGNISPIPEIHPSESASAI------DDGSMA-----SFPRGHDENFFTFKFKAPN 509
               G+G      ++HP++SASA+      DDG+ A     S     D+  + FKF  P+
Sbjct: 382 ----GAGIADISSDLHPNDSASAVGHALTGDDGASAIGVPSSAAVEADDGTYLFKFVTPS 437

Query: 510 GKSHRFTVDYTSFEHIRATVASKLPS---------------------------------- 535
           G++HRF   Y S+E IR  V  KL                                    
Sbjct: 438 GRTHRFQARYDSYETIREIVCIKLGGDPFFEPVPAAASGAVENGEANGDVQPAVNGAAEV 497

Query: 536 -NVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
            +  DF + Y                 DAV++A++QG  RV+L +Q
Sbjct: 498 PDPNDFQLAYTDDEEDVVLITADGDVQDAVKVARKQGRDRVVLLLQ 543



>gi|336376304|gb|EGO04639.1| hypothetical protein SERLA73DRAFT_118591 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336389355|gb|EGO30498.1| hypothetical protein SERLADRAFT_432066 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 688

 Score =  462 bits (1189), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 287/645 (44%), Positives = 369/645 (57%), Gaps = 79/645 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKST-SLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           R++ +K+DEAIRK++E EL++K     T +++ R K   +    +GTVA+L PS ALTV 
Sbjct: 53  RRKQTKRDEAIRKRIESELSRKRVIPLTQNISGRSKRSSRSAVTRGTVAALRPSLALTVP 112

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+  V EASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  DGLD  TT V+ IMTR
Sbjct: 113 ENITVAEASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAYRVTADGLDPHTTPVSQIMTR 172

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           +PM  ++ TSATDAL  MV R FRHLPVCNEEG+VVGLLDITK  +EAL+K+ER+  +S+
Sbjct: 173 SPMVTRDTTSATDALQLMVQRHFRHLPVCNEEGNVVGLLDITKVFHEALNKVERSSSASE 232

Query: 248 KLYDALEGVEREW-----STNQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTS 301
           KLY+AL GV+ E      S  Q   +L Y+D LREK A PDL++V+D  + PA V  KT+
Sbjct: 233 KLYNALAGVQSELGPGMTSNPQAAAMLAYVDALREKTALPDLTTVIDRCVQPATVTPKTT 292

Query: 302 VRDAARLMREYRTTAVLVMEHHS--------IAGIFTSKDIVLRVIAAGLDPSTCSVIRV 353
           VR+ ARLMRE RTTAV VME  +        + GIFTSKDIVLRVIAAGLD   CSVIRV
Sbjct: 293 VREVARLMRERRTTAVCVMEFPAAVSDMFPKVVGIFTSKDIVLRVIAAGLDAGMCSVIRV 352

Query: 354 MTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSM-- 410
           MTPHPDTA P  S+ DALK+M++GHYLNLPVVD  G ++ +VDVLKLTYAT+EQM +M  
Sbjct: 353 MTPHPDTAQPSMSVHDALKRMHNGHYLNLPVVDFDGQLMAIVDVLKLTYATLEQMNAMTA 412

Query: 411 -QNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNI 469
              +   +  GGPMW KF+ SL    DN+S VS S                    G    
Sbjct: 413 DTAEGTWDSQGGPMWGKFFESLGGQDDNDSVVSGS------------HIPEEGVIGQQQQ 460

Query: 470 SPIPEIHPSESASAIDDGSMASF-PRGH------------------DENFFTFKFKAPNG 510
           S   E+HPS+SAS I D   ++  P  H                  D+  + FK + P+G
Sbjct: 461 SSYSEVHPSDSASFIGDELTSALEPLPHEKGRIAAPSITGTLNTLADDGTYVFKLRMPSG 520

Query: 511 KSHRFTVDYTSFEHIRATVASKLPSN-----------VR----DFTIYYVXXXXXXXXXX 555
           ++HRF   + S E +   V  KL ++            R    DF + Y           
Sbjct: 521 RTHRFQARHDSMETLEEIVRGKLAADPFFTEYTGMVETRPDPCDFDLSYTDADGDAVLIT 580

Query: 556 XXXXXIDAVRIAQRQGMSRVILHIQ----------EIEKKSLRXXXXXXXXXXXXI---- 601
                +DAV+ A+  G  RV+L  Q          E E  +              +    
Sbjct: 581 SDSDIVDAVKNARSAGSDRVVLFAQGGRSWVSAGWEGEVSTTPSKEVAIGKEAEIVKGAA 640

Query: 602 LEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSR 646
           L K     +     D  + +P DL+LP +V  LA+ I+ +F  SR
Sbjct: 641 LVKEAALSQISPEEDTIMGMPKDLILPTSVGALAVVILAIFTFSR 685



>gi|302916341|ref|XP_003051981.1| CBS/PB1 domain-containing protein [Nectria haematococca mpVI
           77-13-4]
 gi|256732920|gb|EEU46268.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 672

 Score =  462 bits (1188), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 251/481 (52%), Positives = 325/481 (67%), Gaps = 37/481 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E++L+KK       L +R +  R+ P   GTV +L PS AL ++
Sbjct: 49  SRQKQSKRDEAIRKKLENDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQIK 101

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G  A   T+A IMT+
Sbjct: 102 PATTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGAKASAITIAEIMTK 161

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 162 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSR 221

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ LR KM+ P L +VL+G  P  V V+TSV++AA+
Sbjct: 222 KLYDALEGVQSELGSTQPQQIIQYVEALRSKMSGPTLETVLNGVPPTTVSVRTSVKEAAQ 281

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E RTTAVLV +  +I GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   ++
Sbjct: 282 LMKENRTTAVLVQDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTL 341

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ DGG I+GMVDVLKLTYAT++Q+ +M N    ND  GP WNK
Sbjct: 342 QAALRKMHDGHYLNLPVMNDGGEIVGMVDVLKLTYATLDQINAMSNT---ND-EGPAWNK 397

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXX---XRTRGSGNISPIPEIHPSESASA 483
           FW SL  D + ES +S   +                  R R   +++      P +SAS 
Sbjct: 398 FWLSL--DAETESMMSGEGSASLQHTNLGSRLTSPDVARDRIGDSLA------PGDSASH 449

Query: 484 ID----------DGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASK 532
           I           DG+    P   +E  F FKFKAP+G+ HR  V  T   +   A VA+K
Sbjct: 450 IGLESPPRSLLHDGTETRLP---EERPFPFKFKAPSGRVHRVKVIATEGMDAFVAAVAAK 506

Query: 533 L 533
           L
Sbjct: 507 L 507



>gi|440472354|gb|ELQ41219.1| mitochondrial ribosomal protein subunit S4 [Magnaporthe oryzae Y34]
 gi|440489369|gb|ELQ69027.1| mitochondrial ribosomal protein subunit S4 [Magnaporthe oryzae
           P131]
          Length = 733

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 278/642 (43%), Positives = 361/642 (56%), Gaps = 92/642 (14%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIR+K+E++L KK       +  R +  R+ P   GTV +L PSQAL ++    V EA+
Sbjct: 106 QAIRRKMENDLAKKKH-----VTGRARHSRKAP--PGTVLALKPSQALQIKPGTTVAEAA 158

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A   T+A IMT+NP+C + DT
Sbjct: 159 QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKATNVTIAEIMTKNPLCARTDT 218

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV
Sbjct: 219 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRKLYDALEGV 278

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E   +QP QI+QY++ LR KM+ P L SVL+G  P  VGVKTSV++AA++M+E  TTA
Sbjct: 279 QSELGASQPQQIIQYVEALRTKMSGPTLESVLNGMPPTTVGVKTSVKEAAQMMKENHTTA 338

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +   I GIFTSKD+VLRVIA GLDP  CSV+RVMTPHPD AP   SI  AL+KM+D
Sbjct: 339 VLVQDQGQITGIFTSKDVVLRVIAPGLDPGNCSVVRVMTPHPDFAPMDMSIQAALRKMHD 398

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ D G I+GMVDVLKLTYAT+EQ+ +M + +N     GP WNKFW SL  D 
Sbjct: 399 GHYLNLPVMNDSGEIVGMVDVLKLTYATLEQINTMSSGDNE----GPAWNKFWLSL--DN 452

Query: 436 DNESTVSD----SIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMAS 491
           + ES VS       +               R R       +  + P +SAS     S   
Sbjct: 453 ETESMVSGDGSHHHSHSHIHHRSVMSPDLTRER-------LDSVAPGDSASHAGVESPGH 505

Query: 492 FPRGHDENF------FTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKL----------P 534
               H          F FKFKAP+G+ HR  V  +         V SKL          P
Sbjct: 506 SIVQHSPELPVSEIPFPFKFKAPSGRVHRLQVIASHGVAAFITNVTSKLGGEIEAVGGAP 565

Query: 535 SNVRD------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEK---- 584
               D      F + Y+               ++A+ +A++ G  +V L + + EK    
Sbjct: 566 EVTEDGQVRGGFALSYLDNEGDSVSITADQDLLEAILLARQSGRDKVDLFVHDPEKPPVA 625

Query: 585 ----------KSLRXXXXXXXXXXXXILEKRRRRK------------------------- 609
                      S              +  +RRRRK                         
Sbjct: 626 VAAPAAVPPAPSEPVSVPIPTPPASSVARERRRRKSPASDESDEEEESEDDGSSTLRRPR 685

Query: 610 ---RGKHAPDYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
              R   A    L   +P++LLLPGA++TLA+ I+GVF +SR
Sbjct: 686 RHQRAAAAQQEPLIAGVPNELLLPGAIVTLAVVIVGVFTISR 727



>gi|452838321|gb|EME40262.1| hypothetical protein DOTSEDRAFT_74911 [Dothistroma septosporum
           NZE10]
          Length = 665

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 278/629 (44%), Positives = 371/629 (58%), Gaps = 61/629 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEA+RKK+E +L+KK          R +  R+ P   GTV +L P+QAL +R
Sbjct: 47  SRAKQSKRDEALRKKLETDLSKKR-----GAAGRARQTRKAP--PGTVLALRPNQALQIR 99

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+Q+MAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A + T+A IMT+
Sbjct: 100 PNTTVTEAAQMMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKANSVTIAEIMTK 159

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C   DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SSK
Sbjct: 160 NPLCANTDTSATDALDLMVRKGFRHLPVMDENHDISGVLDITKCFYDAMEKLERAYTSSK 219

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R++M+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 220 KLYDALEGVQAELGSSQPQQIIQYVEAVRQRMSGPTLESVLNGLPPTTVSVRTSVKEAAQ 279

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +   I GIFTSKD+VLRVIAAGLDPSTCSVIRVMTPHPD AP   SI
Sbjct: 280 LMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAAGLDPSTCSVIRVMTPHPDFAPLDMSI 339

Query: 368 LDALKKMYDGHYLNLPVVDGGS--ILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+DGHYLNLPV++  S  I+GMVDVLKLTYAT++Q+  M   +N     GP WN
Sbjct: 340 QQALRKMHDGHYLNLPVMNKESDEIVGMVDVLKLTYATLDQINGMSTSDN----EGPAWN 395

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID 485
           KFW S+ + GD ES +S   +                      +     + P++SAS   
Sbjct: 396 KFWMSM-DHGDTESMMSGEGSHSHAPLDVRSGMMSPDVAHRPGMDRGDSVLPTDSASHNG 454

Query: 486 DGSMASFPRGHDENF-FTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLP--------- 534
               AS   G  E+  FTFKFKAP G+ HR  V  ++    + + VA KL          
Sbjct: 455 GEDEASALAGAIEDKPFTFKFKAPGGRIHRLQVVASAGLSEVVSHVAEKLGHEADSIGGV 514

Query: 535 SNVRD-------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSL 587
            N  D       F + Y+               ++A+ +A+     +V L + + EK ++
Sbjct: 515 PNFEDGKLAHAGFALSYMDNEGDTVSITSDHDLLEAIMMARTARKDKVDLFVHDPEKPAI 574

Query: 588 ------------------------RXXXXXXXXXXXXILEKRRRRKRGKHAP----DYNL 619
                                   R               +RR RK     P    D  +
Sbjct: 575 PVTVDPQPAIIPPTPPESSVRHRKRYESSDEQDEEESPSIRRRDRKSAAAQPVKAQDAII 634

Query: 620 P-IPHDLLLPGAVLTLAIAIIGVFALSRS 647
           P +P++LLLPGAV+ L + I+  F L RS
Sbjct: 635 PGVPNELLLPGAVVVLGVVIVITFTLGRS 663



>gi|443926166|gb|ELU44888.1| CBS and PB1 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 566

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 253/487 (51%), Positives = 331/487 (67%), Gaps = 24/487 (4%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R++ +K+DEAIRKK+E EL++K RT ST++  R +   +   AKGTVA+L PS ALTV 
Sbjct: 47  SRKKQNKRDEAIRKKIEGELSRK-RTISTNVP-RSRKTGKSTAAKGTVAALRPSPALTVP 104

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           E+  V +ASQL AAKR DCVLV+D EE LSGIFTAKDLAFRV  +GLD RTT V+ IMTR
Sbjct: 105 ENMTVSDASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAFRVSAEGLDPRTTPVSQIMTR 164

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
            PM  ++ TSAT+AL  MV RGFRHLPVCN+EG+VVGLLDITK  +EAL+K+ER   +S 
Sbjct: 165 GPMVTRDTTSATEALQLMVQRGFRHLPVCNDEGNVVGLLDITKVFHEALEKLERGSSASA 224

Query: 248 KLYDALEGVEREWSTN---QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVR 303
           KL+ ALEGV+ E       Q   ++ Y+  LREK   PDL++V+D  + PA V  +++VR
Sbjct: 225 KLHAALEGVQSELGNGLNPQAMAMMSYVASLREKTTLPDLTTVMDSRTQPATVSPRSTVR 284

Query: 304 DAARLMREYRTTAVLVME-----HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHP 358
           DAA+LM+E RTTAV +ME        IAGIFTSKD+VLRVIAAGLDP+ CSV+RVMTPHP
Sbjct: 285 DAAKLMKENRTTAVCIMEPLQGGPPKIAGIFTSKDVVLRVIAAGLDPNRCSVVRVMTPHP 344

Query: 359 DTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGN 417
           D A P  ++ DALKKMY G YLNLPVV+G G ++ +VDVLKLTYAT+EQ+ S+   +   
Sbjct: 345 DVAEPSMTVHDALKKMYVGRYLNLPVVEGDGKLVAIVDVLKLTYATLEQINSLSGGDQTE 404

Query: 418 DGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHP 477
           +  GPMW +F++S     DNES VS S                 R   +G  SP  E+HP
Sbjct: 405 E-SGPMWGRFFDSFQQGDDNESAVSGS---NMPHDTSSSYIDPGRLGVNGGRSPHSEVHP 460

Query: 478 SESASAIDD------GSMASFPRGH--DENFFTFKFKAPNGKSHRFTVDYTSFEHIRATV 529
           ++SAS I++        + + P     D+  + FKF+ P+G++HRF     +FE++R  +
Sbjct: 461 NDSASVIEELHHQHSSILEAMPAYEPIDDGTYVFKFRTPSGRTHRFQARQDNFENLRDII 520

Query: 530 ASKLPSN 536
           A KL S+
Sbjct: 521 AGKLESD 527



>gi|452978400|gb|EME78164.1| hypothetical protein MYCFIDRAFT_200475 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 671

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 268/628 (42%), Positives = 361/628 (57%), Gaps = 60/628 (9%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DE    K+E +L+KK      +   R  P        GTV +L P+QAL ++
Sbjct: 49  SRAKQSKRDEV--GKLEKDLSKKRGPAGRTAQRRKAP-------PGTVLALKPNQALQIK 99

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A   TVA IMT+
Sbjct: 100 PTLSVTEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKANNVTVAEIMTK 159

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SSK
Sbjct: 160 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYASSK 219

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ +R +M+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 220 KLYDALEGVQAELGSTQPQQIIQYVEAVRHRMSGPTLESVLNGLPPTTVSVRTSVKEAAQ 279

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTAVLV +   I GIFTSKD+VLRVIAAGLDP  CSVIRVMTPHPD AP   SI
Sbjct: 280 LMKENHTTAVLVQDQGQITGIFTSKDVVLRVIAAGLDPGNCSVIRVMTPHPDFAPMDMSI 339

Query: 368 LDALKKMYDGHYLNLPVVDGGS--ILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+DGHYLNLPV++  S  I+GMVDVLKLTYAT++Q+ SM   E   +G GP W+
Sbjct: 340 QQALRKMHDGHYLNLPVMNKESDEIVGMVDVLKLTYATLDQINSMSTNE--GEGAGPAWS 397

Query: 426 KFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--A 483
           KFW S+ + GD ES +S   +                    G +     + P++SAS   
Sbjct: 398 KFWMSM-DHGDTESLMSGEGSSHAPHTPDRFAMMSPDGHRPGMMDRGDSVLPTDSASHNG 456

Query: 484 IDDGSMASFPRGH-DENFFTFKFKAPNGKSHRF-TVDYTSFEHIRATVASKLPSNVR--- 538
           ID    ++    + +E  FTFKFKAP+G+ HR   +       +   +A KL +      
Sbjct: 457 IDHDQTSALAGANIEETPFTFKFKAPSGRVHRLHVIAAQGLGELIGVIADKLGAEAEGIG 516

Query: 539 -------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK 585
                         F + Y+               ++A+ +AQ     +V L + + EK 
Sbjct: 517 GVPAFENGKLQHAGFALSYLDNEGDTVSITTDHDLLEAIMLAQSARKDKVDLFVHDPEKP 576

Query: 586 SLRXXXXXXXXXXXXILEKR--RRRK----------RGKHAPDYN--------------L 619
           ++                +   RRRK            +H PD                 
Sbjct: 577 AIPATVDPQPTIIPPTPPESSVRRRKPYESDEEEEDEARHIPDRRGRKAQPAKAQEQVIQ 636

Query: 620 PIPHDLLLPGAVLTLAIAIIGVFALSRS 647
            +P++LL+PGA++ L   ++  F L RS
Sbjct: 637 GVPNELLIPGAIVILGAVVVITFTLGRS 664



>gi|134115681|ref|XP_773554.1| hypothetical protein CNBI1680 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256180|gb|EAL18907.1| hypothetical protein CNBI1680 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 831

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 271/563 (48%), Positives = 350/563 (62%), Gaps = 66/563 (11%)

Query: 75  KDEAIRKKVEHELNKKN-RTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVV 133
           K +++RKK+E EL++K   + +T  +N GK   + P  KGTVA L PS ALTV E   V 
Sbjct: 170 KLQSLRKKIESELSRKRPGSNATQQSNGGKRSSKRP-QKGTVAGLRPSPALTVPEGMSVA 228

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           +ASQL AAKRADCVLV+D EE LSGIFTAKDLAFRV  +GLD R+T+VA IMT+NPM  +
Sbjct: 229 DASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTKNPMVTR 288

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDAL 253
           + T+AT+AL  MV+RGFRHLPVCNE+GDVVGLLDITK  +EAL K+ER   ++ +L  AL
Sbjct: 289 DTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATSQLSAAL 348

Query: 254 EGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAAR 307
            GV+ E         Q   +L Y++ LRE+MA PDL++V+D  S P  V  +T+VR+AAR
Sbjct: 349 AGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTVREAAR 408

Query: 308 LMREYRTTAVLVMEHHS----------------IAGIFTSKDIVLRVIAAGLDPSTCSVI 351
           LM+E RTTAV VME ++                IAGIFTSKDIVLRVIAAGLD S CSV+
Sbjct: 409 LMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKDIVLRVIAAGLDASRCSVV 468

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSM 410
           RVMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+EQ+ SM
Sbjct: 469 RVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTYATLEQIESM 528

Query: 411 QNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG-SGNI 469
            N++  N+  GPMW++F+  L   G ++ T   SI                  RG S   
Sbjct: 529 -NEDRSNE-SGPMWSRFFEGLPGAGGDDDTA--SIVSASERPDTPSRSHLGHGRGLSSMT 584

Query: 470 SPIPEIHPSESASAIDD------------GSMASFPRGHDENFFTFKFKAPNGKSHRFTV 517
           SPI EI P++SAS +DD             S+A+     D+  + FKF+ P+G++HRF  
Sbjct: 585 SPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPIDDGTYIFKFRTPSGRTHRFQA 644

Query: 518 DYTSFEHIRATVASKL---------------------PSNVRDFTIYYVXXXXXXXXXXX 556
            + S+E +R  VA KL                     PSN   FT++Y            
Sbjct: 645 RHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSN---FTLHYTDDEGDLVTMTA 701

Query: 557 XXXXIDAVRIAQRQGMSRVILHI 579
                DAVRIA+ Q   R++L +
Sbjct: 702 DSDVADAVRIARGQKSDRIVLLV 724



>gi|58261288|ref|XP_568054.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57230136|gb|AAW46537.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 831

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 271/563 (48%), Positives = 350/563 (62%), Gaps = 66/563 (11%)

Query: 75  KDEAIRKKVEHELNKKN-RTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVV 133
           K +++RKK+E EL++K   + +T  +N GK   + P  KGTVA L PS ALTV E   V 
Sbjct: 170 KLQSLRKKIESELSRKRPGSNATQQSNGGKRSSKRP-QKGTVAGLRPSPALTVPEGMSVA 228

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           +ASQL AAKRADCVLV+D EE LSGIFTAKDLAFRV  +GLD R+T+VA IMT+NPM  +
Sbjct: 229 DASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTKNPMVTR 288

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDAL 253
           + T+AT+AL  MV+RGFRHLPVCNE+GDVVGLLDITK  +EAL K+ER   ++ +L  AL
Sbjct: 289 DTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATSQLSAAL 348

Query: 254 EGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAAR 307
            GV+ E         Q   +L Y++ LRE+MA PDL++V+D  S P  V  +T+VR+AAR
Sbjct: 349 AGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTVREAAR 408

Query: 308 LMREYRTTAVLVMEHHS----------------IAGIFTSKDIVLRVIAAGLDPSTCSVI 351
           LM+E RTTAV VME ++                IAGIFTSKDIVLRVIAAGLD S CSV+
Sbjct: 409 LMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKDIVLRVIAAGLDASRCSVV 468

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSM 410
           RVMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+EQ+ SM
Sbjct: 469 RVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTYATLEQIESM 528

Query: 411 QNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG-SGNI 469
            N++  N+  GPMW++F+  L   G ++ T   SI                  RG S   
Sbjct: 529 -NEDRSNE-SGPMWSRFFEGLPGAGGDDDTA--SIVSASERPDTPSRSHLGHGRGLSSMT 584

Query: 470 SPIPEIHPSESASAIDD------------GSMASFPRGHDENFFTFKFKAPNGKSHRFTV 517
           SPI EI P++SAS +DD             S+A+     D+  + FKF+ P+G++HRF  
Sbjct: 585 SPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPIDDGTYIFKFRTPSGRTHRFQA 644

Query: 518 DYTSFEHIRATVASKL---------------------PSNVRDFTIYYVXXXXXXXXXXX 556
            + S+E +R  VA KL                     PSN   FT++Y            
Sbjct: 645 RHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSN---FTLHYTDDEGDLVTMTA 701

Query: 557 XXXXIDAVRIAQRQGMSRVILHI 579
                DAVRIA+ Q   R++L +
Sbjct: 702 DSDVADAVRIARGQKSDRIVLLV 724



>gi|505756171|gb|EOR00344.1| Meiotically up-regulated 70 protein [Wallemia ichthyophaga EXF-994]
          Length = 696

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 267/565 (47%), Positives = 348/565 (61%), Gaps = 74/565 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKK--NRTKSTSLNNRG---KPQRQVPGAKGTVASLNPSQA 123
           R+R ++KDEA+R+K+E EL KK    T+ST  N +    +P+R      G+VA+L PS A
Sbjct: 35  RKRNTQKDEALRRKIETELGKKRPGSTQSTHSNRKHSSRQPKRN-QKQPGSVAALKPSPA 93

Query: 124 LTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVAT 183
           LTV +S  V +ASQL AAKR DCVLV+D +E L GIFTAKDLAFRVV + +D R T V+ 
Sbjct: 94  LTVPDSISVADASQLCAAKRTDCVLVVDDDESLCGIFTAKDLAFRVVAENMDTRHTPVSQ 153

Query: 184 IMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAY 243
           IMT NP+  ++ +SATDAL  MV+R FRHLPVCN++GDVVGLLDIT+   EALDK+ER Y
Sbjct: 154 IMTPNPLVTRDSSSATDALQLMVSRAFRHLPVCNDDGDVVGLLDITRVFNEALDKIERGY 213

Query: 244 GSSKKLYDALEGVEREWSTN----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGV 298
           G+S+KLY ALEGV+ E   N    Q + ++ Y+D LR++MA P+L SVLD  + PA V V
Sbjct: 214 GASQKLYTALEGVQNELGGNTHTRQASAMMNYVDALRDRMALPELHSVLDARTHPATVSV 273

Query: 299 KTSVRDAARLMREYRTTAVLVM------EHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           +TSVR+AAR+M+++RTTAV VM      E   IAGIFTSKD+VLRVIAAGL P  CSV+R
Sbjct: 274 RTSVREAARIMKQHRTTAVCVMDTGVGGEQAKIAGIFTSKDVVLRVIAAGLQPDRCSVVR 333

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQN 412
           VMTPHPD APP  +I +AL+KMY GHYLN+PVVD G ++ +VDVLKLTYA +EQ+ +M  
Sbjct: 334 VMTPHPDRAPPSMTIQEALRKMYAGHYLNMPVVDEGRLVAIVDVLKLTYAILEQINAMSA 393

Query: 413 QENG--NDGGGPMWNKFWNSLANDGDN-ESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNI 469
           ++ G   + GGPMW KF+ +LA   D+ ES VS S                 R  GS N 
Sbjct: 394 EDGGAEQEEGGPMWGKFFGTLAAAPDDAESAVSGS-----------------RDVGSPNG 436

Query: 470 SPIPEIHPSESASAID----------------DGSMASFPRGHDEN--FFTFKFKAPNGK 511
               E+HP++SAS +D                +    S  +  DE+     FKF +P+ +
Sbjct: 437 RNDSELHPNDSASVVDHEETSQVGLNTSLMESEAVTGSNAQATDEHAQVAVFKFVSPSQR 496

Query: 512 SHRFTVDYTSFEHIRATVASKLPS-------------------NVRDFTIYYVXXXXXXX 552
            HRF     S EH+R  VA KL +                   +  DF + Y        
Sbjct: 497 IHRFESPTLSLEHLRDIVAGKLSTDPFFSQHVESTPVHDLDMPDPYDFALLYEDDDGDHV 556

Query: 553 XXXXXXXXIDAVRIAQRQGMSRVIL 577
                    DAV +AQ++  SRV+L
Sbjct: 557 VLDADSDVKDAVVVAQKKRQSRVLL 581



>gi|164422735|ref|XP_001727992.1| CBS/PB1 domain-containing protein [Neurospora crassa OR74A]
 gi|157069798|gb|EDO64901.1| mitochondrial ribosomal protein subunit S4 [Neurospora crassa
           OR74A]
          Length = 610

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 267/620 (43%), Positives = 363/620 (58%), Gaps = 71/620 (11%)

Query: 83  VEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAK 142
           +E +L+KK       L +R +  R+ P   GTV +L PS AL ++ +  V EA+QLMAAK
Sbjct: 1   MESDLSKKKH-----LTSRARHTRKAP--PGTVLALKPSPALQIKAATTVSEAAQLMAAK 53

Query: 143 RADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDAL 202
           R DCVLV D +E ++GIFTAKDLAFRVVG GL A T T+A IMT+NP+C + DTSATDAL
Sbjct: 54  REDCVLVTDDDERIAGIFTAKDLAFRVVGGGLKANTVTIAEIMTKNPLCARTDTSATDAL 113

Query: 203 NTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWST 262
           + MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV+ E  T
Sbjct: 114 DLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYASSRRLYDALEGVQSELGT 173

Query: 263 NQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEH 322
           +QP QI+QY++ LR KM+ P L SVL+G  P  V V+TSV++AA+LM+E  TTAVLV + 
Sbjct: 174 SQPQQIIQYVEALRSKMSGPTLESVLNGIPPTTVSVRTSVKEAAQLMKENHTTAVLVQDQ 233

Query: 323 HSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNL 382
            +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   +I  AL+KM+DGHYLNL
Sbjct: 234 GAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMTIQAALRKMHDGHYLNL 293

Query: 383 PVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTV 441
           PV+ D G I+GMVDVLKLTYAT+EQ+ +M    +G D  GP WNKFW SL  D + ES V
Sbjct: 294 PVMNDAGEIVGMVDVLKLTYATLEQINTMG---SGTDNEGPAWNKFWLSL--DHETESMV 348

Query: 442 SDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASFPRGHDEN 499
           S   +                 R    +     + P +SAS   I+  S +      + N
Sbjct: 349 SGDGSLHHTHHGPRSLMSPDIARSERIVD---SVAPGDSASHAGIESPSHSQLGGIQEVN 405

Query: 500 ----FFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVR---------------D 539
                F FKFKAP+G+ HR  V  +       A VA+KL + V                 
Sbjct: 406 PADIPFPFKFKAPSGRVHRLQVTASHGMAEFVAAVAAKLGAEVDAIGGTPEVENGRLSGG 465

Query: 540 FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXX--------X 591
           F + Y+               ++A+ +A+     +V L + +  + ++            
Sbjct: 466 FALSYLDDEGDSVSITTDQDLLEAILLARHGLREKVDLFVHDPSEPAISHAPTPAPVIET 525

Query: 592 XXXXXXXXXILEKRRRR-------------------------KRGKHAPDYNLPIPHDLL 626
                    ++ +RR++                          + + AP     +P++LL
Sbjct: 526 IPATPPASSVVRERRKKVEEESEEVSEEEEPVHRRPTRTRTMSQPQEAPQVIAGVPNELL 585

Query: 627 LPGAVLTLAIAIIGVFALSR 646
           LPGA++TLA+ I+ VF +SR
Sbjct: 586 LPGAIVTLAVVIVSVFTISR 605



>gi|477534228|gb|ENH85790.1| cbs and pb1 domain containing protein [Colletotrichum orbiculare
           MAFF 240422]
          Length = 636

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 274/625 (43%), Positives = 363/625 (58%), Gaps = 72/625 (11%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIRKK+E +L+KK       L +R +  R+ P   GTV +L PS AL ++ +  V EA+
Sbjct: 25  KAIRKKMESDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSPALQIKPATTVAEAA 77

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G      T+A IMT+NP+C + DT
Sbjct: 78  QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKPNHITIAEIMTKNPLCARTDT 137

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV
Sbjct: 138 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRRLYDALEGV 197

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  T+QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA+ M+E RTTA
Sbjct: 198 QSELGTSQPQQIIQYVEALRSKMSGPTLESVLDGRPPTTVSVRTSVKEAAQQMKENRTTA 257

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+D
Sbjct: 258 VLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSIQAALRKMHD 317

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M      +D  GP WNKFW SL  D 
Sbjct: 318 GHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMST----SDSEGPAWNKFWLSL--DD 371

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMA----- 490
             ES +S   +                TR     S    + P +SAS +   S A     
Sbjct: 372 GTESMMSGEGSHTHHTNLGSRIMSPDITRERIGDS----VAPGDSASHVGLESPAHSIVQ 427

Query: 491 ---SFPRGHDENFFTFKFKAPNGKSHRFTVDYT-SFEHIRATVASKLPSNVRD------- 539
                 +   E  F FKFKAP+G+ HR  V  +     +   V SKL + V         
Sbjct: 428 SNSPVQQSPAELPFPFKFKAPSGRVHRLQVIASQGIGAMVTNVVSKLGNEVDSIGGAPAV 487

Query: 540 --------FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXX 591
                   F + Y+               ++++ +A++    +V L + + EK  +    
Sbjct: 488 EEGRISGGFALSYLDDEGDSVSITTDNDLLESILLARQGRREKVDLFVHDPEKPPVAVAQ 547

Query: 592 ---------------------------XXXXXXXXXILEKRRRRKRGKHAPDYNLPI--- 621
                                                +   RR +R + AP+    I   
Sbjct: 548 PVEPIALPTPPISATPDLRHRRKYDEEEDDAEDEDDDVSHVRRSRRTRAAPEPEQVIAGV 607

Query: 622 PHDLLLPGAVLTLAIAIIGVFALSR 646
           P++LLLPGA++TLA+ I GVF +SR
Sbjct: 608 PNELLLPGAIVTLAVVIAGVFTVSR 632



>gi|405119601|gb|AFR94373.1| CBS and PB1 domain-containing protein [Cryptococcus neoformans var.
           grubii H99]
          Length = 813

 Score =  459 bits (1181), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 266/562 (47%), Positives = 345/562 (61%), Gaps = 64/562 (11%)

Query: 75  KDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVE 134
           K +++RKK+E EL++K    + +  + G  +      KGTVA L PS ALTV E   V +
Sbjct: 152 KLQSLRKKIESELSRKRPGSNAAQQSNGGKRSSKRAQKGTVAGLRPSPALTVPEGMSVAD 211

Query: 135 ASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKN 194
           ASQL AAKRADCVLV+D EE LSGIFTAKDLAFRV  +GLD R+T+VA IMT+NPM  ++
Sbjct: 212 ASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTKNPMVTRD 271

Query: 195 DTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALE 254
            T+AT+AL  MV+RGFRHLPVCNE+GDVVGLLDITK  +EAL K+ER   ++ +L  AL 
Sbjct: 272 TTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATNQLSAALA 331

Query: 255 GVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARL 308
           GV+ E         Q   +L Y++ LRE+MA PDL++V+D  S P  V  +T+VR+AARL
Sbjct: 332 GVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTVREAARL 391

Query: 309 MREYRTTAVLVMEHHS----------------IAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           M+E RTTAV VME ++                IAGIFTSKDIVLRVIAAGLD S CSV+R
Sbjct: 392 MKERRTTAVCVMEANAGTSAVSGVSGGNVIPKIAGIFTSKDIVLRVIAAGLDASRCSVVR 451

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+EQ+ SM 
Sbjct: 452 VMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTYATLEQIESM- 510

Query: 412 NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG-SGNIS 470
           N++  N+  GPMW++F+  L   G ++ T   SI                  RG S   S
Sbjct: 511 NEDRSNE-SGPMWSRFFEGLPGAGGDDDTA--SIVSASERPDTPSRSHLGHGRGLSSMTS 567

Query: 471 PIPEIHPSESASAIDD------------GSMASFPRGHDENFFTFKFKAPNGKSHRFTVD 518
           PI EI P++SAS +DD             S+A+     D+  + FKF+ P+G++HRF   
Sbjct: 568 PISEIMPNDSASVVDDNISDLGGKHGPASSVAAPALPVDDGTYIFKFRTPSGRTHRFQAR 627

Query: 519 YTSFEHIRATVASKL---------------------PSNVRDFTIYYVXXXXXXXXXXXX 557
           + S+E +R  V  KL                     PSN   FT++Y             
Sbjct: 628 HDSYELLRDIVTGKLLTDPFFTAPGAKEGEAVHLPDPSN---FTLHYTDDEGDLVTMTAD 684

Query: 558 XXXIDAVRIAQRQGMSRVILHI 579
               DAVRIA+ Q   R++L +
Sbjct: 685 SDVADAVRIARGQKSDRIVLLV 706



>gi|393247785|gb|EJD55292.1| CBS-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 650

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 261/559 (46%), Positives = 347/559 (62%), Gaps = 54/559 (9%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R++ ++KDEAIRKK+E EL++K    +T   +R +P + V   KGTVA+L PS ALTV E
Sbjct: 17  RRKQNRKDEAIRKKIESELSRKRTISTTQSLSRKRPGKTV--QKGTVAALRPSPALTVPE 74

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           S  V +ASQL AAKR DCVLV+D EE LSGIFTAKDLA+RV  +GLD R T V+ IMTRN
Sbjct: 75  SMTVSDASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAYRVAAEGLDPRNTPVSAIMTRN 134

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           PM  ++ T AT+AL  MV R FRHLPVCNE+G+VVGLLDITK  +EAL+K+ER   +S K
Sbjct: 135 PMVTRDTTGATEALELMVQRHFRHLPVCNEDGNVVGLLDITKVFHEALEKVERGSSASLK 194

Query: 249 LYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSV 302
           LY+ALEGV+ E         Q   +L Y++ LREK A PDL+SV+D  + PA VG +T+V
Sbjct: 195 LYNALEGVQSELGAGLAANPQAAAMLAYVEALREKTALPDLTSVMDSRTNPATVGPRTTV 254

Query: 303 RDAARLMREYRTTAVLVMEHHS----IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHP 358
           R+A +LM+E+RTTAV VME +     I GIFTSKD+VLRVIAAGLDP  CSV+RVMTPHP
Sbjct: 255 REATKLMKEFRTTAVCVMEKNGPEERIVGIFTSKDVVLRVIAAGLDPGRCSVVRVMTPHP 314

Query: 359 DTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGN 417
           D APP  ++ DALKKM++G YLNLPV++  G ++ +VDVLKLTYAT+E M +M  +  G+
Sbjct: 315 DVAPPTMTVQDALKKMHNGRYLNLPVIESDGRLVAIVDVLKLTYATLEHMNTMGAESGGS 374

Query: 418 --DGGGPMWNKFWNSL-ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPI-P 473
             + GGP+W++F++SL A D D ES +S S                    GS  +S    
Sbjct: 375 QEENGGPVWSRFFDSLGAPDQDTESVLSGSALPRGEIMQTPPPMP-----GSAGLSRFDS 429

Query: 474 EIHPSESASAIDD---------------GSMASFPRGH---DENFFTFKFKAPNGKSHRF 515
           E+HP +SAS +DD                ++AS   G    D+  + FKF  P+G++HRF
Sbjct: 430 ELHPDDSASVMDDDHASLHGGARLAGAISTVASSKIGQVPVDDGTYVFKFSTPSGRTHRF 489

Query: 516 TVDYTSFEHIRATVASKLP--------------SNVRDFTIYYVXXXXXXXXXXXXXXXI 561
                 +E++R  +  KL                +  D+ + Y                 
Sbjct: 490 QARADHYENLREIITGKLTLDPFLTHRDGDGPLPDPNDYHLAYTDSDGDAVYITQDSDVR 549

Query: 562 DAVRIAQRQGMSRVILHIQ 580
           DAV +A+   + RV+L + 
Sbjct: 550 DAVDLARAHRVDRVVLFVH 568



>gi|392577363|gb|EIW70492.1| hypothetical protein TREMEDRAFT_29142 [Tremella mesenterica DSM
           1558]
          Length = 769

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 286/666 (42%), Positives = 375/666 (56%), Gaps = 101/666 (15%)

Query: 75  KDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVE 134
           K +++RKK+E+EL++K +  S  ++   K   + P  KGTVA L PS ALTV ES  V +
Sbjct: 108 KLQSLRKKIENELSRKRQGPSAPVSQGAKRGGKKP-QKGTVAGLRPSPALTVPESMSVAD 166

Query: 135 ASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKN 194
           ASQL AAKR DCVLV+D EE LSGIFTAKDLAFRV  +GLD R T+VA IMT+NPM  ++
Sbjct: 167 ASQLCAAKRTDCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRVTSVAQIMTKNPMVTRD 226

Query: 195 DTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALE 254
            TSAT+AL  MV+RGFRHLPVCNE+GDV GLLDITK  +EAL K+ER   ++ +L  AL 
Sbjct: 227 TTSATEALQLMVSRGFRHLPVCNEDGDVAGLLDITKVFHEALAKVERGSNATSQLSAALA 286

Query: 255 GVEREW----STN-QPTQILQYMDMLREKMACPDLSSVLDGSMPAE-VGVKTSVRDAARL 308
           GV+ E     S N Q   ++ Y+D LREKMA PDL++V+D S+P   V  +TSVRDAA+L
Sbjct: 287 GVQTELGPAISANPQAAAMMAYVDALREKMAQPDLTTVIDTSLPPPTVSPRTSVRDAAKL 346

Query: 309 MREYRTTAVLVMEHH----------------SIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
           M+E RTTAV VME +                 IAGIFTSKDIVLRVIAAGLD   CSV+R
Sbjct: 347 MKERRTTAVCVMETNLGTSAVSGASGQNGLPRIAGIFTSKDIVLRVIAAGLDAQRCSVVR 406

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTPHPDTAPP   + DALKKM++GHYLNLPVV+  G ++G+VDVLKLTYAT+EQ  S  
Sbjct: 407 VMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVESDGRLIGIVDVLKLTYATLEQASSYD 466

Query: 412 -----NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
                N EN ND  GP+W KF+++L   G ++ T S                     RG 
Sbjct: 467 KIENMNGENHND--GPVWGKFFDTLGTAGGDDDTAS----VVSHSDRPDTPSRHLHNRGM 520

Query: 467 GNI-SPIPEIHPSESASAIDDG------------SMASFPRGHDENFFTFKFKAPNGKSH 513
            ++ SPI E+ P++SAS +D+G            S+A+ P+  D+  + FKF+ P+G++H
Sbjct: 521 SSLTSPISELMPNDSASVVDEGSSEVGKRGGAPSSVAAAPQIVDDGTYIFKFRTPSGRTH 580

Query: 514 RFTVDYTSFEHIRATVASKLP------------------SNVRDFTIYYVXXXXXXXXXX 555
           RF   + S+E +R  V  KL                    +   F + Y           
Sbjct: 581 RFQARHDSYELLRDIVYGKLVVDPFFSGEGATEGQTIHIPDPNAFILSYTDDEGDSVTMT 640

Query: 556 XXXXXIDAVRIAQRQGMSRVILHI----------------QEIEK----KSLRXXXXXXX 595
                 DAVRIA+ Q   RV+L +                + +EK    + ++       
Sbjct: 641 ADGDVADAVRIAKGQKSDRVVLIVDGGKAWEQAARDLGGDKAVEKLKQAEDVKKVDEEDQ 700

Query: 596 XXXXXILEKRRRRKRGK------HAPDYNLP---------IPHDLLLPGAVLTLAIAIIG 640
                  +       GK      H P    P         +P ++ LP AV  L + I+G
Sbjct: 701 KLEQPTADPAVSPTFGKAGVVHSHGPSPGTPGVPELIGGVLPKEMALPAAVGFLGVVILG 760

Query: 641 VFALSR 646
           VF  +R
Sbjct: 761 VFIATR 766



>gi|409051394|gb|EKM60870.1| hypothetical protein PHACADRAFT_80818, partial [Phanerochaete
           carnosa HHB-10118-sp]
          Length = 472

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 316/446 (70%), Gaps = 34/446 (7%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGA-KGTVASLNPSQALTVR 127
           R++ S+KDEAIRKK+E EL++K    +T    RG  +R+     KGTVA+L PS ALTV 
Sbjct: 12  RRKQSRKDEAIRKKIESELSRKRTISTTYQQGRGSKRREKANVQKGTVAALKPSPALTVP 71

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           ES  V EASQL AAKR DCVLV+D +E LSGIFTAKDLA+RV  +GLD  TT V+ IMTR
Sbjct: 72  ESITVSEASQLCAAKRTDCVLVVDDDEGLSGIFTAKDLAYRVTAEGLDPHTTPVSVIMTR 131

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPM  ++ TSAT+AL  MV+R FRHLPVCNEEG+VVGLLDIT+  +EALDK+ER+  +S+
Sbjct: 132 NPMVTRDTTSATEALELMVSRHFRHLPVCNEEGNVVGLLDITRVFHEALDKVERSSSASE 191

Query: 248 KLYDALEGVEREW----STN-QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTS 301
           KLY+AL GV+ E     +TN Q   +L Y++ LREK A PDL++V+D  + PA VG KT+
Sbjct: 192 KLYNALAGVQSELGGGVATNPQTAAMLSYVEALREKTALPDLTTVMDSRTEPATVGPKTT 251

Query: 302 VRDAARLMREYRTTAVLVMEHHS-----------IAGIFTSKDIVLRVIAAGLDPSTCSV 350
           VR+ A+LM+E RTTAV VME  S           IAGIFTSKD+VLRVIAAGLD   CSV
Sbjct: 252 VREVAKLMKERRTTAVCVMESPSTSMGGTAATPRIAGIFTSKDVVLRVIAAGLDAGRCSV 311

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
           +RVMTPHPDTAPP  ++ DALKKM++GHYLNLPV++  G ++ +VDVLKLTYAT+EQM +
Sbjct: 312 VRVMTPHPDTAPPTMTVHDALKKMHNGHYLNLPVIETDGRLIAIVDVLKLTYATLEQMNA 371

Query: 410 MQNQENGN--DGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
           M  +  G     GGPMW +F+ SL +D DNES VS S A               +TR + 
Sbjct: 372 MSAEAAGGAEPEGGPMWGRFFESLGHD-DNESAVSGSAA--------HTEQSRNQTRSTS 422

Query: 468 NI--SPIPEIHPSESASAI--DDGSM 489
           ++  SP  E+HP++SAS +  DDGS+
Sbjct: 423 HLMQSPHSELHPNDSASVVDEDDGSV 448



>gi|398390317|ref|XP_003848619.1| hypothetical protein MYCGRDRAFT_76843 [Zymoseptoria tritici IPO323]
 gi|339468494|gb|EGP83595.1| hypothetical protein MYCGRDRAFT_76843 [Zymoseptoria tritici IPO323]
          Length = 629

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 251/545 (46%), Positives = 339/545 (62%), Gaps = 42/545 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R + SK+DEAIR K+E +LNKK         NR +  R+ P   GTV +L P+QAL ++
Sbjct: 12  SRAKQSKRDEAIRIKIEKDLNKKR-----GPGNRARQTRKAP--PGTVLALRPNQALQIK 64

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG GL A+  T+A IMT+
Sbjct: 65  PTMTVTEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGLKAQNVTIAEIMTK 124

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C K DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SSK
Sbjct: 125 NPLCAKTDTSATDALDLMVRKGFRHLPVMDENHDISGILDITKCFYDAMEKLERAYSSSK 184

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+QY++ +R++M+ P L SVL+G  P  V V+TSV++AA+
Sbjct: 185 KLYDALEGVQAELGSSQPQQIIQYVEAVRQRMSGPTLESVLNGLPPVTVSVRTSVKEAAQ 244

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           +M++  TTAVLV +   I GIFTSKD+VLRVIAAGLDP+ CSVIRVMTPHPD AP   SI
Sbjct: 245 MMKDNHTTAVLVQDQGQITGIFTSKDVVLRVIAAGLDPANCSVIRVMTPHPDFAPMDMSI 304

Query: 368 LDALKKMYDGHYLNLPVVDGGS--ILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
             AL+KM+DGHYLNLPV++  S  I+GMVDVLKLTYAT++Q+  M   +N     GP WN
Sbjct: 305 QQALRKMHDGHYLNLPVMNKESDEIVGMVDVLKLTYATLDQINGMSTGDN----EGPAWN 360

Query: 426 KFWNSLAND------GDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSE 479
           KFW S+ N+      G+  S +  +                   RG    S +P    S 
Sbjct: 361 KFWMSMENETESMMSGEGGSHIPHTSDERSNMMSPDMGHRMHLERGD---SVLPNDSASH 417

Query: 480 SASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FEHIRATVASKLPSNVR 538
           + +   + S+A      ++  FTFKFKAP G+ HR  V  ++    +   V +KL +   
Sbjct: 418 TGAPDQEQSLAG---AVEDRPFTFKFKAPGGRVHRLQVVASAGLAELITDVGNKLGNEAE 474

Query: 539 ----------------DFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEI 582
                            F + Y+               ++A+ +AQ     +V L + + 
Sbjct: 475 GLGGVPTFENGTLGHAGFALSYLDNEGDTVSITTDHDLLEAITLAQAARKDKVDLFVHDP 534

Query: 583 EKKSL 587
           EK +L
Sbjct: 535 EKPAL 539



>gi|361127748|gb|EHK99707.1| putative Meiotically up-regulated gene 70 protein [Glarea
           lozoyensis 74030]
          Length = 698

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 314/480 (65%), Gaps = 27/480 (5%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIR+K+E +L+KK  T       R +  R+ P   GTV +L PSQAL ++
Sbjct: 59  SRQKQSKRDEAIRRKIETDLSKKKHT-----TGRARQTRKAP--PGTVLALRPSQALQIK 111

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ A    ++ IMT+
Sbjct: 112 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIKASNVMISEIMTK 171

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 172 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 231

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  + QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA 
Sbjct: 232 KLYDALEGVQSELGSTQPQQIIQYVEALRSKMSGPTLESVLDGRPPVTVSVRTSVKEAAA 291

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
            M+E  TTAVLV +  SI GIFTSKD+VLRVIA GLDP+ CSV+RVMTPHPD AP   SI
Sbjct: 292 KMKENHTTAVLVQDQDSITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMSI 351

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+KM+DGHYLNLPV+ +GG I+GMVDVLKLTYAT+EQ+ +M       D  GP W K
Sbjct: 352 QAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINTMST----GDSEGPAWGK 407

Query: 427 FWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAID- 485
           FW +L N  + ES +S                    +RG      +  + P +SAS +  
Sbjct: 408 FWMALEN--ETESIMSGE-GSHHHTTGGRSLMSPDLSRGHERTVDV-SVAPGDSASHVGM 463

Query: 486 -------DGSMASFPRGHDENFFTFKFKAPNGKSHRFTV-DYTSFEHIRATVASKLPSNV 537
                      A  P   +E  F FKFKAP+G+ HR  V        +   V SKL S V
Sbjct: 464 DSPSRSVVSRSADVPA--EEVPFPFKFKAPSGRVHRLQVIGAHGLAELITAVISKLGSEV 521



>gi|388580282|gb|EIM20598.1| CBS-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 818

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 266/569 (46%), Positives = 339/569 (59%), Gaps = 82/569 (14%)

Query: 75  KDEAIRKKVEHELNKKNRTKSTSL-NNRGKPQRQVPGAKGTVASLNPSQALTVRESALVV 133
           K +A+RKK+E EL KK    S    ++ G+ +++     GTVASL PS ALTV +S  V 
Sbjct: 159 KFQALRKKIETELGKKRPGSSNPRRDHHGRDRKRNNKQPGTVASLRPSPALTVPDSMTVA 218

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           +ASQL AAKR DCVLV+D EE L GIFTAKDLAFRVV + +D R T V+ IMT NPM  +
Sbjct: 219 DASQLCAAKRTDCVLVVDDEESLCGIFTAKDLAFRVVAESIDTRHTPVSEIMTPNPMVTR 278

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDAL 253
           +  SAT+AL  MVAR FRHLPVCN++GDVVGLLDIT+   EALDK+ER YG+S+KLY+AL
Sbjct: 279 DSASATEALELMVARAFRHLPVCNDDGDVVGLLDITRVFNEALDKIERGYGASQKLYNAL 338

Query: 254 EGVEREWSTN----QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARL 308
           EGV+ E   N    Q   ++ Y+D LRE+MA PDL SVLD  + PA V V+T+VR+AAR+
Sbjct: 339 EGVQNELGGNTNSRQAAAMMNYVDALRERMALPDLQSVLDARTHPATVSVRTTVREAARI 398

Query: 309 MREYRTTAVLVMEH---------------HSIAGIFTSKDIVLRVIAAGLDPSTCSVIRV 353
           M++YRTTAV VM++                 IAGIFTSKD+VLRVIAAGL P  CSV+RV
Sbjct: 399 MKQYRTTAVCVMDNPISAGTGGHLNSQNQPRIAGIFTSKDVVLRVIAAGLQPDRCSVVRV 458

Query: 354 MTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSM-- 410
           MTPHPD APP  +I +AL+KMY GHYLN+PVV D G ++ +VDVLKLTYA +EQ+ SM  
Sbjct: 459 MTPHPDRAPPSMTIQEALRKMYTGHYLNMPVVEDDGKLIAIVDVLKLTYAILEQINSMSQ 518

Query: 411 -QNQENGNDGGGPMWNKFWNSL-ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
            Q  E G +  GPMW KF+ +L A   DN+S VS S                   +G  N
Sbjct: 519 EQQNETGEEASGPMWGKFFGTLAAAPDDNDSVVSGS-------------RDVASPQGGRN 565

Query: 469 ISPIPEIHPSESASAID-----DGSMASFPRGH-------------DENFFTFKFKAPNG 510
            S   E+HP++SAS +D     D S                     DE+   FKF +P+ 
Sbjct: 566 DS---ELHPNDSASVVDHSVDHDASQIGIDHASSGVLESEAANGVVDEHIAVFKFVSPSQ 622

Query: 511 KSHRFTVDYTSFEHIRATVASKLPS----------------------NVRDFTIYYVXXX 548
           + HRF     S EH+R  VA KL +                      +  DF++ Y    
Sbjct: 623 RIHRFESPTLSLEHLRDIVAGKLSTDPFFTQHTEKAPVEDENPAPAPDPYDFSLLYEDDD 682

Query: 549 XXXXXXXXXXXXIDAVRIAQRQGMSRVIL 577
                        DAV +AQ++  +RV+L
Sbjct: 683 GDHVVMSADSDVKDAVFVAQKKRQTRVLL 711



>gi|346979111|gb|EGY22563.1| CBS domain-containing protein [Verticillium dahliae VdLs.17]
          Length = 714

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 238/451 (52%), Positives = 307/451 (68%), Gaps = 28/451 (6%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIR+K+E +L+KK       L+ R +  R+ P   GTV +L PS AL ++    V EA+
Sbjct: 101 KAIRRKMESDLSKKKH-----LSGRARHTRKAP--PGTVLALKPSPALQIKPGTTVAEAA 153

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ +SGIFTAKDLAFRVVG G+     T+A IMT+NP+C + DT
Sbjct: 154 QLMAAKREDCVLVTDDDDRISGIFTAKDLAFRVVGAGMKPTHITIADIMTKNPLCARTDT 213

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV
Sbjct: 214 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRRLYDALEGV 273

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  ++QP QI+QY++ LR KM+ P L SVL+G+ P  V V+TSVR+AA+LM+E RTTA
Sbjct: 274 QSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGTPPTTVSVRTSVREAAQLMKENRTTA 333

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD A    SI  AL+KM+D
Sbjct: 334 VLVQDQGAITGIFTSKDVVLRVIAVGLDPATCSVVRVMTPHPDFASMDMSIQAALRKMHD 393

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M   +N     GP WNKFW SL  D 
Sbjct: 394 GHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMATGDN----EGPAWNKFWLSL--DN 447

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASF- 492
           ++ES VS   +                    G+      + P +SAS   ++    + F 
Sbjct: 448 ESESMVSGEGSHHHTNLGSRIMSPDHTRERIGD-----SVAPGDSASHVGVESPPHSEFI 502

Query: 493 ------PRGHDENFFTFKFKAPNGKSHRFTV 517
                 P+   E  F FKFKAP+G+ HR  V
Sbjct: 503 PADIIAPQSPAELPFPFKFKAPSGRVHRLQV 533



>gi|302418246|ref|XP_003006954.1| CBS/PB1 domain-containing protein [Verticillium albo-atrum
           VaMs.102]
 gi|261354556|gb|EEY16984.1| CBS domain-containing protein [Verticillium albo-atrum VaMs.102]
          Length = 750

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 238/451 (52%), Positives = 307/451 (68%), Gaps = 28/451 (6%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIR+K+E +L+KK       L+ R +  R+ P   GTV +L PS AL ++    V EA+
Sbjct: 137 KAIRRKMESDLSKKKH-----LSGRARHTRKAP--PGTVLALKPSPALQIKPGTTVAEAA 189

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ +SGIFTAKDLAFRVVG G+     T+A IMT+NP+C + DT
Sbjct: 190 QLMAAKREDCVLVTDDDDRISGIFTAKDLAFRVVGAGMKPTHITIAEIMTKNPLCARTDT 249

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV
Sbjct: 250 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRRLYDALEGV 309

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  ++QP QI+QY++ LR KM+ P L SVL+G+ P  V V+TSVR+AA+LM+E RTTA
Sbjct: 310 QSELGSSQPQQIIQYVEALRSKMSGPTLESVLNGTPPTTVSVRTSVREAAQLMKENRTTA 369

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD A    SI  AL+KM+D
Sbjct: 370 VLVQDQGAITGIFTSKDVVLRVIAVGLDPATCSVVRVMTPHPDFASMDMSIQAALRKMHD 429

Query: 377 GHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDG 435
           GHYLNLPV+ DGG I+GMVDVLKLTYAT+EQ+ +M   +N     GP WNKFW SL  D 
Sbjct: 430 GHYLNLPVMNDGGEIVGMVDVLKLTYATLEQINTMATGDN----EGPAWNKFWLSL--DN 483

Query: 436 DNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESAS--AIDDGSMASF- 492
           ++ES VS   +                    G+      + P +SAS   ++    + F 
Sbjct: 484 ESESMVSGEGSHHHTNLGSRIMSPDHTRERIGD-----SVAPGDSASHVGVESPPHSEFI 538

Query: 493 ------PRGHDENFFTFKFKAPNGKSHRFTV 517
                 P+   E  F FKFKAP+G+ HR  V
Sbjct: 539 PADSIAPQSPAELPFPFKFKAPSGRVHRLQV 569



>gi|50550993|ref|XP_502970.1| CBS/PB1 domain-containing protein [Yarrowia lipolytica CLIB122]
 gi|49648838|emb|CAG81162.1| YALI0D18106p [Yarrowia lipolytica CLIB122]
          Length = 593

 Score =  446 bits (1146), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 259/596 (43%), Positives = 360/596 (60%), Gaps = 45/596 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SKKDEAIR+K+E +L+K++         R KP +++    GTV +L PS A+T++
Sbjct: 28  SRKRQSKKDEAIRRKLETDLSKRSHV-------RPKPTKKI--VSGTVMALKPSPAVTIK 78

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
               V EA+QLM+AKR +CVLVI+ ++++SGIFTAKDLAF+VVG GLDA  TTV  IMTR
Sbjct: 79  PKTSVSEAAQLMSAKRENCVLVIE-DDNISGIFTAKDLAFKVVGSGLDASVTTVDQIMTR 137

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+    +TSAT+ LN MV +GFRHLPV +E  +V G+LDITKC +EA++K+ERAY SS+
Sbjct: 138 NPLYATTNTSATEGLNLMVNKGFRHLPVMDENNEVSGILDITKCYHEAMEKLERAYQSSR 197

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  ++QP QI+ Y++ L+++M  PDL SVLDG+ P  V V+T+V +AA 
Sbjct: 198 KLYDALEGVQTELGSSQPAQIINYVEALKQRMEGPDLESVLDGTPPTYVDVRTTVFEAAS 257

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM++  TTAVLV +H  + GIFTSKD+VLRVIAAGLDP  CSVIRVMTPHPD AP   SI
Sbjct: 258 LMKQNHTTAVLVTDHDQVKGIFTSKDVVLRVIAAGLDPKNCSVIRVMTPHPDVAPQNMSI 317

Query: 368 LDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNK 426
             AL+ M++G YLNLPV+     ++G+VDVLKLTYAT+EQ+ +M       D  GP WNK
Sbjct: 318 QVALRTMHEGRYLNLPVMGPNAELVGVVDVLKLTYATLEQINTMST----GDSEGPAWNK 373

Query: 427 FWNSL--ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI------HPS 478
           FW SL   ++  +E+   + I                   G G + P   I       P 
Sbjct: 374 FWMSLDDGSEAGSETNSHNRIMSPVSVSSPEVSHSELAQFGVGEVGPSDSISTDGYDRPG 433

Query: 479 ESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFT-VDYTSFEHIRATVASKLPSN- 536
            +A+    G +A+ P       F FKFK+P+G++HR T V       +R +++ KL    
Sbjct: 434 SNAA----GMIATMP-------FQFKFKSPSGRNHRLTVVPNAGVTALRTSISDKLSVGD 482

Query: 537 ----VRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXX 592
                +++ I Y+               +DAV I +R G+ +  L I   + + ++    
Sbjct: 483 VELVTQNYAISYIDDEGDIVAITSDQDLLDAVSITRRAGLEKADLFIHHPDNE-VKPVVT 541

Query: 593 XXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGVFALSRSK 648
                   I  K       +  P     + +DLLLPGAV  +A A    F+L R++
Sbjct: 542 QKLEDSVEIPVKAAAAPAPEIIPG----LSNDLLLPGAVAVVAAACAVAFSLGRAR 593



>gi|154278497|ref|XP_001540062.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413647|gb|EDN09030.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 403

 Score =  439 bits (1130), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 270/349 (77%), Gaps = 7/349 (2%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQ+ SK+DEAIRKK+E +LNKK          R +  R+ P   GTV +L PSQAL ++
Sbjct: 57  SRQKQSKRDEAIRKKMEADLNKKRHGNPA----RSRHSRKAP--PGTVMALKPSQALQIK 110

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G+ AR  T+A IMT+
Sbjct: 111 PNTTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGIRARDVTIAEIMTK 170

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+
Sbjct: 171 NPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSR 230

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAAR 307
           KLYDALEGV+ E  +NQP QI+QY++ LR+KM+ P L SVL+G  P  V V+TSVR+AA 
Sbjct: 231 KLYDALEGVQSELGSNQPQQIIQYVEALRQKMSGPTLESVLNGLPPTTVSVRTSVREAAT 290

Query: 308 LMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSI 367
           LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCSVIRVMTPHPD AP   SI
Sbjct: 291 LMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPNTCSVIRVMTPHPDFAPTDMSI 350

Query: 368 LDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQEN 415
             AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ SM   EN
Sbjct: 351 QAALRKMHDGHYLNLPVMNEAGEIVGMVDVLKLTYATLEQVNSMSTNEN 399



>gi|326480461|gb|EGE04471.1| CBS and PB1 domain-containing protein [Trichophyton equinum CBS
           127.97]
          Length = 696

 Score =  439 bits (1129), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 252/580 (43%), Positives = 338/580 (58%), Gaps = 60/580 (10%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G  GTV +L PSQAL ++ +  V EA+QLMAAKR DCVLV D ++ ++GIFTAKDLA+RV
Sbjct: 130 GPPGTVLALKPSQALQIKPNTTVSEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAYRV 189

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           VG G+ AR  T+  IMT+NP+C + DTSATDAL+ MV +GFRHLPV +E  D+ G+LDIT
Sbjct: 190 VGAGIRARDVTIVEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGILDIT 249

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLD 289
           KC Y+A++K+ERAY SS+KLYDALEGV+ E  ++QP QI+QY++ LR KM+ P L SVL+
Sbjct: 250 KCFYDAMEKLERAYSSSRKLYDALEGVQSELGSSQPQQIIQYVEALRSKMSGPTLESVLN 309

Query: 290 GSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCS 349
           G  P  V V+TSV++AA LM+E  TTA+LV +  SI GIFTSKD+VLRVIA GLDP+TCS
Sbjct: 310 GLPPTTVSVRTSVKEAAALMKENHTTALLVQDQGSITGIFTSKDVVLRVIAPGLDPATCS 369

Query: 350 VIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMY 408
           V+RVMTPHPD AP   SI  AL+KM+DGHYLNLPV+ + G I+GMVDVLKLTYAT+EQ+ 
Sbjct: 370 VVRVMTPHPDFAPTDMSIQAALRKMHDGHYLNLPVMNESGEIVGMVDVLKLTYATLEQIN 429

Query: 409 SMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
           ++Q     N+  GP WNKFW S+ N+ D  S VS S                  +     
Sbjct: 430 TIQT----NESEGPAWNKFWLSMDNESD--SMVSGSQPHHRSLLSPDHRGHTGDSVCQTT 483

Query: 469 ISPIPEIHP--SESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
           + P  E+    S+       G +   P+             P+ + HR  VD ++     
Sbjct: 484 LPPTTEVKTLLSQRYRTPSRGKLDLIPQ-----------SGPSRRVHRLHVDPSAGMRAV 532

Query: 527 ATVASKLPSNV----------------RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
             V++KL + V                  F + Y+               +DA+ IA++ 
Sbjct: 533 QNVSAKLGAEVDTIGGQAVVEDGKLSNTGFAMSYLDSEGDTVSITADQDLVDAISIARKA 592

Query: 571 GMSRVILHI----------QEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAP----- 615
              +V L +          +E E  +                E+   R+    +P     
Sbjct: 593 SQDKVDLFVHSPDSTPVVAKEPESAAAAKTASPPESVTVAAEEETVHREELASSPKSVAQ 652

Query: 616 -------DYNL--PIPHDLLLPGAVLTLAIAIIGVFALSR 646
                  D  L   IP++L+LPGA++TLA  I+GVF LSR
Sbjct: 653 SLVQPSTDQQLINGIPNELILPGAIVTLAAVIVGVFVLSR 692



>gi|429850172|gb|ELA25470.1| cbs and pb1 domain protein [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 520

 Score =  422 bits (1085), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/351 (59%), Positives = 264/351 (75%), Gaps = 13/351 (3%)

Query: 77  EAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEAS 136
           +AIRKK+E +L+KK       L +R +  R+ P   GTV +L PS AL ++ +  V EA+
Sbjct: 167 KAIRKKMESDLSKKKH-----LTSRARHSRKAP--PGTVLALKPSPALQIKPATTVAEAA 219

Query: 137 QLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDT 196
           QLMAAKR DCVLV D ++ ++GIFTAKDLAFRVVG G      T+A IMT+NP+C + DT
Sbjct: 220 QLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKPNHITIAEIMTKNPLCARTDT 279

Query: 197 SATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGV 256
           SATDAL+ MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS++LYDALEGV
Sbjct: 280 SATDALDLMVRKGFRHLPVMDENQDISGILDITKCFYDAMEKLERAYSSSRRLYDALEGV 339

Query: 257 EREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTA 316
           + E  T+QP QI+QY++ LR KM+ P L SVLDG  P  V V+TSV++AA+ M+E RTTA
Sbjct: 340 QSELGTSQPQQIIQYVEALRHKMSGPTLESVLDGRPPTTVSVRTSVKEAAQQMKENRTTA 399

Query: 317 VLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYD 376
           VLV +  +I GIFTSKD+VLRVIA GLDP+TCSV+RVMTPHPD AP   SI  AL+KM+D
Sbjct: 400 VLVQDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVMTPHPDFAPMDMSIQAALRKMHD 459

Query: 377 GHYLNLPVV--DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWN 425
           GHYLNLPV+  DGG I+GMVDVLKLTYAT+EQ+ +M       D  GP WN
Sbjct: 460 GHYLNLPVMTSDGGEIVGMVDVLKLTYATLEQINTMSTA----DSEGPAWN 506



>gi|406602467|emb|CCH46008.1| Inosine-5'-monophosphate dehydrogenase [Wickerhamomyces ciferrii]
          Length = 641

 Score =  416 bits (1069), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 238/550 (43%), Positives = 323/550 (58%), Gaps = 39/550 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKK-----NRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQ 122
           +R+R SK+DEAIR+++E++L+KK       +   +       +R      G+V SL PS+
Sbjct: 33  SRKRQSKRDEAIRRRIENDLSKKRYGTKGSSGGAAGAGTSGKKRSRHSQPGSVLSLKPSE 92

Query: 123 ALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVA 182
           A+  + S    EA+QLM+AKR +C+LVID +E L GIFTAKDLAFRVV  GL A + T+ 
Sbjct: 93  AVVCKPSFTAYEAAQLMSAKRENCILVIDDDERLLGIFTAKDLAFRVVSKGLKAGSVTID 152

Query: 183 TIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERA 242
            IMT NP+C  ++T A++ALN MV RGFRHLPV +E   + G+LDITKC  EA++K+ER 
Sbjct: 153 QIMTENPLCATSNTPASEALNLMVERGFRHLPVLDENNFIYGVLDITKCYQEAMEKLERM 212

Query: 243 YGSSKKLYDALEGVERE-WSTNQPTQILQYMDMLREKMACPDLSSVLD-GSMPAEVGVKT 300
           Y SSKKL+DAL+GV+ E  S  QP Q+++Y + L+  M  P L SVLD  S+P+ V VKT
Sbjct: 213 YESSKKLHDALQGVQLEIGSQQQPLQVIRYFENLKSVMNGPTLESVLDENSLPSYVNVKT 272

Query: 301 SVRDAARLMREYRTTAVLVME--HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHP 358
           SV DAA LM+E  TTAVLV +  +  ++GIFTSKD+VLRVIAAGLDP T SVIRVMT  P
Sbjct: 273 SVYDAAVLMKENHTTAVLVKDSNNEDVSGIFTSKDVVLRVIAAGLDPKTVSVIRVMTSQP 332

Query: 359 DTAPPQTSILDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQMYSMQNQE---N 415
           D AP   +I  AL+KM+DGHYLNLP+V+   I+G+V+VLKLTYAT+ Q+  M + E   N
Sbjct: 333 DVAPKNLTIQQALRKMFDGHYLNLPIVEDDEIIGIVEVLKLTYATLNQISLMNSNESNGN 392

Query: 416 GNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI 475
           G +  GP WNKFW SL  D D ES  SDS                        I+    +
Sbjct: 393 GEEQEGPAWNKFWTSL--DNDTESLHSDSQLDNGSQIIPDISQSEINQFSLNQINTNDNL 450

Query: 476 HPSESASAIDD-------------GSMASFPRGHD---ENFFTFKFKAPNGKSHRFTVD- 518
            P++S SA ++              ++ S     +   E FF FKFK+PNG++HR  +  
Sbjct: 451 GPNDSVSATNELTGNNNGGGGVNGSTITSNLNNKELIKEQFFAFKFKSPNGRNHRINLKP 510

Query: 519 YTSFEHIRATVASKLPSN--------VRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
               E + + +  KL +           +F I Y+               +D V I +  
Sbjct: 511 IEGIEELISQIKIKLTTQEFETLTQGYENFAISYIDDENDIVAITNDQDLLDCVLINKNS 570

Query: 571 GMSRVILHIQ 580
            + +  L I 
Sbjct: 571 NLDKADLFIH 580



>gi|320580871|gb|EFW95093.1| hypothetical protein HPODL_3465 [Ogataea parapolymorpha DL-1]
          Length = 624

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 263/643 (40%), Positives = 350/643 (54%), Gaps = 114/643 (17%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQV---PGAKGTVASLNPSQALT 125
           R+R SKKD+ IRKK+EH+L KKN     S  N G PQ++     GA GTV SL PS+A+ 
Sbjct: 30  RKRQSKKDDQIRKKIEHDLRKKNNVSMVS--NLGSPQKRSKGSSGAAGTVMSLKPSEAVI 87

Query: 126 VRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIM 185
            + +  V EA+QLM+  + +CVLV+D +  LSGIFTAKDLAFR+VG  L+A  TT+  IM
Sbjct: 88  CKPTNTVYEAAQLMSVTKENCVLVVDEDGLLSGIFTAKDLAFRIVGANLNANQTTIDQIM 147

Query: 186 TRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGS 245
           T NPMC K  T A+DAL+ MV +GFRHLPV NE   +VG+LDITKC  EA+ K+ER Y S
Sbjct: 148 TPNPMCAKVSTLASDALSLMVNKGFRHLPVVNEGNQIVGVLDITKCYNEAMTKLERMYES 207

Query: 246 SKKLYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVR 303
           SK+LYDA+EGV  E  T NQP  +++Y + LR  ++ P L+SVL + ++P    +KT+V 
Sbjct: 208 SKRLYDAMEGVTEELGTANQPVHVIKYFENLRNLVSGPTLNSVLSERTIPVCCDIKTTVY 267

Query: 304 DAARLMREYRTTAVLVME---HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDT 360
           +AA LMR+ +TTAVLV +   +  + GIFTSKDIVLRVIAAG+DP TCSVIRVMTP P  
Sbjct: 268 EAAILMRDNKTTAVLVKDSKNNDEVTGIFTSKDIVLRVIAAGIDPRTCSVIRVMTPKPSY 327

Query: 361 APPQTSILDALKKMYDGHYLNLPVV--DGGSILGMVDVLKLTYATMEQMYSMQNQENGN- 417
           A   +SI  AL++M++G YLNLPVV  D   I+G+VDVLKLTY T+ Q+ S+Q   NG+ 
Sbjct: 328 ALASSSIHQALRQMFEGRYLNLPVVDDDNSEIVGVVDVLKLTYHTLNQLQSIQTINNGDS 387

Query: 418 DGG------GPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP 471
           D G      GP WNKFW SL  D D  S  S S+A                     N+S 
Sbjct: 388 DAGSNEEKEGPAWNKFWTSL--DNDTSSLHSASLADVTQSEL-----------AQFNVST 434

Query: 472 IPEIHPSESAS---AIDDGSMA----SFPRGHDENFFTFKFKAPNGKSHRFTVDYTS-FE 523
              + PS+S S   A +  S A          DE  F FKFK+P G++HR +   +   +
Sbjct: 435 NDAVKPSDSISFSGAPETSSSALKAPQVEVDFDEPVF-FKFKSPQGRTHRISCKPSDGIQ 493

Query: 524 HIRATVASKL-----------PSN---------VRDFTIYYVXXXXXXXXXXXXXXXIDA 563
            +R  ++SKL           P +            F I YV                D 
Sbjct: 494 SLRELISSKLSRQEIRTLLTPPEDSETGQVFEPAEQFAISYVDDEN------------DL 541

Query: 564 VRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIP- 622
           V I   Q +   I+ +  + K  +                         H PD N+ +P 
Sbjct: 542 VAITSDQDLKDCIVVLTSLNKDKINLIV---------------------HHPDQNVDVPS 580

Query: 623 -------------------HDLLLPGAVLTLAIAIIGVFALSR 646
                               +L+LPG +  LA +++  F +SR
Sbjct: 581 TLSSAKTASASQGLPNDTIRELILPGVLFALAASVVVAFTISR 623



>gi|294659574|ref|XP_461972.2| CBS/PB1 domain-containing protein [Debaryomyces hansenii CBS767]
 gi|199434069|emb|CAG90442.2| DEHA2G09790p [Debaryomyces hansenii CBS767]
          Length = 607

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 244/622 (39%), Positives = 357/622 (57%), Gaps = 83/622 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKS-TSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +R+R SK+D+AIR+K+E++L+KK ++ + T+ + +G P        GTV SL PS+ +  
Sbjct: 25  SRRRQSKRDDAIRRKIENDLSKKKKSGTRTTKHKKGVP--------GTVLSLKPSEPIIC 76

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + S+ V E SQLM+AKR +C+LV++    L GIFTAKDLAFR+VG GL A + T+  IMT
Sbjct: 77  KTSSTVYEVSQLMSAKRENCILVVNDIGELLGIFTAKDLAFRIVGAGLSATSVTIDQIMT 136

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
            NPMC  ++T A++ALN MV +GFRHLPV +E   +VG+LDITKC  + ++K+ER + SS
Sbjct: 137 PNPMCANSNTPASEALNLMVHKGFRHLPVLDENNQIVGVLDITKCYAQQMEKLERMHSSS 196

Query: 247 KKLYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRD 304
           KKLY+AL+ V  E     QP  + QY + L+ KM  P L SVLD  + P    VKT+V D
Sbjct: 197 KKLYEALDNVHSEMGMMQQPLHVFQYFENLKNKMNGPTLESVLDATTTPVYTTVKTTVYD 256

Query: 305 AARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           A  LM+E +TTAVL+ + +  +AGIFTSKD+VLRVIAAGLDP  CS++RVMTP PD A  
Sbjct: 257 ATVLMKENKTTAVLIKDTNEEVAGIFTSKDVVLRVIAAGLDPKKCSIVRVMTPQPDIAKQ 316

Query: 364 QTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGG-- 420
             SI +AL++M++G YLNLP+V +   I+G+VDVLKLTYAT+ Q+   ++ +  N  G  
Sbjct: 317 DLSIQEALRQMFEGRYLNLPIVGNENDIVGIVDVLKLTYATLNQIKQTESNDLINSDGKS 376

Query: 421 ---------GPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP 471
                    GP WNKFW SL N+ D++S  SDS+                   G+G+  P
Sbjct: 377 GSETAINSEGPAWNKFWTSLDNE-DSDSVHSDSVT------------------GTGSAPP 417

Query: 472 --IP--------EIHPSESASAIDDGSMASFPRGHDENF-FTFKFKAP--NGKSHRFTVD 518
              P        +I PS+S S  +    +S       +  +TFKFK+P   G+ HR ++ 
Sbjct: 418 DVTPSEFHSFNFDIKPSDSISHTESPKKSSNLNNSTSDLSYTFKFKSPAVEGRVHRISLK 477

Query: 519 YTS-FEHIRATVASKLPSNVRDF-------------TIYYVXXXXXXXXXXXXXXXIDAV 564
            +     +R+ + SKL +N  +F              I YV               +D V
Sbjct: 478 PSEGVTKLRSLMDSKLYANDFEFMRVVKNDQDGESYAISYVDDEGDIVSITSDTDLLDCV 537

Query: 565 RIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHD 624
           RI Q+    +  L+I    + +              + E + +++  +   +    IP++
Sbjct: 538 RINQQLNNDKADLYIHNPHESA-------------PVNEMKNKKQPKQEKQEILKGIPNE 584

Query: 625 LLLPGAVLTLAIAIIGVFALSR 646
           +L+PGA+  LA +II  F +S+
Sbjct: 585 VLIPGALAVLATSIIVGFIMSK 606



>gi|401888948|gb|EJT52892.1| hypothetical protein A1Q1_00797 [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406697658|gb|EKD00914.1| hypothetical protein A1Q2_04787 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 729

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 265/660 (40%), Positives = 356/660 (53%), Gaps = 122/660 (18%)

Query: 77  EAIRKKVEHELNKK------------NRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQAL 124
           +++RKK+E+EL++K            +R +S+ L    +P R+    KGTVA L PS AL
Sbjct: 99  QSLRKKIENELSRKRPGGGRGPSEPQHRQESSFLK---RPSRR--HQKGTVAGLRPSPAL 153

Query: 125 TVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATI 184
           TV E   + +ASQL AAKR DCVLV+D EE LSGIFTAKDLAFRV  DGLD RTTTVA I
Sbjct: 154 TVPEGMSIADASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAFRVTADGLDPRTTTVAQI 213

Query: 185 MTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYG 244
           MTRNPM  ++ TSAT+AL  MV+R FRHL                   ++AL K+ER+  
Sbjct: 214 MTRNPMVTRDTTSATEALQVMVSRHFRHL-----------------VFHDALAKVERSSS 256

Query: 245 SSKKLYDALEGVEREWSTN-----QPTQILQYMDMLREKMACPDLSSVLDGSMPAE-VGV 298
           ++ +L  AL GV+ E   N     Q   ++ Y+D LR++MA PDL+SVLD S+P   V  
Sbjct: 257 ATSQLSMALAGVQTELGPNLTANPQAAAMMAYVDALRDRMAQPDLTSVLDTSLPPPTVTP 316

Query: 299 KTSVRDAARLMREYRTTAVLVMEHHS---------------IAGIFTSKDIVLRVIAAGL 343
           +TSVR+AARLM+E RTTAV V+E +                IAGIFTSKDIVLRVIAAGL
Sbjct: 317 RTSVREAARLMKERRTTAVCVLEPNGTSVMSGVSNNGVPPKIAGIFTSKDIVLRVIAAGL 376

Query: 344 DPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYA 402
           D S CSV+RVMTPHPDTAPP  ++ DALKKM+ GHYLNLPVV+  G +LG+VDVLKLTYA
Sbjct: 377 DSSRCSVVRVMTPHPDTAPPDMTVQDALKKMHTGHYLNLPVVESDGRLLGIVDVLKLTYA 436

Query: 403 TMEQMYSMQNQENGNDGGGPMWNKFWNSL---ANDGDNESTVSDSIAXXXXXXXXXXXXX 459
           T+EQ+ +M +  +     GPMW+KF+++L     D ++ S +S +I              
Sbjct: 437 TLEQIDTMNDDRS---DAGPMWSKFFDTLNTAGGDDESHSAISGAIPDTPSKVGHQRAL- 492

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDD--GSMASFPRGH----------DENFFTFKFKA 507
                 S   SP+ E+ P +SAS +++    ++   +G+          D+  + FKFK 
Sbjct: 493 ------SNATSPMSEVMPGDSASVVNEVNDGISDLGKGNTSSLAPALPVDDGTYVFKFKT 546

Query: 508 PNGKSHRFTVDYTSFEHIRATVASKL--------PSNVRD------FTIYYVXXXXXXXX 553
           P+G+ HRF   + S++ +R  +  KL        P++ R       FTI Y         
Sbjct: 547 PSGRVHRFQARHDSYDLLRDIIHGKLQSDPFFDEPTDGRPAADSSVFTIAYTDDEGDLVQ 606

Query: 554 XXXXXXXIDAVRIAQRQGMSRVILHIQEIE--KKSLRXXXXXXXXXXXXILEKRRRRKRG 611
                  +DAV  A+ Q   RV L I   +  +++ R            + E     K  
Sbjct: 607 ITADGDVLDAVNTARGQKTDRVTLLINGGKNWEEAARSAGGEDAVEKLKVAETVPAAKGE 666

Query: 612 KHAPDYNLP-------------------------IPHDLLLPGAVLTLAIAIIGVFALSR 646
            H  D                             +P DL LP A+  L + I+GVF  SR
Sbjct: 667 SHLLDEGADPAHAAAYGAKGVHAKPGSEELIGGVLPKDLALPAAIGFLGVVILGVFIASR 726



>gi|238878382|gb|EEQ42020.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 605

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 256/620 (41%), Positives = 348/620 (56%), Gaps = 65/620 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SK+D+AIRK++E++L KK    STSL+ R     +  GA GTV  L P + +  +
Sbjct: 9   SRQRQSKRDDAIRKRIENDLRKKK--ASTSLSTR-----RSRGAPGTVLWLKPGEPIICK 61

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +A V E +QLM A+R +CVLV++    L GIFTAKD+AFR+VG GL+A   T+ TIMT+
Sbjct: 62  PTATVYEVAQLMTARRENCVLVVNEIGELLGIFTAKDVAFRIVGSGLNATQVTIDTIMTK 121

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C      A DALN MV RGFRHLPV +E+  +VG+LDITK   + ++K+ER + SSK
Sbjct: 122 NPICANAADPAGDALNLMVERGFRHLPVLDEKSQIVGVLDITKSYAQQMEKLERMHSSSK 181

Query: 248 KLYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDA 305
           KL++AL+ V  E     QP  + QY + L+ KM  P L   LD  ++P  V VK SV +A
Sbjct: 182 KLHEALDSVHNEIGVGEQPHHVFQYFETLKNKMNGPTLEDALDANTVPTYVNVKASVHEA 241

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E RTTAVLV + +  +AGIFTSKD+VLRVIAAGLDP  CSV+RVMTP PD AP  
Sbjct: 242 TMLMKENRTTAVLVKDTNEQVAGIFTSKDVVLRVIAAGLDPKKCSVVRVMTPQPDVAPIG 301

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGG--- 420
             + DAL+KM+DGHYLNLPVV + G I+G+V+VLKLT+ T+ Q+  ++  E  N      
Sbjct: 302 LPVQDALRKMFDGHYLNLPVVANEGDIIGVVEVLKLTHITLNQIKQLETSETSNGSTAVD 361

Query: 421 ----GPMWNKFWNSLAN-DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG---NISPI 472
               GP WNKFW SL N DGD ES  SDS+                 +RGS    +I+P 
Sbjct: 362 STNEGPAWNKFWTSLDNTDGDTESAHSDSLMET--------------SRGSATAPDITPS 407

Query: 473 P------EIHPSESASAIDDGSM--ASFPRGH----DENFFTFKFKAP--NGKSHRFTVD 518
                  +I PS+S S ++   +  +SF        DE  F FKFK+P   G+ HR T+ 
Sbjct: 408 EFHSFNVDIKPSDSVSHVNTSPLKASSFKMTSSMTVDEIPFIFKFKSPGIEGRVHRITLK 467

Query: 519 YT-SFEHIRATVASKLPSNVRDFTIYYV------XXXXXXXXXXXXXXXIDAVRIAQRQG 571
            +     +R  +  KL  + +DF    V                      D V I     
Sbjct: 468 ASDGIIKLRELMNEKL--HDKDFAFLNVPKPDGNASTQETYAISYVDDEGDVVSITSDSD 525

Query: 572 MS---RVILHIQEIEKKSLRXXXXXXXXXXXXI--LEKRRRRKRGKHAPDYNLPIPHDLL 626
           ++   R+ L++Q  EK  L             I  + K  + + G         IP+++L
Sbjct: 526 LAECIRINLNLQN-EKADLYLHNPHEPAPIENIKSIHKSAKNRHGNADNGLIFGIPNEIL 584

Query: 627 LPGAVLTLAIAIIGVFALSR 646
           +P A+  L  +II  F LSR
Sbjct: 585 IPSALAVLGASIIVGFTLSR 604



>gi|68479125|ref|XP_716368.1| hypothetical protein CaO19.12702 [Candida albicans SC5314]
 gi|68479256|ref|XP_716307.1| hypothetical protein CaO19.5238 [Candida albicans SC5314]
 gi|46437973|gb|EAK97311.1| hypothetical protein CaO19.5238 [Candida albicans SC5314]
 gi|46438035|gb|EAK97372.1| hypothetical protein CaO19.12702 [Candida albicans SC5314]
          Length = 605

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 256/620 (41%), Positives = 348/620 (56%), Gaps = 65/620 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR SK+D+AIRK++E++L KK    STSL+ R     +  GA GTV  L P + +  +
Sbjct: 9   SRQRQSKRDDAIRKRIENDLRKKK--ASTSLSTR-----RSRGAPGTVLWLKPGEPIICK 61

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +A V E +QLM A+R +CVLV++    L GIFTAKD+AFR+VG GL+A   T+ TIMT+
Sbjct: 62  PTATVYEVAQLMTARRENCVLVVNEIGELLGIFTAKDVAFRIVGSGLNATQVTIDTIMTK 121

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C      A DALN MV RGFRHLPV +E+  +VG+LDITK   + ++K+ER + SSK
Sbjct: 122 NPICANAADPAGDALNLMVERGFRHLPVLDEKSQIVGVLDITKSYAQQMEKLERMHSSSK 181

Query: 248 KLYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDA 305
           KL++AL+ V  E     QP  + QY + L+ KM  P L   LD  ++P  V VK SV +A
Sbjct: 182 KLHEALDSVHNEIGVGEQPHHVFQYFETLKNKMNGPTLEDALDANTVPTYVNVKASVHEA 241

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E RTTAVLV + +  +AGIFTSKD+VLRVIAAGLDP  CSV+RVMTP PD AP  
Sbjct: 242 TMLMKENRTTAVLVKDTNEQVAGIFTSKDVVLRVIAAGLDPKKCSVVRVMTPQPDVAPIG 301

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGG--- 420
             + DAL+KM+DGHYLNLPVV + G I+G+V+VLKLT+ T+ Q+  ++  E  N      
Sbjct: 302 LPVQDALRKMFDGHYLNLPVVANEGDIIGVVEVLKLTHITLNQIKQLETSETSNGSTAVD 361

Query: 421 ----GPMWNKFWNSLAN-DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG---NISPI 472
               GP WNKFW SL N DGD ES  SDS+                 +RGS    +I+P 
Sbjct: 362 STNEGPAWNKFWTSLDNTDGDTESAHSDSLMET--------------SRGSATAPDITPS 407

Query: 473 P------EIHPSESASAIDDGSM--ASFPRGH----DENFFTFKFKAP--NGKSHRFTVD 518
                  +I PS+S S ++   +  +SF        DE  F FKFK+P   G+ HR T+ 
Sbjct: 408 EFHSFNVDIKPSDSVSHVNTSPLKASSFKMTSSMTVDEIPFIFKFKSPGIEGRVHRITLK 467

Query: 519 YT-SFEHIRATVASKLPSNVRDFTIYYV------XXXXXXXXXXXXXXXIDAVRIAQRQG 571
            +     +R  +  KL  + +DF    V                      D V I     
Sbjct: 468 ASDGIIKLRELMNEKL--HDKDFAFLNVPKPDGNSSTQETYAISYVDDEGDVVSITSDSD 525

Query: 572 MS---RVILHIQEIEKKSLRXXXXXXXXXXXXI--LEKRRRRKRGKHAPDYNLPIPHDLL 626
           ++   R+ L++Q  EK  L             I  + K  + + G         IP+++L
Sbjct: 526 LAECIRINLNLQN-EKADLYLHNPHEPAPIENIKSIHKSAKNRHGNADNGLIFGIPNEIL 584

Query: 627 LPGAVLTLAIAIIGVFALSR 646
           +P A+  L  +II  F LSR
Sbjct: 585 IPSALAVLGASIIVGFTLSR 604



>gi|448114822|ref|XP_004202675.1| Piso0_001524 [Millerozyma farinosa CBS 7064]
 gi|359383543|emb|CCE79459.1| Piso0_001524 [Millerozyma farinosa CBS 7064]
          Length = 598

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 241/608 (39%), Positives = 347/608 (57%), Gaps = 64/608 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SKKDEAIR+K+E +L+KK R       N  K  R   G  G+V +L PS+++  R
Sbjct: 25  SRKRQSKKDEAIRRKIEKDLSKKKR-------NNAKSTRFKKGTPGSVLALKPSESIICR 77

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            ++ V EA+QLM+ KR +C+LV++    L GIFTAKDLAFR+VG GL+A + T+  IMT 
Sbjct: 78  TTSTVYEAAQLMSTKRENCLLVVNDAGELMGIFTAKDLAFRIVGSGLNANSVTIDQIMTP 137

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPMC  ++T A++ALN MV + FRHLPV ++   +VG+LDITKC  + ++++ER Y SSK
Sbjct: 138 NPMCANSNTPASEALNLMVHKKFRHLPVLDDSNQIVGILDITKCYSQQMERLERMYLSSK 197

Query: 248 KLYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTSVRDA 305
           KLY+AL+ V  +   T Q + I +Y + L++K++ P L ++LD S  P    +KTSV DA
Sbjct: 198 KLYEALDNVHSQIGFTEQSSHIAEYFEHLKDKISGPRLETMLDNSTAPIYATIKTSVYDA 257

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM++  TTAVLV + +  +AGIFTSKD+VLRVIA+GLDP  CS++RVMTP PD A   
Sbjct: 258 TVLMKDNNTTAVLVKDTNDEVAGIFTSKDVVLRVIASGLDPKNCSIVRVMTPQPDVANCG 317

Query: 365 TSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGND----- 418
            SI +AL+KM++GHYLNLPV D  G I+G+VDVLKLTYA + Q+  +++ E  N+     
Sbjct: 318 VSIQEALRKMFNGHYLNLPVTDDEGEIVGIVDVLKLTYAVLNQIKQLEHSETDNNRNETR 377

Query: 419 ----GGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE 474
               G GP WNKFW SL N+ + +S  SDS                  T          E
Sbjct: 378 AISQGEGPAWNKFWTSLDNE-ETDSIHSDSFQGSKFQDLTTPDLQTFST----------E 426

Query: 475 IHPSESASAIDD--GSMASFPRGHDENFFTFKFKAP--NGKSHRFTVD-YTSFEHIRATV 529
           + P +S S I     S +SF     +  F FKFK+P  +G+ +R T +       +R  +
Sbjct: 427 LAPFDSVSHITTPLKSESSFKVSTSD--FVFKFKSPGISGRVNRVTFNPEEGIISLRNLI 484

Query: 530 ASKL-----------PSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
            +KL            S    + I +V               ID V+I +    ++V ++
Sbjct: 485 DAKLHWKDKAALKINESEGETYAISFVDDEGDVVSITSDVDLIDCVKIYENLRKNKVEIY 544

Query: 579 IQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAI 638
           I    + ++             I +++R   +G      NL IP + +LPGA+  LA +I
Sbjct: 545 IHNPNEPAI-------------IPQEKREIIKGSRKK--NLGIPQEFILPGALTVLATSI 589

Query: 639 IGVFALSR 646
           +    LSR
Sbjct: 590 LIGITLSR 597



>gi|254565947|ref|XP_002490084.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238029880|emb|CAY67803.1| Hypothetical protein PAS_chr1-1_0425 [Komagataella pastoris GS115]
 gi|328350486|emb|CCA36886.1| Meiotically up-regulated gene 70 protein [Komagataella pastoris CBS
           7435]
          Length = 625

 Score =  396 bits (1018), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 243/632 (38%), Positives = 353/632 (55%), Gaps = 84/632 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNR--TKSTSLNNRGKPQRQVPG--------------- 110
           +R R  KKD+AIR+++E    K+    T STS      P R V G               
Sbjct: 27  SRSRQCKKDDAIRRRIEQGFKKRTSRPTGSTS------PTRNVNGILSSPIKRNKTISRN 80

Query: 111 --AKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFR 168
               GTV +L PS+ +  + +  V EA+QLM  K+ +C+LV+D  + LSGIFTAKDLAFR
Sbjct: 81  KHEPGTVMALKPSEPIICKPNYTVHEAAQLMGFKKENCILVVDENDELSGIFTAKDLAFR 140

Query: 169 VVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDI 228
           +VG GL A +TTV  IMT +P+C K  T A++ALN MV +GFRHLP+ ++   +VG+LDI
Sbjct: 141 IVGSGLRANSTTVDAIMTPSPLCCKTTTKASEALNLMVTKGFRHLPIVDDTNQIVGILDI 200

Query: 229 TKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL 288
           TKC  EA+ K+ER Y SSKKLYDALEGV  E    QP +++QY + L+  +  P+LS+VL
Sbjct: 201 TKCYNEAMSKLERMYESSKKLYDALEGVNSELQAQQPLEVIQYFENLKRMIDGPNLSTVL 260

Query: 289 DG-SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS---IAGIFTSKDIVLRVIAAGLD 344
           D  ++P  V VK++V++AA LMR+ RTTAVLV + ++   + GIFTSKD+VLRVIAA L+
Sbjct: 261 DDTTLPVYVDVKSTVQEAASLMRDNRTTAVLVQDSNNDNEVTGIFTSKDVVLRVIAADLN 320

Query: 345 PSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGS--ILGMVDVLKLTYA 402
           P  CSVIRVMTP PD A  + S+ +AL+KM++G YLNLP++D  S  I+G+V+VLKLT+ 
Sbjct: 321 PKNCSVIRVMTPKPDYATSELSVHEALRKMFEGRYLNLPIIDPLSTEIIGIVEVLKLTHV 380

Query: 403 TMEQMYSMQNQ--------------ENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXX 448
           T+ Q+ +MQ Q              ++ ++  GP WNKFW SL  + D+ES  S      
Sbjct: 381 TLSQIKTMQTQIGTSSSVETVKSGFDSPDETQGPAWNKFWTSLDQE-DSESLHS------ 433

Query: 449 XXXXXXXXXXXXXRTRGSGNISPIP---EIHPSESASAIDDGSMASFPRGHDENF-FTFK 504
                            S  +   P   EI PS+S S    G+  S     D N  F+FK
Sbjct: 434 -----LNSDTQSPFEVTSSEMQQFPLDHEIQPSDSVSF--SGNSHSRTLNVDYNSPFSFK 486

Query: 505 FKAPNGKSHRFTVD-YTSFEHIRATVASKLPSNVRD-------FTIYYVXXXXXXXXXXX 556
            + P G++HR ++        +R+ ++SK  +  R        F I Y+           
Sbjct: 487 LRTPVGRTHRVSLKPMEGICQLRSIISSKFNNIERQLLIAEDAFAISYIDDEGDLISVTT 546

Query: 557 XXXXIDAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPD 616
               +D V +++     +V L I + +                  L     R + ++  +
Sbjct: 547 DQDLLDCVYMSKLDHKEKVDLLIHKPDD-------------TPDTLLNGLPRTKTEYTAE 593

Query: 617 YNLPIPHDLLLPGAVLTLAIAIIGVFALSRSK 648
           +   +P+++LLPGA+  LA +I+ +F L+R+K
Sbjct: 594 FVKGVPNEILLPGAIFALAASIVAIFTLARNK 625



>gi|448112259|ref|XP_004202051.1| Piso0_001524 [Millerozyma farinosa CBS 7064]
 gi|359465040|emb|CCE88745.1| Piso0_001524 [Millerozyma farinosa CBS 7064]
          Length = 598

 Score =  396 bits (1018), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 240/608 (39%), Positives = 345/608 (56%), Gaps = 64/608 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SKKDEAIR+K+E +L+KK R       N  K  R   G  G+V +L PS+++  R
Sbjct: 25  SRKRQSKKDEAIRRKIEKDLSKKKR-------NNAKSTRFKKGTPGSVLALKPSESIICR 77

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            ++ V EA+QLM+ KR +C+LV++    L GIFTAKDLAFR+VG GL+A + T+  IMT 
Sbjct: 78  TTSTVYEAAQLMSTKRENCLLVVNDAGELMGIFTAKDLAFRIVGSGLNANSVTIDQIMTP 137

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NPMC  ++T A++ALN MV + FRHLPV ++   +VG+LDITKC  + ++++ER Y SSK
Sbjct: 138 NPMCANSNTPASEALNLMVHKKFRHLPVLDDSNQIVGILDITKCYSQQMERLERMYLSSK 197

Query: 248 KLYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTSVRDA 305
           KLY+AL+ V  +   T Q + I +Y + L++K++ P L ++LD S  P    +KTSV DA
Sbjct: 198 KLYEALDNVHSQIGYTEQSSHIAEYFEHLKDKISGPRLETMLDNSTAPIYATIKTSVYDA 257

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM++  TTAVLV + +  +AGIFTSKD+VLRVIA+GLDP  CS++RVMTP PD A   
Sbjct: 258 TVLMKDNNTTAVLVKDTNDEVAGIFTSKDVVLRVIASGLDPKNCSIVRVMTPQPDVANYS 317

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGN------ 417
            SI +AL+KM++GHYLNLPV  D G I+G+VDVLKLTYA + Q+  +++ E+ N      
Sbjct: 318 VSIQEALRKMFNGHYLNLPVTNDEGEIVGIVDVLKLTYAVLNQIKQLEHSESDNTKNETR 377

Query: 418 ---DGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPE 474
               G GP WNKFW SL N+ + +S  SDS                  T          E
Sbjct: 378 ATSQGEGPAWNKFWTSLDNE-ETDSVHSDSFQGSKLHDLNTPDLQTFST----------E 426

Query: 475 IHPSESASAIDD--GSMASFPRGHDENFFTFKFKAP--NGKSHRFTVD-YTSFEHIRATV 529
           + P +S S I     S ASF     +  F FKFK+P  +G+ +R T +       +R  +
Sbjct: 427 LAPFDSVSHITTPLKSDASFKVSSSD--FVFKFKSPGISGRMNRVTFNPEEGIGSLRNLI 484

Query: 530 ASKL-----------PSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
            +KL            S    + I +V               ID V+I +    ++V ++
Sbjct: 485 DAKLHWKDKEALSLNESEGETYAISFVDDEGDVVSITSDVDLIDCVKIYENLKRNKVEIY 544

Query: 579 IQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAI 638
           I    + ++                 + +R+  K     NL IP + +LPGA+  LA +I
Sbjct: 545 IHNPNEPAII---------------PQEKREITKDPRKKNLGIPQEFILPGALTVLATSI 589

Query: 639 IGVFALSR 646
           +    L+R
Sbjct: 590 LIGITLNR 597



>gi|260943069|ref|XP_002615833.1| hypothetical protein CLUG_04715 [Clavispora lusitaniae ATCC 42720]
 gi|238851123|gb|EEQ40587.1| hypothetical protein CLUG_04715 [Clavispora lusitaniae ATCC 42720]
          Length = 627

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/486 (46%), Positives = 309/486 (63%), Gaps = 40/486 (8%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKK-NRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +R+R SKKDEAIR+K+E+EL+KK  ++  TS  N+  P        GTV+ L PS+A+  
Sbjct: 55  SRKRQSKKDEAIRRKIEYELSKKRGQSSRTSRKNKAVP--------GTVSYLKPSEAIIC 106

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           +++A V +A+QLM+A+R +C+LV++ +  L GIFTAKDLAFRVVG GL+A  T +  IMT
Sbjct: 107 KKNATVYQAAQLMSARRENCILVVNDDGELIGIFTAKDLAFRVVGSGLNANATLIEQIMT 166

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
            +P+C   D+ A++AL  MV +GFRHLPV +++  +VG+LDITK   + ++K+ER + SS
Sbjct: 167 PSPICANADSPASEALTLMVEKGFRHLPVLDDKSRIVGVLDITKSYAQQMEKLERLHASS 226

Query: 247 KKLYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLD-GSMPAEVGVKTSVRD 304
           K LY+AL+ V  E    +QP  I +Y + L+ KM  P LSSVLD  + P    VK SV +
Sbjct: 227 KNLYEALDSVHNEMGVADQPRHIFEYFEDLKSKMDGPTLSSVLDSATTPIYTNVKCSVLE 286

Query: 305 AARLMREYRTTAVLVMEHH-SIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           A   M+E RTTAVLV +    + GIFTSKD+VLRVIAAGL+P TCSV+RVMTP PD A  
Sbjct: 287 ATIQMKENRTTAVLVNDTSGELTGIFTSKDVVLRVIAAGLNPKTCSVVRVMTPQPDVANE 346

Query: 364 QTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGND---- 418
           +TSI  AL++M++GHYLNLPVVD  G I+G+VDVLKLTYAT+ Q+  ++     +D    
Sbjct: 347 RTSIQQALRQMFEGHYLNLPVVDNEGDIIGIVDVLKLTYATLNQIKRIEQSSRTSDSVEE 406

Query: 419 -GGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHP 477
              GP WNKFW SL ND D  +  SDS+A                   S NI    EI P
Sbjct: 407 SSEGPAWNKFWTSLDNDSDYAN--SDSLASAPDVTPSEMQ--------SFNI----EIGP 452

Query: 478 SESASAIDDGSMASFPRGHDENF-----FTFKFKAP--NGKSHRFTVDYT-SFEHIRATV 529
           S+S SA++  S+         N      FTFKFK+P  +G+ HR ++  T +   +R+ +
Sbjct: 453 SDSVSAVEASSLLKQSSKSMSNISLTESFTFKFKSPAMHGRVHRVSLKQTDTLSDLRSVI 512

Query: 530 ASKLPS 535
             KL S
Sbjct: 513 NEKLHS 518



>gi|448535220|ref|XP_003870934.1| hypothetical protein CORT_0G01200 [Candida orthopsilosis Co 90-125]
 gi|380355290|emb|CCG24807.1| hypothetical protein CORT_0G01200 [Candida orthopsilosis]
          Length = 620

 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 249/621 (40%), Positives = 340/621 (54%), Gaps = 75/621 (12%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R+R SK+DEAIR+++EH+L+KK +       N  +  R      GTV SL PS  +  + 
Sbjct: 31  RKRQSKRDEAIRRRIEHDLSKKKK-------NGSRITRHKKAIPGTVLSLKPSDPIICKT 83

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +A V E SQ+M A R +CVLV++    L GIFTAKDLAFR+VG GL A + T+  IMT +
Sbjct: 84  TATVHEVSQMMTATRENCVLVVNDIGELLGIFTAKDLAFRIVGSGLTANSVTIDQIMTAD 143

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C   +  A++ALN MV RGFRHLPV + +  +VG+LDITKC  + ++K+ER +  SK 
Sbjct: 144 PICANANNPASEALNLMVERGFRHLPVLDNDNQIVGVLDITKCYAQQMEKLERMHAQSKT 203

Query: 249 LYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTSVRDAA 306
           LYDA   V  E    +QP  + QY + L+ KM  P L +VLD +  P  V VKTSV +A 
Sbjct: 204 LYDAWNSVHNEIGVQDQPQHVFQYFETLKSKMNGPTLDNVLDETTEPIYVSVKTSVYEAT 263

Query: 307 RLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQT 365
            LM+E +TTAVLV + +  + GIFTSKD+VLRVIAAGLDP  CSV+RVMT HPD A    
Sbjct: 264 VLMKENKTTAVLVKDTNQEVTGIFTSKDVVLRVIAAGLDPKNCSVVRVMTSHPDVAYASL 323

Query: 366 SILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQ---------EN 415
            I  AL+KM+DGHYLNLPVV+    I+GMVDVLKLTYAT+ Q+  ++ +         E 
Sbjct: 324 PIQQALRKMFDGHYLNLPVVNNEDDIIGMVDVLKLTYATLTQIKQLEAKDLPSSLDVPEQ 383

Query: 416 GNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI 475
           GN+  GP WNKFW SL    DNES  SDS+                    S N+    +I
Sbjct: 384 GNE--GPAWNKFWTSL---DDNESVHSDSLMEESAAANAPDVTPSEFQ--SFNV----DI 432

Query: 476 HPSESASAIDD----GSMASFPRGH---DENFFTFKFKAP--NGKSHRFTVDYTS-FEHI 525
            PS+S S +D+    GS A+    H   D++ + FKFK+P   G+ HR T+  +     +
Sbjct: 433 KPSDSISHVDESPTKGSTAAGSLAHSVQDDSPYIFKFKSPAIEGRVHRITLKPSDGILLL 492

Query: 526 RATVASKL------------PSNVRD--------FTIYYVXXXXXXXXXXXXXXXIDAVR 565
           R  + SKL            PS+  D          I Y+                + VR
Sbjct: 493 RKLINSKLNDKDFIKLNVSKPSDNEDEPASSNNGVAISYIDDEGDVVSITTDNDLTECVR 552

Query: 566 IAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDL 625
           I  R G  +  L++    +                 +++ +  KRG     +   I +++
Sbjct: 553 INHRLGNEKADLYLHNPHQHPS--------------VDEIKPIKRGTKQEPFVSGIANEV 598

Query: 626 LLPGAVLTLAIAIIGVFALSR 646
           L+PG +  LA +II   ALSR
Sbjct: 599 LVPGVLAVLASSIIIGIALSR 619



>gi|344232849|gb|EGV64722.1| hypothetical protein CANTEDRAFT_104365 [Candida tenuis ATCC 10573]
          Length = 619

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 243/621 (39%), Positives = 345/621 (55%), Gaps = 76/621 (12%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SK+D+AIR+K+E +L+KK R          K  RQ     GTV +L PS+A+T +
Sbjct: 32  SRRRQSKRDDAIRRKIESDLSKKRR-------GAAKVSRQRKATPGTVLALKPSEAVTCK 84

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S  V EASQLM AKR +C+LV+  +  L GIFTAKDLAFRVVG  L+A   T+  IMT 
Sbjct: 85  PSTTVFEASQLMTAKRENCILVVGEDGELLGIFTAKDLAFRVVGSNLNANVITIDQIMTP 144

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C   +  A+DAL  M+ + FRHLPV +    +VG+LDITKC  + ++K+ER + SSK
Sbjct: 145 NPLCTNANDPASDALTVMIQKRFRHLPVLDNRDRIVGVLDITKCYSQQMEKLERMHESSK 204

Query: 248 KLYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDA 305
           +LY+A + V  E +   QP Q+ QY + L+ KM  P L +VLD  ++P    +KT+V +A
Sbjct: 205 RLYEAFDTVHSEMAVVQQPLQVFQYFEELKSKMNGPTLDTVLDSRTVPIYCSIKTTVYEA 264

Query: 306 ARLMREYRTTAVLVMEHHS-IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E  TTAVLV ++   + GIFTSKD+VLRVIAAGL P  CS++RVMTP PD A   
Sbjct: 265 TVLMKENNTTAVLVKDNEDKVNGIFTSKDVVLRVIAAGLTPKNCSIVRVMTPQPDVARHD 324

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQEN------GN 417
            SI ++L+KM+DGHYLNLPVV D G I+G+V+VLKLTYAT+ Q+  +++QE+        
Sbjct: 325 LSIQESLRKMFDGHYLNLPVVGDSGDIIGIVEVLKLTYATLNQIKQVKDQESPEIVSEAK 384

Query: 418 DGG--GPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXR---TRGSGNISPI 472
            GG  GP WNKFW SL ND D  S  SDS+                +   T    N+   
Sbjct: 385 SGGAEGPAWNKFWTSLDNDAD--SVNSDSLVVDSSGRPQTPTNLTSQAGLTSSDLNL--- 439

Query: 473 PEIHPSESASAID--DGSMASFPRGHDENFFTFKFKAP--NGKSHRFTVDYT-------- 520
            +I PS+S S I+    S  S     DE+F   KFK+P    + HR ++  T        
Sbjct: 440 -DIKPSDSISHIETPQKSRTSLLDSLDESFV-LKFKSPANENRVHRISIKPTDGLTKLRE 497

Query: 521 ---------SFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQG 571
                     F+++R T   K+  + + + I YV               +D V+I  R  
Sbjct: 498 LIDEKLHPKDFQYLRVT---KVNDDGKTYAISYVDDEGDIVSITSDNDLLDCVKINLRLA 554

Query: 572 MSRVILHIQE------IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDL 625
             +  L++        IE   +R               KR RR     + +    +P+++
Sbjct: 555 SHKANLYLHNPHEPAPIENIKIRK-------------PKRPRRV----SENGFFGVPNEV 597

Query: 626 LLPGAVLTLAIAIIGVFALSR 646
           L+PG +L LA A +  +++++
Sbjct: 598 LIPGVLLVLATATLIGYSVNK 618



>gi|255728581|ref|XP_002549216.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240133532|gb|EER33088.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 618

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 243/617 (39%), Positives = 345/617 (55%), Gaps = 50/617 (8%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SK+D+AIR+++EH+LNKK +  +TS   R    +  PG   TV SL PS  +  +
Sbjct: 13  SRKRQSKRDDAIRRRIEHDLNKKKKNGTTSTRRR----KATPG---TVLSLKPSDPIICK 65

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            ++ V E SQLM AKR +CVLV+D    L GIFTAKDLAFR+VG GL+A   T+  IMT+
Sbjct: 66  TTSTVYEVSQLMTAKRENCVLVVDEVGQLLGIFTAKDLAFRIVGSGLNANQVTIDQIMTK 125

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           +P+C   + +A +AL  MV +GFRHLPV +++  +VG+LDITKC  E + K+ER + SSK
Sbjct: 126 DPICANANNAAGEALTLMVEKGFRHLPVLDDDNHIVGVLDITKCYAEQMSKLERMHSSSK 185

Query: 248 KLYDALEGVEREWS-TNQPTQILQYMDMLREKMACPDLSSVLD-GSMPAEVGVKTSVRDA 305
           KLY+AL+ V  E   + QP  + QY + L+ KM  P L +VLD  + P    VK SV +A
Sbjct: 186 KLYEALDSVHSEMGVSEQPQHVFQYFETLKNKMNGPTLENVLDFHTEPIYTNVKASVFEA 245

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E RTTAVLV + +  +AGIFTSKD+VLRVIAAGLDP  CS++RVMTP PD A   
Sbjct: 246 TILMKENRTTAVLVKDTNDEVAGIFTSKDVVLRVIAAGLDPKKCSIVRVMTPQPDVAHVS 305

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSM-----------QN 412
             + +AL+KM+DGHYLNLPVV D   I+G+VDVLKLTY T+ Q+  +            +
Sbjct: 306 LPVPEALRKMFDGHYLNLPVVGDEDEIIGIVDVLKLTYVTLNQLKQLETTAAFTTETGTD 365

Query: 413 QENGNDGGGPMWNKFWNSLAN--DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNIS 470
             +   G GP WNKFW SL N  +G+ ES  SDS+                 + G+ +I+
Sbjct: 366 SVDTPTGEGPAWNKFWTSLDNHTEGETESAHSDSLMDAGAFSNSGVGAGITGS-GAPDIT 424

Query: 471 PIP------EIHPSESASAIDDGSMASFPRGH------DENFFTFKFKAP--NGKSHRFT 516
           P        +I PS+S S ++     +    +      DE  FTFKFK+P   G+ HR T
Sbjct: 425 PSEFHSFNVDIKPSDSVSHVESLPFKASSLKYASSAAIDEIPFTFKFKSPGIEGRVHRIT 484

Query: 517 VDYTS-FEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRV 575
           +  +     ++  + +KL  + +D+T+  +                D V I     +   
Sbjct: 485 LKSSEGIVRLKELIDAKL--HEKDYTVLNIESDEKYAISYVDDEG-DVVSITSDDDLCEC 541

Query: 576 I---LHIQEIEKKSL---RXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPG 629
           I   L +Q  +K  L                I  ++  RK    + D    +P+++L+P 
Sbjct: 542 IKINLKLQN-DKADLYLHNPHEHATIEDVKSIYSRKSVRKNNIGSSDLIAGVPNEILIPS 600

Query: 630 AVLTLAIAIIGVFALSR 646
           A+  L  +II  F  +R
Sbjct: 601 ALAVLGASIIIGFTFAR 617



>gi|241950133|ref|XP_002417789.1| CBS/PB1 domain-containing protein [Candida dubliniensis CD36]
 gi|223641127|emb|CAX45503.1| conserved hypothetical protein [Candida dubliniensis CD36]
          Length = 605

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 249/611 (40%), Positives = 346/611 (56%), Gaps = 47/611 (7%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +RQR S++D+AIRK++E++L KK  + STS        R+  GA GTV  L P + +  +
Sbjct: 9   SRQRQSRRDDAIRKRIENDLRKKKASTSTS-------TRRSRGAPGTVLWLKPGEPIICK 61

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +A V E +QLM A+R +CVLV++    L GIFTAKD+AFR+VG GL+A   T+ TIMT+
Sbjct: 62  PTATVYEVAQLMTARRENCVLVVNEIGELLGIFTAKDVAFRIVGSGLNATQVTIDTIMTK 121

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C      A DALN MV +GFRHLPV +E+  +VG+LDITK   + ++K+ER + SSK
Sbjct: 122 NPICANATDPAGDALNLMVEKGFRHLPVLDEKSQIVGVLDITKSYAQQMEKLERMHSSSK 181

Query: 248 KLYDALEGVEREWSTN-QPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDA 305
           KL++AL+ V  E   N QP  + QY + L+ KM  P L   LD  ++P  V VK SV +A
Sbjct: 182 KLHEALDSVHNEIGVNEQPHHVYQYFETLKNKMNGPTLEDALDANTVPTYVNVKASVHEA 241

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E RTTAVLV + +  +AGIFTSKD+VLRVIAAGLDP  CSV+RVMTP PD AP  
Sbjct: 242 TMLMKENRTTAVLVKDTNEQVAGIFTSKDVVLRVIAAGLDPKKCSVVRVMTPQPDVAPIG 301

Query: 365 TSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQENGNDGG--- 420
             + DAL+KM+DGHYLNLPVV + G I+G+V+VLKLT+ T+ Q+  ++  +  N      
Sbjct: 302 LPVQDALRKMFDGHYLNLPVVANEGDIIGVVEVLKLTHITLNQIKQLETSDTSNGSTAVE 361

Query: 421 ----GPMWNKFWNSLAN-DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI 475
               GP WNKFW SL N DGD ES  SDS+                    S N+    +I
Sbjct: 362 STNEGPAWNKFWTSLDNTDGDTESAHSDSLMETSHGSATAPDITPSEFH-SFNV----DI 416

Query: 476 HPSESASAIDDGSM--ASFPRGH----DENFFTFKFKAP--NGKSHRFTVDYT-SFEHIR 526
            PS+S S ++   +  +SF        DE  F FKFK+P   G+ HR T+  +     +R
Sbjct: 417 KPSDSVSYVNSSPLKASSFKMTSSMTVDEIPFIFKFKSPGIEGRVHRITLKASDGIIKLR 476

Query: 527 ATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXI------DAVRIAQRQGMS---RVIL 577
             +  KL  + +DF    V                      D V I     ++   R+ L
Sbjct: 477 ELMNEKL--HEKDFAFLNVPKPDENSSTQETYAISYVDDEGDVVSITSDSDLAECIRINL 534

Query: 578 HIQEIEKKSLRXXXXXXXXXXXXI-LEKRRRRKRGKHAPDYNL-PIPHDLLLPGAVLTLA 635
           ++Q  +K  L             I L  +  + R  +A +  L  IP+++L+P A+  L 
Sbjct: 535 NLQN-DKADLYLHNPHEPAPIENIKLIHKSGKNRHVNADNSLLFGIPNEILIPSALAVLG 593

Query: 636 IAIIGVFALSR 646
            ++I  F LS+
Sbjct: 594 ASVILGFTLSK 604



>gi|50302383|ref|XP_451126.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640257|emb|CAH02714.1| KLLA0A02893p [Kluyveromyces lactis]
          Length = 637

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 242/627 (38%), Positives = 346/627 (55%), Gaps = 66/627 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSL--NNRGKPQRQVPGAKGTVASLNPSQALTV 126
           R+R SK+DEAIR+K+E++L+KK   KS++    N GK  R    + GTV SL+PS+ +  
Sbjct: 26  RKRQSKRDEAIRRKLENDLSKKKAGKSSTKKGQNSGKKNRNA-SSPGTVLSLSPSEPVVC 84

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEH------------LSGIFTAKDLAFRVVGDGL 174
           + SA V EA+QLM+AKR +C+LV+D ++             L GIFTAKDLAFRVVG GL
Sbjct: 85  KPSATVYEAAQLMSAKRENCILVVDYDDDTNLEDDSSISGALLGIFTAKDLAFRVVGTGL 144

Query: 175 DARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGD-VVGLLDITKCLY 233
            A + T+  IMT +P+C  +DT A+DALN MV RGFRHLPV +E+   ++ +LDITKC  
Sbjct: 145 KASSVTIDQIMTPHPLCATSDTLASDALNLMVERGFRHLPVIDEDTHAIISVLDITKCYQ 204

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWST----NQPTQILQYMDMLREKMACPDLSSVL- 288
           EA++K+ER Y  SKKL+DA   +  E       +QP ++++Y + ++  M  P L SVL 
Sbjct: 205 EAMEKLERMYEHSKKLHDAFNSISNEIGGLSGGSQPFEVVKYFEHMKSVMNGPTLESVLH 264

Query: 289 -DGSMPAEVGVKTSVRDAARLMREYRTTAVLVM-EHHSIAGIFTSKDIVLRVIAAGLDPS 346
            + ++P+ V VKTSV +AA  M++  TTAVLV  E + ++GIFTSKD+VLRVIAAGLDP 
Sbjct: 265 DETTVPSYVNVKTSVHEAALTMKDNHTTAVLVKNEVNEVSGIFTSKDVVLRVIAAGLDPK 324

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGSILGMVDVLKLTYATMEQ 406
           T SVIRVMTP PD AP   SI  AL+KM++GHYLNLPVVD G I+G+V+VLKLTYAT+ Q
Sbjct: 325 TVSVIRVMTPQPDVAPKTLSIQQALRKMFEGHYLNLPVVDDGEIVGIVEVLKLTYATLSQ 384

Query: 407 MYSMQNQENGNDGG---------------GPMWNKFWNSLANDGDNESTVSDSIAXXXXX 451
           +  + + E+ N                  GP WNKFWN      D+ S  S+S+      
Sbjct: 385 INLISDAESHNSQSQRSSVPTTPSKNAAPGPAWNKFWNGFDLMNDSSSVHSESVFSNGPP 444

Query: 452 XXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGH---DENFFT----FK 504
                     +            +H ++S S ++  + +     H    E+  T    FK
Sbjct: 445 EISQTELNQFQLDNG--------MHLNDSVSFVNGETSSLMGSSHITSQEDIRTCLHSFK 496

Query: 505 FKA-PNGKSHRFTV-DYTSFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXID 562
           FK   N K+HR ++        +   +  KL  +  D  I YV               ID
Sbjct: 497 FKTLTNNKTHRVSLRPIEGVSKLVELIGEKLGGS-DDVEILYVDDENDLVSITHDQDLID 555

Query: 563 AVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYN--LP 620
            V + +   + ++ L +                     +++ R ++    H    N  +P
Sbjct: 556 CVLVHKNMNLDKIDLLVH-------YRYETVPQDAVNRLIQNRFKKNVPSHPKPSNQLIP 608

Query: 621 -IPHDLLLPGAVLTLAIAIIGVFALSR 646
            IP++ LLP  ++ L  +I  +F+LSR
Sbjct: 609 GIPNETLLPAVIVALGASIAVIFSLSR 635



>gi|354548364|emb|CCE45100.1| hypothetical protein CPAR2_701040 [Candida parapsilosis]
          Length = 619

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 247/626 (39%), Positives = 340/626 (54%), Gaps = 83/626 (13%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R+R SK+DEAIR+++EH+L+KK +       N  +  R      GTV SL PS  +  + 
Sbjct: 28  RKRQSKRDEAIRRRIEHDLSKKKK-------NGSRITRYKKAIPGTVLSLKPSDPIICKT 80

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +A V E SQ+M A R +CVLV++    L GIFTAKDLAFR+VG GL A + T+  IMT +
Sbjct: 81  TATVHEVSQMMTATRENCVLVVNDIGELLGIFTAKDLAFRIVGSGLTANSVTIDQIMTAD 140

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKK 248
           P+C   +  A++ALN MV RGFRHLPV + +  +VG+LDITKC  + ++K+ER +  SK 
Sbjct: 141 PICANANNPASEALNLMVERGFRHLPVLDNDNQIVGVLDITKCYAQQMEKLERMHAQSKT 200

Query: 249 LYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTSVRDAA 306
           LY+A   V  E    +QP  + QY + L+ KM  P L +VLD +  P  V VKTSV +A 
Sbjct: 201 LYEAWTSVHNEIGVQDQPPHVFQYFETLKNKMNGPTLDNVLDETTEPIYVSVKTSVYEAT 260

Query: 307 RLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQT 365
            LM+E +TTAVLV + +  + GIFTSKD+VLRVIAAGLDP  CSV+RVMT HPD A    
Sbjct: 261 VLMKENKTTAVLVKDTNQEVTGIFTSKDVVLRVIAAGLDPKNCSVVRVMTSHPDVAYANL 320

Query: 366 SILDALKKMYDGHYLNLPVVDGGS-ILGMVDVLKLTYATMEQMYSMQNQ---------EN 415
            I +AL+KM+DGHYLNLPVV+    I+GMVDVLKLTYAT+ Q+  ++ +         E 
Sbjct: 321 PIQEALRKMFDGHYLNLPVVNTDEDIIGMVDVLKLTYATLTQIKQLEAKDLPSSLDAPEQ 380

Query: 416 GNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI 475
           G++  GP WNKFW SL    DNES  SDS                     S N+    +I
Sbjct: 381 GSE--GPAWNKFWTSL---DDNESVHSDSFMEESAAANAPDVTPSEFQ--SFNV----DI 429

Query: 476 HPSESASAIDDGSM------ASFPRG--HDENFFTFKFKAP--NGKSHRFTVD-YTSFEH 524
            PS+S S +D+  M      AS       D++ + FKFK+P   G+ HR T+        
Sbjct: 430 KPSDSISYVDESPMKGSTAAASLSNSVQQDDSPYIFKFKSPAIEGRVHRITLKPNDGVLA 489

Query: 525 IRATVASKLPSNVRDF-----------------------TIYYVXXXXXXXXXXXXXXXI 561
           +R ++ SKL  N +DF                        I Y+               +
Sbjct: 490 LRKSIHSKL--NEKDFIKLNVIKPSEDNEDGSASTNNEVAISYIDDEGDVVSITTDSDLV 547

Query: 562 DAVRIAQRQGMSRVILHIQEIEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLP- 620
           + VRI +R G  +  L++    +                + E +  +K  K   D  +P 
Sbjct: 548 ECVRINRRLGNEKADLYLHNPHQHP-------------SVDELKPIKKVTKS--DSLVPG 592

Query: 621 IPHDLLLPGAVLTLAIAIIGVFALSR 646
           I +++L+PG +  LA +II    LSR
Sbjct: 593 IANEVLVPGVLAVLASSIILGITLSR 618



>gi|465795639|emb|CCV00131.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 544

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 230/548 (41%), Positives = 303/548 (55%), Gaps = 101/548 (18%)

Query: 190 MCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKL 249
           M  ++ TSAT+AL+TMV RGFRHLPVCNE+GDVVGLLDI K  YEAL+K+ERA+GSS+KL
Sbjct: 1   MVTRDTTSATEALSTMVTRGFRHLPVCNEDGDVVGLLDIAKVFYEALEKLERAHGSSQKL 60

Query: 250 YDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARL 308
           Y ALEGV+ EW       ++QY++ LR++M+ P+++S+LD  +MP  VGV+TSVRDAARL
Sbjct: 61  YHALEGVQNEWGGGPQQAMMQYVETLRQRMSMPEIASILDSRTMPCTVGVRTSVRDAARL 120

Query: 309 MREYRTTAVLVMEH------------HSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTP 356
           M++Y+TTAV V+E+              IAGIFTSKD+VLRVIAAGLDP  CSV+RVMTP
Sbjct: 121 MKQYKTTAVCVLENAPNNHGECAITSGKIAGIFTSKDVVLRVIAAGLDPERCSVVRVMTP 180

Query: 357 HPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQEN 415
           HPDTAPP  SI +AL+KM+DG YLNLPVVD    ++G+VDVLKLTYAT+EQ+ SM N E+
Sbjct: 181 HPDTAPPSMSIQEALRKMHDGRYLNLPVVDVDARLVGVVDVLKLTYATLEQINSMNNGED 240

Query: 416 GNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEI 475
            +  GGPMWN+FWNS        S   +S +                T G+ +IS   E+
Sbjct: 241 SD--GGPMWNRFWNSFGQGAG--SAFEESNSALSGSQRLGTDAQLSPTGGALDIS--SEV 294

Query: 476 HPSESASAI-----DDGS-MASFPRG-HDENFFTFKFKAPNGKSHRFTVDYTSFEHIRAT 528
           HP++SASA+     D GS + + P G  D+  + FKF  P+G+ HRF   Y S+E IR  
Sbjct: 295 HPNDSASAVGGSTHDGGSAVDAAPLGAADDGTYLFKFVTPSGRVHRFQARYDSYETIREI 354

Query: 529 VASKL----------------------------------------------PSNVRDFTI 542
           V  KL                                              P +V+D+T+
Sbjct: 355 VTIKLSGDPFFVYTGGSQDMPVEAASTAFDEDGRLPLHIFTPPMPAGPQPNPPDVKDYTL 414

Query: 543 YYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRV--ILHIQEIEKKSLRXXXXXXXXXXXX 600
            Y                 D+V++AQ QG  RV  +LH  +   ++              
Sbjct: 415 AYKDDDDDLVLMTADTDVQDSVKVAQHQGKDRVLLVLHGGKTWDEAAARDGQYSSASAVT 474

Query: 601 ILEKRRRRK----------------RGKHAPDYNLP----IPHDLLLPGA-----VLTLA 635
               RR+R+                R   +P  N P    +P D+ LP A     V+ LA
Sbjct: 475 AANHRRQRELAEDQARNVQRSEQPGRAASSPS-NEPLFGFLPRDMALPAAIGFASVVGLA 533

Query: 636 IAIIGVFA 643
            A I  FA
Sbjct: 534 AACIFRFA 541



>gi|126275953|ref|XP_001386928.1| CBS/PB1 domain-containing protein [Scheffersomyces stipitis CBS
           6054]
 gi|126212797|gb|EAZ62905.1| CBS domain-containing protein [Scheffersomyces stipitis CBS 6054]
          Length = 609

 Score =  365 bits (937), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 213/494 (43%), Positives = 300/494 (60%), Gaps = 42/494 (8%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKS-TSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +R+R +K+D+AIR+++E++LNKK R  + TS N R  P        GTV SL P+  +  
Sbjct: 29  SRKRQTKRDDAIRRRIENDLNKKKRGGTRTSRNRRAAP--------GTVLSLKPTDPIIC 80

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           + S+ V E SQLM A+R +CVLV++    L GIFTAKDLAFRVVG  L+A + T+  IMT
Sbjct: 81  KTSSTVYEVSQLMTARRENCVLVVNDVGELLGIFTAKDLAFRVVGSSLNANSVTIDQIMT 140

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
            NP C   + +A++AL  MV RGFRHLPV ++   +VG+LDITKC  + ++K+ER + SS
Sbjct: 141 PNPQCANANAAASEALTLMVERGFRHLPVLDDNNQIVGVLDITKCYAQQMEKLERMHASS 200

Query: 247 KKLYDALEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRD 304
           KKLY+AL+ V  E     QP Q+ +Y + L+ KM  P L SVLD  ++P    VK++V +
Sbjct: 201 KKLYEALDSVHSEMGVGQQPLQVFKYFENLKSKMNGPTLESVLDANTVPVYSNVKSTVYE 260

Query: 305 AARLMREYRTTAVLVMEHH-SIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           A  LM+E RTTAVLV +++  + GIFTSKD+VLRVIAAGLDP  CS++RVMTP PD A  
Sbjct: 261 ATVLMKENRTTAVLVKDNNDEVTGIFTSKDVVLRVIAAGLDPKNCSIVRVMTPQPDVAKV 320

Query: 364 QTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQN----QENG-- 416
              I  AL++M++GHYLNLPVV D   I+G+V+VLKLTYAT+ Q+  ++     +++G  
Sbjct: 321 NLPIQQALRQMFEGHYLNLPVVGDQNDIIGIVEVLKLTYATLNQIKQLETADSVEQSGAT 380

Query: 417 ---NDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNI---- 469
               D  GP WNKFW S+ +D  +                          + S +I    
Sbjct: 381 LEQQDSEGPAWNKFWTSMDDDDSDSVHSGSITGSAPDVTASEFQSFNIDIKPSDSISYVE 440

Query: 470 SPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAP--NGKSHRFTVDYTS-FEHIR 526
           SP+     S  +S I+D      P       FTFKFK+P   G+ HR ++  +   + +R
Sbjct: 441 SPVKPARQSTLSSPIED----DLP-------FTFKFKSPAIEGRVHRISIRASEGLDKLR 489

Query: 527 ATVASKLPSNVRDF 540
           A + +KL  + +DF
Sbjct: 490 ALMDAKL--HTKDF 501



>gi|344302225|gb|EGW32530.1| hypothetical protein SPAPADRAFT_139714 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 653

 Score =  364 bits (934), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 222/518 (42%), Positives = 309/518 (59%), Gaps = 59/518 (11%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SK+D+AIR+++EH+LNKK +  S S   R   +       GTV SL P+  +  +
Sbjct: 27  SRKRQSKRDDAIRRRIEHDLNKKKKGGSGSSRKRRSFK------AGTVMSLRPNDPIACK 80

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            S+ V E SQLM AKR +C+LVI+    L GIFTAKDLAFRVVG GL+A + T+  IMT 
Sbjct: 81  ASSTVYEISQLMTAKRENCILVINEAGELMGIFTAKDLAFRVVGAGLNASSITIDQIMTP 140

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGD-VVGLLDITKCLYEALDKMERAYGSS 246
           NP+C   +  A++AL  MV +GFRHLPV +EE + ++G+LDITKC  + ++K+ER + SS
Sbjct: 141 NPICAFANQPASEALTLMVEKGFRHLPVLDEETNQILGVLDITKCYEQQMEKLERMHSSS 200

Query: 247 KKLYDALEGVEREWSTNQ-PTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTSVRD 304
            KL DAL  +  E   ++ P Q+ +Y + L++KM  P L SVLD +  P    VK SV +
Sbjct: 201 SKLDDALNSIHSEIGIDEHPAQVFEYFETLKQKMNSPTLESVLDFTTGPVFTNVKASVYE 260

Query: 305 AARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPP 363
           A  LM+E RTTAVL+ + +  +AGIFTSKD+VLRVIAAGLDP TCS++RVMTPHPD A  
Sbjct: 261 ATILMKENRTTAVLIKDTNDEVAGIFTSKDVVLRVIAAGLDPKTCSIVRVMTPHPDVANV 320

Query: 364 QTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSM----------QN 412
              +  AL++M +GHYLNLPV+ +   I+G+VDVLKLTY T+ Q+ S+          Q+
Sbjct: 321 NLPVQQALRQMLEGHYLNLPVIGEDQEIIGIVDVLKLTYVTLSQIKSVETKDLPMTPSQS 380

Query: 413 QENGN----DGGGPMWNKFWNSLAND--GDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
           +E+GN     G GP WNKFW +  +    DN+S  SD+I+               + RG 
Sbjct: 381 KESGNANVSQGSGPAWNKFWTTFDHQLLDDNDSVHSDTIS-------GSLGAGGGKERGH 433

Query: 467 GNISPIP---------EIHPSESASAIDDGS-----------MASFPRGHDENFFTFKFK 506
             + P           EI PS+S S +D  S             +     ++  FTFKFK
Sbjct: 434 HTLPPPDVTASEIHSFEIEPSDSVSHVDSKSETRDLGVAVTGTTTTTLAEEDTPFTFKFK 493

Query: 507 AP--NGKSHRFTVDYT-SFEHIRATVASKLPSNVRDFT 541
           +P   G+ +R TV  +   + +R  +  KL    +DFT
Sbjct: 494 SPGIEGRVNRITVRPSDGVDKLRGLIEQKLIE--KDFT 529



>gi|459371818|gb|EMG49487.1| hypothetical protein G210_5735 [Candida maltosa Xu316]
          Length = 600

 Score =  358 bits (920), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 220/517 (42%), Positives = 304/517 (58%), Gaps = 55/517 (10%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R SK+DEAIR+K+E++L+KK R  ST+   R K       + G+V +L PS  L  +
Sbjct: 10  SRKRQSKRDEAIRRKIENDLSKKKRPGSTTTTRRRK------ASPGSVLALRPSDPLICK 63

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +    +A+QLM+A+R +C LVI+    L GIFTAKDLAFR+VG GL+    TV  IMT 
Sbjct: 64  ATTTAFQAAQLMSARRENCALVINEAGELLGIFTAKDLAFRIVGSGLNPNQVTVDQIMTS 123

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVC-----NEEGDVVGLLDITKCLYEALDKMERA 242
           NP+CV ++  A DALN MV +GFRHLPV      N+ G +VG+LDITK   + ++K+E+ 
Sbjct: 124 NPICVHSNDPAGDALNLMVEKGFRHLPVLEITEENQVGQIVGVLDITKSYAQQMEKLEKL 183

Query: 243 YGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSM-PAEVGVKTS 301
             SS+ + ++L  + +     QP  I+ Y   L EKM  P L SVL+ S  P  V VK S
Sbjct: 184 NQSSETIRNSLTQIGQ-----QPQHIVDYFTELGEKMKGPILESVLNVSTHPIYVQVKQS 238

Query: 302 VRDAARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDT 360
           V +A  +M+E+RTTAVLV + ++ +AGIFTSKD+VLRVIAAGLD +T SV+RVMTP PD 
Sbjct: 239 VAEATVMMKEHRTTAVLVKDTNNEVAGIFTSKDVVLRVIAAGLDANTTSVLRVMTPQPDV 298

Query: 361 APPQTSILDALKKMYDGHYLNLPVV-DGGSILGMVDVLKLTYATMEQMYSMQNQEN---- 415
           A    SI  AL++M++GHYLNLPVV D   I+G+VDVLKLT+AT+ Q+  ++  EN    
Sbjct: 299 ATSDLSIQSALRQMFEGHYLNLPVVGDEDEIIGIVDVLKLTHATLNQLKEIETTENSFGS 358

Query: 416 ----GNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXX-----RTRGS 466
                + G GP WNKFWN++ +DG+     S+SI                         S
Sbjct: 359 ATAAASSGEGPAWNKFWNNM-DDGEGSDAHSNSIVETTTNSGGFSSNAAAPDVTPSEFNS 417

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGH-----DENFFTFKFKAP--NGKSHRFTVDY 519
            NI    +I PS+S S ++   + S   G      DE  FTFKF +P  +G++HR  +  
Sbjct: 418 FNI----DIKPSDSVSHVESLPLKSSTFGSSSLNIDEIAFTFKFTSPGIDGRAHRIVMKS 473

Query: 520 T-SFEHIRATVASKL----------PSNVRDFTIYYV 545
           T     +R  ++ KL            +  DF I YV
Sbjct: 474 TDGVAKLRELISGKLHDKDYAALNITKDEEDFAISYV 510



>gi|83766852|dbj|BAE56992.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 287

 Score =  358 bits (919), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 175/293 (59%), Positives = 222/293 (75%), Gaps = 7/293 (2%)

Query: 83  VEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAK 142
           +E +LNKK +  + +  +R  P        GTV +L PSQAL ++ +  + EA+QLMAAK
Sbjct: 1   MEADLNKKKQAPTRAHRSRKAP-------PGTVLALKPSQALQIKPNMTIAEAAQLMAAK 53

Query: 143 RADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDAL 202
           R DCVLV D ++ ++GIFTAKDLAFRVVG G  AR  TVA IMT+NP+C + DTSATDAL
Sbjct: 54  REDCVLVTDDDDRIAGIFTAKDLAFRVVGAGQKARDITVAEIMTKNPLCARTDTSATDAL 113

Query: 203 NTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWST 262
           + MV +GFRHLPV +E  D+ G+LDITKC Y+A++K+ERAY SS+KLYDALEGV+ E  +
Sbjct: 114 DLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGS 173

Query: 263 NQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEH 322
           +QP QI+QY++ LR KM+ P L +VLDG  P  V V+TSV+DAA +M+E+ TTA+LV + 
Sbjct: 174 SQPQQIIQYVEALRSKMSGPTLETVLDGLPPVTVSVRTSVKDAAAMMKEHHTTALLVQDQ 233

Query: 323 HSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMY 375
            SI GIFTSKDIVLRVIA GLDPSTCSV+RVMTPHPD AP   SI  AL+KM+
Sbjct: 234 GSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPADMSIQAALRKMH 286



>gi|149239558|ref|XP_001525655.1| hypothetical protein LELG_03583 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451148|gb|EDK45404.1| hypothetical protein LELG_03583 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 652

 Score =  354 bits (908), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 235/665 (35%), Positives = 344/665 (51%), Gaps = 108/665 (16%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           +R+R +KKD+AIRK++EH+L+KK +  S       + +R +PG   TV SL P++ +T +
Sbjct: 9   SRKRQTKKDDAIRKRIEHDLSKKKKNGSYI----ARHKRPMPG---TVLSLKPNEPITCK 61

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
            +A V E SQLM A+R +CVLV+  E  L GIFTAKDLAFRVVG GL+A   T+  IMT 
Sbjct: 62  ATATVYEVSQLMIARRENCVLVVGEEGDLMGIFTAKDLAFRVVGAGLNAGNVTINKIMTP 121

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+C   +  A+DAL  MV +GFRHLPV NE   VVG+LDIT C  + ++K+ER + SSK
Sbjct: 122 NPICTMENNPASDALTLMVDKGFRHLPVKNELQQVVGILDITNCYAQQMEKLERMHNSSK 181

Query: 248 KLYDALEGVEREWSTNQ-PTQILQYMDMLREKMACPDLSSVLD-GSMPAEVGVKTSVRDA 305
           KLY+AL+ V+ E    Q P Q+ +Y + LR KM  P L +VLD  + P  V VK +V +A
Sbjct: 182 KLYEALDSVQTEIGLKQHPQQVFEYFEKLRSKMNGPTLETVLDEQTAPIYVSVKATVLEA 241

Query: 306 ARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQ 364
             LM+E  TTAVLV + +  + GIFTSKD+VLRVIAAGL+P  CSV+RVMTP PD A   
Sbjct: 242 TVLMKENNTTAVLVKDTNEELTGIFTSKDVVLRVIAAGLEPKQCSVVRVMTPQPDVANAN 301

Query: 365 TSILDALKKMYDGHYLNLPV-VDGG------------------SILGMVDVLKLTYATME 405
             I  AL++M++GHYLNLPV  DG                   +I+G+VDVLKLT +T+ 
Sbjct: 302 LPIQQALRQMFNGHYLNLPVFCDGANSGNEDDVSGDIRKKRVCNIIGIVDVLKLTCSTLN 361

Query: 406 QMYSMQNQE-------NGNDGGGPMWNKFWNSLAN--------------------DGDNE 438
           Q+  ++  +       + ++  GP W+KFW  L N                    +G   
Sbjct: 362 QIKQLELDDFMPEALVDSHESLGPAWSKFWTELGNEDTISNHSEIVVDMDAMHNGEGVVN 421

Query: 439 STVSDSIAXXXX-------XXXXXXXXXXXRTRGSGNISPI---PEIHPSESASAIDD-- 486
             V+DSI                           +   +P+   PEI PS+S S  +   
Sbjct: 422 DAVNDSIVAENTRHIASTTASSTAAAAAVVTDAAATEAAPLHSHPEISPSDSVSRANSLT 481

Query: 487 ----------GSMASFPRGHDENFFTFKFKAPN--GKSHRFTVDY-TSFEHIRATVASKL 533
                     G ++S     ++  F FKF++P   GK HR  + Y    E ++  + +KL
Sbjct: 482 TRGSYRHSIGGPLSSRMLSTEDIMFVFKFRSPGHIGKVHRVALAYGDGIEKLKELIGAKL 541

Query: 534 PS----------NVRD--FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
            +          +V++  + + Y+               ++ VR+ ++ G  +  +++  
Sbjct: 542 LAKDFEALGVNRSVKEGTYIVSYLDDENDIVSITSDYDLLECVRVNRKLGKEKADIYLSS 601

Query: 582 IEKKSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAIIGV 641
           +                  I E R+  KR      ++  +  + LLP  +  LA + +  
Sbjct: 602 LSNH-------------IAINEARKCHKRNNRY--FSSVMDSEYLLPSIIAILASSAVVG 646

Query: 642 FALSR 646
           F LSR
Sbjct: 647 FTLSR 651



>gi|328767299|gb|EGF77349.1| hypothetical protein BATDEDRAFT_36036 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 712

 Score =  343 bits (879), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 209/509 (41%), Positives = 292/509 (57%), Gaps = 55/509 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRE 128
           R R  ++D+AIRKKVE EL+++   ++++ +  G+         GTV+SL P+ A+ + E
Sbjct: 34  RSRNKRRDDAIRKKVEQELSRRTMKRNSASSASGQKHDTRRTRVGTVSSLRPAPAIIIIE 93

Query: 129 SALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRN 188
           +A +++A+QLMAAKR D VLV+  +  L+GI T KD+A+RVV +GLD RTT V+++MTR+
Sbjct: 94  TARIIQAAQLMAAKRTDAVLVVGEDGALAGILTDKDIAYRVVAEGLDIRTTPVSSVMTRD 153

Query: 189 PMCVKNDTSATDALNTMVARGFRHLPVCNEEG-----------------DVVGLLDITKC 231
           P+ V +  S  +ALN MV+R FRHLPV +E G                  VVGLLDITKC
Sbjct: 154 PIAVYDKGSRNEALNIMVSRRFRHLPVISETGGGNDDDDNEFDEAAGGTSVVGLLDITKC 213

Query: 232 LYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL--- 288
           ++E +D +ER       +  A+E +ER     + T   +++ ++R+   CPD+  VL   
Sbjct: 214 VFERIDDLERKVNEDLNIISAMEALER-----RGTVAAEHVGVVRQHHGCPDVGFVLTQT 268

Query: 289 ------DGSMPAEVGVKTSVRDAARLMREYRTTAVLVM----EHHSIAGIFTSKDIVLRV 338
                  G++P EV +K+SVRDAAR+M+ Y TTAVLV+    +   I GIFT+KDIVLRV
Sbjct: 269 IGGQLEHGTVP-EVSIKSSVRDAARIMKAYHTTAVLVIGNSNDDEQIGGIFTTKDIVLRV 327

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGGSILGMVDVLK 398
           IAA LDP T SV+RVMTPHPD     TSILDALKK+  GHYL+LPVVDGG  +G+VDV+ 
Sbjct: 328 IAASLDPMTTSVVRVMTPHPDYVLASTSILDALKKLNTGHYLHLPVVDGGVPIGLVDVMT 387

Query: 399 LTYATMEQMYS--MQNQENGNDGGGPMWNKFWNS------LANDGDNESTVSDSI---AX 447
           LT + +  + +  +  QE      GP+WNKFWNS      +  + D  S  SDS    + 
Sbjct: 388 LTISMLTYLMTKDLGTQEGSISEDGPLWNKFWNSTFAGSTIETESDRLSQTSDSRPSGSI 447

Query: 448 XXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFK- 506
                           R S  +      HP E +S +    +    +  D N FTFK K 
Sbjct: 448 HYQPSSSSQHATEMSNRQSLQLQRTLSPHPDEYSSMLSRSQI----QNDDPNMFTFKLKD 503

Query: 507 ---APNGKSHRFTVDYTSFEHIRATVASK 532
                NGK  RF+  + S   + A V  K
Sbjct: 504 MTRTGNGKVFRFSSRFNSLSEVYAQVCLK 532



>gi|190346549|gb|EDK38658.2| hypothetical protein PGUG_02756 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 551

 Score =  280 bits (715), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 231/376 (61%), Gaps = 17/376 (4%)

Query: 74  KKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVV 133
           ++DEAIR++++HE +KK RT +       KP+    G  G+V SL PS+ +T  ++  + 
Sbjct: 24  RRDEAIRRRIDHEFSKKRRTPT-------KPKIPRRGLPGSVLSLKPSEPVTCTKNTTIY 76

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           E +QLM+AKR +CVL++D  E L G+FT+KDLAFRVVG GLDA   TV  +MT NP+   
Sbjct: 77  EVAQLMSAKRCNCVLIVDDHEKLLGLFTSKDLAFRVVGSGLDATVATVGQVMTSNPLTSS 136

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEG-DVVGLLDITKCLYEALDKMERAYGSSKKLYDA 252
             + A+ AL+ M+   FRH+PV  +   +++G+LDI     + + K ER   +S +L+D 
Sbjct: 137 ATSPASQALDQMLEHKFRHMPVVEDSNTEIIGVLDIVTFYKKQMKKFERLNANSARLFDT 196

Query: 253 LEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVLDG-SMPAEVGVKTSVRDAARLMR 310
           L+ +  +    + P  I +Y++ LR ++  P + SV+   S P    +K +V + A +M+
Sbjct: 197 LDVLHNDLGMESNPPHIEEYLESLRSQVNGPTIQSVVGNVSRPVFASLKATVYEVANMMK 256

Query: 311 EYRTTAVLVMEHHS-IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILD 369
              T+ +L+ +    + GI +SKD+  R IAAGL+P  CSV+RVMT +PD     T+I  
Sbjct: 257 ANNTSVILIRDGSGKVVGIVSSKDVTFRAIAAGLNPKICSVVRVMTANPDVVNTSTTIRQ 316

Query: 370 ALKKMYDGHYLNLPVVDGG-SILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFW 428
           ALK+M DG+YLNLPV D   SI+ +VDVL L +AT++ +   + +     GGG  WN FW
Sbjct: 317 ALKQMLDGNYLNLPVEDSSHSIIAVVDVLSLIHATLQNVGPAELE-----GGGSRWNNFW 371

Query: 429 NSLANDGDNESTVSDS 444
            ++ ++ ++  +V+DS
Sbjct: 372 TTVDDESESGRSVNDS 387



>gi|146418122|ref|XP_001485027.1| hypothetical protein PGUG_02756 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 551

 Score =  277 bits (708), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 231/376 (61%), Gaps = 17/376 (4%)

Query: 74  KKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVV 133
           ++DEAIR++++HE +KK RT +       KP+    G  G+V SL PS+ +T  ++  + 
Sbjct: 24  RRDEAIRRRIDHEFSKKRRTPT-------KPKIPRRGLPGSVLSLKPSEPVTCTKNTTIY 76

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           E +QLM AKR +CVL++D  E L G+FT+KDLAFRVVG GLDA   TV  +MT NP+   
Sbjct: 77  EVAQLMLAKRCNCVLIVDDHEKLLGLFTSKDLAFRVVGSGLDATVATVGQVMTSNPLTSS 136

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEG-DVVGLLDITKCLYEALDKMERAYGSSKKLYDA 252
             + A+ AL+ M+   FRH+PV  +   +++G+LDI     + + K ER   +S +L+D 
Sbjct: 137 ATSPASQALDQMLEHKFRHMPVVEDSNTEIIGVLDIVTFYKKQMKKFERLNANSARLFDT 196

Query: 253 LEGVEREWST-NQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMR 310
           L+ +  +    + P  I +Y++ LR ++  P + SV+ + S P    +K +V + A +M+
Sbjct: 197 LDVLHNDLGMESNPPHIEEYLESLRSQVNGPTIQSVVGNVSRPVFASLKATVYEVANMMK 256

Query: 311 EYRTTAVLVMEHHS-IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILD 369
              T+ +L+ +    + GI +SKD+  R IAAGL+P  CSV+RVMT +PD     T+I  
Sbjct: 257 ANNTSVILIRDGSGKVVGIVSSKDVTFRAIAAGLNPKICSVVRVMTANPDVVNTSTTIRQ 316

Query: 370 ALKKMYDGHYLNLPVVDGG-SILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFW 428
           ALK+M DG+YLNLPV D   SI+ +VDVL L +AT++ +   + +     GGG  WN FW
Sbjct: 317 ALKQMLDGNYLNLPVEDSSHSIIAVVDVLSLIHATLQNVGPAELE-----GGGSRWNNFW 371

Query: 429 NSLANDGDNESTVSDS 444
            ++ ++ ++  +V+DS
Sbjct: 372 TTVDDELESGRSVNDS 387



>gi|19114942|ref|NP_594030.1| conserved protein Mug20 [Schizosaccharomyces pombe 972h-]
 gi|3183377|sp|O13965.1|MUG70_SCHPO RecName: Full=Meiotically up-regulated gene 70 protein
 gi|2330788|emb|CAB11262.1| conserved protein Mug20 [Schizosaccharomyces pombe]
          Length = 730

 Score =  266 bits (680), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 229/367 (62%), Gaps = 39/367 (10%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQV--PGAKGTV--ASLNPSQAL 124
           R+R  ++DEA+RKK+  EL KK+        N   P R++   G  GTV  A+L+P  AL
Sbjct: 24  RKRQYQRDEALRKKIISELGKKS-------GNFESPVRKIRRNGEPGTVDSAALDP--AL 74

Query: 125 TVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATI 184
           TV   +LV E +QLMAAKR +CVLV+D +E L+GI TA D+A R VG GL+AR T +A I
Sbjct: 75  TVHMQSLVTETAQLMAAKRQNCVLVVDDDEQLAGIVTATDIATRCVGAGLNARQTLIADI 134

Query: 185 MTRNPMCVKNDTSATDALNTMVARGFRHLPVCN---------EEGDVVGLLDITKCLYEA 235
           M+ +P+C+ +DT   DAL  M+   FRHLPV +         +EGDV+G++++  CL E 
Sbjct: 135 MSTSPLCITSDTRFDDALLLMIEHKFRHLPVVSDGGPDGSAGDEGDVIGIINMRACLREP 194

Query: 236 LDKMERAYGSSKKLYDALEGVEREW--------------STNQPTQILQYMDMLREKMAC 281
           L+++ R   +++KL +ALEG + E               S N   + L+Y++ L++K + 
Sbjct: 195 LNRIARQQEAAQKLVEALEGAQEEIENKSVSGNTNSSSVSGNHAAEFLEYVESLKKKASG 254

Query: 282 PDLSSVLDGS-MPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIA 340
            ++ S++D S  P  VG +T+V +A   M     +AVLVM++ +++G+FT+ D+VLRV+A
Sbjct: 255 LEIMSLIDSSEEPFLVGTRTTVAEATESMARSGVSAVLVMDNGAVSGVFTAHDVVLRVLA 314

Query: 341 AGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKL 399
           AGLDP   SVIRVMTPHPD A     +  AL++M +G + NLPVVD   +I+GM+ +  L
Sbjct: 315 AGLDPYRSSVIRVMTPHPDCALASLRVSTALERMIEGKFSNLPVVDESDAIIGMLSLFHL 374

Query: 400 TYATMEQ 406
             A +EQ
Sbjct: 375 ATA-IEQ 380



>gi|213407912|ref|XP_002174727.1| CBS domain-containing protein [Schizosaccharomyces japonicus
           yFS275]
 gi|212002774|gb|EEB08434.1| CBS domain-containing protein [Schizosaccharomyces japonicus
           yFS275]
          Length = 655

 Score =  265 bits (677), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 224/354 (63%), Gaps = 25/354 (7%)

Query: 69  RQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKG--TVASLNPSQALTV 126
           R+R ++KDEA+RKK+  ELNKK       +++   P+R V       TVAS + + ALTV
Sbjct: 31  RKRQNRKDEALRKKIATELNKK-------MSHLDPPKRNVRSHSDPTTVASASLAPALTV 83

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
           +   LV EA QLMAAKR +C+LV+D  + L+GI T+ D++ + VG G D R +TV + MT
Sbjct: 84  QTHTLVSEACQLMAAKREECLLVVDEAQQLTGIITSLDVSRKCVGGGFDPRGSTVESFMT 143

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCN-------EEGDVVGLLDITKCLYEALDKM 239
             P+C+ +DT   DAL  M+     +LPV +       E+GDV+G+LDI  CL+E L ++
Sbjct: 144 EGPICITSDTQFADALALMLEHDRIYLPVVSDGTDEGCEDGDVLGILDICSCLHEPLSRV 203

Query: 240 ERAYGSSKKLYDALEGVEREW------STNQPTQILQYMDMLREKMACPDLSSVLDGSM- 292
           +R   ++ KL +AL G   E        +   ++ ++Y++ LR+K A  ++ ++L+  + 
Sbjct: 204 KRQEDAAAKLMEALAGAHDELDGSSLSGSAHASEFVEYVESLRQKAAGREVGALLEDVLF 263

Query: 293 -PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVI 351
            P  VGV+TSV +A++LM +    AVLVM+   ++GIFTS DIVLRV+AAGLDPS CSVI
Sbjct: 264 EPVLVGVRTSVLEASQLMAQAEANAVLVMDQGLVSGIFTSHDIVLRVVAAGLDPSKCSVI 323

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATM 404
           R+MTPHPD A     I  AL++M +G + NLPV+D    I+G++++ +L  A +
Sbjct: 324 RIMTPHPDCALVSLHISTALERMLEGGFNNLPVIDENDGIVGLLNITQLAQAIV 377



>gi|42565877|ref|NP_190863.3| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|334185937|ref|NP_001190074.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|75263848|sp|Q9LF97.1|Y3295_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB3
 gi|7529719|emb|CAB86899.1| putative protein [Arabidopsis thaliana]
 gi|332645495|gb|AEE79016.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|332645496|gb|AEE79017.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
          Length = 556

 Score =  264 bits (674), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 255/483 (52%), Gaps = 55/483 (11%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V +A + MAA+R D  L+ DS   LSGI T KD+A RV+ +G
Sbjct: 63  TVKKLRLSKALTIPEGTTVFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIAEG 122

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDITKCLY
Sbjct: 123 LRPDQTLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLY 181

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +ME+A      L  A+EGVE++W +        +++ LRE+M  P LS+++ D S 
Sbjct: 182 DAISRMEKAAEQGSALAAAVEGVEKQWGSGYSAP-YAFIETLRERMFKPALSTIITDNSK 240

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AA+ MR+ R  +V++   + I+GI TSKDI++RV+A  L P    V +
Sbjct: 241 VALVAPSDPVSVAAKRMRDLRVNSVIISTGNKISGILTSKDILMRVVAQNLSPELTLVEK 300

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A  +T+ILDAL  M+DG +L+LP++D  GS    VDVL++T+A +    SM 
Sbjct: 301 VMTPNPECASLETTILDALHTMHDGKFLHLPIIDKDGSAAACVDVLQITHAAI----SMV 356

Query: 412 NQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
              +G  ND    M  KFW+S LA    +D D +S +S                      
Sbjct: 357 ENSSGAVNDMANTMMQKFWDSALALEPPDDSDTQSEMS---------------------- 394

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
                     +H S      D G ++S+P     N F+FKF+   G+ HRFT    + E 
Sbjct: 395 --------AMMHHS------DIGKLSSYPSLGLGNSFSFKFEDLKGRVHRFTSGAENLEE 440

Query: 525 IRATVASKLPSNVRDF----TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
           +   V  ++ S+  +      I Y                + AV +A+  G   + LH+ 
Sbjct: 441 LMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDLVGAVTLARSTGQKVLRLHLD 500

Query: 581 EIE 583
             E
Sbjct: 501 FTE 503



>gi|508700816|gb|EOX92712.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein
           isoform 1 [Theobroma cacao]
          Length = 532

 Score =  262 bits (669), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 248/452 (54%), Gaps = 49/452 (10%)

Query: 94  KSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSE 153
           KS S +N         G + TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+ 
Sbjct: 26  KSHSSDNAKPTSPSSVGGERTVKKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDAN 85

Query: 154 EHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHL 213
             LSGI T KD+A RV+ +GL    T V+ IMTR+P+ V  D+ A +AL  MV   FRHL
Sbjct: 86  ALLSGIITDKDIATRVIAEGLRPEQTVVSKIMTRSPIFVTADSLAIEALQKMVQGKFRHL 145

Query: 214 PVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMD 273
           PV  E G+V+ LLDITKCLY+A+ +ME+A      +  A+EGVER+W +N  +    +++
Sbjct: 146 PVV-ENGEVIALLDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNL-SAPYAFIE 203

Query: 274 MLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSK 332
            LRE+M  P LS+++ + S    V     V  AA+ MRE R  +V+V+  + I GI TSK
Sbjct: 204 TLRERMFKPSLSTIIAENSKVPIVSSSDPVYVAAKKMRELRVNSVVVVMGNKIQGILTSK 263

Query: 333 DIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSIL 391
           DI++RV+A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV+D  G++ 
Sbjct: 264 DILMRVVAQNLSPELTLVEKVMTPNPECATIETTILDALHIMHDGKFLHLPVLDKDGTVA 323

Query: 392 GMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDS 444
             VDVL++T+A +    SM    +G  N+    M  KFW+S LA    +D D +S +S  
Sbjct: 324 ACVDVLQITHAAI----SMVENSSGAVNEMANTMMQKFWDSALALEPPDDYDTQSEMSAI 379

Query: 445 IAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFK 504
           +A                                  +   D G ++S+P     N F FK
Sbjct: 380 MA----------------------------------SDGGDAGKLSSYPSLGLGNSFAFK 405

Query: 505 FKAPNGKSHRFTVDYTSFEHIRATVASKLPSN 536
           F+   G+ HRF     + + + + +  ++ S+
Sbjct: 406 FEDLKGRVHRFNCGTENLDELLSAIMPRIASS 437



>gi|297816584|ref|XP_002876175.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gi|297322013|gb|EFH52434.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
          Length = 556

 Score =  261 bits (666), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 254/483 (52%), Gaps = 55/483 (11%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   + +A + MAA+R D  L+ DS   LSGI T KD+A RV+ +G
Sbjct: 63  TVKKLRLSKALTIPEGTTIFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIAEG 122

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDITKCLY
Sbjct: 123 LRPDQTLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLY 181

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +ME+A      L  A+EGVE++W +        +++ LRE+M  P LS+++ + S 
Sbjct: 182 DAISRMEKAAEQGSALAAAVEGVEKQWGSGYSAP-YAFIETLRERMFKPALSTIITENSK 240

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AA+ MR+ R  +V++   + I GI TSKDI++RV+A  L P    V +
Sbjct: 241 VALVAPSDPVSVAAKRMRDLRVNSVIISNGNKIHGILTSKDILMRVVAQNLPPELTLVEK 300

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A  +T+ILDAL  M+DG +L+LP++D  GS    VDVL++T+A +    SM 
Sbjct: 301 VMTPNPECASLETTILDALHIMHDGKFLHLPIIDKDGSAAACVDVLQITHAAI----SMV 356

Query: 412 NQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
              +G  ND    M  KFW+S LA    +D D +S +S                      
Sbjct: 357 ENSSGAVNDMANTMMQKFWDSALALEPPDDSDTQSEMS---------------------- 394

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
                     +H S      D G ++S+P     N F+FKF+   G+ HRFT    + E 
Sbjct: 395 --------AMMHHS------DIGKLSSYPSLGLGNSFSFKFEDLKGRVHRFTSAAENLEE 440

Query: 525 IRATVASKLPSNVRDF----TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
           +   V  ++ S+  D      I Y                + AV +A+  G   + LH+ 
Sbjct: 441 LMGIVMQRIGSDNNDVEQRPQIIYEDDEGDKVLITSDSDLVGAVTLARSTGQKVLRLHLD 500

Query: 581 EIE 583
             E
Sbjct: 501 FTE 503



>gi|482559546|gb|EOA23737.1| hypothetical protein CARUB_v10016950mg [Capsella rubella]
          Length = 557

 Score =  260 bits (665), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 273/540 (50%), Gaps = 68/540 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V +A + MAA+R D  L+ DS   LSGI T KD+A RV+ +G
Sbjct: 64  TVKKLRLSKALTIPEGTTVFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIAEG 123

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDITKCLY
Sbjct: 124 LRPDQTLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLY 182

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +ME+A      L  A+EGVE++W +        +++ LRE+M  P LS+++ D S 
Sbjct: 183 DAISRMEKAAEQGSALAAAVEGVEKQWGSGYSAP-YAFIETLRERMFKPALSTIITDNSK 241

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AA+ MR+ R  +V++   + I GI TSKDI++RV+A  L P    V +
Sbjct: 242 VALVAPSDPVYVAAKKMRDLRVNSVIISMGNKIHGILTSKDILMRVVAQNLSPELTLVEK 301

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A  +T+ILDAL  M+DG +L+LP++D  GS    VDVL++T+A +    SM 
Sbjct: 302 VMTPNPECASLETTILDALHIMHDGKFLHLPIIDKDGSAAACVDVLQITHAAI----SMV 357

Query: 412 NQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
              +G  ND    M  KFW+S LA    +D D +S +S  +                   
Sbjct: 358 ENSSGAVNDMANTMMQKFWDSALALEPPDDSDTQSEMSAMMQQS---------------- 401

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
                               D G ++S+P     N F+FKF+   G+ HRFT    + E 
Sbjct: 402 --------------------DIGKLSSYPSLGLGNSFSFKFEDLKGRVHRFTSAAENLEE 441

Query: 525 IRATVASKLPSNVRDF----TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ 580
           +   V  ++ S+  +      I Y                + AV +A+  G   + LH+ 
Sbjct: 442 LMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDLVGAVTLARSTGQKVLRLHLD 501

Query: 581 EIEK-KSLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYNLPIPHDLLLPGAVLTLAIAII 639
             E  +SL              L+K   R RG     +       +++ GAV   ++A++
Sbjct: 502 FTESTRSLSSETTQ--------LKKADSRDRGSGLVSWR----GGVVVTGAVALTSVAVV 549



>gi|357157411|ref|XP_003577789.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like
           [Brachypodium distachyon]
          Length = 556

 Score =  256 bits (654), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 175/475 (36%), Positives = 252/475 (53%), Gaps = 44/475 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 68  TVKKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDANGLLSGIVTDKDVATRVIAEG 127

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T ++ IMTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ +LDI KC+Y
Sbjct: 128 LRVEHTIISKIMTRNPLYVSSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAMLDIAKCMY 186

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ ++E+A      L  A+EGVER+   N  T     ++ LRE+M  P LS+++ + + 
Sbjct: 187 DAISRLEKAAEQGSALAAAVEGVERQLGGNF-TAPYALIETLRERMFKPSLSTIITENTK 245

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V +   V  AA+ MRE R  +V++   +S+ GIFTSKD+++RV+A  L P    V +
Sbjct: 246 VATVSLSDPVYVAAQKMRELRVNSVVITNGNSLQGIFTSKDVLMRVVAQNLSPELTLVEK 305

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMT HPD A   TSILDAL  M+DG +L++PVVDG G ++  +DVL+LT+A +    SM 
Sbjct: 306 VMTAHPDCATLDTSILDALHIMHDGKFLHIPVVDGDGRVVACLDVLQLTHAAI----SMA 361

Query: 412 NQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
               G  ND    +   FW+S LA +  +E   S                          
Sbjct: 362 EGGPGAANDVANTVMQNFWDSALALEPPDEEFDSH------------------------- 396

Query: 469 ISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRAT 528
            S I  + PSE    + DG  + +P     N F FK +   G+ HRFT    S + + ++
Sbjct: 397 -SEISLVIPSE----VGDGRSSIYP-AVVGNSFAFKLQDHKGRMHRFTCGSESLDELMSS 450

Query: 529 VASKLPSNVRD--FTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQE 581
              +L  +V +    + Y                  AV  A+  G+  + LHI+E
Sbjct: 451 AIQRLGISVENGPIQLLYDDDEGDRVLLTTDSDLASAVIHAKSSGLKVLRLHIEE 505



>gi|502137179|ref|XP_004502996.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X2
           [Cicer arietinum]
          Length = 518

 Score =  256 bits (654), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 162/431 (37%), Positives = 233/431 (54%), Gaps = 50/431 (11%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G + TV  +  S+ALT+ +   V EA + MAA+R D VL+ DS   LSGI T KD+A RV
Sbjct: 32  GGERTVKKVKLSKALTIPDGTTVSEACRRMAARRVDAVLLTDSSALLSGILTDKDVATRV 91

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           V +GL    TTV+ +MTRNP+ V +DT A DAL  M+   FRHLPV  E G+V+ +LDIT
Sbjct: 92  VAEGLLPDETTVSKVMTRNPIFVTSDTLAIDALQKMIQGKFRHLPVV-ENGEVIAILDIT 150

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL- 288
           KCLY+A+ ++E+A      +  A EGVE + + N       ++D LRE+M  P LS++L 
Sbjct: 151 KCLYDAIARVEKASKQGSAIAAAAEGVENQRAPN------AFIDTLRERMFKPSLSTILG 204

Query: 289 DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTC 348
           + +  A   V  SV  AA+ M+E R ++ +++    I GI TSKDI++RV+A  L P   
Sbjct: 205 ENTKVAITSVSDSVHVAAKRMQELRVSSAVIVTESKIKGILTSKDILMRVMARNLSPDLT 264

Query: 349 SVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQM 407
            V +VMTP+P+ A  +T+ILDAL  M+DG +LNLPVVD  G+ +  VDVL++T+A +  +
Sbjct: 265 LVEKVMTPNPECASVETTILDALHMMHDGKFLNLPVVDKDGNAVACVDVLQITHAAISLV 324

Query: 408 YSMQNQENGNDGGGPMWNKFWNSL-----ANDGDNESTVSDSIAXXXXXXXXXXXXXXXR 462
            S  +  N ND  G +  KFW+S        D D  S +S  +                 
Sbjct: 325 ES-SSSGNVNDVAGTIMQKFWDSAFALEPPEDYDTNSEISGQLTLDGA------------ 371

Query: 463 TRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF 522
                                  D + + +      N FTFKF+  NG+ HRF       
Sbjct: 372 -----------------------DTTKSMYQSAGFGNSFTFKFEDLNGQVHRFNCGSEHQ 408

Query: 523 EHIRATVASKL 533
           + + + V  K+
Sbjct: 409 DELVSAVMQKI 419



>gi|225438337|ref|XP_002272502.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Vitis
           vinifera]
          Length = 539

 Score =  256 bits (653), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 167/439 (38%), Positives = 241/439 (54%), Gaps = 51/439 (11%)

Query: 104 PQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAK 163
           P   V G + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   LSGI T K
Sbjct: 43  PTHLVDGVR-TVKKLRLSKALTIPEGTTVSDACRRMAARRVDAVLLTDSNALLSGIVTDK 101

Query: 164 DLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVV 223
           D+A RV+ + L    T V+ IMTR+P+ V +D+ A +AL  MV   FRHLPV  E G+V+
Sbjct: 102 DIATRVIAEELRPEQTVVSKIMTRHPIFVNSDSLAIEALEKMVQGKFRHLPVV-ENGEVI 160

Query: 224 GLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPD 283
            +LDITKCLY+A+ +ME+A      +  A+EGVER+W +N  T    +++ LRE+M  P 
Sbjct: 161 AILDITKCLYDAISRMEKAAEHGSAIAAAVEGVERQWGSNF-TAPYSFIETLRERMFKPA 219

Query: 284 LSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAG 342
           LS+++ + +  A V     +  AA+ MREYR  +V++M    I GI TSKDI++RV+A  
Sbjct: 220 LSTIIAENTKVAIVSPSDPISVAAKKMREYRVNSVIIMTGSKIQGILTSKDILMRVVAQN 279

Query: 343 LDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTY 401
           L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPVVD  G I   VDVL++T+
Sbjct: 280 LSPELTLVEKVMTPNPECATLETTILDALHIMHDGKFLHLPVVDKDGGIAACVDVLQITH 339

Query: 402 ATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXX 454
           A +    SM    +G  N+    +  KFW+S LA    +D D +S +S  +A        
Sbjct: 340 AAI----SMVENSSGAVNEVTNTIMQKFWDSTLALEPPDDYDTQSELSAVMA-------- 387

Query: 455 XXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHR 514
                      +    P   ++PS                    N F FKF+   G+ HR
Sbjct: 388 -----------ADGAEPGRNMYPSLGLG----------------NSFAFKFEDIKGRVHR 420

Query: 515 FTVDYTSFEHIRATVASKL 533
           F     S + + + V  ++
Sbjct: 421 FNCGTESLDELVSAVMQRI 439



>gi|502137176|ref|XP_004502995.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X1
           [Cicer arietinum]
          Length = 520

 Score =  256 bits (653), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 235/435 (54%), Gaps = 51/435 (11%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G + TV  +  S+ALT+ +   V EA + MAA+R D VL+ DS   LSGI T KD+A RV
Sbjct: 34  GGERTVKKVKLSKALTIPDGTTVSEACRRMAARRVDAVLLTDSSALLSGILTDKDVATRV 93

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           V +GL    TTV+ +MTRNP+ V +DT A DAL  M+   FRHLPV  E G+V+ +LDIT
Sbjct: 94  VAEGLLPDETTVSKVMTRNPIFVTSDTLAIDALQKMIQGKFRHLPVV-ENGEVIAILDIT 152

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL- 288
           KCLY+A+ ++E+A      +  A EGVE + + N       ++D LRE+M  P LS++L 
Sbjct: 153 KCLYDAIARVEKASKQGSAIAAAAEGVENQRAPN------AFIDTLRERMFKPSLSTILG 206

Query: 289 DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTC 348
           + +  A   V  SV  AA+ M+E R ++ +++    I GI TSKDI++RV+A  L P   
Sbjct: 207 ENTKVAITSVSDSVHVAAKRMQELRVSSAVIVTESKIKGILTSKDILMRVMARNLSPDLT 266

Query: 349 SVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQM 407
            V +VMTP+P+ A  +T+ILDAL  M+DG +LNLPVVD  G+ +  VDVL++T+A +  +
Sbjct: 267 LVEKVMTPNPECASVETTILDALHMMHDGKFLNLPVVDKDGNAVACVDVLQITHAAISLV 326

Query: 408 YSMQNQENGNDGGGPMWNKFWNSL-----ANDGDNESTVSDSIAXXXXXXXXXXXXXXXR 462
            S  +  N ND  G +  KFW+S        D D  S +S  +                 
Sbjct: 327 ES-SSSGNVNDVAGTIMQKFWDSAFALEPPEDYDTNSEISGQLTLDGA------------ 373

Query: 463 TRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF 522
                                  D + + +      N FTFKF+  NG+ HRF       
Sbjct: 374 -----------------------DTTKSMYQSAGFGNSFTFKFEDLNGQVHRFNCGSEHQ 410

Query: 523 EHIRATVASKL-PSN 536
           + + + V  K+ P N
Sbjct: 411 DELVSAVMQKIGPVN 425



>gi|168028312|ref|XP_001766672.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682104|gb|EDQ68525.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 570

 Score =  254 bits (650), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 173/497 (34%), Positives = 259/497 (52%), Gaps = 39/497 (7%)

Query: 103 KPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTA 162
           KP R VP  + TV  L  S+ALT+ + + V +A + MA +R D  L++DS   L GI T 
Sbjct: 57  KPSRSVPPGERTVKRLRLSKALTIPDGSTVADACRRMATRRVDAALLVDSSALLCGIITD 116

Query: 163 KDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDV 222
           KD+A RV+ +GL    T+V+ +MT+NP+ V  DT A +AL  MV   FRHLPV  E G+V
Sbjct: 117 KDVATRVIAEGLRPEDTSVSKVMTKNPVFVMGDTLAVEALQKMVQGKFRHLPVV-ENGEV 175

Query: 223 VGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACP 282
           V LLDITKCLY+A+ +MERA      +  A+E VEREW  N  T+   +++ LR+KM  P
Sbjct: 176 VALLDITKCLYDAIARMERAAEKGNAIAAAVESVEREWG-NNATEKSSFIENLRDKMFRP 234

Query: 283 DLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIA 340
            L S++ +G+         +V  A + M+E R  +V+++   +   GI TSKD+++RV+A
Sbjct: 235 TLGSIIPEGTKVPTCSASETVTAATKKMKENRMNSVIIVSPSNKPTGILTSKDVLMRVVA 294

Query: 341 AGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKL 399
            GL P T ++ +VMTP+P+ A   T+++DAL  M+DG +L+LPV D  G I+  VDVL+L
Sbjct: 295 QGLPPETTTLDKVMTPNPECAGLDTTLVDALHTMHDGKFLHLPVTDRDGHIVACVDVLQL 354

Query: 400 TYATMEQMYSMQNQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXX 458
           T+  +  +        G D    M  KFW+S LA +   E   S S              
Sbjct: 355 THGAVATVGGGSAAGGGADQATNMLQKFWDSALALEPAEEDDDSHS-------------- 400

Query: 459 XXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPN----GKSHR 514
                    +IS       SE  S   +   +S+P     N F FK K        ++HR
Sbjct: 401 ---------DISARQSDMYSERQSGYQE-RHSSYPSFGLGNQFAFKLKVTGRDGTEQNHR 450

Query: 515 FTVDYTSFEHIRATVASKLPSNVRDFT----IYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
           F     S   + + +A ++  ++ D T    + YV               + AV  A+  
Sbjct: 451 FNCGSESLTELMSMIAQRVGHDI-DRTHLSRLMYVDDEGDKVLLATDSDLVAAVNFARIS 509

Query: 571 GMSRVILHIQEIEKKSL 587
           G   + LH++E ++K +
Sbjct: 510 GWKALTLHLEEPKRKKI 526



>gi|296082621|emb|CBI21626.3| unnamed protein product [Vitis vinifera]
          Length = 556

 Score =  254 bits (649), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 237/429 (55%), Gaps = 50/429 (11%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   LSGI T KD+A RV+ + 
Sbjct: 69  TVKKLRLSKALTIPEGTTVSDACRRMAARRVDAVLLTDSNALLSGIVTDKDIATRVIAEE 128

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ IMTR+P+ V +D+ A +AL  MV   FRHLPV  E G+V+ +LDITKCLY
Sbjct: 129 LRPEQTVVSKIMTRHPIFVNSDSLAIEALEKMVQGKFRHLPVV-ENGEVIAILDITKCLY 187

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +ME+A      +  A+EGVER+W +N  T    +++ LRE+M  P LS+++ + + 
Sbjct: 188 DAISRMEKAAEHGSAIAAAVEGVERQWGSNF-TAPYSFIETLRERMFKPALSTIIAENTK 246

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     +  AA+ MREYR  +V++M    I GI TSKDI++RV+A  L P    V +
Sbjct: 247 VAIVSPSDPISVAAKKMREYRVNSVIIMTGSKIQGILTSKDILMRVVAQNLSPELTLVEK 306

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A  +T+ILDAL  M+DG +L+LPVVD  G I   VDVL++T+A +    SM 
Sbjct: 307 VMTPNPECATLETTILDALHIMHDGKFLHLPVVDKDGGIAACVDVLQITHAAI----SMV 362

Query: 412 NQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
              +G  N+    +  KFW+S LA    +D D +S +S  +A                  
Sbjct: 363 ENSSGAVNEVTNTIMQKFWDSTLALEPPDDYDTQSELSAVMA------------------ 404

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
            +    P   ++PS                    N F FKF+   G+ HRF     S + 
Sbjct: 405 -ADGAEPGRNMYPSLGLG----------------NSFAFKFEDIKGRVHRFNCGTESLDE 447

Query: 525 IRATVASKL 533
           + + V  ++
Sbjct: 448 LVSAVMQRI 456



>gi|449457321|ref|XP_004146397.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Cucumis
           sativus]
          Length = 539

 Score =  253 bits (647), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 161/438 (36%), Positives = 237/438 (54%), Gaps = 46/438 (10%)

Query: 102 GKPQRQVPGAKG--TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGI 159
           G P +    A G  TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI
Sbjct: 43  GSPTQLPSAAVGERTVKKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDANALLSGI 102

Query: 160 FTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEE 219
            T KD+A RV+ +GL    T V+ IMTRNP+ V +D+ A +AL  MV   FRHLPV  E 
Sbjct: 103 LTDKDVATRVIAEGLRPEQTVVSKIMTRNPIFVTSDSLAMEALQKMVQGKFRHLPVV-EN 161

Query: 220 GDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKM 279
           G+V+ LLDITKCLY+A+ +ME+A      +  A+EGVER+W ++       +++ LRE+M
Sbjct: 162 GEVIALLDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSDFSAP-YAFIETLRERM 220

Query: 280 ACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
             P LS++L + +  A V     +  AA+ MRE R  +V++     I GI TSKDI++RV
Sbjct: 221 FKPSLSTILSENTKAAIVSASDPIYVAAKKMRELRVNSVVITMGTKIQGILTSKDILMRV 280

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVL 397
           +A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV+D  G ++  VDVL
Sbjct: 281 VAHNLSPELTLVEKVMTPNPECATVETTILDALHIMHDGKFLHLPVLDREGLVVACVDVL 340

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           ++T+A +  + S     + ND    M  KFW+S                           
Sbjct: 341 QITHAAISMVES--GSSSVNDVASTMMQKFWDS--------------------------- 371

Query: 458 XXXXRTRGSGNISPIPEI--HPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRF 515
                   +  + P  +I  H   SA    +G++ ++P     N F FKF+   G+ HR 
Sbjct: 372 --------ALALEPPDDIDTHSEMSAFMASEGTL-NYPSLGLGNSFAFKFEDLKGRVHRV 422

Query: 516 TVDYTSFEHIRATVASKL 533
                + + + + V  ++
Sbjct: 423 NCGTETLDELVSVVMQRI 440



>gi|473951596|gb|EMS50765.1| Meiotically up-regulated gene 70 protein [Triticum urartu]
          Length = 654

 Score =  251 bits (642), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 172/453 (37%), Positives = 247/453 (54%), Gaps = 54/453 (11%)

Query: 88  NKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCV 147
           N K  +K TS N+       V G + TV  L  S+ALT+ E   V EA + MAA+R D V
Sbjct: 39  NGKAPSKPTSPNH-------VAGER-TVKKLRLSKALTIPEGTTVSEACRRMAARRVDAV 90

Query: 148 LVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVA 207
           L+ D    LSGI T KD+A RV+ +GL    T ++ IMTR+P  V  DT A +AL  MV 
Sbjct: 91  LLTDVNGLLSGIVTDKDIATRVIAEGLRVEQTIISKIMTRSPHYVTADTLAIEALQKMVQ 150

Query: 208 RGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QP 265
             FRHLPV  + G+V+ +LDI KCLY+A+ ++E+A      L  A+EGVER++ +N   P
Sbjct: 151 GKFRHLPVV-DNGEVIAMLDIAKCLYDAISRLEKAAEQGSALAAAVEGVERQFGSNFSAP 209

Query: 266 TQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS 324
           + +++    +RE+M  P LS+++ + +  A V     V  AA+ MRE R  +V++   + 
Sbjct: 210 STLIE---TIRERMFKPSLSTIITESTKVAIVSPSDPVYVAAQKMRELRVNSVVITTGNL 266

Query: 325 IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPV 384
           + GIFTSKD+++RV+A  L P    V +VMT HPD A   TSILDAL  M+DG +L++PV
Sbjct: 267 LQGIFTSKDVLMRVVAQNLSPELTLVEKVMTAHPDCATLDTSILDALHIMHDGKFLHIPV 326

Query: 385 VDG-GSILGMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNEST 440
           VDG G ++  +DVL+LT A +    SM    +G  ND    M  KFW+S LA +  +E  
Sbjct: 327 VDGDGRVVACLDVLQLTQAAI----SMAEGGSGAANDVANTMMQKFWDSALALEPPDEEF 382

Query: 441 VSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENF 500
            S                           S I  + PSE    + DG  + +P     N 
Sbjct: 383 DSQ--------------------------SEISLVMPSE----VGDGRSSIYPAAVG-NS 411

Query: 501 FTFKFKAPNGKSHRFTVDYTSFEHIRATVASKL 533
           F FK +   G+ HRFT    S + + +++  +L
Sbjct: 412 FAFKLQDKKGRMHRFTCGSESLDELMSSITQRL 444



>gi|449519605|ref|XP_004166825.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein
           CBSCBSPB3-like [Cucumis sativus]
          Length = 539

 Score =  251 bits (640), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 160/438 (36%), Positives = 236/438 (53%), Gaps = 46/438 (10%)

Query: 102 GKPQRQVPGAKG--TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGI 159
           G P +    A G  TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI
Sbjct: 43  GSPTQLPSAAVGERTVKKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDANALLSGI 102

Query: 160 FTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEE 219
            T KD+A RV+ +GL    T V+ IMTRNP+ V +D+ A +AL  MV   FRHLPV  E 
Sbjct: 103 LTDKDVATRVIAEGLRPEQTVVSKIMTRNPIFVTSDSLAMEALQKMVQGKFRHLPVV-EN 161

Query: 220 GDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKM 279
           G+V+ LLDITKCLY+A+ +ME+A      +  A+EGVER+W ++       +++ LRE+M
Sbjct: 162 GEVIALLDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSDFSAP-YAFIETLRERM 220

Query: 280 ACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRV 338
             P LS++L + +  A V     +  A + MRE R  +V++     I GI TSKDI++RV
Sbjct: 221 FKPSLSTILSENTKAAIVSASDPIYVAXQKMRELRVNSVVITMGTKIQGILTSKDILMRV 280

Query: 339 IAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVL 397
           +A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV+D  G ++  VDVL
Sbjct: 281 VAHNLSPELTLVEKVMTPNPECATVETTILDALHIMHDGKFLHLPVLDREGLVVACVDVL 340

Query: 398 KLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXX 457
           ++T+A +  + S     + ND    M  KFW+S                           
Sbjct: 341 QITHAAISMVES--GSSSVNDVASTMMQKFWDS--------------------------- 371

Query: 458 XXXXRTRGSGNISPIPEI--HPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRF 515
                   +  + P  +I  H   SA    +G++ ++P     N F FKF+   G+ HR 
Sbjct: 372 --------ALALEPPDDIDTHSEMSAFMASEGTL-NYPSLGLGNSFAFKFEDLKGRVHRV 422

Query: 516 TVDYTSFEHIRATVASKL 533
                + + + + V  ++
Sbjct: 423 NCGTETLDELVSVVMQRI 440



>gi|22136010|gb|AAM91587.1| putative protein [Arabidopsis thaliana]
 gi|23197824|gb|AAN15439.1| putative protein [Arabidopsis thaliana]
          Length = 469

 Score =  251 bits (640), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 166/458 (36%), Positives = 241/458 (52%), Gaps = 55/458 (12%)

Query: 139 MAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSA 198
           MAA+R D  L+ DS   LSGI T KD+A RV+ +GL    T V+ +MTRNP+ V +D+ A
Sbjct: 1   MAARRVDACLLTDSSALLSGIVTDKDVATRVIAEGLRPDQTLVSKVMTRNPIFVTSDSLA 60

Query: 199 TDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVER 258
            +AL  MV   FRHLPV  E G+V+ LLDITKCLY+A+ +ME+A      L  A+EGVE+
Sbjct: 61  LEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLYDAISRMEKAAEQGSALAAAVEGVEK 119

Query: 259 EWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAV 317
           +W +        +++ LRE+M  P LS+++ D S  A V     V  AA+ MR+ R  +V
Sbjct: 120 QWGSGYSAP-YAFIETLRERMFKPALSTIITDNSKVALVAPSDPVSVAAKRMRDLRVNSV 178

Query: 318 LVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDG 377
           ++   + I+GI TSKDI++RV+A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG
Sbjct: 179 IISTGNKISGILTSKDILMRVVAQNLSPELTLVEKVMTPNPECASLETTILDALHTMHDG 238

Query: 378 HYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LA- 432
            +L+LP++D  GS    VDVL++T+A +    SM    +G  ND    M  KFW+S LA 
Sbjct: 239 KFLHLPIIDKDGSAAACVDVLQITHAAI----SMVENSSGAVNDMANTMMQKFWDSALAL 294

Query: 433 ---NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSM 489
              +D D +S +S                                +H S      D G +
Sbjct: 295 EPPDDSDTQSEMS------------------------------AMMHHS------DIGKL 318

Query: 490 ASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLPSNVRDF----TIYYV 545
           +S+P     N F+FKF+   G+ HRFT    + E +   V  ++ S+  +      I Y 
Sbjct: 319 SSYPSLGLGNSFSFKFEDLKGRVHRFTSGAENLEELMGIVMQRIGSDNNNVEQRPQIIYE 378

Query: 546 XXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIE 583
                          + AV +A+  G   + LH+   E
Sbjct: 379 DDEGDKVLITSDSDLVGAVTLARSTGQKVLRLHLDFTE 416



>gi|356518812|ref|XP_003528071.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine
           max]
          Length = 525

 Score =  250 bits (639), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 165/446 (36%), Positives = 236/446 (52%), Gaps = 54/446 (12%)

Query: 89  KKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVL 148
           K+N  KS SL  R        G + TV  L  S+ALT+ +   V EA + MAA+R D VL
Sbjct: 14  KRNHKKSLSLPARNGITPPDDGGERTVKKLRLSKALTIPDGTTVSEACRRMAARRIDAVL 73

Query: 149 VIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVAR 208
           + DS   LSGI T KD+A RVV +GL    TTV+ +MTRNP+ V +DT A DAL  M+  
Sbjct: 74  LTDSNALLSGILTDKDVATRVVAEGLKPEETTVSKVMTRNPIFVTSDTLAIDALQKMIQG 133

Query: 209 GFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPT 266
            FRHLPV  E G+V+ +LDITKCLY+A+ +ME A      +  A+EGVE + ++N   P 
Sbjct: 134 RFRHLPVV-ENGEVIAMLDITKCLYDAISRMESATQQGSAVAAAVEGVELQRTSNVSAPN 192

Query: 267 QILQYMDMLREKMACPDLSSVLDGSMPAEVG-VKTSVRDAARLMREYRTTAVLVMEHHSI 325
               +++ LRE++  P LS+++D +    +  V   V  AA+ MRE    A +++  + I
Sbjct: 193 ---TFIETLRERVFKPSLSTIVDENTKVAIALVSDPVYVAAKKMRELHVNAAVIVMENKI 249

Query: 326 AGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVV 385
            GI TSKDI++RV+A  L P +  + +VMTP+P+ A  +T+ILDAL  M++G +L+LPVV
Sbjct: 250 KGILTSKDILMRVVAQNLSPESALLEKVMTPNPECASLETTILDALHMMHNGKFLHLPVV 309

Query: 386 D-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDS 444
           D  G+ +  +DVL++T+A +  + S       ND    +  KFW+S              
Sbjct: 310 DRDGNAIACLDVLQITHAAISLVESSPGA--SNDAANTVMQKFWDS-------------- 353

Query: 445 IAXXXXXXXXXXXXXXXRTRGSGNISPIPE---IHPSESASAIDDG---SMASFPRGHDE 498
                                +  + P PE    H   S     DG   + +++      
Sbjct: 354 ---------------------AFALEPPPEDFDTHSEASGRLTLDGADTTKSTYQSVGFG 392

Query: 499 NFFTFKFKAPNGKSHRFTVDYTSFEH 524
           N F FKF   NG  HRF   Y   EH
Sbjct: 393 NSFAFKFDDHNGHVHRF---YCGAEH 415



>gi|413925448|gb|AFW65380.1| hypothetical protein ZEAMMB73_586556 [Zea mays]
          Length = 545

 Score =  250 bits (639), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 159/424 (37%), Positives = 230/424 (54%), Gaps = 42/424 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 59  TVKKLRLSKALTIAEGTTVSEACRRMAARRVDAVLLTDAGGLLSGIVTDKDIATRVIAEG 118

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T ++ IMTRNP  V  DT A +AL+ MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 119 LRVEQTIISKIMTRNPSYVMADTPAIEALHKMVQGKFRHLPVV-ENGEVIAMLDIAKCLY 177

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ ++E+A      L  A+EGVER+   N   P  +L+    LRE+M  P LS+++ + 
Sbjct: 178 DAISRLEKAAEQGSALAAAIEGVERQLGGNFSGPHNLLET---LRERMFKPSLSTIITEN 234

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +  A V +   V  A R MR+ R  +V++M  +S+ GIFTSKD+++RV+A  L P    V
Sbjct: 235 TKVATVSLSDPVCVATRKMRDLRVNSVIIMAGNSLHGIFTSKDVLMRVVAQNLSPELTLV 294

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYS 409
            +VMT HPD A   T+ILDAL  M+DG +L++PV+DG G +   +DVL+LT+A +  +  
Sbjct: 295 EKVMTAHPDCATLDTTILDALHIMHDGKFLHIPVLDGDGQVAACLDVLQLTHAAISMVEG 354

Query: 410 MQNQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNI 469
                  ND    +  KFW+S     D +                             + 
Sbjct: 355 --GPGGANDVANTIMQKFWDSALEPPDEDFD---------------------------SH 385

Query: 470 SPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATV 529
           S +  + PS++     DG    +P     N F FK +   G+ HRFT    S + + ++V
Sbjct: 386 SELSLVVPSDAG----DGRSCIYPPAVG-NSFVFKLQDRKGRMHRFTCGSESLDELMSSV 440

Query: 530 ASKL 533
             +L
Sbjct: 441 IQRL 444



>gi|470148343|ref|XP_004309727.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein
           CBSCBSPB3-like [Fragaria vesca subsp. vesca]
          Length = 541

 Score =  249 bits (637), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 163/440 (37%), Positives = 236/440 (53%), Gaps = 54/440 (12%)

Query: 104 PQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAK 163
           P     G + TV  L  S+ALT+     V +A + MAA+R D VL+ D+   LSGI T K
Sbjct: 45  PALGTAGGERTVKKLRLSKALTIPXGTTVSDACRRMAARRVDAVLLTDANALLSGIVTDK 104

Query: 164 DLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVV 223
           D+A RV+ +GL    TTV+ IMTRNP+ V  D+ A +AL  M+   FRHLPV  E G+V+
Sbjct: 105 DIATRVIAEGLRPENTTVSKIMTRNPIFVNADSLAMEALQKMIQGKFRHLPVV-ENGEVI 163

Query: 224 GLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPD 283
            LLDITKCLY+A+ +ME+A      +  A+EGVER+W  N       +++ LRE+M  P 
Sbjct: 164 ALLDITKCLYDAIARMEKAAEQGSAIAAAVEGVERQWGANYSAP-YAFLETLRERMFKPS 222

Query: 284 LSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAG 342
           LSS++ + +  A V     V  AA+ MR++R  +V+++  + I GI TSKDI++RV+A  
Sbjct: 223 LSSIIGENTKVAIVSPSDPVYVAAKRMRDFRVNSVIIVMGNKIQGILTSKDILMRVVAQN 282

Query: 343 LDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTY 401
           + P    V +VMTP+P+ A  +T+ILDAL  M++G +L+LPV+D   S+   VDVL++T+
Sbjct: 283 VSPELTLVEKVMTPNPECATLETTILDALHIMHEGKFLHLPVLDRDESVAACVDVLQITH 342

Query: 402 ATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXX 454
           A +    SM    +G  ND    M  KFW+S LA    +D D +S +S  +A        
Sbjct: 343 AAI----SMVESSSGTVNDMANTMMQKFWDSALALEPPDDTDTQSEMSAMMAS------- 391

Query: 455 XXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASF--PRGHDENFFTFKFKAPNGKS 512
                                         D G  A F  P     N F FKF+   G+ 
Sbjct: 392 ------------------------------DAGEQAKFTYPSLGLGNSFAFKFEDRKGRV 421

Query: 513 HRFTVDYTSFEHIRATVASK 532
           HR      + + + + V  +
Sbjct: 422 HRLNSGTENLDELVSAVMQR 441



>gi|356511510|ref|XP_003524468.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Glycine
           max]
          Length = 542

 Score =  249 bits (636), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 155/429 (36%), Positives = 235/429 (54%), Gaps = 39/429 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV SL  S+ALTV E+  V EA + MAA++ D +L+ DS   L GI T KD+A RV+   
Sbjct: 51  TVKSLRLSKALTVPETTTVYEACRRMAARKVDALLLTDSNALLCGILTDKDIATRVIARE 110

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+VV +LDI KCLY
Sbjct: 111 VNLEETPVSKVMTRNPVFVLSDTRAVEALQKMVQGRFRHLPVV-ENGEVVAILDIAKCLY 169

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EG+E+ W T+ P     +M+ LRE++  P LS+++ + S 
Sbjct: 170 DAIARMERAAEKGKAIAAAVEGIEKHWGTSTPASNSTFMETLREQIFKPSLSTIIPENSK 229

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV    + M E R ++ +V       GI TSKDI++RVIA  L PS+  V +
Sbjct: 230 VVTVSPTDSVLTTTKKMLELRASSAVVTIDDKPCGILTSKDILMRVIAQSLPPSSTLVEK 289

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+     T I+DAL  M+DG +L+LPVV+ GG ++  VDV+ +T+A +  + +  
Sbjct: 290 VMTPNPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATVGNTP 349

Query: 412 NQENGNDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
           N    N+    M  KFW+S   LA + ++E + S++                       +
Sbjct: 350 N--FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEA-----------------------S 384

Query: 469 ISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRAT 528
           +  I E          + G   S+     +N F+FK +   G+ HRFT D  S   +  +
Sbjct: 385 LKMISE--------GGETGRSISYLTSSMQNVFSFKLQDRKGRLHRFTCDTRSLAEVITS 436

Query: 529 VASKLPSNV 537
           +  ++  ++
Sbjct: 437 IVQRVGDDI 445



>gi|462418727|gb|EMJ22990.1| hypothetical protein PRUPE_ppa003919mg [Prunus persica]
          Length = 540

 Score =  248 bits (634), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 169/477 (35%), Positives = 251/477 (52%), Gaps = 52/477 (10%)

Query: 67  IARQRMSKK---DEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQA 123
           + R  +S+K     AI+K V  E    N T  TS  +         G + TV  L  S+A
Sbjct: 7   VRRTSLSQKRGPSAAIKKSVPPENGTSNGT--TSKPSSPPHPLSSGGGERTVKKLRLSKA 64

Query: 124 LTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVAT 183
           LT+ E   V +A + MAA+R D VL+ D+   LSGI T KD+  RV+ +GL    T V+ 
Sbjct: 65  LTIPEGTTVSDACRRMAARRVDAVLLTDANALLSGIVTDKDILARVIAEGLRPEQTIVSK 124

Query: 184 IMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAY 243
           IMTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDITKCLY+A+ +ME+A 
Sbjct: 125 IMTRNPIFVNSDSLALEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLYDAISRMEKAA 183

Query: 244 GSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSV 302
                +  A+EGVER+W  N       +++ LRE+M  P L++++ + +  A V     V
Sbjct: 184 EQGSAIAAAVEGVERQWGANLSAP-YAFLETLRERMFKPSLATIIGENTKVAIVSPSDPV 242

Query: 303 RDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAP 362
             AA+ MRE+R  + ++   + I GI TSKDI++RV+A  L P    V +VMTP+P+ A 
Sbjct: 243 YVAAKRMREFRMNSAIIATGNKIQGILTSKDILMRVVAQNLSPELTLVEKVMTPNPECAM 302

Query: 363 PQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGG 421
            +T+ILDAL  M++G +L+LPV+D  GS+   VDVL++T+A +  + S  +    N    
Sbjct: 303 LETTILDALHIMHEGKFLHLPVLDRDGSVAACVDVLQITHAAISMVES--SSGTANTMAN 360

Query: 422 PMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIH 476
            M  KFW+S LA    +D D +S +S  +A                + G+    P P + 
Sbjct: 361 TMMQKFWDSALALEPPDDCDTQSELSALMA----------------SDGTDGKFPYPSLG 404

Query: 477 PSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKL 533
                                 N F FKF+   G+ HR      + + + + V  ++
Sbjct: 405 LG--------------------NSFAFKFEDLRGRMHRINCGMENLDELLSAVMQRI 441



>gi|357464823|ref|XP_003602693.1| Octicosapeptide/Phox/Bem1p domain-containing protein [Medicago
           truncatula]
 gi|355491741|gb|AES72944.1| Octicosapeptide/Phox/Bem1p domain-containing protein [Medicago
           truncatula]
          Length = 519

 Score =  248 bits (634), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 161/430 (37%), Positives = 233/430 (54%), Gaps = 55/430 (12%)

Query: 99  NNRGKPQR--QVPGAKG--TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEE 154
           N  GKP      PG  G  TV  +  S+ALT+ +   V +A + MAA+R D VL+ DS  
Sbjct: 18  NGNGKPPSPSSQPGDGGERTVKKVKLSKALTIPDGTTVTDACRRMAARRVDAVLLTDSSA 77

Query: 155 HLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLP 214
            LSGI T KD+A RVV +GL    T V+ +MTRNP+ V +DT A DAL  M+   FRHLP
Sbjct: 78  LLSGILTDKDVATRVVAEGLSPDETHVSKVMTRNPIFVTSDTLAIDALQKMIQGKFRHLP 137

Query: 215 VCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKL-YDALEGVEREWSTNQPTQILQYMD 273
           V  E G+V+ +LDITKCLY+A+ ++E+A      +   A+EGVE + + N       ++D
Sbjct: 138 VV-ENGEVIAILDITKCLYDAIARVEKASQQGSAIAAAAVEGVEHQRAPN------AFID 190

Query: 274 MLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSK 332
            LRE+M  P LS++L + +  A       V  AA+ M+E R ++ +++  + I GI TSK
Sbjct: 191 TLRERMFKPSLSTILGENTKVAITSASDPVHVAAKRMQELRVSSSVIVTENKIQGILTSK 250

Query: 333 DIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSIL 391
           DI++RV+A  L P +  V +VMTP+P  A  +T+I+DAL  M+DG +L+LPVVD  G+++
Sbjct: 251 DILMRVMAPNLSPESTLVEKVMTPNPQCATLETTIIDALHMMHDGKFLHLPVVDKDGNVV 310

Query: 392 GMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSL-----ANDGDNESTVSDSIA 446
             VDVL++T+A +  + S  +  N ND    +  KFW+S        D D  S VS  + 
Sbjct: 311 ACVDVLQITHAAISLVES-SSSGNVNDVASTIMQKFWDSAFALEPPEDYDTNSEVSGQLT 369

Query: 447 XXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFK 506
                                                  D + +++      N FTFKF+
Sbjct: 370 LDGA-----------------------------------DTTKSTYQSAGFGNSFTFKFE 394

Query: 507 APNGKSHRFT 516
             NG+ HRFT
Sbjct: 395 DLNGQVHRFT 404



>gi|409038017|gb|EKM48265.1| hypothetical protein PHACADRAFT_132508 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 426

 Score =  248 bits (634), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 165/426 (38%), Positives = 221/426 (51%), Gaps = 81/426 (19%)

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHS-----------IAGIFTSKDIVLRVIAA 341
           PA VG KT+VR+ A+LM+E RTTAV VME  S           IAGIFTSKD+VLRVIAA
Sbjct: 7   PATVGPKTTVREVAKLMKERRTTAVCVMESPSTSMGGTAATPRIAGIFTSKDVVLRVIAA 66

Query: 342 GLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLT 400
           GLD   CSV+RVMTPHPDTAPP  ++ DALKKM++GHYLNLPV++  G ++ +VDVLKLT
Sbjct: 67  GLDAGRCSVVRVMTPHPDTAPPTMTVHDALKKMHNGHYLNLPVIETDGRLIAIVDVLKLT 126

Query: 401 YATMEQMYSMQNQENGN--DGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXX 458
           YAT+EQM +M  +  G     GGPMW +F+ SL +D DNES VS S A            
Sbjct: 127 YATLEQMNAMSAEAAGGAEPEGGPMWGRFFESLGHD-DNESAVSGSAA--------HTEQ 177

Query: 459 XXXRTRGSGNI--SPIPEIHPSESASAI--DDGS-MASFPR--------------GHDEN 499
              +TR + ++  SP  E+HP++SAS +  DDGS + ++ R                D+ 
Sbjct: 178 SRNQTRSTSHLMQSPHSELHPNDSASVVDEDDGSVLDAYSRRKGDPPSIIGAQSIAPDDG 237

Query: 500 FFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLPS-----------------NVRDFTI 542
            + FKF+ P+G++HRF   +   E +R  V+ KL +                 N  DF +
Sbjct: 238 TYVFKFRTPSGRTHRFQARHDDVEVLREIVSGKLATDPFFTQHKVVDDGDVSPNPTDFLL 297

Query: 543 YYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQ----------EIEKKSLRXXXX 592
            Y                 DAV+IA+  G  RV+L +Q          E   K       
Sbjct: 298 SYTDADGDSVLVTSNADVTDAVKIARNAGEDRVVLLVQGGKGWEDATAERSAKQAEQVAA 357

Query: 593 XXXXXXXXI-----------LEKRRRRKRGKHAPDYN-LPIPHDLLLPGAVLTLAIAIIG 640
                   I           +E      +  H P+   + IP DLLLP ++  LA  I+G
Sbjct: 358 AAQEEVKAIEKEATPIPTPPIEHHYAPPQPVHVPEEKVMGIPKDLLLPASIGALAAVILG 417

Query: 641 VFALSR 646
           +F +SR
Sbjct: 418 IFTMSR 423



>gi|356512874|ref|XP_003525140.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine
           max]
          Length = 535

 Score =  248 bits (634), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 174/486 (35%), Positives = 250/486 (51%), Gaps = 54/486 (11%)

Query: 106 RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDL 165
           ++  G + TV  L  S+ALT+ E   V EA + MAA+R D VL+ DS   LSGI T KD+
Sbjct: 41  QEFDGGERTVKKLRLSKALTISEVTTVSEACRRMAARRVDAVLLTDSNVLLSGIMTDKDI 100

Query: 166 AFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGL 225
           A RV+ +GL    T V+ +MTR+P+ V +DT A +AL  MV   FRHLPV  E G+V+ +
Sbjct: 101 ATRVIAEGLRPEQTMVSKVMTRSPIFVTSDTLALEALQKMVQGKFRHLPVV-ENGEVIAI 159

Query: 226 LDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLS 285
           LDIT+CLY+A+ +ME+A      +  A+EGVER   +N     L  ++ LRE+M  P LS
Sbjct: 160 LDITRCLYDAITRMEKAAEQGSAIAAAVEGVERHRGSNVSASAL--IEALRERMFKPSLS 217

Query: 286 SVLDGSMPAEVGVKTS-VRDAARLMREYRT-TAVLV-MEHHSIAGIFTSKDIVLRVIAAG 342
           +++  +    +      V  AAR MR+ R  +AV+V +    I GI TSKDI++RV+A  
Sbjct: 218 TLMGENTKVAIASPADPVYVAARKMRDLRVNSAVIVSLSGTKIQGILTSKDILMRVVAQN 277

Query: 343 LDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTY 401
           L P    V +VMTP+PD A   T+ILD+L  M+DG +L+LPVVD  G ++  +DVL++T+
Sbjct: 278 LSPELTLVEKVMTPNPDCASVDTTILDSLHMMHDGKFLHLPVVDKDGYVVACMDVLQITH 337

Query: 402 ATMEQMYSMQNQENG--NDGGGPMWNKFWNSLAN-----DGDNESTVSDSIAXXXXXXXX 454
           A +    SM    +G  ND    +  KFW+S  N     D D  S +S            
Sbjct: 338 AAI----SMVESSSGAVNDVANTIMQKFWDSAFNLEPPEDSDTHSEISG----------- 382

Query: 455 XXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHR 514
                               +  S+ A    D S +++      N F FKFK  +G+ HR
Sbjct: 383 --------------------LMTSDGA----DTSKSAYQSVGFGNSFAFKFKDLSGRVHR 418

Query: 515 FTVDYTSFEHIRATVASKLPSN-VRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMS 573
           F       + + +T+  +L  N V    I Y                + AV  A   GM 
Sbjct: 419 FNCGTEHIDELVSTIMQRLDVNDVERPMILYEDDEGDKIVLATDSDLVSAVSYATSAGMK 478

Query: 574 RVILHI 579
            + LH+
Sbjct: 479 ALKLHL 484



>gi|326524536|dbj|BAK00651.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 559

 Score =  248 bits (634), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 180/505 (35%), Positives = 262/505 (51%), Gaps = 56/505 (11%)

Query: 88  NKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCV 147
           N K  +K TS N+       V G + TV  L  S+ALT+ E   + EA + MAA+R D V
Sbjct: 54  NGKVPSKPTSPNH-------VAGER-TVKKLRLSKALTIPEGTTLSEACRRMAARRVDAV 105

Query: 148 LVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVA 207
           L+ D    LSGI T KD+A RV+ +GL    T ++ IMTR+P  V  DT A +AL  MV 
Sbjct: 106 LLTDVNGLLSGIVTDKDIATRVIAEGLRVEQTIISKIMTRSPHYVTADTLAIEALQKMVQ 165

Query: 208 RGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QP 265
             FRHLPV +  G+V+ +LDI KCLY+A+ ++E+A      L  A+EGVER+  +N   P
Sbjct: 166 GKFRHLPVVD-NGEVIAMLDIAKCLYDAISRLEKAAEQGSALAAAVEGVERQLGSNFSAP 224

Query: 266 TQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHS 324
           + +++    +RE+M  P LS+++ + +  A V     V  AA+ MRE R  +V++   + 
Sbjct: 225 STLIET---IRERMFKPSLSTIITESTKVAIVSPSDPVYVAAQKMRELRVNSVVITTGNL 281

Query: 325 IAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPV 384
           + GIFTSKD+++RV+A  L P    V +VMT HPD A   TSILDAL  M+DG +L++PV
Sbjct: 282 LQGIFTSKDVLMRVVAQNLSPELTLVEKVMTAHPDCATLDTSILDALHIMHDGKFLHIPV 341

Query: 385 VDG-GSILGMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNEST 440
           VDG G ++  +DVL+LT A +    SM    +G  ND    M  KFW+S LA +  +E  
Sbjct: 342 VDGDGRVVACLDVLQLTQAAI----SMAEGGSGAANDVANTMMQKFWDSALALEPSDEEF 397

Query: 441 VSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENF 500
            S                           S +  + PSE    + DG  + +P     N 
Sbjct: 398 DSH--------------------------SEMSLVMPSE----VGDGRSSIYP-AVVGNS 426

Query: 501 FTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLPSNVRD--FTIYYVXXXXXXXXXXXXX 558
           F FK +   G+ HRFT    S + + +++  +L + V      + Y              
Sbjct: 427 FAFKLQDKKGRMHRFTCGSESLDELVSSITQRLGTVVEKGLIQLLYDDDEGDRVLLTTDS 486

Query: 559 XXIDAVRIAQRQGMSRVILHIQEIE 583
               AV  A+  G+  + LHI + E
Sbjct: 487 DLAGAVLNAKSSGLKVLRLHIDDSE 511



>gi|118489093|gb|ABK96353.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 555

 Score =  248 bits (633), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 158/433 (36%), Positives = 232/433 (53%), Gaps = 52/433 (12%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G + TV  L  S+ALT+ E   V +A + MAA+R + VL+ D+   LSGI T KD++ RV
Sbjct: 65  GGERTVKKLKLSKALTIPEGTTVFDACRRMAARRVNAVLLTDANALLSGIVTDKDISARV 124

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           + +GL    T V+ IMTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDIT
Sbjct: 125 IAEGLRPEHTIVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVV-ENGEVIALLDIT 183

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL- 288
           +CLY+A+ +ME+A      +  A+EGVER+W  N  T    +++ LRE+M  P LS+++ 
Sbjct: 184 RCLYDAISRMEKAAEQGSAIAAAVEGVERQWGNNF-TAPYAFIETLRERMFKPSLSTIIG 242

Query: 289 DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTC 348
           + S  A       V  A + MRE R  +V+V+  + I GI TSKDI++RV+A  L P   
Sbjct: 243 EQSKVAIASPSDPVYAATKKMRELRVNSVIVVTGNKIQGILTSKDILMRVVAQNLSPELT 302

Query: 349 SVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQM 407
            V +VMT +P+    +T+ILDAL  M+DG +L+LPVVD  GS+   +DVL++T+A +   
Sbjct: 303 LVEKVMTLNPECVTLETTILDALHVMHDGKFLHLPVVDKDGSVAACLDVLQITHAAI--- 359

Query: 408 YSMQNQENG--NDGGGPMWNKFWNSL-----ANDGDNESTVSDSIAXXXXXXXXXXXXXX 460
            S+    +G  ND    M  KFW+S      A+D D +S +S  +A              
Sbjct: 360 -SLVESSSGAVNDVANTMMQKFWDSALALEPADDYDTQSEMSALMAS------------- 405

Query: 461 XRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYT 520
                                   D   +  +P     N F FKF+   G+ HR      
Sbjct: 406 ------------------------DATELGRYPSLGLGNSFAFKFQDLKGRVHRLNCGTE 441

Query: 521 SFEHIRATVASKL 533
           +   + +TV  ++
Sbjct: 442 NLNELLSTVLQRI 454



>gi|356507428|ref|XP_003522469.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine
           max]
          Length = 734

 Score =  248 bits (633), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 150/361 (41%), Positives = 221/361 (61%), Gaps = 15/361 (4%)

Query: 73  SKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALV 132
           S +  +I KK      K+++ KS SL  R        G + TV  L  S+ALT+ +   V
Sbjct: 3   STETSSINKKT-----KRHQKKSLSLPARNGINPPDDGGERTVKKLRLSKALTIPDGTTV 57

Query: 133 VEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCV 192
            EA + MAA+R D VL+ DS   L+GI T KD+A RVV +GL    TTV+ +MTRNP+ V
Sbjct: 58  SEACRRMAARRIDAVLLTDSNALLAGILTDKDVATRVVTEGLKPEETTVSKVMTRNPIFV 117

Query: 193 KNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDA 252
            +DT A DAL  M+   FRHLPV  E G+V+ +LDITKCLY+A+ +ME A      +  A
Sbjct: 118 TSDTLAIDALQKMIQGKFRHLPVV-ENGEVIAMLDITKCLYDAISRMESATQHGSAVAAA 176

Query: 253 LEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMPAEVGVKTS-VRDAARLMRE 311
           +EGVE + ++N P     +++ LRE++  P LS+++D +    + + +  V  AA+ MRE
Sbjct: 177 VEGVELQQTSNAPN---TFIETLRERVFKPSLSTIVDENTKVAIALASDPVYVAAKKMRE 233

Query: 312 -YRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDA 370
            +  +AV+VME + I GI TSKDI++RV+A  L P +  + +VMTP+P  A  +T+ILDA
Sbjct: 234 LHVNSAVIVME-NKIQGILTSKDILMRVVAQNLSPESALLEKVMTPNPQCASLETTILDA 292

Query: 371 LKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWN 429
           L  M++G +L+LPVVD  G++   +DVL++T+A +  + S       ND    +  KFW+
Sbjct: 293 LHMMHNGKFLHLPVVDRDGNVTACLDVLQITHAAISLVESSPGA--SNDAANTVMQKFWD 350

Query: 430 S 430
           S
Sbjct: 351 S 351



>gi|218185325|gb|EEC67752.1| hypothetical protein OsI_35274 [Oryza sativa Indica Group]
          Length = 560

 Score =  247 bits (630), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 161/423 (38%), Positives = 229/423 (54%), Gaps = 38/423 (8%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  ++A+T+ E   V EA Q MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 52  TVKKLRLTKAVTIPEGTTVAEACQRMAARRVDAVLLTDANGLLSGIVTDKDIAKRVIAEG 111

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T  + IMTR P+ V +DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 112 LRVEQTITSKIMTRTPVYVMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAMLDIAKCLY 170

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ ++E+A      L  A+EGVER+   N P      ++ LRE+M  P LS+++ + + 
Sbjct: 171 DAISRLEKAAEQGSALAAAVEGVERQVGDNLPDHS-SVIETLRERMLKPSLSTIISENTK 229

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AAR MRE R  +V++   +S+ GIFTSKD+++RV+   L P    V +
Sbjct: 230 VAIVSPWDPVCVAARKMRELRVNSVVITAGNSLQGIFTSKDVLMRVVTQNLSPELTHVEK 289

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMT HP+ A   TSILDAL  M+DG +L++PVVDG G ++  +DVL++T+A +  +    
Sbjct: 290 VMTAHPECATLDTSILDALHIMHDGKFLHIPVVDGEGRVVACLDVLQITHAAISMVEG-- 347

Query: 412 NQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNIS 470
             E  ND    +  KFW+S LA +  +E   S                           S
Sbjct: 348 GPETTNDVANTIMQKFWDSALALEPPDEEFDSR--------------------------S 381

Query: 471 PIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVA 530
            I  + PSE+     DG  +  P     N F FK +   G+ HRF     S   + ++V 
Sbjct: 382 EISLLMPSEAG----DGRSSINPPVVG-NSFVFKIEDQKGRMHRFACGSESLHELVSSVV 436

Query: 531 SKL 533
            +L
Sbjct: 437 QRL 439



>gi|302783404|ref|XP_002973475.1| hypothetical protein SELMODRAFT_149040 [Selaginella moellendorffii]
 gi|300159228|gb|EFJ25849.1| hypothetical protein SELMODRAFT_149040 [Selaginella moellendorffii]
          Length = 545

 Score =  247 bits (630), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 262/530 (49%), Gaps = 74/530 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           A  + SK+  A +KK   E     +TKS+             G + TV  L  S+ALT+ 
Sbjct: 9   AGSKSSKRPPAAKKKPISENGSLRKTKSS-------------GGERTVKKLRLSKALTIP 55

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           +   V +A + M  +R D  L+ DS   L GI T KD+A RV+ + L    T V+ +MT+
Sbjct: 56  DGTTVADACRRMVTRRVDAALLTDSTAMLCGIITDKDVATRVIAENLRPDETLVSKVMTK 115

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+ V +D  A DAL  MV   FRHLPV  E G+V+ LLDITKCLY+A+ +ME+A     
Sbjct: 116 NPVFVMSDALAVDALQKMVQGKFRHLPVV-ENGEVIALLDITKCLYDAIARMEKAAEKGN 174

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAA 306
            +  A++ VER+W  N       ++D LRE+M  P LS+++ + +  A V    +V  A 
Sbjct: 175 AIAAAVQDVERQWG-NTLNSSSTFIDTLRERMFRPTLSTLINENTKVATVSPSDTVLTAT 233

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           R MRE+R  +V++  ++   GI TSKD+++RV+A+ L P + +V +VMTP+P+    +T+
Sbjct: 234 RKMREFRVNSVIITINNKPQGILTSKDVLMRVVASNLAPDSTTVDKVMTPNPECVTLETT 293

Query: 367 ILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGNDGGG---- 421
           I+DAL  M+DG +L+LPVVD    I+  +DVL+LT+  +  +        GN GGG    
Sbjct: 294 IVDALHTMHDGKFLHLPVVDQENCIVACLDVLQLTHGAVATV--------GNVGGGTPSE 345

Query: 422 ---PMWNKFWNSL------ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPI 472
               M  KFW+S        +D D +S +S ++                           
Sbjct: 346 TGSTMMQKFWDSAFALDAPEDDDDTQSNLSATL--------------------------- 378

Query: 473 PEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASK 532
                +  A   + G +  +P G   N F FK K  NG+ HRF     S   + + V  +
Sbjct: 379 -----TSEAFHTEVGRLG-YPSGGPGNVFGFKLKDRNGRVHRFNCGTESLTELVSAVVQR 432

Query: 533 LPSNV---RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
           L  ++   +   I Y                + AV  A+  G+  + LH+
Sbjct: 433 LGDDIDRNKPPQILYEDDERDRVLLSSDGDLVAAVNFAKATGLKGLKLHV 482



>gi|224093670|ref|XP_002309952.1| predicted protein [Populus trichocarpa]
 gi|222852855|gb|EEE90402.1| predicted protein [Populus trichocarpa]
          Length = 488

 Score =  246 bits (628), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/429 (36%), Positives = 230/429 (53%), Gaps = 52/429 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V +A + MAA+R +  L+ D+   LSGI T KD++ RV+ +G
Sbjct: 4   TVKKLRLSKALTIPEGTTVSDACRRMAARRVNAALLTDANALLSGIVTDKDISARVIAEG 63

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ IMTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLDITKCLY
Sbjct: 64  LRPDQTIVSKIMTRNPIFVNSDSLAIEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLY 122

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMP 293
           +A+ +ME+A      +  A+EGVER+W  N  T    +++ LRE+M  P LS+++     
Sbjct: 123 DAISRMEKAAEQGSAIAAAVEGVERQWG-NNFTAPHTFIETLRERMFKPSLSTIIGEQTK 181

Query: 294 AEVGVKTS-VRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
             V   +  V  AA+ MRE R  + +V+  + I GI TSKDI++RV+A  L P    V +
Sbjct: 182 VAVASPSDPVYVAAKKMRELRVNSAIVVTGNKIQGILTSKDILMRVVAQNLSPELTLVEK 241

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+    +T++LDAL  M+DG +L+LPV+D  GS    VDVL++T+A +    SM 
Sbjct: 242 VMTPNPECVTLETTVLDALHVMHDGKFLHLPVLDKDGSAAACVDVLQITHAAI----SMV 297

Query: 412 NQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
              +G  ND    M  KFW+S LA    +D D +S +S  +A                  
Sbjct: 298 ESSSGAVNDAASTMMQKFWDSALALEPPDDYDTQSEMSALMAS----------------- 340

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
                               D   +  +P     N F FKF+   G+ HR      + + 
Sbjct: 341 --------------------DGAELGRYPSLGLGNSFAFKFEDLKGRIHRLNCCTENLDE 380

Query: 525 IRATVASKL 533
           + +TV  ++
Sbjct: 381 LLSTVLQRI 389



>gi|255574194|ref|XP_002528012.1| conserved hypothetical protein [Ricinus communis]
 gi|223532581|gb|EEF34368.1| conserved hypothetical protein [Ricinus communis]
          Length = 546

 Score =  246 bits (628), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 160/435 (36%), Positives = 234/435 (53%), Gaps = 50/435 (11%)

Query: 108 VPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAF 167
           V G + TV  L  S+ALT+ E   V +A + MAA+R D VL+ D+   LSGI T KD++ 
Sbjct: 54  VVGGERTVKKLRLSKALTIPEGTTVSDACRRMAARRVDAVLLTDANALLSGIVTDKDISA 113

Query: 168 RVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLD 227
           RV+ +GL    T V+ IMTRNP+ V +D+ A DAL  MV   FRHLPV  E G+V+ LLD
Sbjct: 114 RVIAEGLRPEQTIVSKIMTRNPIFVASDSLAIDALQKMVQGKFRHLPVV-ENGEVIALLD 172

Query: 228 ITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSV 287
           ITKCLY+A+ +ME+       +  A+EGVER+W +N       +++ LRE+M  P LS++
Sbjct: 173 ITKCLYDAISRMEKVAEQGSAIAAAVEGVERQWGSNFSAP-YAFIETLRERMFKPSLSTI 231

Query: 288 LDGSMPAEVGVKTS-VRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPS 346
           +       +   +  V  AA+ MR+ +  +V+++  + I GI TSKDI++RV+A  + P 
Sbjct: 232 IGEQTKVAIASPSDPVYVAAKRMRDLQVNSVIIVTGNKIQGILTSKDILMRVVAHNISPE 291

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATME 405
              V +VMT +P+ A  +T+ILDAL  M+DG +L+LPVVD  GS    VDVL++T+A + 
Sbjct: 292 LTLVEKVMTSNPECATLETTILDALHIMHDGKFLHLPVVDKDGSATACVDVLQITHAAI- 350

Query: 406 QMYSMQNQENG--NDGGGPMWNKFWNS-LA----NDGDNESTVSDSIAXXXXXXXXXXXX 458
              SM    +G  ND    M  KFW+S LA    +D D +S                   
Sbjct: 351 ---SMVENSSGAANDVANTMMQKFWDSALALEPPDDYDTQS------------------- 388

Query: 459 XXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVD 518
                          E+    ++   D G  A  P G   N F FKF    G+ HRF   
Sbjct: 389 ---------------EMSAIMTSDGTDLGKYAYPPVGLG-NSFAFKFVDLKGRVHRFNCG 432

Query: 519 YTSFEHIRATVASKL 533
             + + + + +  ++
Sbjct: 433 TENLDELTSALLQRI 447



>gi|482562683|gb|EOA26873.1| hypothetical protein CARUB_v10022966mg [Capsella rubella]
          Length = 536

 Score =  246 bits (628), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 172/497 (34%), Positives = 249/497 (50%), Gaps = 54/497 (10%)

Query: 100 NRGKPQ----RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEH 155
           N  KP     + V   + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   
Sbjct: 43  NTSKPDSPLAQPVSDGERTVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSAL 102

Query: 156 LSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPV 215
           LSGI T KD+A RV+ +GL    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV
Sbjct: 103 LSGIVTDKDIATRVIAEGLRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPV 162

Query: 216 CNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDML 275
             E G+V+ LLDITKCLY+A+ +ME+A      L  A+E  ER W +        ++D L
Sbjct: 163 V-ENGEVIALLDITKCLYDAISRMEKAAEQGSALATAVE--ERHWGSGN----FAFIDTL 215

Query: 276 REKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDI 334
           RE+M  P LS+++ + S  A V     V  A++ MR+ R  +V++   + + GI TSKDI
Sbjct: 216 RERMFKPALSTIITENSKVALVSASDPVFVASKRMRDLRVNSVIIAVGNKVQGILTSKDI 275

Query: 335 VLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGM 393
           ++RV+A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPVVD  G  +  
Sbjct: 276 LMRVVAQNLSPELTLVEKVMTPNPECASMETTILDALHIMHDGKFLHLPVVDKDGFAVAC 335

Query: 394 VDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXX 450
           +DVL++++  +    +++N  +G  ND    M  KFW+S LA D   +            
Sbjct: 336 LDVLQISHGAIS---TVENNSSGAVNDMTNTMMQKFWDSALALDPPEDY----------- 381

Query: 451 XXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNG 510
                                  E H   SA  I+     S P     N F FKF+   G
Sbjct: 382 -----------------------ETHSDMSAMLINSDGKQSCPSQGLVNSFAFKFEDRKG 418

Query: 511 KSHRFTVDYTSFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
           + HRF     S E +   V  +  ++     I Y                + AV   +  
Sbjct: 419 RVHRFNSAGESLEELMGVVMQRCDAD-SGLQIMYQDDEGDKVLISRDSDLVAAVTFVRSL 477

Query: 571 GMSRVILHIQEIEKKSL 587
           G + + LH+   E  +L
Sbjct: 478 GQNVLRLHLDFTEAMAL 494



>gi|508775246|gb|EOY22502.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform
           2 [Theobroma cacao]
          Length = 544

 Score =  246 bits (627), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 161/431 (37%), Positives = 233/431 (54%), Gaps = 41/431 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 50  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 109

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 110 LNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 168

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W  +   Q   +++ LRE+M  P LS+++ D S 
Sbjct: 169 DAIARMERAAEKGKAIAAAVEGVEKNWGASFAGQN-TFIEALRERMFRPSLSTIISDNSK 227

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV   A+ M E R ++ +V   +   GI TSKDI++RVI+  L P +  V +
Sbjct: 228 IVTVSPTDSVLATAKKMLESRLSSAVVTVENKPRGILTSKDILMRVISQNLPPESTLVEK 287

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G I+ +VDVL +T+A +  +  + 
Sbjct: 288 VMTPNPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVSQVG 347

Query: 412 NQEN-GNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
           +     N+    M  KFW+S      N+ D+E+   +S+                 + G 
Sbjct: 348 STSGINNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLA--------------SDGG 393

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
                +P  +PS           +S P     N F FK +   G+ HRFT D  S   + 
Sbjct: 394 ETARSLP--YPS-----------SSMP-----NTFGFKIQDKKGRMHRFTCDTRSMTDLI 435

Query: 527 ATVASKLPSNV 537
             +  +L  ++
Sbjct: 436 TAILQRLEDDI 446



>gi|508775245|gb|EOY22501.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform
           1 [Theobroma cacao]
          Length = 541

 Score =  245 bits (626), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 162/430 (37%), Positives = 232/430 (53%), Gaps = 42/430 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 50  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 109

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 110 LNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 168

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W  +   Q   +++ LRE+M  P LS+++ D S 
Sbjct: 169 DAIARMERAAEKGKAIAAAVEGVEKNWGASFAGQN-TFIEALRERMFRPSLSTIISDNSK 227

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV   A+ M E R ++ +V   +   GI TSKDI++RVI+  L P +  V +
Sbjct: 228 IVTVSPTDSVLATAKKMLESRLSSAVVTVENKPRGILTSKDILMRVISQNLPPESTLVEK 287

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G I+ +VDVL +T+A +  + S  
Sbjct: 288 VMTPNPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVGSTS 347

Query: 412 NQENGNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
                N+    M  KFW+S      N+ D+E+   +S+                 + G  
Sbjct: 348 GI--NNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLA--------------SDGGE 391

Query: 468 NISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRA 527
               +P  +PS           +S P     N F FK +   G+ HRFT D  S   +  
Sbjct: 392 TARSLP--YPS-----------SSMP-----NTFGFKIQDKKGRMHRFTCDTRSMTDLIT 433

Query: 528 TVASKLPSNV 537
            +  +L  ++
Sbjct: 434 AILQRLEDDI 443



>gi|297598372|ref|NP_001045471.2| Os01g0961200 [Oryza sativa Japonica Group]
 gi|57899170|dbj|BAD87222.1| CBS domain-containing protein-like [Oryza sativa Japonica Group]
 gi|57900300|dbj|BAD87133.1| CBS domain-containing protein-like [Oryza sativa Japonica Group]
 gi|255674099|dbj|BAF07385.2| Os01g0961200 [Oryza sativa Japonica Group]
          Length = 533

 Score =  245 bits (625), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 159/442 (35%), Positives = 231/442 (52%), Gaps = 44/442 (9%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q P  + TV  L  ++ALT+ E+  V EA + MA KR D  L+ DS   LSGI TA+D++
Sbjct: 46  QAPSPERTVKKLRLAKALTLPEATSVSEACRRMALKRVDAALLTDSNGMLSGILTAEDIS 105

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RV+ +GL    T VA  MTRNP+ V +++ A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 106 GRVIAEGLRPDETNVAKAMTRNPVFVMSNSPAIEALQKMVKGKFRHLPVV-EHGEVIAML 164

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSS 286
           DITK LY+A+ +ME+A      +  A+EGVER+W  + P     +++ LR+++  P LS+
Sbjct: 165 DITKFLYDAISRMEKAAEQGSAIAAAMEGVERQWGNDFPGP-HSFIENLRDQLFKPSLST 223

Query: 287 VL--DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLD 344
           ++  + S+P  V     V  AA+ MREYR  +V+VM  + + GI TSKD+VLR++A  L 
Sbjct: 224 IITENNSVPV-VSPSDPVIAAAKKMREYRVNSVVVMTGNMLLGILTSKDLVLRLVAQSLS 282

Query: 345 PSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYAT 403
           P    V +VMT +PD A   TSIL+AL  M DG YL++PV D  G I+  +D L+LT+A 
Sbjct: 283 PDVTLVEKVMTTNPDCATLDTSILEALHSMQDGKYLHIPVADKNGQIIACLDALQLTHAA 342

Query: 404 MEQMYSMQNQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXR 462
           +     ++     N     M  KFW+S LA     ES                       
Sbjct: 343 ISM---VEGASEANSMANTMMQKFWDSALALQPAEES----------------------- 376

Query: 463 TRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF 522
                      +    ES  A  D +       H  N F+FK +   G+ HRF+    S 
Sbjct: 377 -----------DARSEESRMATSDNAEGKHIPPHVGNSFSFKLQDRKGRMHRFSCVSESL 425

Query: 523 EHIRATVASKLPSNVRDFTIYY 544
           + + + V+ +L        + Y
Sbjct: 426 DELVSAVSYRLGMEKEKINLLY 447



>gi|413925447|gb|AFW65379.1| hypothetical protein ZEAMMB73_586556 [Zea mays]
          Length = 388

 Score =  244 bits (624), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 197/321 (61%), Gaps = 10/321 (3%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 59  TVKKLRLSKALTIAEGTTVSEACRRMAARRVDAVLLTDAGGLLSGIVTDKDIATRVIAEG 118

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T ++ IMTRNP  V  DT A +AL+ MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 119 LRVEQTIISKIMTRNPSYVMADTPAIEALHKMVQGKFRHLPVV-ENGEVIAMLDIAKCLY 177

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ ++E+A      L  A+EGVER+   N   P  +L+    LRE+M  P LS+++ + 
Sbjct: 178 DAISRLEKAAEQGSALAAAIEGVERQLGGNFSGPHNLLET---LRERMFKPSLSTIITEN 234

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +  A V +   V  A R MR+ R  +V++M  +S+ GIFTSKD+++RV+A  L P    V
Sbjct: 235 TKVATVSLSDPVCVATRKMRDLRVNSVIIMAGNSLHGIFTSKDVLMRVVAQNLSPELTLV 294

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYS 409
            +VMT HPD A   T+ILDAL  M+DG +L++PV+DG G +   +DVL+LT+A +  +  
Sbjct: 295 EKVMTAHPDCATLDTTILDALHIMHDGKFLHIPVLDGDGQVAACLDVLQLTHAAISMVEG 354

Query: 410 MQNQENGNDGGGPMWNKFWNS 430
                  ND    +  KFW+S
Sbjct: 355 --GPGGANDVANTIMQKFWDS 373



>gi|297823463|ref|XP_002879614.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gi|297325453|gb|EFH55873.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
          Length = 536

 Score =  244 bits (623), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 168/481 (34%), Positives = 245/481 (50%), Gaps = 50/481 (10%)

Query: 108 VPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAF 167
           V   + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   LSGI T KD+A 
Sbjct: 55  VSDGERTVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSALLSGIVTDKDIAT 114

Query: 168 RVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLD 227
           RV+ +GL    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV  E G+V+ LLD
Sbjct: 115 RVIAEGLRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVV-ENGEVIALLD 173

Query: 228 ITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSV 287
           ITKCLY+A+ +ME+A      L  A+E  ER W +        ++D LRE+M  P LS++
Sbjct: 174 ITKCLYDAISRMEKAAEQGSALATAVE--ERHWGSGN----FAFIDTLRERMFKPALSTI 227

Query: 288 L-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPS 346
           + + +  A V     V  A++ MR+ R  +V++   + I GI TSKDI++RV+A  L P 
Sbjct: 228 VTENTKVALVSASDPVFVASKRMRDLRVNSVIIAVGNKIHGILTSKDILMRVVAQNLSPE 287

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATME 405
              V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV+D  G  +  +DVL++T+A + 
Sbjct: 288 LTLVEKVMTPNPECASIETTILDALHIMHDGKFLHLPVLDKDGFAVACLDVLQITHAAIS 347

Query: 406 QMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXR 462
              +++N  +G  N+    M  KFW+S LA D   +                        
Sbjct: 348 ---TVENNSSGAVNEMANTMMQKFWDSALALDPPEDY----------------------- 381

Query: 463 TRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF 522
                      E H   SA  I+     S P     + F FKF+   G+ HRF     S 
Sbjct: 382 -----------ETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKGRVHRFNSTGESL 430

Query: 523 EHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEI 582
           E + + V  +  ++     I Y                + AV  A+  G   + LH+   
Sbjct: 431 EELMSVVMQRCEAD-SGLQIMYQDDEGDKVLISRDSDLVAAVTFARSLGQKVLRLHLDFT 489

Query: 583 E 583
           E
Sbjct: 490 E 490



>gi|302809978|ref|XP_002986681.1| hypothetical protein SELMODRAFT_446714 [Selaginella moellendorffii]
 gi|300145569|gb|EFJ12244.1| hypothetical protein SELMODRAFT_446714 [Selaginella moellendorffii]
          Length = 545

 Score =  244 bits (622), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 171/530 (32%), Positives = 261/530 (49%), Gaps = 74/530 (13%)

Query: 68  ARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVR 127
           A  + SK+  A +KK   E     +TKS+             G + TV  L  S+ALT+ 
Sbjct: 9   AGSKSSKRPPAAKKKPISENGSLRKTKSS-------------GGERTVKKLRLSKALTIP 55

Query: 128 ESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTR 187
           +   V +A + M  +R D  L+ DS   L GI T KD+A RV+ + L    T V+ +MT+
Sbjct: 56  DGTTVADACRRMVTRRVDAALLTDSTAMLCGIITDKDVATRVIAENLRPDETLVSKVMTK 115

Query: 188 NPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSK 247
           NP+ V +D  A DAL  MV   FRHLPV  E G+V+ LLDITKCLY+A+ +ME+A     
Sbjct: 116 NPVFVISDALAVDALQKMVQGKFRHLPVV-ENGEVIALLDITKCLYDAIARMEKAAEKGN 174

Query: 248 KLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAA 306
            +  A++ VER+W  N       ++D LRE+M  P LS+++ + +  A V    +V  A 
Sbjct: 175 AIAAAVQDVERQWG-NTLNSSSTFIDTLRERMFRPTLSTLINENTKVATVSPSDTVLTAT 233

Query: 307 RLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTS 366
           R MRE+R  +V++  ++   GI TSKD+++RV+A+ L P + +V +VMTP+P+    +T+
Sbjct: 234 RKMREFRVNSVIITINNKPQGILTSKDVLMRVVASNLAPDSTTVDKVMTPNPECVTLETT 293

Query: 367 ILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGNDGGG---- 421
           I+DAL  M+DG +L+LPVVD    I+  +DVL+LT+  +  +        GN GGG    
Sbjct: 294 IVDALHTMHDGKFLHLPVVDQENCIVACLDVLQLTHGAVATV--------GNVGGGTPSE 345

Query: 422 ---PMWNKFWNSL------ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPI 472
               M  KFW+S        +D + +S +S ++                           
Sbjct: 346 TGSTMMQKFWDSAFALDAPEDDDETQSNLSATL--------------------------- 378

Query: 473 PEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASK 532
                +  A   + G +  +P G   N F FK K  NG+ HRF     S   + + V  +
Sbjct: 379 -----TSEAFHTEVGRLG-YPSGGPGNVFGFKLKDRNGRVHRFNCGTESLTELVSAVVQR 432

Query: 533 LPSNV---RDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHI 579
           L   +   +   I Y                + AV  A+  G+  + LH+
Sbjct: 433 LGDYIDRNKPPQILYEDDERDRVLLSSDGDLVAAVNFAKATGLKGLKLHV 482



>gi|357520151|ref|XP_003630364.1| Meiotically up-regulated gene 70 protein [Medicago truncatula]
 gi|355524386|gb|AET04840.1| Meiotically up-regulated gene 70 protein [Medicago truncatula]
          Length = 534

 Score =  244 bits (622), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 168/444 (37%), Positives = 235/444 (52%), Gaps = 58/444 (13%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G + TV  L  S+ALT+ E   V +A + MAA+R D VL+ D+   LSGI T KD+A RV
Sbjct: 44  GGERTVKKLRLSKALTISEGTSVSDACRRMAARRVDAVLLTDANALLSGIMTDKDIATRV 103

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           + +GL    T VA +MTRNP+ V +DT A DAL  MV   FRHLPV  E G+V+ +LDIT
Sbjct: 104 IAEGLRPDQTMVAKVMTRNPLFVTSDTLAIDALQKMVQGKFRHLPVV-ENGEVIAILDIT 162

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSV 287
           KCLY+A+ +ME+A      +  A+EG ER+  +N   P  +L   D LRE++  P LS++
Sbjct: 163 KCLYDAISRMEKAAEQGSAIAAAVEGAERQRGSNASAPNALL---DTLRERIFRPSLSTL 219

Query: 288 L-DGSMPAEVGVKTSVRDAARLMREYRT-TAVLV-MEHHSIAGIFTSKDIVLRVIAAGLD 344
           + + +  A       V  AA+ MRE R  +AV+V +    I GI TSKDI++RV+A  L 
Sbjct: 220 ISENTKVAIASAADPVYVAAKKMRELRVNSAVIVSLSGTKIQGILTSKDILMRVVAQNLS 279

Query: 345 PSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYAT 403
           P    V +VMTP+PD A   T+ILDAL  M+DG +L+LPVVD  G +   VDVL++T+A 
Sbjct: 280 PELTLVEKVMTPNPDCATLDTTILDALHMMHDGKFLHLPVVDRHGYVAACVDVLQITHAA 339

Query: 404 MEQMYSMQNQENG--NDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXX 458
           +    S+    +G  ND    +  KFW+S   L    D++S                   
Sbjct: 340 I----SLVESSSGAVNDVANTIMQKFWDSAFALEPPEDSDS------------------- 376

Query: 459 XXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENF---FTFKFKAPNGKSHRF 515
                            H   SA    DG+  +    H   F   F FKF+  NG+ HRF
Sbjct: 377 -----------------HSEVSALMTSDGADTTKSAYHSMGFGNSFPFKFEDLNGRVHRF 419

Query: 516 TVDYTSFEHIRATVASKLPSNVRD 539
                  + + + V  ++  N R+
Sbjct: 420 NCGTEHLDELVSAVMQRVDINDRE 443



>gi|449440540|ref|XP_004138042.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis
           sativus]
 gi|449520507|ref|XP_004167275.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis
           sativus]
          Length = 540

 Score =  244 bits (622), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 233/432 (53%), Gaps = 46/432 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KD+A RV+  G
Sbjct: 51  TVKRLRLSRALTVPESTTISEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIACG 110

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++   T+V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 111 INLEETSVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 169

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWST--NQPTQILQYMDMLREKMACPDLSSVLDGS 291
           +A+ +MERA    K +  A+EGVE+ W T  + P     +++ LRE+M  P LS+++  +
Sbjct: 170 DAIARMERAAEKGKAIAAAVEGVEKSWGTSVSGPN---TFIETLRERMFRPSLSTIIPEN 226

Query: 292 MP-AEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +    V    +V  A + M E R ++ +V       GI TSKDI++R+IA  L P +  V
Sbjct: 227 LKIVTVPPTETVLMATKKMLELRVSSAVVTVDSKPQGILTSKDILMRLIAQNLPPDSTLV 286

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G+++ +VDV+ +T+A +  + +
Sbjct: 287 EKVMTPNPECASIDTPIVDALHTMHDGKFLHLPVVDRDGNVVAVVDVIHITHAAVATVGN 346

Query: 410 MQNQENGNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
                 GN+    M  KFW+S      ND D+E                       R+ G
Sbjct: 347 TSGV--GNEAASSMMQKFWDSAMALSPNDDDDE----------------------LRSEG 382

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  +          ++   D      FP     N F+FK +   G+ HRF+ D  S   +
Sbjct: 383 SMKL----------ASEETDTLRTLPFPSPGMSNTFSFKLEDRRGRMHRFSCDTRSLTDV 432

Query: 526 RATVASKLPSNV 537
              +  ++  ++
Sbjct: 433 ITAILQRVGDDI 444



>gi|218186500|gb|EEC68927.1| hypothetical protein OsI_37618 [Oryza sativa Indica Group]
          Length = 543

 Score =  244 bits (622), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 160/430 (37%), Positives = 233/430 (54%), Gaps = 38/430 (8%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V EA + MAA+R D VL+ D++  LSGI T KD+A
Sbjct: 49  QLTGER-TVRKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDAQGLLSGIVTDKDVA 107

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RVV +GL    T ++ IMTRNP    +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 108 TRVVAEGLRVEQTIMSKIMTRNPTYAMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAML 166

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSS 286
           DI KCLY+A+ ++E+A      +  A+EGVER+   N       +++ LRE+M  P LSS
Sbjct: 167 DIAKCLYDAISRLEKAAEQGSAIAAAVEGVERQLGGNFSAP-YAFIETLRERMFKPSLSS 225

Query: 287 VL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDP 345
           ++ +G+  A V     V  A + MRE+R  +V+V   +++ GIFTSKD+++RV+A  L P
Sbjct: 226 IVTEGTKVAIVSPSDPVYVATQKMREFRVNSVVVATGNTLQGIFTSKDLLMRVVAQNLSP 285

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATM 404
               V +VMT +PD A   T+ILDAL  M+DG +L++PV+D  G I   +DVL+LT+A +
Sbjct: 286 ELTLVEKVMTVNPDFATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAI 345

Query: 405 EQMYSMQNQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRT 463
            Q+      +  ND    +  +FW+S LA +  +E   S S                   
Sbjct: 346 -QLVVEGGNDTVNDVANTVMQRFWDSTLALESPDEECDSRSEVSLLL------------- 391

Query: 464 RGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFE 523
                            AS   DG  + +P     N F FK +   G+ HRFT    S  
Sbjct: 392 -----------------ASETGDGKSSIYPPVIG-NSFAFKLQDQKGRVHRFTCGSESLN 433

Query: 524 HIRATVASKL 533
            + +++  +L
Sbjct: 434 ELASSIKQRL 443



>gi|15227986|ref|NP_181191.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|75265956|sp|Q9SJQ5.1|Y2650_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB2
 gi|4581150|gb|AAD24634.1| hypothetical protein [Arabidopsis thaliana]
 gi|330254170|gb|AEC09264.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
          Length = 536

 Score =  243 bits (621), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 248/493 (50%), Gaps = 54/493 (10%)

Query: 100 NRGKPQ----RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEH 155
           N  KP     + V   + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   
Sbjct: 43  NTSKPDSPLAQPVSDGERTVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSAL 102

Query: 156 LSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPV 215
           LSGI T KD+A RV+ +GL    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV
Sbjct: 103 LSGIVTDKDIATRVIAEGLRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPV 162

Query: 216 CNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDML 275
             E G+V+ LLDITKCLY+A+ +ME+A      L  A+E  ER W +        ++D L
Sbjct: 163 V-ENGEVIALLDITKCLYDAISRMEKAAEQGSALATAVE--ERHWGSGN----FAFIDTL 215

Query: 276 REKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDI 334
           RE+M  P LS+++ + +  A V     V  A++ MR+ R  +V++   + I GI TSKDI
Sbjct: 216 RERMFKPALSTIVTENTKVALVSASDPVFVASKKMRDLRVNSVIIAVGNKIHGILTSKDI 275

Query: 335 VLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGM 393
           ++RV+A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV D  G  +  
Sbjct: 276 LMRVVAQNLSPELTLVEKVMTPNPECASIETTILDALHIMHDGKFLHLPVFDKDGFAVAC 335

Query: 394 VDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXX 450
           +DVL++T+A +    +++N  +G  ND    M  KFW+S LA +   +            
Sbjct: 336 LDVLQITHAAIS---TVENNSSGAVNDMANTMMQKFWDSALALEPPEDY----------- 381

Query: 451 XXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNG 510
                                  E H   SA  I+     S P     + F FKF+   G
Sbjct: 382 -----------------------ETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKG 418

Query: 511 KSHRFTVDYTSFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
           +  RF     SFE + + V  +  ++     I Y                + AV  A+  
Sbjct: 419 RVQRFNSTGESFEELMSVVMQRCEAD-SGLQIMYQDDEGDKVLISRDSDLVAAVTFARSL 477

Query: 571 GMSRVILHIQEIE 583
           G   + LH+   E
Sbjct: 478 GQKVLRLHLDFTE 490



>gi|28973655|gb|AAO64148.1| unknown protein [Arabidopsis thaliana]
          Length = 536

 Score =  243 bits (620), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 248/493 (50%), Gaps = 54/493 (10%)

Query: 100 NRGKPQ----RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEH 155
           N  KP     + V   + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   
Sbjct: 43  NTSKPDSPLAQPVSDGERTVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSAL 102

Query: 156 LSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPV 215
           LSGI T KD+A RV+ +GL    T V+ +MTRNP+ V +D+ A +AL  MV   FRHLPV
Sbjct: 103 LSGIVTDKDIATRVIAEGLRPEHTPVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPV 162

Query: 216 CNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDML 275
             E G+V+ LLDITKCLY+A+ +ME+A      L  A+E  ER W +        ++D L
Sbjct: 163 V-ENGEVIALLDITKCLYDAISRMEKAAEQGSALATAVE--ERHWGSGN----FAFIDTL 215

Query: 276 REKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDI 334
           RE+M  P LS+++ + +  A V     V  A++ MR+ R  +V++   + I GI TSKDI
Sbjct: 216 RERMFKPALSTIVTENTKVALVSASDPVFVASKKMRDLRVNSVIIAVGNKIHGILTSKDI 275

Query: 335 VLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGM 393
           ++RV+A  L P    V +VMTP+P+ A  +T+ILDAL  M+DG +L+LPV D  G  +  
Sbjct: 276 LMRVVAQNLSPELTLVEKVMTPNPECASIETTILDALHIMHDGKFLHLPVFDKDGFAVAC 335

Query: 394 VDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXX 450
           +DVL++T+A +    +++N  +G  ND    M  KFW+S LA +   +            
Sbjct: 336 LDVLQITHAAIS---TVENNSSGAVNDMANTMMQKFWDSALALEPPEDY----------- 381

Query: 451 XXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNG 510
                                  E H   SA  I+     S P     + F FKF+   G
Sbjct: 382 -----------------------ETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKG 418

Query: 511 KSHRFTVDYTSFEHIRATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQ 570
           +  RF     SFE + + V  +  ++     I Y                + AV  A+  
Sbjct: 419 RVQRFNSTGESFEELMSVVMQRCEAD-SGLQIMYQDDEGDKVLISRDSDLVAAVTFARSL 477

Query: 571 GMSRVILHIQEIE 583
           G   + LH+   E
Sbjct: 478 GQKVLRLHLDFTE 490



>gi|222616703|gb|EEE52835.1| hypothetical protein OsJ_35364 [Oryza sativa Japonica Group]
          Length = 543

 Score =  243 bits (619), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 159/430 (36%), Positives = 233/430 (54%), Gaps = 38/430 (8%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V EA + MAA+R D VL+ D++  LSGI T KD+A
Sbjct: 49  QLTGER-TVRKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDAQGLLSGIVTDKDVA 107

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RVV +GL    T ++ IMTRNP    +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 108 TRVVAEGLRVEQTIMSKIMTRNPTYAMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAML 166

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSS 286
           DI KCLY+A+ ++E+A      +  A+EGVER+   N       +++ LRE+M  P LS+
Sbjct: 167 DIAKCLYDAISRLEKAAEQGSAIAAAVEGVERQLGGNFSAP-YAFIETLRERMFKPSLST 225

Query: 287 VL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDP 345
           ++ +G+  A V     V  A + MRE+R  +V+V   +++ GIFTSKD+++RV+A  L P
Sbjct: 226 IVTEGTKVAIVSPSDPVYVATQKMREFRVNSVVVATGNTLQGIFTSKDLLMRVVAQNLSP 285

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATM 404
               V +VMT +PD A   T+ILDAL  M+DG +L++PV+D  G I   +DVL+LT+A +
Sbjct: 286 ELTLVEKVMTVNPDFATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAI 345

Query: 405 EQMYSMQNQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRT 463
            Q+      +  ND    +  +FW+S LA +  +E   S S                   
Sbjct: 346 -QLVVEGGNDTVNDVANTVMQRFWDSTLALESPDEECDSRSEVSLLL------------- 391

Query: 464 RGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFE 523
                            AS   DG  + +P     N F FK +   G+ HRFT    S  
Sbjct: 392 -----------------ASETGDGKSSIYPPVIG-NSFAFKLQDQKGRVHRFTCGSESLN 433

Query: 524 HIRATVASKL 533
            + +++  +L
Sbjct: 434 ELASSIKQRL 443



>gi|460377044|ref|XP_004234305.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Solanum
           lycopersicum]
          Length = 551

 Score =  242 bits (617), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 156/429 (36%), Positives = 236/429 (55%), Gaps = 41/429 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV +S  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 60  TVKRLRLSKALTVPDSTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 119

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++ + T V+ IMT+NP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 120 VNIQETPVSKIMTKNPVFVLSDTLAVEALQKMVLGKFRHLPVV-ENGEVIALLDIAKCLY 178

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ ++ERA    K +  A+EGVE+ W ++       +++ L+E+M  P LS+++ + S 
Sbjct: 179 DAIARLERAAEKGKAIAAAVEGVEKHWGSSVSGSN-TFIETLQERMFKPSLSTIISENSK 237

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    +V   A+ M E RT++ +VM  +   GI TSKD+++RVIA  L P +  V R
Sbjct: 238 VVIVEPSDTVLATAKKMLESRTSSAIVMVDNKPRGILTSKDMLMRVIAQDLSPESILVER 297

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP P+ +   T I+DAL  M+DG +L+LPVVD  G+++ ++DVL +T+A +  +   Q
Sbjct: 298 VMTPSPECSTTDTPIVDALHTMHDGKFLHLPVVDKEGTVVAVLDVLHITHAAVSTVG--Q 355

Query: 412 NQENGNDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGN 468
           N    N+    M  +FW+S   L  D D E+                      R+ GS  
Sbjct: 356 NAGPNNEAANTMMQRFWDSAMALTPDDDEET----------------------RSEGSLK 393

Query: 469 ISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRAT 528
           ++       SE A   + G    +P     N F FK +   G+ HRF  D  S   +  +
Sbjct: 394 LA-------SEGA---ETGRSNLYPSASLPNTFAFKIQDRKGRMHRFNCDIRSVTDLITS 443

Query: 529 VASKLPSNV 537
           +  +L +++
Sbjct: 444 IIQRLGNDI 452



>gi|508775247|gb|EOY22503.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein
           isoform 3 [Theobroma cacao]
          Length = 426

 Score =  242 bits (617), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 157/414 (37%), Positives = 222/414 (53%), Gaps = 47/414 (11%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 50  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 109

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 110 LNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 168

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W  +   Q   +++ LRE+M  P LS+++ D S 
Sbjct: 169 DAIARMERAAEKGKAIAAAVEGVEKNWGASFAGQN-TFIEALRERMFRPSLSTIISDNSK 227

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV   A+ M E R ++ +V   +   GI TSKDI++RVI+  L P +  V +
Sbjct: 228 IVTVSPTDSVLATAKKMLESRLSSAVVTVENKPRGILTSKDILMRVISQNLPPESTLVEK 287

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G I+ +VDVL +T+A +  +  + 
Sbjct: 288 VMTPNPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVSQVG 347

Query: 412 NQEN-GNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
           +     N+    M  KFW+S      N+ D+E+   +S+                     
Sbjct: 348 STSGINNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKL------------------- 388

Query: 467 GNISPIPEIHPSESASAIDDGSMAS---FPRGHDENFFTFKFKAPNGKSHRFTV 517
                           A D G  A    +P     N F FK +   G+ HRFT+
Sbjct: 389 ----------------ASDGGETARSLPYPSSSMPNTFGFKIQDKRGRMHRFTL 426



>gi|357160673|ref|XP_003578839.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like
           [Brachypodium distachyon]
          Length = 543

 Score =  242 bits (617), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 165/465 (35%), Positives = 252/465 (54%), Gaps = 48/465 (10%)

Query: 80  RKKVEHELNKKNRTKST-SLNNRGKPQRQVPGAKG-----TVASLNPSQALTVRESALVV 133
           R +++  L++K+   ST + N  GK   ++   K      TV  L  S+ALT+ E   V 
Sbjct: 15  RSRLQPSLSRKSDDPSTIAANGNGKTSPKLASPKHLPRERTVKKLRLSKALTIPEGTTVY 74

Query: 134 EASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVK 193
           +AS+ MA +R D VL+ D++  LSGI T KD++ RV+ +GL    T ++ IMTRNP  V 
Sbjct: 75  DASRRMATRRVDAVLLTDAQGLLSGIVTDKDISTRVIAEGLRVEQTIMSKIMTRNPTYVT 134

Query: 194 NDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDAL 253
           +D+ A +AL  MV   FRHLPV  E G+V+ +LDI KCLY+A+ ++E+A      +  A+
Sbjct: 135 SDSLAIEALQKMVQGKFRHLPVV-ENGEVMAMLDIAKCLYDAIARLEKAAEQGSAIAAAV 193

Query: 254 EGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREY 312
           EGVER+   N  T    +++ LRE+M  P LS+++ +G+  A V     V  A + MRE+
Sbjct: 194 EGVERQLGGNF-TAPYAFIETLRERMFKPSLSTIVTEGTKVAIVSPSDPVYVATQQMREF 252

Query: 313 RTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALK 372
           R  +V+V   +++ GIFTSKD+++RV++  L P    V +VMT +PD A   T+ILDAL 
Sbjct: 253 RVNSVVVTTGNTVQGIFTSKDVLMRVVSQNLSPELTLVEKVMTANPDCATLDTTILDALH 312

Query: 373 KMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWN 429
            M+DG +L++PV+D  G I   +DVL+LT+A ++    +    NG  ND    +  +FW+
Sbjct: 313 IMHDGKFLHIPVLDREGQIAACLDVLQLTHAAIQ----LVEGGNGAANDVANSVMQRFWD 368

Query: 430 S-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGS 488
           S LA +  ++   S S A                                  AS   DG 
Sbjct: 369 SALALEPPDDEFDSRSEASLLM------------------------------ASEAGDGK 398

Query: 489 MASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKL 533
            + +P     N F FK +   G+ HRFT    S + + ++V  +L
Sbjct: 399 SSIYPPIIG-NSFAFKLQDRKGRVHRFTCGLESLDELMSSVRQRL 442



>gi|508775248|gb|EOY22504.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein
           isoform 4 [Theobroma cacao]
          Length = 423

 Score =  241 bits (616), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 158/413 (38%), Positives = 221/413 (53%), Gaps = 48/413 (11%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 50  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 109

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 110 LNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 168

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W  +   Q   +++ LRE+M  P LS+++ D S 
Sbjct: 169 DAIARMERAAEKGKAIAAAVEGVEKNWGASFAGQN-TFIEALRERMFRPSLSTIISDNSK 227

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV   A+ M E R ++ +V   +   GI TSKDI++RVI+  L P +  V +
Sbjct: 228 IVTVSPTDSVLATAKKMLESRLSSAVVTVENKPRGILTSKDILMRVISQNLPPESTLVEK 287

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G I+ +VDVL +T+A +  + S  
Sbjct: 288 VMTPNPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVGSTS 347

Query: 412 NQENGNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
                N+    M  KFW+S      N+ D+E+   +S+                      
Sbjct: 348 GI--NNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKL-------------------- 385

Query: 468 NISPIPEIHPSESASAIDDGSMAS---FPRGHDENFFTFKFKAPNGKSHRFTV 517
                          A D G  A    +P     N F FK +   G+ HRFT+
Sbjct: 386 ---------------ASDGGETARSLPYPSSSMPNTFGFKIQDKRGRMHRFTL 423



>gi|297612744|ref|NP_001066263.2| Os12g0169400 [Oryza sativa Japonica Group]
 gi|77553133|gb|ABA95929.1| CBS domain-containing protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|255670087|dbj|BAF29282.2| Os12g0169400 [Oryza sativa Japonica Group]
          Length = 542

 Score =  241 bits (616), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 162/434 (37%), Positives = 235/434 (54%), Gaps = 47/434 (10%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V EA + MAA+R D VL+ D++  LSGI T KD+A
Sbjct: 49  QLTGER-TVRKLRLSKALTIPEGTTVSEACRRMAARRVDAVLLTDAQGLLSGIVTDKDVA 107

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RVV +GL    T ++ IMTRNP    +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 108 TRVVAEGLRVEQTIMSKIMTRNPTYAMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAML 166

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSS 286
           DI KCLY+A+ ++E+A      +  A+EGVER+   N       +++ LRE+M  P LS+
Sbjct: 167 DIAKCLYDAISRLEKAAEQGSAIAAAVEGVERQLGGNFSAP-YAFIETLRERMFKPSLST 225

Query: 287 VL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDP 345
           ++ +G+  A V     V  A + MRE+R  +V+V   +++ GIFTSKD+++RV+A  L P
Sbjct: 226 IVTEGTKVAIVSPSDPVYVATQKMREFRVNSVVVATGNTLQGIFTSKDLLMRVVAQNLSP 285

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATM 404
               V +VMT +PD A   T+ILDAL  M+DG +L++PV+D  G I   +DVL+LT+A  
Sbjct: 286 ELTLVEKVMTVNPDFATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHA-- 343

Query: 405 EQMYSMQNQENGNDGGGPMWN----KFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXX 459
               ++Q  E GND    + N    +FW+S LA +  +E   S S               
Sbjct: 344 ----AIQLVEGGNDTVNDVANTVMQRFWDSTLALESPDEECDSRSEVSLLL--------- 390

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDY 519
                                AS   DG  + +P     N F FK +   G+ HRFT   
Sbjct: 391 ---------------------ASETGDGKSSIYPPVIG-NSFAFKLQDQKGRVHRFTCGS 428

Query: 520 TSFEHIRATVASKL 533
            S   + +++  +L
Sbjct: 429 ESLNELASSIKQRL 442



>gi|414588468|tpg|DAA39039.1| TPA: hypothetical protein ZEAMMB73_855016 [Zea mays]
          Length = 539

 Score =  241 bits (615), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 159/451 (35%), Positives = 237/451 (52%), Gaps = 65/451 (14%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   + EA + MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 58  TVKKLRLSKALTIPEGTTISEACRRMAARRVDAVLLTDAGGLLSGIVTDKDIATRVIAEG 117

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T ++ IMTRNP+ V  DT A +AL  M+   FRHLPV  E G+V+ +LDITKCLY
Sbjct: 118 LRVEQTIISKIMTRNPLYVMGDTPAIEALQKMIQGKFRHLPVV-ENGEVIAMLDITKCLY 176

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ ++E+A      L  A+EGVER+   N   P  +++ M   RE+M  P LS+++ + 
Sbjct: 177 DAISRLEKAAEQESALAAAVEGVERQLGGNFSAPHNLIETM---RERMFKPSLSTIITEN 233

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +  A V +   V  AAR MRE +  +V++   + + GIFT +D+++RV+A  L P    V
Sbjct: 234 TKVATVSLSDPVCVAARKMRELQVNSVIITAGNLLHGIFTPRDVLMRVVAQNLSPELTLV 293

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATM----- 404
            +VMT HPD A   T+ILDAL  M+DG +L++PV+DG G +   +DVL+LT+A +     
Sbjct: 294 EKVMTAHPDCATLDTTILDALHIMHDGKFLHIPVLDGDGRVAACLDVLQLTHAAISMVSL 353

Query: 405 ------------------EQMYSMQNQEN---GNDGGGPMWNKFWNS-LANDGDNESTVS 442
                             E ++ ++ +       D    +  KFW S LA +   E    
Sbjct: 354 SMAHALSFLIHLSNLSPSEMVFPLKVEGGPGAATDVANTIMQKFWESALALEQPPEEDFD 413

Query: 443 DSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFT 502
                                      S +P + PS++     DGS +S  R   +N F 
Sbjct: 414 SH-------------------------SELPLVMPSDA----RDGS-SSIYRPAVDNLFV 443

Query: 503 FKFKAPNGKSHRFTVDYTSFEHIRATVASKL 533
           FK +   G+ HRFT    S + + ++V  +L
Sbjct: 444 FKLQDKKGRMHRFTCGSESLDELISSVIQRL 474



>gi|118484915|gb|ABK94323.1| unknown [Populus trichocarpa]
          Length = 541

 Score =  241 bits (615), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 157/430 (36%), Positives = 234/430 (54%), Gaps = 42/430 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KDLA RV+   
Sbjct: 51  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDLASRVIAPE 110

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 111 VNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 169

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W T+       +++ LRE+M  P LS+++ + S 
Sbjct: 170 DAIARMERAAEKGKAIAAAVEGVEKNWGTSISVPN-TFIETLRERMFRPALSTIIPENSK 228

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    +V    + M E R+   +V       GIFTSKDI++RVIA  L P +  V +
Sbjct: 229 VVTVSPSETVLVVTKKMLESRSGCAVVTVDEKPRGIFTSKDILMRVIAQNLPPDSTLVEK 288

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G+I+ ++DV+ +T+A +  + +  
Sbjct: 289 VMTPNPECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNTT 348

Query: 412 NQENGNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
                N+    M  KFW+S      ND ++E+                      R+ GS 
Sbjct: 349 GA--NNETASTMMQKFWDSAMAMSPNDDEDET----------------------RSEGSL 384

Query: 468 NISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRA 527
            I+       +E+A ++       +P     N F+FK +   G+ HRFT +  S   +  
Sbjct: 385 KIAS----EGTETARSL------LYPSSGLPNNFSFKIEDKKGRMHRFTCETRSLTDLIT 434

Query: 528 TVASKLPSNV 537
           ++  +L  ++
Sbjct: 435 SILQRLGDDI 444



>gi|356527022|ref|XP_003532113.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine
           max]
          Length = 535

 Score =  241 bits (615), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 248/486 (51%), Gaps = 54/486 (11%)

Query: 106 RQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDL 165
           ++  G + TV  L  S+ALT+ E   V EA + MA +R D VL+ DS   LSGI T KD+
Sbjct: 41  QEFDGGERTVKKLRLSKALTISEVTTVSEACRRMATRRVDAVLLTDSNALLSGIMTDKDI 100

Query: 166 AFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGL 225
           A RV+ +GL    T V+ +MTR+P+ V +D  A +AL  MV   FRHLPV  E G+V+ +
Sbjct: 101 ATRVIAEGLRPEQTMVSKVMTRSPIFVTSDMLALEALQKMVQGKFRHLPVV-ENGEVIAI 159

Query: 226 LDITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLS 285
           LDIT+CLY+A+ +MERA      +  A+EGVER   +N     L  ++ L+E+M  P LS
Sbjct: 160 LDITRCLYDAITRMERAAEQGSAIAAAVEGVERHRGSNVSASAL--IETLKERMFKPSLS 217

Query: 286 SVLDGSMPAEVGVKTS-VRDAARLMREYRT-TAVLV-MEHHSIAGIFTSKDIVLRVIAAG 342
           +++  +    +      V  AA+ MR+ R  +AV+V +    I GI TSKDI++RV+A  
Sbjct: 218 TLMGENTKVAIASPADPVYVAAKKMRDLRVNSAVIVSLSGTKIQGILTSKDILMRVVAQN 277

Query: 343 LDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTY 401
           L P    V +VMTP+PD A   T+ILDAL  M+DG +L+LPVVD  G ++  +DVL++T+
Sbjct: 278 LSPELTLVEKVMTPNPDCASIDTTILDALHMMHDGKFLHLPVVDKDGYVVACMDVLQITH 337

Query: 402 ATMEQMYSMQNQENG--NDGGGPMWNKFWNSLAN-----DGDNESTVSDSIAXXXXXXXX 454
           A +    SM    +G  ND    +  KFW+S  N     D D  S +S  +         
Sbjct: 338 AAI----SMVESSSGAVNDVANTIMQKFWDSAFNLEPPEDSDTHSELSGLVM-------- 385

Query: 455 XXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHR 514
                                  S+ A    D S + +      N F FKFK  +G+ HR
Sbjct: 386 -----------------------SDGA----DTSKSGYQSVGFGNSFAFKFKDLSGRVHR 418

Query: 515 FTVDYTSFEHIRATVASKLPSNVRDF-TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMS 573
           F       + + +T+  +L  N  +   I Y                + AV  A+  G+ 
Sbjct: 419 FNCGTEHLDELVSTIMQRLDVNDGERPIILYEDDEGDKIVLATNSDLVSAVSYARSAGVK 478

Query: 574 RVILHI 579
            + LH+
Sbjct: 479 ALKLHL 484



>gi|326523955|dbj|BAJ96988.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 553

 Score =  241 bits (614), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 158/430 (36%), Positives = 237/430 (55%), Gaps = 39/430 (9%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
            +PG + TV  L  S+ALT+ E   V +AS+ MAA+R D VL+ D++  LSGI T KD++
Sbjct: 59  HLPGER-TVKKLRLSKALTIPEGTTVYDASRRMAARRVDAVLLTDAQGLLSGIVTDKDIS 117

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RV+ +GL    T ++ IMTRNP  V  D+ A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 118 TRVIAEGLRVEQTIMSKIMTRNPTYVSADSLAIEALQKMVQGKFRHLPVV-ENGEVMAML 176

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSS 286
           DI KCLY+A+ ++E+A      +  A+EGVER+   N  T    +++ LRE+M  P LS+
Sbjct: 177 DIAKCLYDAIARLEKAAEQGSAIAAAVEGVERQLGGNF-TAPYAFIETLRERMFKPSLST 235

Query: 287 VL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDP 345
           ++ +G+  A +     V  A + MRE+R  +V+V   +++ GIFTSKD+++RV++  L P
Sbjct: 236 IVTEGTKVAIISPSDPVYVATQKMREFRVNSVVVTTGNTVQGIFTSKDVLMRVVSQNLSP 295

Query: 346 STCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATM 404
               V +VMT +PD A   T+ILDAL  M+DG +L++PV+D  G I   +DVL+LT+A +
Sbjct: 296 ELTLVEKVMTANPDCATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAI 355

Query: 405 EQMYSMQNQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRT 463
            Q+    N    ND    +  +FW+S LA +  ++   S S A                 
Sbjct: 356 -QLVEGGNG-TANDVANSVMQRFWDSALALEAPDDEFDSRSEASLLM------------- 400

Query: 464 RGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFE 523
                            AS   DG  + +P     N F FK +   G+ HRFT    S +
Sbjct: 401 -----------------ASEAGDGRSSIYPPIIG-NSFPFKLQDRKGRVHRFTCGSESLD 442

Query: 524 HIRATVASKL 533
            + ++V  +L
Sbjct: 443 ELVSSVRQRL 452



>gi|255540203|ref|XP_002511166.1| conserved hypothetical protein [Ricinus communis]
 gi|223550281|gb|EEF51768.1| conserved hypothetical protein [Ricinus communis]
          Length = 545

 Score =  240 bits (613), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 158/431 (36%), Positives = 234/431 (54%), Gaps = 44/431 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV E+  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 54  TVKRLRLSKALTVPETTTIQEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 113

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 114 LNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 172

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWST--NQPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    K +  A+EGVE+ W T  + P     +++ LRE+M  P LS++L + 
Sbjct: 173 DAIARMERAAEKGKAIAAAVEGVEKNWGTTFSGPN---TFIETLRERMFRPSLSTILPEN 229

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S    V    +V    + M E R+++ +V+      GI TSKDI++RVIA  L   +   
Sbjct: 230 SKVVTVLPTETVLAVTKKMLESRSSSAVVIVDQKPRGILTSKDILMRVIAQNLPSDSTLA 289

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMTP+P+ A   T I+DAL  M+DG +L+LPV+D  G+++ +VDV+ +T+A +  + S
Sbjct: 290 EKVMTPNPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNVVAVVDVIHITHAAVATVGS 349

Query: 410 MQNQENGNDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
                  N+    M  KFW+S   L+ + D++ T                     R+ GS
Sbjct: 350 TAGV--NNEAASTMMQKFWDSAMALSPNEDDDDT---------------------RSEGS 386

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
             +       PSE A   + G    +P     N F FK +   G+ HRFT D  S   + 
Sbjct: 387 LKL-------PSEGA---ETGRSLPYPSAGFPNSFGFKIEDKKGRMHRFTSDTRSLTDLI 436

Query: 527 ATVASKLPSNV 537
             +  +L +++
Sbjct: 437 TAILQRLGNDI 447



>gi|125528914|gb|EAY77028.1| hypothetical protein OsI_04983 [Oryza sativa Indica Group]
 gi|125573153|gb|EAZ14668.1| hypothetical protein OsJ_04591 [Oryza sativa Japonica Group]
          Length = 497

 Score =  240 bits (613), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 235/432 (54%), Gaps = 46/432 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MAA+R D VL+ DS   L GI T KD+  RV+   
Sbjct: 6   TVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIARE 65

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 66  LKLEETPVSKVMTRNPLFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 124

Query: 234 EALDKMERAYGSSKKLYDALEGVEREW--STNQPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    K +  A+EGVE+ W  S + P     +++ LRE+M  P LS+++ + 
Sbjct: 125 DAIARMERAAEKGKAIAAAVEGVEKHWGASVSGPNT---FIETLRERMFRPSLSTIISEN 181

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S    V    +V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V
Sbjct: 182 SKVVTVAPTDTVLTASKKMLEVKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTV 241

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT  P+ A   T ILDAL  M+DG +L+LPV+D  G+++ +VDVL +T+A +  + +
Sbjct: 242 EKVMTQTPECATVDTPILDALHTMHDGKFLHLPVLDKDGNVVTVVDVLHITHAAIATVGN 301

Query: 410 MQNQENGNDGGGPMWNKFWNSLAN----DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
             +  +G++    M  +FW+S  +    D D++S                      R+ G
Sbjct: 302 --SAGSGSEATSAMMQRFWDSAMSIGPLDDDDDS----------------------RSEG 337

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  ++          + A D G  A +P     N F FK +   G+ HRF  + +S   +
Sbjct: 338 STKVA----------SEATDVGRSAFYPASGLSNTFGFKIQDKQGRMHRFNCETSSLTEL 387

Query: 526 RATVASKLPSNV 537
             ++  +L  ++
Sbjct: 388 ITSILQRLGDDI 399



>gi|108864045|gb|ABA91621.2| CBS domain-containing protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|215768686|dbj|BAH00915.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222615591|gb|EEE51723.1| hypothetical protein OsJ_33116 [Oryza sativa Japonica Group]
          Length = 560

 Score =  240 bits (612), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 159/423 (37%), Positives = 226/423 (53%), Gaps = 38/423 (8%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  ++A+T+ E   V EA Q MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 52  TVKKLRLTKAVTIPEGTTVAEACQRMAARRVDAVLLTDANGLLSGIVTDKDIAKRVIAEG 111

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T  + IMTR P+ V +DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 112 LRVEQTITSKIMTRTPVYVMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAMLDIAKCLY 170

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ ++E+A      L  A+EGVER+   N P      ++ LRE+M  P LS+++ + + 
Sbjct: 171 DAISRLEKAAEQGSALAAAVEGVERQVGDNLPDH-SSVIETLRERMLKPSLSTIISENTK 229

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AAR M E R  +V++   +S+ GIFTSKD+++RV+   L P    V +
Sbjct: 230 VAIVSPWDPVCVAARKMHELRVNSVVITAGNSLQGIFTSKDVLMRVVTQNLSPELTHVEK 289

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMT HP+ A   TSILDAL  M DG +L++PVVDG G ++  +DVL++T+A +  +    
Sbjct: 290 VMTAHPECATLDTSILDALHIMRDGKFLHIPVVDGEGRVVACLDVLQITHAAISMVEG-- 347

Query: 412 NQENGNDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNIS 470
             E  N     +  KFW+S LA +  +E   S                           S
Sbjct: 348 GPETTNGVANTIMQKFWDSALALEPPDEEFDSR--------------------------S 381

Query: 471 PIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVA 530
            I  + PSE+     DG  +  P     N F FK +   G+ HRF     S   + ++V 
Sbjct: 382 EISLLMPSEAG----DGRSSINPPVVG-NSFVFKIEDQKGRMHRFACGSESLHELVSSVV 436

Query: 531 SKL 533
            +L
Sbjct: 437 QRL 439



>gi|502139757|ref|XP_004503889.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Cicer
           arietinum]
          Length = 532

 Score =  240 bits (612), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 171/485 (35%), Positives = 248/485 (51%), Gaps = 57/485 (11%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
           G + TV  L  S+ALT+ E   V +A + MAA+R D VL+ DS   LSGI T KD+A RV
Sbjct: 42  GGERTVKKLRLSKALTISEGTSVSDACRRMAARRVDAVLLTDSNALLSGIMTDKDIATRV 101

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           + +GL    T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ +LDIT
Sbjct: 102 IAEGLRPDQTAVSKVMTRNPLFVSSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAILDIT 160

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSV 287
           +CLY+A+ +ME+A      +  A+EG ER   +N   P  +L+    LRE++  P LS++
Sbjct: 161 RCLYDAISRMEKAAEQGSAIAAAVEGAERHRGSNASAPNALLE---TLRERIFKPSLSTL 217

Query: 288 L-DGSMPAEVGVKTSVRDAARLMREYRT-TAVLV-MEHHSIAGIFTSKDIVLRVIAAGLD 344
           + + +  A       V  AA+ M+E R  +AV+V +    I GI TSKDI++RV+A  L 
Sbjct: 218 IGENTKVAIASAADPVYVAAKKMQELRVNSAVIVSLSGTKIQGILTSKDILMRVVAPNLS 277

Query: 345 PSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYAT 403
           P    V +VMTP+PD A   T+ILDAL  M+ G +L+LPVVD  G +   +DVL++T+A 
Sbjct: 278 PELTLVEKVMTPNPDCATLDTTILDALHMMHHGKFLHLPVVDRDGHLAACIDVLQITHAA 337

Query: 404 MEQMYSMQNQENGNDGGGPMWNKFWNSL-----ANDGDNESTVSDSIAXXXXXXXXXXXX 458
           +  + S       ND    +  KFW+S        D D  S VS                
Sbjct: 338 ISLVESSSGAV--NDVANTIMQKFWDSAFALEPPEDSDTHSEVSG--------------- 380

Query: 459 XXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVD 518
                           +  S+ A    D + +++      N FTFKF+ PNG+ HRF   
Sbjct: 381 ----------------LMTSDGA----DTAKSAYHSMGFGNSFTFKFEDPNGRVHRFNCG 420

Query: 519 YTSFEHIRATVASKLPSNVRDF---TIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRV 575
               + + + V  ++  NV D     I Y                + AV  A+  G+  +
Sbjct: 421 TEHVDELVSAVMQRV--NVNDGEHPVILYEDDEGDRIVLGTDSDLVSAVSYARSAGVKAL 478

Query: 576 ILHIQ 580
            LH++
Sbjct: 479 KLHLE 483



>gi|460413674|ref|XP_004252207.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Solanum
           lycopersicum]
          Length = 543

 Score =  240 bits (612), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 159/431 (36%), Positives = 231/431 (53%), Gaps = 52/431 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ E   V EA + MAA+R D VL+ D+   LSGI T KD+A RV+ + 
Sbjct: 56  TVKKLRLSKALTIPEGTTVSEACRRMAARRIDAVLLTDANALLSGIVTDKDIATRVIAEE 115

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T ++ +MTRNP+ V  D+SA +AL  MV   FRHLPV  E G+V+ LLDITKCL+
Sbjct: 116 LRPEQTIISKVMTRNPIFVAADSSAIEALQKMVQGKFRHLPVV-ENGEVIALLDITKCLF 174

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +ME+A      +  A+EGVER+W  N   P+    +++ LRE +  P LS+++ + 
Sbjct: 175 DAISRMEKAAEQGSAIAAAVEGVERQWGNNFSAPS---AFIETLRELIFKPSLSAIVSEN 231

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +  A V     V  AA+ MRE R  + L+   + I GI TSKDI++RV+A  L P    V
Sbjct: 232 TKVAIVCPSDPVYVAAKKMRELRVNSALITVGNKIQGILTSKDILMRVVAQNLSPELTLV 291

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT +P+ A  +T+IL+AL  M+DG +L+LP++D  G ++  +DVL++T+A +    S
Sbjct: 292 EKVMTSNPECATLETTILEALHIMHDGKFLHLPIIDRDGCVVACIDVLQITHAAI----S 347

Query: 410 MQNQENG--NDGGGPMWNKFWNSLAN-----DGDNESTVSDSIAXXXXXXXXXXXXXXXR 462
           M    +G  N+    M  KFW+S  N     D D+ S +S S                  
Sbjct: 348 MVENSSGAVNEMANTMMQKFWDSALNLEPPDDYDSLSEMSMS------------------ 389

Query: 463 TRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSF 522
                      ++  SE A A   G    +P     N F FKF    G+ +RF     S 
Sbjct: 390 -----------QLMMSEGAEAGKSG----YPLLGLGNTFAFKFVDLKGRVNRFNFGSESL 434

Query: 523 EHIRATVASKL 533
             +   V  +L
Sbjct: 435 LELVTAVVQRL 445



>gi|225456355|ref|XP_002283958.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 1
           [Vitis vinifera]
          Length = 546

 Score =  239 bits (610), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/431 (35%), Positives = 228/431 (52%), Gaps = 45/431 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ++  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 56  TVKRLRLSRALTVPDTTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 115

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 116 LNLEETPVSKVMTRNPIFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 174

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    K +  A+EGVE+ W T+   P+    +++ LRE+M  P LS+++ + 
Sbjct: 175 DAIARMERAAEKGKAIAAAVEGVEKNWGTSLSGPST---FIETLRERMFRPALSTIIPEN 231

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S    V    +V  AA+ M E + +  +V   +   GI TSKDI++RVIA  L P +  V
Sbjct: 232 SKVVTVSPTDTVLTAAKKMLELKLSCAVVAVENRPKGILTSKDILMRVIAQNLHPESTPV 291

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMTP+P+ A   T I+DAL  M+DG +L+LPV+D  G ++ + DV+ +T+A +  +  
Sbjct: 292 EKVMTPNPECATIDTPIVDALHTMHDGKFLHLPVIDRDGGVVAVADVIHITHAAVATVGG 351

Query: 410 MQNQENGNDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
             N    N+    +  KFW+S   L  D D E                        TR  
Sbjct: 352 --NAGVNNEAASSLMQKFWDSAMALGTDDDEE------------------------TRSE 385

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
           G++    E          + G    +      N F FK +   G+ HRFT D  S   + 
Sbjct: 386 GSLKLASE--------GTEIGRTLPYTSSAMHNTFAFKIEDKRGRMHRFTCDTRSLTDVI 437

Query: 527 ATVASKLPSNV 537
            ++  ++  ++
Sbjct: 438 TSILQRVGDDI 448



>gi|359491097|ref|XP_003634219.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 2
           [Vitis vinifera]
 gi|297734436|emb|CBI15683.3| unnamed protein product [Vitis vinifera]
          Length = 541

 Score =  239 bits (610), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/431 (35%), Positives = 228/431 (52%), Gaps = 45/431 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ++  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 51  TVKRLRLSRALTVPDTTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIARE 110

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 111 LNLEETPVSKVMTRNPIFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 169

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    K +  A+EGVE+ W T+   P+    +++ LRE+M  P LS+++ + 
Sbjct: 170 DAIARMERAAEKGKAIAAAVEGVEKNWGTSLSGPST---FIETLRERMFRPALSTIIPEN 226

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S    V    +V  AA+ M E + +  +V   +   GI TSKDI++RVIA  L P +  V
Sbjct: 227 SKVVTVSPTDTVLTAAKKMLELKLSCAVVAVENRPKGILTSKDILMRVIAQNLHPESTPV 286

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMTP+P+ A   T I+DAL  M+DG +L+LPV+D  G ++ + DV+ +T+A +  +  
Sbjct: 287 EKVMTPNPECATIDTPIVDALHTMHDGKFLHLPVIDRDGGVVAVADVIHITHAAVATVGG 346

Query: 410 MQNQENGNDGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
             N    N+    +  KFW+S   L  D D E                        TR  
Sbjct: 347 --NAGVNNEAASSLMQKFWDSAMALGTDDDEE------------------------TRSE 380

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
           G++    E          + G    +      N F FK +   G+ HRFT D  S   + 
Sbjct: 381 GSLKLASE--------GTEIGRTLPYTSSAMHNTFAFKIEDKRGRMHRFTCDTRSLTDVI 432

Query: 527 ATVASKLPSNV 537
            ++  ++  ++
Sbjct: 433 TSILQRVGDDI 443



>gi|474215686|gb|EMS59026.1| Meiotically up-regulated gene 70 protein [Triticum urartu]
          Length = 520

 Score =  239 bits (610), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 169/512 (33%), Positives = 260/512 (50%), Gaps = 64/512 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MAA+R D VL+ DS   L GI T KD+  RV+   
Sbjct: 30  TVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIARE 89

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV +  G+V+ LLDI KCLY
Sbjct: 90  LKLEDTPVSKVMTRNPLFVLGDTLAVEALQKMVQGKFRHLPVVD-NGEVIALLDIAKCLY 148

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWST--NQPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    + +  A+EGVE+ W T  + P     +++ LRE+M  P LS+++ + 
Sbjct: 149 DAIARMERAAEKGRAIAAAVEGVEKHWGTSVSGPN---TFVETLRERMFRPSLSTIISEN 205

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S  A V    +V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V
Sbjct: 206 SKVATVAPTDTVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTV 265

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT  P+ A   T IL+AL  M+DG +L+LPV+D  GS++ +VDVL +T+A +  + +
Sbjct: 266 GKVMTQSPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGN 325

Query: 410 MQNQENGNDGGGPMWNKFWNSLANDG----DNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
             +   G++    M  +FW+S  + G    D++S                      R+ G
Sbjct: 326 --SGATGSEATSSMMQRFWDSAMSSGPLDDDDDS----------------------RSEG 361

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  ++       SE+A   D G  A FP     N F FK +   G+ HRF  + +S   +
Sbjct: 362 STKVA-------SEAA---DIGRSAFFPPSGLSNTFGFKIQDKQGRMHRFNCETSSLAEL 411

Query: 526 RATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK 585
             ++  +L  ++    +  +                D V ++    +   + H ++I  K
Sbjct: 412 ITSILQRLGDDIDKLNLPQILYEDDDH---------DKVILSSDTDLIAAVDHARQIGWK 462

Query: 586 SLRXXXXXXXXXXXXILEKRRRRKRGKHAPDY 617
           SLR                  RRKRG  + D+
Sbjct: 463 SLRLHLDYAGVG---------RRKRGAVSSDF 485



>gi|502139380|ref|XP_004503746.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform X1
           [Cicer arietinum]
          Length = 543

 Score =  238 bits (608), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 160/460 (34%), Positives = 233/460 (50%), Gaps = 48/460 (10%)

Query: 88  NKKNRTKSTSLN--------NRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLM 139
           N   RTK  +L          +  P  +    + TV SL  S+ALTV E+  V EA + M
Sbjct: 16  NSPTRTKKKALEYSPSDPNIRKSFPSMRTTTGERTVKSLRLSKALTVPETTTVYEACRRM 75

Query: 140 AAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSAT 199
           AA+R D +L+ DS   L GI T KD+  RV+   ++   T  + +MTRNP+ V  DT A 
Sbjct: 76  AARRVDALLLTDSNALLCGILTDKDITTRVIAREVNLEDTPCSKVMTRNPIFVLTDTLAV 135

Query: 200 DALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVERE 259
           +AL  MV   FRHLPV  E G+VV +LDI KCLY+A+ +MERA    K +  A+EG+E+ 
Sbjct: 136 EALQKMVQGRFRHLPVV-ENGEVVAILDIAKCLYDAIARMERAAEKGKAIAAAVEGIEKH 194

Query: 260 WSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVL 318
           W  +       ++D LRE++  P LS+V+ + S    V    SV    + M E R +A +
Sbjct: 195 WGASASGSNSSFIDTLREQIFKPSLSTVIPENSKIVTVSPTDSVLTTTKKMLELRASAAV 254

Query: 319 VMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGH 378
           V   +   GI TSKDI++RVIA    PS+  V +VMT +P+ A   T I+DAL  M++G+
Sbjct: 255 VTVDNKPCGILTSKDILMRVIALNFPPSSTIVEKVMTANPECAVIDTPIVDALHIMHNGN 314

Query: 379 YLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQEN-GNDGGGPMWNKFWNS----LA 432
           +L+LPVVD  G ++  VDV+ +T+A +     + N  N  N+    M  KFW+S     A
Sbjct: 315 FLHLPVVDRDGIVVATVDVIHITHAAVVTASQVGNTVNLNNEAANTMMQKFWDSAMALTA 374

Query: 433 NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASF 492
           ND + +     S+                 + G      IP  +PS   +A         
Sbjct: 375 NDEEEDLQSETSLKMI--------------SEGGDTGRSIP-YNPSSMQTA--------- 410

Query: 493 PRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASK 532
                   F+FK +   G+ HRFT D  S   +  ++  +
Sbjct: 411 --------FSFKLQDKKGRLHRFTCDTRSLTEVITSIVQR 442



>gi|357126564|ref|XP_003564957.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like
           [Brachypodium distachyon]
          Length = 550

 Score =  238 bits (607), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 160/481 (33%), Positives = 248/481 (51%), Gaps = 49/481 (10%)

Query: 110 GAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRV 169
            A+ TV  L  S+ALT+ +   V EA + MAA+R D VL+ DS   L GI T KD+  RV
Sbjct: 56  AAERTVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRV 115

Query: 170 VGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDIT 229
           +   L    T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI 
Sbjct: 116 IARELKLEDTPVSKVMTRNPLFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIA 174

Query: 230 KCLYEALDKMERAYGSSKKLYDALEGVEREWST--NQPTQILQYMDMLREKMACPDLSSV 287
           KCLY+A+ +MERA    K +  A+EGVE+ W T  + P     +++ LRE+M  P LS++
Sbjct: 175 KCLYDAIARMERAAEKGKAIAAAVEGVEKHWGTAVSGPNT---FVETLRERMFRPSLSTI 231

Query: 288 L-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPS 346
           + + S    V    +V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P 
Sbjct: 232 ISENSKVVTVAPTDTVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPE 291

Query: 347 TCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATME 405
           + +V +VMT  P+ A   T IL+AL  M+DG +L+LPV+D  G+++ ++DVL +T+A + 
Sbjct: 292 STTVEKVMTQSPECATTDTPILEALHTMHDGKFLHLPVLDSDGNVVTVIDVLHITHAAIA 351

Query: 406 QMYSMQNQENGNDGGGPMWNKFWNSLANDG----DNESTVSDSIAXXXXXXXXXXXXXXX 461
            + +  +   G++    M  +FW+S  + G    D++S                      
Sbjct: 352 TVGN--SGAAGSEATSSMMQRFWDSAMSSGPLDDDDDS---------------------- 387

Query: 462 RTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTS 521
           R+ GS  ++          + A D G    +P     + F FK +   G+ HRF  D +S
Sbjct: 388 RSEGSTKVA----------SEATDIGRSTFYPASGLSSTFGFKIQDKQGRMHRFNCDTSS 437

Query: 522 FEHIRATVASKLPSNVRDFT---IYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILH 578
              +  ++  +L  ++       I Y                I AV  A++ G   + LH
Sbjct: 438 LTELITSILQRLGDDIDKLNLPQILYEDEDRDKVILSSDSDLIAAVDHARQIGWKSLRLH 497

Query: 579 I 579
           +
Sbjct: 498 L 498



>gi|462406302|gb|EMJ11766.1| hypothetical protein PRUPE_ppa003833mg [Prunus persica]
          Length = 545

 Score =  237 bits (605), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 151/426 (35%), Positives = 230/426 (53%), Gaps = 34/426 (7%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV E+  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   
Sbjct: 53  TVKRLRLSKALTVPENTSIQEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVISRE 112

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 113 LNLEDTLVSKVMTRNPIFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 171

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W T+       +++ LRE++  P LS+++ + S 
Sbjct: 172 DAIARMERAAEKGKAIAAAVEGVEKHWGTSTSGSN-TFVETLRERLFRPSLSTIIPESSK 230

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    +V    + M+E R ++ +V   +   GI TSKDI++RVIA  L P    V +
Sbjct: 231 VLTVSPTDTVLMTTKKMQEMRVSSAVVTVDNKPRGILTSKDILMRVIAQNLSPKATLVEK 290

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMT +P+ A   T I+DAL  M+DG +L+LPVVD  G+++ +VDV+ +T+A +  + +  
Sbjct: 291 VMTQNPECATVDTPIVDALHTMHDGKFLHLPVVDRDGTVVAVVDVIHITHAAVATVGNTA 350

Query: 412 NQENGNDGGGPMWNKFWNSLANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISP 471
                N+    +  KFW+S    G +E    DS                 R+ GS  +  
Sbjct: 351 GV--SNEAANSLMQKFWDSAMALGPHEED-EDS-----------------RSEGSLKL-- 388

Query: 472 IPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVAS 531
                   ++   + G    FP  +  N F FK +   G+ HRFT +  S   +  ++  
Sbjct: 389 --------ASDGAETGRSLPFPSSNFPNTFAFKLQDKRGRMHRFTCNIQSLTDLITSIVQ 440

Query: 532 KLPSNV 537
           ++  ++
Sbjct: 441 RMGDDI 446



>gi|326509897|dbj|BAJ87164.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 550

 Score =  237 bits (605), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 154/432 (35%), Positives = 235/432 (54%), Gaps = 46/432 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MAA+R D VL+ DS   L GI T KD+  RV+   
Sbjct: 60  TVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIARE 119

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV +  G+V+ LLDI KCLY
Sbjct: 120 LKLEETPVSKVMTRNPLFVLGDTLAVEALQKMVQGKFRHLPVVDN-GEVIALLDIAKCLY 178

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    + +  A+EGVE+ W T+   P     +++ LRE+M  P L++++ + 
Sbjct: 179 DAIARMERAAEKGRAIAAAVEGVEKHWGTSVSGPNT---FVETLRERMFRPSLATIISEN 235

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S  A V    +V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V
Sbjct: 236 SKVATVAPTDTVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTV 295

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT  P+ A   T IL+AL  M+DG +L+LPV+D  GS++ +VDVL +T+A +  + +
Sbjct: 296 GKVMTQSPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGN 355

Query: 410 MQNQENGNDGGGPMWNKFWNSLANDG----DNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
             +   G++    M  +FW+S  + G    D++S                      R+ G
Sbjct: 356 --SGATGSEATSSMMQRFWDSAMSSGPLDDDDDS----------------------RSEG 391

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  ++       SE A   D G  A FP     N F FK +   G+ HRF  + +S   +
Sbjct: 392 STKVA-------SEVA---DMGRSAFFPASGLSNTFGFKIQDKQGRMHRFNCETSSLTEL 441

Query: 526 RATVASKLPSNV 537
             ++  +L  ++
Sbjct: 442 ITSILQRLGDDI 453



>gi|414868430|tpg|DAA46987.1| TPA: hypothetical protein ZEAMMB73_412952 [Zea mays]
          Length = 529

 Score =  237 bits (605), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 160/434 (36%), Positives = 244/434 (56%), Gaps = 47/434 (10%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V++A + MAA+R D VL+ D++  LSGI T KD+A
Sbjct: 51  QLTGER-TVKKLRLSKALTIPEGTTVLDACRRMAARRVDAVLLTDNQGLLSGIVTDKDIA 109

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RVV +GL    T ++ IMTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 110 TRVVAEGLRVEQTIMSKIMTRNPVYVMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAML 168

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDL 284
           DI KCLYEA+ ++E+A      +  A+EGVER+   N   P+ +++    LRE+M  P L
Sbjct: 169 DIAKCLYEAIARLEKAAEQGSAIAAAVEGVERQLGGNFSAPSALIE---TLRERMFKPSL 225

Query: 285 SSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGL 343
           S+++ + +  A V     V  AA+ MRE+   +V+V   +++ GIFTSKDI++RV++  +
Sbjct: 226 STIVTENTKVAIVSPTDPVCVAAQKMREFCVNSVVVSTGNTLQGIFTSKDILMRVVSQNI 285

Query: 344 DPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYA 402
            P    V +VMT +PD A  +T+ILD L  M+DG +L++PV+D  G I   +DVL+LT+A
Sbjct: 286 SPELTLVEKVMTVNPDCATLETTILDTLHIMHDGKFLHIPVIDKDGQIAACLDVLQLTHA 345

Query: 403 TMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXX 459
           T++    +    NG  N+    +  +FW+S LA +  +E   S                 
Sbjct: 346 TIQ----LVEGGNGTVNNVANSVMQRFWDSALALEPPDEEFDSH---------------- 385

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDY 519
                     S +  +  SE+     DG  + +P     N F+FK +   G+ HRFT   
Sbjct: 386 ----------SEVSLLLQSEAG----DGKSSVYPPVVG-NSFSFKLQDRKGRVHRFTCGS 430

Query: 520 TSFEHIRATVASKL 533
            S + + ++V  +L
Sbjct: 431 ESLDELVSSVRQRL 444



>gi|226501428|ref|NP_001148069.1| CBS domain containing protein [Zea mays]
 gi|195615614|gb|ACG29637.1| CBS domain containing protein [Zea mays]
 gi|223947611|gb|ACN27889.1| unknown [Zea mays]
 gi|414868431|tpg|DAA46988.1| TPA: CBS domain containing protein [Zea mays]
          Length = 545

 Score =  237 bits (604), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 160/434 (36%), Positives = 244/434 (56%), Gaps = 47/434 (10%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V++A + MAA+R D VL+ D++  LSGI T KD+A
Sbjct: 51  QLTGER-TVKKLRLSKALTIPEGTTVLDACRRMAARRVDAVLLTDNQGLLSGIVTDKDIA 109

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RVV +GL    T ++ IMTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 110 TRVVAEGLRVEQTIMSKIMTRNPVYVMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAML 168

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDL 284
           DI KCLYEA+ ++E+A      +  A+EGVER+   N   P+ +++    LRE+M  P L
Sbjct: 169 DIAKCLYEAIARLEKAAEQGSAIAAAVEGVERQLGGNFSAPSALIET---LRERMFKPSL 225

Query: 285 SSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGL 343
           S+++ + +  A V     V  AA+ MRE+   +V+V   +++ GIFTSKDI++RV++  +
Sbjct: 226 STIVTENTKVAIVSPTDPVCVAAQKMREFCVNSVVVSTGNTLQGIFTSKDILMRVVSQNI 285

Query: 344 DPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYA 402
            P    V +VMT +PD A  +T+ILD L  M+DG +L++PV+D  G I   +DVL+LT+A
Sbjct: 286 SPELTLVEKVMTVNPDCATLETTILDTLHIMHDGKFLHIPVIDKDGQIAACLDVLQLTHA 345

Query: 403 TMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXX 459
           T++    +    NG  N+    +  +FW+S LA +  +E   S                 
Sbjct: 346 TIQ----LVEGGNGTVNNVANSVMQRFWDSALALEPPDEEFDSH---------------- 385

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDY 519
                     S +  +  SE+     DG  + +P     N F+FK +   G+ HRFT   
Sbjct: 386 ----------SEVSLLLQSEAG----DGKSSVYPPVVG-NSFSFKLQDRKGRVHRFTCGS 430

Query: 520 TSFEHIRATVASKL 533
            S + + ++V  +L
Sbjct: 431 ESLDELVSSVRQRL 444



>gi|224122050|ref|XP_002318739.1| predicted protein [Populus trichocarpa]
 gi|222859412|gb|EEE96959.1| predicted protein [Populus trichocarpa]
          Length = 535

 Score =  236 bits (603), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 155/430 (36%), Positives = 230/430 (53%), Gaps = 36/430 (8%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALTV ES  + EA + MAA+R D +L+ DS   L GI T KDLA RV+   
Sbjct: 39  TVKRLRLSKALTVPESTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDLASRVIAPE 98

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++   T V+ +MTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 99  VNLEETPVSKVMTRNPVFVLSDTLAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 157

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA    K +  A+EGVE+ W T+       +++ LRE+M  P LS+++ + S 
Sbjct: 158 DAIARMERAAEKGKAIAAAVEGVEKNWGTSISVPN-TFIETLRERMFRPALSTIIPENSK 216

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    +V    + M E R+   +V       GIFTSKDI++RVIA  L P +  V +
Sbjct: 217 VVTVSPSETVLVVTKKMLESRSGCAVVTVDEKPRGIFTSKDILMRVIAQNLPPDSTLVEK 276

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+ A   T I+DAL  M+DG +L+LPVVD  G+I+ ++DV+ +T+A +  + +  
Sbjct: 277 VMTPNPECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNAT 336

Query: 412 NQENGNDGGGPMWNKFWNSLA----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
                N+    M  KFW+S      ND ++E+   D +                    S 
Sbjct: 337 GA--NNETASTMMQKFWDSAMAMSPNDDEDETRRLDVLVLILSKILI----------SST 384

Query: 468 NISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRA 527
             +    ++PS           +  P     N F+FK +   G+ HRFT +  S   +  
Sbjct: 385 GFTYTSLLYPS-----------SGLP-----NNFSFKIEDKKGRMHRFTCETRSLTDLIT 428

Query: 528 TVASKLPSNV 537
           ++  +L  ++
Sbjct: 429 SILQRLGDDI 438



>gi|242084930|ref|XP_002442890.1| hypothetical protein SORBIDRAFT_08g004470 [Sorghum bicolor]
 gi|241943583|gb|EES16728.1| hypothetical protein SORBIDRAFT_08g004470 [Sorghum bicolor]
          Length = 549

 Score =  236 bits (603), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 159/434 (36%), Positives = 241/434 (55%), Gaps = 47/434 (10%)

Query: 107 QVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLA 166
           Q+ G + TV  L  S+ALT+ E   V +A + MAA+R D VL+ D+   LSGI T KD+A
Sbjct: 55  QLTGER-TVKKLRLSKALTIPEGTTVSDACRRMAARRVDAVLLTDAHGLLSGIVTDKDIA 113

Query: 167 FRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLL 226
            RV+ +GL    T ++ IMTRNP+ V +DT A +AL  MV   FRHLPV  E G+V+ +L
Sbjct: 114 TRVIAEGLRVEQTIISKIMTRNPIYVMSDTPAIEALQKMVQGKFRHLPVV-ENGEVIAML 172

Query: 227 DITKCLYEALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDL 284
           DI KCLY+A+ ++E+A      +  A+EGVE +   N   P+ +++    LRE+M  P L
Sbjct: 173 DIAKCLYDAISRLEKAAEQGSAIAAAVEGVECQLGGNFSVPSALIE---TLRERMFKPSL 229

Query: 285 SSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGL 343
           S+++ + +  A V     V  AA+ MRE+R  +V+V   +++ GIFTSKDI++RV++  +
Sbjct: 230 STIVTENTKVAIVSPTDPVYVAAQKMREFRVNSVVVATGNTLQGIFTSKDILMRVVSQNI 289

Query: 344 DPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYA 402
            P    V +VMT +PD A  +T+ILDAL  M+DG +L++PV+D  G I   +DVL+LT+A
Sbjct: 290 SPDLTLVEKVMTANPDCATLETTILDALHIMHDGKFLHIPVIDKDGQIAACLDVLQLTHA 349

Query: 403 TMEQMYSMQNQENG--NDGGGPMWNKFWNS-LANDGDNESTVSDSIAXXXXXXXXXXXXX 459
           T++    +    NG  ND    +  +FW+S LA +  +E   S                 
Sbjct: 350 TIQ----LVEGGNGTVNDVANSVMQRFWDSALALEPPDEEFDSR---------------- 389

Query: 460 XXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDY 519
                     S +  +  SE+     DG  + +P     N F+FK     G+ HRFT   
Sbjct: 390 ----------SEVSLLLQSEAG----DGKSSVYPPVIG-NSFSFKLHDRKGRVHRFTCGS 434

Query: 520 TSFEHIRATVASKL 533
              + + ++V  +L
Sbjct: 435 ECLDELVSSVRQRL 448



>gi|475592009|gb|EMT21949.1| hypothetical protein F775_07841 [Aegilops tauschii]
          Length = 521

 Score =  236 bits (601), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 168/513 (32%), Positives = 259/513 (50%), Gaps = 64/513 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MAA+R D VL+ DS   L GI T KD+  RV+   
Sbjct: 31  TVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIARE 90

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV +  G+V+ LLDI KCLY
Sbjct: 91  LKLEDTPVSKVMTRNPLFVLGDTLAVEALQKMVQGKFRHLPVVDN-GEVIALLDIAKCLY 149

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    + +  A+EGVE+ W T+   P     +++ LRE+M  P LS+++ + 
Sbjct: 150 DAIARMERAAEKGRAIAAAVEGVEKHWGTSVAGPNT---FVETLRERMFRPSLSTIISEN 206

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S  A V    +V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V
Sbjct: 207 SKVATVAPTDTVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTV 266

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT  P+ A   T IL+AL  M+DG +L+LPV+D  GS++ +VDVL +T+A +  + +
Sbjct: 267 GKVMTQSPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGN 326

Query: 410 MQNQENGNDGGGPMWNKFWNSLANDG----DNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
             +   G++    M  +FW+S  + G    D++S                      R+ G
Sbjct: 327 --SGATGSEATSSMMQRFWDSAMSSGPLDDDDDS----------------------RSEG 362

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  ++       SE A   D G  A FP     + F FK +   G+ HRF  + +S   +
Sbjct: 363 STKVA-------SEVA---DMGRSAFFPPSGLSSTFGFKIQDKQGRMHRFNCETSSLTEL 412

Query: 526 RATVASKLPSNVRDFTIYYVXXXXXXXXXXXXXXXIDAVRIAQRQGMSRVILHIQEIEKK 585
             ++  +L  ++    +  +                D V ++    +   + H ++I  K
Sbjct: 413 ITSILQRLGDDIDKLNLPQILYEDDDH---------DKVILSSDTDLIAAVDHARQIGWK 463

Query: 586 SLRXXXXXXXXXXXXILEKRRRRKRGKHAPDYN 618
           SLR                  RRKRG  + D+ 
Sbjct: 464 SLRLHLDYAGVG---------RRKRGAVSSDFE 487



>gi|168034755|ref|XP_001769877.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162678783|gb|EDQ65237.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 524

 Score =  234 bits (597), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 202/338 (59%), Gaps = 12/338 (3%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ + + V +A + MA +R D  L++DS   L GI T KD+A RV+ +G
Sbjct: 4   TVKRLRLSRALTISDGSSVADACRRMATRRVDAALLVDSSALLCGIITDKDVATRVIAEG 63

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MT+NP+ V  DT A +AL  MV   FRHLPV  E+G+VV LLDITKCLY
Sbjct: 64  LRPEETLVSKVMTKNPVFVMGDTLAVEALQKMVQGKFRHLPVV-EKGEVVALLDITKCLY 122

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MERA      +  A+E VEREW  N   +   +++ LR+KM  P L S++ +GS 
Sbjct: 123 DAIARMERAAEKGNAIAAAVESVEREWGNNASDKS-SFIENLRDKMFRPTLGSIIPEGSK 181

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVME-HHSIAGIFTSKDIVLRVIAAGLDPSTCSVI 351
                   +V  A R M+EYR  +V++    +  +GI TSKD+++RV+A GL P T ++ 
Sbjct: 182 VPTCSPSETVSAATRKMKEYRMNSVIITSLSNKPSGILTSKDVLMRVVAQGLPPETTTLD 241

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSM 410
           +VMTP+P+ A   T+++DAL  M+DG +L+LPV D  G I+  VDVL+LT+ T       
Sbjct: 242 KVMTPNPECAGLDTTLVDALHTMHDGKFLHLPVTDRDGYIVACVDVLQLTHGTGSVGGGG 301

Query: 411 QNQENGNDGGGPMWNKFWNSL-----ANDGDNESTVSD 443
                  D    M  KFW+S      A++ D+   +SD
Sbjct: 302 GGGG--ADQATNMLQKFWDSALALEPADEDDDSHRLSD 337



>gi|413951480|gb|AFW84129.1| hypothetical protein ZEAMMB73_744710 [Zea mays]
          Length = 545

 Score =  234 bits (597), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 152/432 (35%), Positives = 233/432 (53%), Gaps = 45/432 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MA++R D VL+ DS   L GI T KD+  RV+   
Sbjct: 57  TVKRLRLSKALTIPDHTTVHEACRRMASRRVDAVLLTDSNALLCGILTDKDITTRVIARE 116

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 117 LKMEETLVSKVMTRNPVFVLADTLAVEALQKMVQGKFRHLPVV-ENGEVIAILDIAKCLY 175

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWST--NQPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MERA    K +  A+EGVE+ W T  + P     +++ LRE+M  P LS+++ + 
Sbjct: 176 DAIARMERAAEKGKAIAAAVEGVEKHWGTAVSGPN---NFIETLRERMFRPSLSTIISEN 232

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           S    V    +V  A++ M E + ++ +V       GI TS+DI++RVIA  L P + +V
Sbjct: 233 SKVVTVVPSDTVLTASKKMLELKMSSAVVAIESKPGGILTSRDILMRVIAQNLPPESTTV 292

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMT  P+ A   T ILDAL  M+DG +L+LPV+D  G+++ +VDVL +T+A +  + +
Sbjct: 293 EKVMTQCPECASVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGN 352

Query: 410 MQNQENGNDGGGPMWNKFWNSLAN----DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRG 465
             +   G++    M  +FW+S  +    D D++ST                     R+ G
Sbjct: 353 --SGAAGSESTSAMMQRFWDSAMSIGPLDDDDDST---------------------RSEG 389

Query: 466 SGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHI 525
           S  +          ++ A D G  A FP     N F FK +   G+ HRF  + +S   +
Sbjct: 390 STKV----------ASEAADIGRSALFPASALSNTFGFKIQDKQGRMHRFNCETSSLTDL 439

Query: 526 RATVASKLPSNV 537
             ++  ++  ++
Sbjct: 440 ITSILQRVGDDI 451



>gi|460391765|ref|XP_004241489.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Solanum
           lycopersicum]
          Length = 543

 Score =  233 bits (594), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 153/476 (32%), Positives = 249/476 (52%), Gaps = 52/476 (10%)

Query: 67  IARQRMSKKDEAIRKKVEHELNKKNRTKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTV 126
           +A+++ + ++E ++    H   +K+ + S S+   G+          TV  L  S+ALT+
Sbjct: 23  LAKKKAAAENEGVQPDSAH---RKSISVSRSMGLTGE---------RTVKRLRLSKALTI 70

Query: 127 RESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMT 186
            ++  + EA + MAA+R D +L+ DS   L GI T KD+A RV+   ++ + T V+ IMT
Sbjct: 71  PDTTSIYEACRKMAARRVDALLLTDSNALLCGILTDKDIATRVIAPEVNIQETPVSKIMT 130

Query: 187 RNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSS 246
           +NP+ V +DT A +AL  MV   FRHLPV  + G+VV LLDI KCLY+A+ ++ERA    
Sbjct: 131 KNPVFVLSDTLAVEALQKMVLGKFRHLPVV-DNGEVVALLDIAKCLYDAIARLERAAEKG 189

Query: 247 KKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDA 305
           K +  A+EGVE+ W          +++ LRE+M  P LS+++ + S    V    +V   
Sbjct: 190 KAIAAAVEGVEKHWGATGCASSNTFIEALRERMFRPSLSTIISENSKIVTVEPNETVLAT 249

Query: 306 ARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQT 365
           A+ M E R ++ ++   +   GI TSKD+++RVIA  L P +  V RVMTP+P+ A    
Sbjct: 250 AKKMLECRISSAIITVDNKPRGILTSKDLLMRVIAQDLPPESTLVERVMTPNPECASIDM 309

Query: 366 SILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMW 424
            I+DAL  M+DG +L+LPVVD  G+++ ++DVL +T+A +  + +       N+    M 
Sbjct: 310 PIVDALHTMHDGKFLHLPVVDKEGTVVSVLDVLHITHAAVATVGNAAGV--NNEAANSMM 367

Query: 425 NKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESA 481
            +FW+S   L  D D+E+   +S+                 + G+     IP        
Sbjct: 368 QRFWDSAMALTPDDDDETRSENSLKLA--------------SEGTETGRSIP-------- 405

Query: 482 SAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRATVASKLPSNV 537
                     +P       F+FK K   G+ HRF  D  +   + A +  ++  ++
Sbjct: 406 ----------YPSSSQPTSFSFKIKDKKGRMHRFNCDIQNMTDLIAAIIQRVGDDI 451



>gi|348688916|gb|EGZ28730.1| hypothetical protein PHYSODRAFT_349233 [Phytophthora sojae]
          Length = 546

 Score =  233 bits (593), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 154/460 (33%), Positives = 244/460 (53%), Gaps = 18/460 (3%)

Query: 93  TKSTSLNNRGKPQRQVPGAKGTVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDS 152
           TK      + + Q    G   +V  + PS+AL   + A V +  + M  ++ D  L++D 
Sbjct: 19  TKKAGRKAKARQQHSSHGHSRSVKRMRPSRALLQGDHATVAQCVRAMVERKTDAALLVDR 78

Query: 153 EEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRH 212
              L+GI T +D+A +VV  G D   T    +MT +P CV  + SA DAL  M++  FRH
Sbjct: 79  SGLLTGILTDRDVAVKVVAVGRDPTRTLAYEVMTPDPSCVSANASAIDALKKMISGQFRH 138

Query: 213 LPVCNEEGDVVGLLDITKCLYEALDKMERAY-GSSKKLYDALEGVEREWSTNQPTQILQY 271
           LPV + +  VVG+LDI KCLYEA+ K+E AY  SS +L + ++ +++  S +    + + 
Sbjct: 139 LPVTDND-KVVGILDIAKCLYEAIAKLEHAYRKSSDRLEETVKKLQQSLSGSTEANLFES 197

Query: 272 MDMLREKMACPDLSS-VLDGSMPAEVGVKTSVRDAARLMREYRTTAVLVM-EHHSIAGIF 329
              LR+K+  P LS+ +++GS    +   ++  DAAR+M   +T+AV+V  E     GIF
Sbjct: 198 ---LRQKLFLPTLSAIIMEGSEVPVLSPTSTAMDAARMMLIQKTSAVMVCDEADRTVGIF 254

Query: 330 TSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDGG- 388
           T+KD++ RV+A  L+PS C +  VMTP P TA   T+IL+ L  M++G +L++PV D G 
Sbjct: 255 TTKDLMRRVVALSLEPSQCLLSGVMTPEPQTATLGTTILETLHSMHNGKFLHVPVFDSGK 314

Query: 389 SILGMVDVLKLTYATMEQMYSMQNQENGNDGGGPMWNKFWNSL--ANDG-DNESTVSDSI 445
            ++G+VDVL++T+  ++QM + Q+ +  NDG  P+W++F NSL  AND  +++  V D  
Sbjct: 315 KLVGIVDVLQVTHGVVQQMGTFQSVK--NDGVQPLWDQFRNSLKSANDATEHDEEVEDDG 372

Query: 446 AXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFP--RGHDENFFTF 503
           +                  G    S   +   S   S   D ++        H  + F +
Sbjct: 373 SNVGVDDPDTDDVNIASLVGRQTWS---DFQSSTGTSVTGDPALLDENPLNEHAPDVFVY 429

Query: 504 KFKAPNGKSHRFTVDYTSFEHIRATVASKLPSNVRDFTIY 543
           K     G +HRFT    S E +   V ++L  N     +Y
Sbjct: 430 KLADCYGNNHRFTSSAESLEQLLVDVQNRLGDNTIRRILY 469



>gi|226495213|ref|NP_001151563.1| CBS domain containing protein [Zea mays]
 gi|195647750|gb|ACG43343.1| CBS domain containing protein [Zea mays]
          Length = 550

 Score =  232 bits (592), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 230/431 (53%), Gaps = 44/431 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MA++R D VL+ DS   L GI T KD+  RV+   
Sbjct: 59  TVKRLRLSKALTIPDHTTVHEACRRMASRRVDAVLLTDSNALLCGILTDKDITTRVIARE 118

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 119 LKMEETPVSKVMTRNPVFVLADTLAVEALQKMVQGKFRHLPVV-ENGEVIAILDIAKCLY 177

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMP 293
           +A+ +MERA    K +  A+EGVE+ W    P     +++ LRE+M  P LS+++  + P
Sbjct: 178 DAIARMERAAEKGKAIAAAVEGVEKHWGAAVPGPN-NFIETLRERMFRPSLSTIISEN-P 235

Query: 294 AEVGVKTS--VRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVI 351
             V V  S  V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V 
Sbjct: 236 KVVTVAPSDMVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTVE 295

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSM 410
           +VMT  P+ A   T ILDAL  M+DG +L+LPV+D  G+++ +VDVL +T+A +  + + 
Sbjct: 296 KVMTQSPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGN- 354

Query: 411 QNQENGNDGGGPMWNKFWNSLAN----DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
            +   G++    M  +FW+S  +    D D++S                      R+ GS
Sbjct: 355 -SGAAGSEATSAMMQRFWDSAMSIGPIDDDDDS----------------------RSEGS 391

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
             +           + A D G  A FP     N F FK +   G+ HRF  + +    + 
Sbjct: 392 TRV----------VSEATDIGRAAFFPASGLSNTFGFKIQDKQGRMHRFNCETSGLAELI 441

Query: 527 ATVASKLPSNV 537
            ++  ++  ++
Sbjct: 442 TSILQRVGDDI 452



>gi|356527608|ref|XP_003532400.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Glycine
           max]
          Length = 598

 Score =  232 bits (592), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 151/430 (35%), Positives = 230/430 (53%), Gaps = 41/430 (9%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV SL  S+ALTV E+  V EA + MAA++ D +L+ DS   L GI T KD+A RV+   
Sbjct: 107 TVKSLRLSKALTVPETTTVYEACRRMAARKVDALLLTDSNALLCGILTDKDIATRVIARE 166

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           ++   T V+ +MTRNP+ V +D  A +AL  MV   FRHLPV  E G+VV +LDI KCLY
Sbjct: 167 VNLEETHVSKVMTRNPVFVLSDALAVEALQKMVQGRFRHLPVV-ENGEVVAILDIAKCLY 225

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ +MER     K +  A+EG+E+ W T+ P     +M+ LRE++  P LS+++   S 
Sbjct: 226 DAIARMERKAEKGKAIAAAVEGIEKHWGTSTPGSNSTFMETLREQIFKPSLSTIIPQNSK 285

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
              V    SV    + M E R ++ +V     + GI TSKDI++RVIA  L PS+  V +
Sbjct: 286 VVTVSPTDSVLTTTKKMLELRASSAVVTVGDKLCGILTSKDILMRVIAQSLPPSSTLVEK 345

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQ 411
           VMTP+P+     T I+DAL  M+DG++L+L VV+  G ++  VD + +T+A +    ++ 
Sbjct: 346 VMTPNPECGTIDTPIIDALHTMHDGNFLHLLVVNRDGIVVATVDAIHITHAAVA---TVG 402

Query: 412 NQENGN-DGGGPMWNKFWNS---LANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSG 467
           N  N N +    M  K W+S   LA + + E + S++                       
Sbjct: 403 NTPNFNSEAANSMIQKIWDSAMALAPNEEEEDSQSET----------------------- 439

Query: 468 NISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIRA 527
           ++  I E          + G   S+     +N F+FK +   G+ HRFT D  S   +  
Sbjct: 440 SLKMISE--------GGETGRSISYLASSMQNAFSFKLQDRKGRLHRFTCDTRSLAEVIT 491

Query: 528 TVASKLPSNV 537
           +V  ++  ++
Sbjct: 492 SVIQRVGDDI 501



>gi|224031159|gb|ACN34655.1| unknown [Zea mays]
 gi|414878944|tpg|DAA56075.1| TPA: CBS domain containing protein [Zea mays]
          Length = 550

 Score =  231 bits (589), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 230/431 (53%), Gaps = 44/431 (10%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  S+ALT+ +   V EA + MA++R D VL+ DS   L GI T KD+  RV+   
Sbjct: 59  TVKRLRLSKALTIPDHTTVHEACRRMASRRVDAVLLTDSNALLCGILTDKDITTRVIARE 118

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T V+ +MTRNP+ V  DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 119 LKMEETPVSKVMTRNPVFVLADTLAVEALQKMVQGKFRHLPVV-ENGEVIAILDIAKCLY 177

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVLDGSMP 293
           +A+ +MERA    K +  A+EGVE+ W    P     +++ LRE+M  P LS+++  + P
Sbjct: 178 DAIARMERAAEKGKAIAAAVEGVEKHWGAAVPGPN-NFIETLRERMFRPSLSTIISEN-P 235

Query: 294 AEVGVKTS--VRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVI 351
             V V  S  V  A++ M E + ++ +V   +   GI TS+DI++RVIA  L P + +V 
Sbjct: 236 KVVTVAPSDMVLTASKKMLELKVSSAVVAIENKPGGILTSRDILMRVIAQNLPPESTTVE 295

Query: 352 RVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSM 410
           +VMT  P+ A   T ILDAL  M+DG +L+LPV+D  G+++ +VDVL +T+A +  + + 
Sbjct: 296 KVMTQSPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGN- 354

Query: 411 QNQENGNDGGGPMWNKFWNSLAN----DGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGS 466
            +   G++    M  +FW+S  +    D D++S                      R+ GS
Sbjct: 355 -SGAAGSEATSAMMQRFWDSAMSIGPIDDDDDS----------------------RSEGS 391

Query: 467 GNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEHIR 526
             +           + A D G  A FP     N F FK +   G+ HRF  + +    + 
Sbjct: 392 TRV----------VSEATDIGRPAFFPASGLSNTFGFKIQDKQGRMHRFNCETSGLAELI 441

Query: 527 ATVASKLPSNV 537
            ++  ++  ++
Sbjct: 442 TSILQRVGDDI 452



>gi|62701927|gb|AAX93000.1| CBS domain, putative [Oryza sativa Japonica Group]
          Length = 575

 Score =  231 bits (588), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 161/451 (35%), Positives = 229/451 (50%), Gaps = 65/451 (14%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L  ++A+T+ E   V EA Q MAA+R D VL+ D+   LSGI T KD+A RV+ +G
Sbjct: 52  TVKKLRLTKAVTIPEGTTVAEACQRMAARRVDAVLLTDANGLLSGIVTDKDIAKRVIAEG 111

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L    T  + IMTR P+ V +DT A +AL  MV   FRHLPV  E G+V+ +LDI KCLY
Sbjct: 112 LRVEQTITSKIMTRTPVYVMSDTLAIEALQKMVQGKFRHLPVV-ENGEVIAMLDIAKCLY 170

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSM 292
           +A+ ++E+A      L  A+EGVER+   N P      ++ LRE+M  P LS+++ + + 
Sbjct: 171 DAISRLEKAAEQGSALAAAVEGVERQVGDNLPDHS-SVIETLRERMLKPSLSTIISENTK 229

Query: 293 PAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIR 352
            A V     V  AAR M E R  +V++   +S+ GIFTSKD+++RV+   L P    V +
Sbjct: 230 VAIVSPWDPVCVAARKMHELRVNSVVITAGNSLQGIFTSKDVLMRVVTQNLSPELTHVEK 289

Query: 353 VMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVDG-GSILGMVDVLKLTYATMEQMYSMQ 411
           VMT HP+ A   TSILDAL  M DG +L++PVVDG G ++  +DVL++T+A +  M S+ 
Sbjct: 290 VMTAHPECATLDTSILDALHIMRDGKFLHIPVVDGEGRVVACLDVLQITHAAI-SMVSLH 348

Query: 412 NQ----------------------------ENGNDGGGPMWNKFWNS-LANDGDNESTVS 442
            +                            E  N     +  KFW+S LA +  +E   S
Sbjct: 349 MRIFSLLIPCFFLMVSVHLTSFCVKVEGGPETTNGVANTIMQKFWDSALALEPPDEEFDS 408

Query: 443 DSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFT 502
                                      S I  + PSE+     DG  +  P     N F 
Sbjct: 409 R--------------------------SEISLLMPSEAG----DGRSSINPPVVG-NSFV 437

Query: 503 FKFKAPNGKSHRFTVDYTSFEHIRATVASKL 533
           FK +   G+ HRF     S   + ++V  +L
Sbjct: 438 FKIEDQKGRMHRFACGSESLHELVSSVVQRL 468



>gi|224081072|ref|XP_002306285.1| predicted protein [Populus trichocarpa]
 gi|222855734|gb|EEE93281.1| predicted protein [Populus trichocarpa]
          Length = 348

 Score =  230 bits (587), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 145/386 (37%), Positives = 209/386 (54%), Gaps = 52/386 (13%)

Query: 139 MAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDGLDARTTTVATIMTRNPMCVKNDTSA 198
           MAA+R + VL+ D+   LSGI T KD++ RV+ +GL    T V+ IMTRNP+ V +D+ A
Sbjct: 1   MAARRVNAVLLTDANALLSGIVTDKDISARVIAEGLRPEHTIVSKIMTRNPIFVTSDSLA 60

Query: 199 TDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLYEALDKMERAYGSSKKLYDALEGVER 258
            +AL  MV   FRHLPV  E G+V+ LLDIT+CLY+A+ +ME+A      +  A+EGVER
Sbjct: 61  IEALQKMVQGKFRHLPVV-ENGEVIALLDITRCLYDAISRMEKAAEQGSAIAAAVEGVER 119

Query: 259 EWSTNQPTQILQYMDMLREKMACPDLSSVL-DGSMPAEVGVKTSVRDAARLMREYRTTAV 317
           +W  N  T    +++ LRE+M  P LS+++ + S  A       V  A + MRE R  +V
Sbjct: 120 QWG-NNFTAPYAFIETLRERMFKPSLSTIIGEQSKVAIASPSDPVYAATKKMRELRVNSV 178

Query: 318 LVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSVIRVMTPHPDTAPPQTSILDALKKMYDG 377
           +V+  + I GI TSKDI++RV+A  L P    V +VMT +P+    +T+ILDAL  M+DG
Sbjct: 179 IVVTGNKIQGILTSKDILMRVVAQNLSPELTLVEKVMTLNPECVTLETTILDALHVMHDG 238

Query: 378 HYLNLPVVD-GGSILGMVDVLKLTYATMEQMYSMQNQENG--NDGGGPMWNKFWNSL--- 431
            +L+LPVVD  GS+   +DVL++T+A +    S+    +G  ND    M  KFW+S    
Sbjct: 239 KFLHLPVVDKDGSVAACLDVLQITHAAI----SLVESSSGAVNDVANTMMQKFWDSALAL 294

Query: 432 --ANDGDNESTVSDSIAXXXXXXXXXXXXXXXRTRGSGNISPIPEIHPSESASAIDDGSM 489
             A+D D +S +S  +A                                      D   +
Sbjct: 295 EPADDYDTQSEMSALMAS-------------------------------------DATEL 317

Query: 490 ASFPRGHDENFFTFKFKAPNGKSHRF 515
             +P     N F FKF+   G+ HR 
Sbjct: 318 GRYPSLGLGNSFAFKFQDLKGRVHRL 343



>gi|18423173|ref|NP_568736.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|22327688|ref|NP_680412.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|347662481|sp|P0DH79.1|Y5064_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB5
 gi|347662483|sp|Q0WLC7.2|Y5053_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB4
 gi|8777387|dbj|BAA96977.1| unnamed protein product [Arabidopsis thaliana]
 gi|9758762|dbj|BAB09138.1| unnamed protein product [Arabidopsis thaliana]
 gi|332008572|gb|AED95955.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
 gi|332008588|gb|AED95971.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein
           [Arabidopsis thaliana]
          Length = 548

 Score =  230 bits (586), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 144/434 (33%), Positives = 231/434 (53%), Gaps = 53/434 (12%)

Query: 114 TVASLNPSQALTVRESALVVEASQLMAAKRADCVLVIDSEEHLSGIFTAKDLAFRVVGDG 173
           TV  L   +ALTV +S  + EA + MAA+R D +L+ DS   L GI T +D+A +V+   
Sbjct: 62  TVKRLRLCKALTVPDSTTLFEACRRMAARRVDALLLTDSNALLCGILTDRDIATKVIAKQ 121

Query: 174 LDARTTTVATIMTRNPMCVKNDTSATDALNTMVARGFRHLPVCNEEGDVVGLLDITKCLY 233
           L+   T V+ +MT+NP+ V +DT A +AL  MV   FRHLPV  E G+V+ LLDI KCLY
Sbjct: 122 LNLEETPVSKVMTKNPVFVLSDTIAVEALQKMVQGKFRHLPVV-ENGEVIALLDIAKCLY 180

Query: 234 EALDKMERAYGSSKKLYDALEGVEREWSTN--QPTQILQYMDMLREKMACPDLSSVL-DG 290
           +A+ +MER+    K +  A+EGVE+ W T+   P     +M+ LRE++  P LS+++ + 
Sbjct: 181 DAIARMERSVEKGKAIAAAVEGVEKNWGTSIAGPN---TFMETLRERIFKPSLSTIIPEN 237

Query: 291 SMPAEVGVKTSVRDAARLMREYRTTAVLVMEHHSIAGIFTSKDIVLRVIAAGLDPSTCSV 350
           +   +VG+  +V      M EY+++A +VM  + + GI TSKDI++RVI+  L   T +V
Sbjct: 238 TKVLKVGLDETVLGVTMKMVEYQSSAAMVMVENKLVGILTSKDILMRVISQNLPQETTTV 297

Query: 351 IRVMTPHPDTAPPQTSILDALKKMYDGHYLNLPVVD-GGSILGMVDVLKLTYATMEQMYS 409
            +VMTP+P++A    +I++AL  M++G +L+LPV+D  G ++ ++DV+ +T+A +    S
Sbjct: 298 EKVMTPNPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGS 357

Query: 410 MQNQENGNDGGGPMWNKFWNSLA-----NDGDNESTVSDSIAXXXXXXXXXXXXXXXRTR 464
                  N+    M  KFW+S        DGD   +  +S+                   
Sbjct: 358 TAGI--NNETANSMMQKFWDSAMALSPNEDGDETRSEEESMKL----------------- 398

Query: 465 GSGNISPIPEIHPSESASAIDDGSMASFPRGHDENFFTFKFKAPNGKSHRFTVDYTSFEH 524
                           +S I+     S+P     N F FK +   G+ HRF  +  S   
Sbjct: 399 ----------------SSEIEVTKSFSYP-----NTFAFKLQDKKGRMHRFMCETQSLTT 437

Query: 525 IRATVASKLPSNVR 538
           +   +  ++  ++ 
Sbjct: 438 LITAILQRMGDDIE 451