BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10051_c0_seq1-m.21 complete 72-1310(+) 413 (+)
         (412 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511003292|gb|EPB84699.1| hypothetical protein HMPREF1544_0857...   199   2e-48   Mucor circinelloides f. circinelloides 1006PhL
gi|477520510|gb|ENH72636.1| RNA-binding post-transcriptional reg...   187   5e-45   Fusarium oxysporum f. sp. cubense race 1
gi|342871442|gb|EGU74039.1| hypothetical protein FOXB_15429 [Fus...   187   5e-45   Fusarium oxysporum Fo5176
gi|296415532|ref|XP_002837440.1| hypothetical protein [Tuber mel...   187   7e-45   Tuber melanosporum Mel28
gi|505755386|gb|EOQ99603.1| RNA-binding post-transcriptional reg...   184   4e-44   Wallemia ichthyophaga EXF-994
gi|46109494|ref|XP_381805.1| hypothetical protein FG01629.1 [Fus...   184   4e-44   
gi|171683814|ref|XP_001906849.1| hypothetical protein [Podospora...   183   7e-44   Podospora anserina S mat+
gi|408393550|gb|EKJ72812.1| hypothetical protein FPSE_06998 [Fus...   183   8e-44   Fusarium pseudograminearum CS3096
gi|388579109|gb|EIM19437.1| hypothetical protein WALSEDRAFT_6144...   182   1e-43   Wallemia mellicola CBS 633.66
gi|367053930|ref|XP_003657343.1| hypothetical protein THITE_2122...   182   2e-43   Thielavia terrestris NRRL 8126
gi|405119379|gb|AFR94152.1| cytoplasmic protein [Cryptococcus ne...   182   2e-43   Cryptococcus neoformans var. grubii H99
gi|116200313|ref|XP_001225968.1| hypothetical protein CHGG_08312...   182   2e-43   Chaetomium globosum CBS 148.51
gi|134117425|ref|XP_772606.1| hypothetical protein CNBK3100 [Cry...   182   2e-43   Cryptococcus neoformans var. neoformans B-3501A
gi|321264293|ref|XP_003196864.1| cytoplasm protein [Cryptococcus...   181   2e-43   Cryptococcus gattii WM276
gi|58260384|ref|XP_567602.1| cytoplasm protein [Cryptococcus neo...   181   3e-43   Cryptococcus neoformans var. neoformans JEC21
gi|401883686|gb|EJT47882.1| hypothetical protein A1Q1_03228 [Tri...   181   3e-43   Trichosporon asahii var. asahii CBS 2479
gi|336468708|gb|EGO56871.1| hypothetical protein NEUTE1DRAFT_844...   181   3e-43   Neurospora tetrasperma FGSC 2508
gi|393216626|gb|EJD02116.1| hypothetical protein FOMMEDRAFT_1243...   181   3e-43   Fomitiporia mediterranea MF3/22
gi|28881338|emb|CAD70341.1| conserved hypothetical protein [Neur...   181   3e-43   Neurospora crassa
gi|85068315|ref|XP_963334.1| hypothetical protein NCU05343 [Neur...   181   3e-43   
gi|367034492|ref|XP_003666528.1| hypothetical protein MYCTH_2311...   181   4e-43   Myceliophthora thermophila ATCC 42464
gi|336263802|ref|XP_003346680.1| hypothetical protein SMAC_04113...   181   4e-43   Sordaria macrospora k-hell
gi|310795683|gb|EFQ31144.1| R3H domain-containing protein [Glome...   181   4e-43   Colletotrichum graminicola M1.001
gi|380489902|emb|CCF36387.1| R3H domain-containing protein [Coll...   181   4e-43   Colletotrichum higginsianum
gi|392567458|gb|EIW60633.1| hypothetical protein TRAVEDRAFT_1655...   180   6e-43   Trametes versicolor FP-101664 SS1
gi|302413487|ref|XP_003004576.1| conserved hypothetical protein ...   179   1e-42   Verticillium alfalfae VaMs.102
gi|302907092|ref|XP_003049570.1| predicted protein [Nectria haem...   179   2e-42   Nectria haematococca mpVI 77-13-4
gi|346973012|gb|EGY16464.1| RNA-binding post-transcriptional reg...   179   2e-42   Verticillium dahliae VdLs.17
gi|494830022|gb|EON66591.1| hypothetical protein W97_05837 [Coni...   178   2e-42   Coniosporium apollinis CBS 100218
gi|328859605|gb|EGG08714.1| hypothetical protein MELLADRAFT_1159...   178   2e-42   Melampsora larici-populina 98AG31
gi|358060227|dbj|GAA93981.1| hypothetical protein E5Q_00628 [Mix...   178   3e-42   Mixia osmundae IAM 14324
gi|340514314|gb|EGR44578.1| predicted protein [Trichoderma reese...   177   4e-42   Trichoderma reesei QM6a
gi|322693592|gb|EFY85447.1| R3H domain protein, putative [Metarh...   177   6e-42   Metarhizium acridum CQMa 102
gi|341039061|gb|EGS24053.1| hypothetical protein CTHT_0007650 [C...   176   9e-42   Chaetomium thermophilum var. thermophilum DSM 1495
gi|399168766|emb|CCE30300.1| uncharacterized protein CPUR_04148 ...   176   1e-41   Claviceps purpurea 20.1
gi|477536043|gb|ENH87528.1| r3h domain-containing protein [Colle...   175   2e-41   Colletotrichum orbiculare MAFF 240422
gi|345560425|gb|EGX43550.1| hypothetical protein AOL_s00215g286 ...   175   2e-41   Arthrobotrys oligospora ATCC 24927
gi|429863831|gb|ELA38238.1| r3h domain-containing protein [Colle...   175   3e-41   Colletotrichum gloeosporioides Nara gc5
gi|400600808|gb|EJP68476.1| R3H domain-containing protein [Beauv...   174   4e-41   Beauveria bassiana ARSEF 2860
gi|407916529|gb|EKG09897.1| hypothetical protein MPH_13104 [Macr...   174   5e-41   Macrophomina phaseolina MS6
gi|358401646|gb|EHK50947.1| hypothetical protein TRIATDRAFT_3141...   172   1e-40   Trichoderma atroviride IMI 206040
gi|358378481|gb|EHK16163.1| hypothetical protein TRIVIDRAFT_8015...   171   3e-40   Trichoderma virens Gv29-8
gi|322703564|gb|EFY95171.1| R3H domain protein, putative [Metarh...   171   3e-40   
gi|225679170|gb|EEH17454.1| RNA-binding protein Cip2 [Paracoccid...   170   6e-40   Paracoccidioides brasiliensis Pb03
gi|226290879|gb|EEH46307.1| conserved hypothetical protein [Para...   170   6e-40   Paracoccidioides brasiliensis Pb18
gi|500252984|gb|EON96742.1| putative rna-binding post-transcript...   170   9e-40   Phaeoacremonium minimum UCRPA7
gi|295658103|ref|XP_002789614.1| conserved hypothetical protein ...   170   9e-40   Paracoccidioides lutzii Pb01
gi|325096738|gb|EGC50048.1| R3H domain-containing protein [Ajell...   169   1e-39   Histoplasma capsulatum H88
gi|212541891|ref|XP_002151100.1| R3H domain protein, putative [T...   169   1e-39   Talaromyces marneffei ATCC 18224
gi|258571371|ref|XP_002544489.1| conserved hypothetical protein ...   169   1e-39   Uncinocarpus reesii 1704
gi|361131274|gb|EHL02972.1| putative RNA-binding post-transcript...   169   1e-39   Glarea lozoyensis 74030
gi|242770272|ref|XP_002341945.1| R3H domain protein, putative [T...   168   2e-39   Talaromyces stipitatus ATCC 10500
gi|19113807|ref|NP_592895.1| RNA-binding protein Cip2 [Schizosac...   168   2e-39   Schizosaccharomyces pombe 972h-
gi|512202213|gb|EPE31041.1| RNA-binding, RBD [Glarea lozoyensis ...   168   2e-39   Glarea lozoyensis ATCC 20868
gi|430813924|emb|CCJ28772.1| unnamed protein product [Pneumocyst...   167   4e-39   Pneumocystis jirovecii
gi|449301688|gb|EMC97699.1| hypothetical protein BAUCODRAFT_4630...   167   4e-39   Baudoinia panamericana UAMH 10762
gi|119182775|ref|XP_001242501.1| hypothetical protein CIMG_06397...   167   4e-39   Coccidioides immitis RS
gi|320040843|gb|EFW22776.1| hypothetical protein CPSG_00675 [Coc...   167   4e-39   Coccidioides posadasii str. Silveira
gi|303319421|ref|XP_003069710.1| R3H domain containing protein [...   167   4e-39   Coccidioides posadasii C735 delta SOWgp
gi|470317545|gb|EMR09257.1| hypothetical protein PNEG_02591 [Pne...   167   6e-39   Pneumocystis murina B123
gi|430813928|emb|CCJ28776.1| unnamed protein product, partial [P...   167   6e-39   Pneumocystis jirovecii
gi|378728567|gb|EHY55026.1| hypothetical protein, variant [Exoph...   167   8e-39   Exophiala dermatitidis NIH/UT8656
gi|378728568|gb|EHY55027.1| hypothetical protein HMPREF1120_0318...   166   8e-39   Exophiala dermatitidis NIH/UT8656
gi|213402139|ref|XP_002171842.1| RNA-binding post-transcriptiona...   166   9e-39   
gi|327357381|gb|EGE86238.1| R3H domain-containing protein [Ajell...   166   1e-38   Blastomyces dermatitidis ATCC 18188
gi|261200195|ref|XP_002626498.1| R3H domain-containing protein [...   166   1e-38   Blastomyces gilchristii SLH14081
gi|119499163|ref|XP_001266339.1| R3H domain protein, putative [N...   166   1e-38   Aspergillus fischeri NRRL 181
gi|189189182|ref|XP_001930930.1| conserved hypothetical protein ...   166   1e-38   Pyrenophora tritici-repentis Pt-1C-BFP
gi|169611849|ref|XP_001799342.1| hypothetical protein SNOG_09039...   166   2e-38   Parastagonospora nodorum SN15
gi|225557256|gb|EEH05542.1| conserved hypothetical protein [Ajel...   165   2e-38   Histoplasma capsulatum G186AR
gi|154277194|ref|XP_001539438.1| conserved hypothetical protein ...   165   2e-38   Histoplasma capsulatum NAm1
gi|471570181|gb|EMR69377.1| putative r3h domain-containing prote...   165   2e-38   Eutypa lata UCREL1
gi|452840954|gb|EME42891.1| hypothetical protein DOTSEDRAFT_7235...   164   3e-38   Dothistroma septosporum NZE10
gi|425772723|gb|EKV11118.1| hypothetical protein PDIG_52610 [Pen...   164   3e-38   Penicillium digitatum PHI26
gi|115443258|ref|XP_001218436.1| conserved hypothetical protein ...   164   3e-38   Aspergillus terreus NIH2624
gi|70985284|ref|XP_748148.1| R3H domain protein [Aspergillus fum...   164   3e-38   Aspergillus fumigatus Af293
gi|255955429|ref|XP_002568467.1| Pc21g14530 [Penicillium chrysog...   164   3e-38   Penicillium rubens Wisconsin 54-1255
gi|83768247|dbj|BAE58386.1| unnamed protein product [Aspergillus...   164   5e-38   Aspergillus oryzae RIB40
gi|482812767|gb|EOA89486.1| hypothetical protein SETTUDRAFT_1058...   164   5e-38   Setosphaeria turcica Et28A
gi|238485560|ref|XP_002374018.1| R3H domain protein, putative [A...   164   5e-38   Aspergillus flavus NRRL3357
gi|485927467|gb|EOD51473.1| putative r3h domain protein [Neofusi...   164   6e-38   Neofusicoccum parvum UCRNP2
gi|302690708|ref|XP_003035033.1| hypothetical protein SCHCODRAFT...   163   8e-38   Schizophyllum commune H4-8
gi|451995861|gb|EMD88328.1| hypothetical protein COCHEDRAFT_1226...   163   8e-38   Bipolaris maydis C5
gi|296817479|ref|XP_002849076.1| RNA-binding post-transcriptiona...   163   9e-38   Arthroderma otae CBS 113480
gi|294654600|ref|XP_456659.2| DEHA2A07634p [Debaryomyces hanseni...   163   1e-37   Debaryomyces hansenii CBS767
gi|358368186|dbj|GAA84803.1| R3H domain protein [Aspergillus kaw...   163   1e-37   Aspergillus kawachii IFO 4308
gi|451854569|gb|EMD67862.1| hypothetical protein COCSADRAFT_2939...   163   1e-37   Bipolaris sorokiniana ND90Pr
gi|330928747|ref|XP_003302386.1| hypothetical protein PTT_14174 ...   163   1e-37   Pyrenophora teres f. teres 0-1
gi|426200340|gb|EKV50264.1| hypothetical protein AGABI2DRAFT_641...   162   1e-37   Agaricus bisporus var. bisporus H97
gi|121719293|ref|XP_001276346.1| R3H domain protein, putative [A...   162   1e-37   Aspergillus clavatus NRRL 1
gi|134083035|emb|CAK42797.1| unnamed protein product [Aspergillu...   162   1e-37   Aspergillus niger
gi|302501931|ref|XP_003012957.1| hypothetical protein ARB_00840 ...   162   1e-37   Arthroderma benhamiae CBS 112371
gi|326475561|gb|EGD99570.1| R3H domain-containing protein [Trich...   162   1e-37   Trichophyton tonsurans CBS 112818
gi|302653313|ref|XP_003018484.1| hypothetical protein TRV_07498 ...   162   1e-37   Trichophyton verrucosum HKI 0517
gi|327301321|ref|XP_003235353.1| R3H domain-containing protein [...   162   1e-37   Trichophyton rubrum CBS 118892
gi|315049051|ref|XP_003173900.1| hypothetical protein MGYG_04073...   162   2e-37   Microsporum gypseum CBS 118893
gi|409082508|gb|EKM82866.1| hypothetical protein AGABI1DRAFT_111...   162   2e-37   Agaricus bisporus var. burnettii JB137-S8
gi|452982066|gb|EME81825.1| hypothetical protein MYCFIDRAFT_1164...   162   2e-37   Cercospora fijiensis CIRAD86
gi|317036029|ref|XP_001397493.2| R3H domain protein [Aspergillus...   162   2e-37   Aspergillus niger CBS 513.88
gi|67902102|ref|XP_681307.1| hypothetical protein AN8038.2 [Aspe...   162   2e-37   Aspergillus nidulans FGSC A4
gi|472243329|gb|EMR87986.1| putative r3h domain protein [Botryot...   161   3e-37   Botrytis cinerea BcDW1
gi|347830526|emb|CCD46223.1| similar to R3H domain protein [Botr...   161   3e-37   Botrytis cinerea T4
gi|390598267|gb|EIN07665.1| hypothetical protein PUNSTDRAFT_5306...   161   4e-37   Punctularia strigosozonata HHB-11173 SS5
gi|254569752|ref|XP_002491986.1| Protein involved in G2/M phase ...   160   5e-37   Komagataella phaffii GS115
gi|402078447|gb|EJT73712.1| RNA-binding post-transcriptional reg...   160   6e-37   Gaeumannomyces graminis var. tritici R3-111a-1
gi|448114719|ref|XP_004202646.1| Piso0_001492 [Millerozyma farin...   160   7e-37   Millerozyma farinosa CBS 7064
gi|440640241|gb|ELR10160.1| hypothetical protein GMDG_04554 [Geo...   160   9e-37   Pseudogymnoascus destructans 20631-21
gi|392580244|gb|EIW73371.1| hypothetical protein TREMEDRAFT_7095...   159   1e-36   Tremella mesenterica DSM 1558
gi|406863143|gb|EKD16191.1| RNA-binding protein Cip2 [Marssonina...   159   1e-36   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|448112143|ref|XP_004202020.1| Piso0_001492 [Millerozyma farin...   159   2e-36   Millerozyma farinosa CBS 7064
gi|398393764|ref|XP_003850341.1| hypothetical protein MYCGRDRAFT...   158   2e-36   Zymoseptoria tritici IPO323
gi|156063878|ref|XP_001597861.1| hypothetical protein SS1G_02057...   158   3e-36   Sclerotinia sclerotiorum 1980 UF-70
gi|396495944|ref|XP_003844668.1| similar to R3H domain protein [...   158   3e-36   Leptosphaeria maculans JN3
gi|453084029|gb|EMF12074.1| hypothetical protein SEPMUDRAFT_1498...   158   4e-36   Sphaerulina musiva SO2202
gi|501756490|emb|CCG80543.1| putative R3H domain protein [Taphri...   156   1e-35   Taphrina deformans PYCC 5710
gi|440476149|gb|ELQ44775.1| RNA-binding post-transcriptional reg...   156   1e-35   Magnaporthe oryzae Y34
gi|344229806|gb|EGV61691.1| hypothetical protein CANTEDRAFT_1246...   156   1e-35   Candida tenuis ATCC 10573
gi|344304227|gb|EGW34476.1| hypothetical protein SPAPADRAFT_1494...   155   2e-35   Spathaspora passalidarum NRRL Y-27907
gi|260949655|ref|XP_002619124.1| hypothetical protein CLUG_00283...   154   6e-35   Clavispora lusitaniae ATCC 42720
gi|354545030|emb|CCE41755.1| hypothetical protein CPAR2_803060 [...   154   7e-35   Candida parapsilosis
gi|512191377|gb|EPE07138.1| rna-binding post-transcriptional reg...   154   7e-35   Ophiostoma piceae UAMH 11346
gi|389628906|ref|XP_003712106.1| RNA-binding post-transcriptiona...   153   8e-35   Magnaporthe oryzae 70-15
gi|448509388|ref|XP_003866133.1| Pin4 protein [Candida orthopsil...   152   2e-34   Candida orthopsilosis Co 90-125
gi|213409449|ref|XP_002175495.1| RNA-binding post-transcriptiona...   151   3e-34   Schizosaccharomyces japonicus yFS275
gi|149246387|ref|XP_001527663.1| hypothetical protein LELG_00183...   151   4e-34   Lodderomyces elongisporus NRRL YB-4239
gi|320593824|gb|EFX06227.1| r3h domain protein [Grosmannia clavi...   151   4e-34   Grosmannia clavigera kw1407
gi|126140076|ref|XP_001386560.1| hypothetical protein PICST_6853...   150   9e-34   Scheffersomyces stipitis CBS 6054
gi|326483162|gb|EGE07172.1| hypothetical protein TEQG_06159 [Tri...   150   9e-34   Trichophyton equinum CBS 127.97
gi|385302604|gb|EIF46728.1| r3h domain-containing protein [Dekke...   149   2e-33   Brettanomyces bruxellensis AWRI1499
gi|320582732|gb|EFW96949.1| hypothetical protein HPODL_1659 [Oga...   148   3e-33   
gi|409046266|gb|EKM55746.1| hypothetical protein PHACADRAFT_5373...   147   7e-33   Phanerochaete carnosa HHB-10118-sp
gi|346324277|gb|EGX93874.1| R3H domain protein [Cordyceps milita...   144   5e-32   Cordyceps militaris CM01
gi|146420080|ref|XP_001485998.1| hypothetical protein PGUG_01669...   143   1e-31   Meyerozyma guilliermondii ATCC 6260
gi|190345648|gb|EDK37571.2| hypothetical protein PGUG_01669 [Mey...   140   5e-31   Meyerozyma guilliermondii ATCC 6260
gi|366997765|ref|XP_003683619.1| hypothetical protein TPHA_0A010...   139   1e-30   Tetrapisispora phaffii CBS 4417
gi|19113563|ref|NP_596771.1| RNA-binding protein Cip1 [Schizosac...   139   1e-30   Schizosaccharomyces pombe 972h-
gi|401840506|gb|EJT43303.1| PIN4-like protein [Saccharomyces kud...   137   7e-30   Saccharomyces kudriavzevii IFO 1802
gi|365762148|gb|EHN03754.1| Pin4p [Saccharomyces cerevisiae x Sa...   137   8e-30   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|384483868|gb|EIE76048.1| hypothetical protein RO3G_00752 [Rhi...   136   1e-29   Rhizopus delemar RA 99-880
gi|259144796|emb|CAY77735.1| Pin4p [Saccharomyces cerevisiae EC1...   135   3e-29   Saccharomyces cerevisiae EC1118
gi|349576329|dbj|GAA21500.1| K7_Pin4p [Saccharomyces cerevisiae ...   135   3e-29   Saccharomyces cerevisiae Kyokai no. 7
gi|392301164|gb|EIW12253.1| Pin4p [Saccharomyces cerevisiae CEN....   135   3e-29   Saccharomyces cerevisiae CEN.PK113-7D
gi|6319420|ref|NP_009502.1| Pin4p [Saccharomyces cerevisiae S288...   135   3e-29   Saccharomyces cerevisiae S288c
gi|365981491|ref|XP_003667579.1| hypothetical protein NDAI_0A017...   135   3e-29   Naumovozyma dairenensis CBS 421
gi|151946344|gb|EDN64566.1| protein involved in G2/M phase progr...   135   3e-29   Saccharomyces cerevisiae YJM789
gi|401626707|gb|EJS44632.1| pin4p [Saccharomyces arboricola H-6]      135   3e-29   Saccharomyces arboricola H-6
gi|190408876|gb|EDV12141.1| hypothetical protein SCRG_03014 [Sac...   134   3e-29   Saccharomyces cerevisiae RM11-1a
gi|256272727|gb|EEU07700.1| Pin4p [Saccharomyces cerevisiae JAY291]   134   3e-29   Saccharomyces cerevisiae JAY291
gi|501302947|dbj|GAC92492.1| hypothetical protein PHSY_000045 [P...   134   4e-29   Pseudozyma hubeiensis SY62
gi|403164952|ref|XP_003324997.2| hypothetical protein PGTG_06534...   134   4e-29   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|156841836|ref|XP_001644289.1| hypothetical protein Kpol_1030p...   133   1e-28   Vanderwaltozyma polyspora DSM 70294
gi|513031453|gb|AGO11477.1| AaceriACR235Wp [Saccharomycetaceae s...   132   1e-28   Saccharomycetaceae sp. 'Ashbya aceri'
gi|45185921|ref|NP_983637.1| ACR235Wp [Ashbya gossypii ATCC 1089...   132   1e-28   Eremothecium gossypii ATCC 10895
gi|366989193|ref|XP_003674364.1| hypothetical protein NCAS_0A142...   132   2e-28   Naumovozyma castellii CBS 4309
gi|255722443|ref|XP_002546156.1| predicted protein [Candida trop...   132   2e-28   Candida tropicalis MYA-3404
gi|164657424|ref|XP_001729838.1| hypothetical protein MGL_2824 [...   131   3e-28   Malassezia globosa CBS 7966
gi|459371117|gb|EMG49008.1| hypothetical protein G210_0323, part...   131   3e-28   Candida maltosa Xu316
gi|255711438|ref|XP_002552002.1| KLTH0B04950p [Lachancea thermot...   131   4e-28   Lachancea thermotolerans CBS 6340
gi|50285043|ref|XP_444950.1| hypothetical protein [Candida glabr...   130   5e-28   Candida glabrata CBS 138
gi|50309675|ref|XP_454849.1| hypothetical protein [Kluyveromyces...   130   7e-28   Kluyveromyces lactis NRRL Y-1140
gi|68475166|ref|XP_718301.1| hypothetical protein CaO19.10069 [C...   130   8e-28   Candida albicans SC5314
gi|68475359|ref|XP_718202.1| hypothetical protein CaO19.2534 [Ca...   130   8e-28   Candida albicans SC5314
gi|406607166|emb|CCH41427.1| Polyadenylate-binding protein, cyto...   130   8e-28   Wickerhamomyces ciferrii
gi|238879631|gb|EEQ43269.1| predicted protein [Candida albicans ...   130   1e-27   Candida albicans WO-1
gi|241958046|ref|XP_002421742.1| RNA-binding protein, putative; ...   130   1e-27   Candida dubliniensis CD36
gi|471894780|emb|CCO31444.1| RNA-binding post-transcriptional re...   129   1e-27   Rhizoctonia solani AG-1 IB
gi|443925376|gb|ELU44229.1| RRM/R3H domain-containing protein [R...   129   1e-27   Rhizoctonia solani AG-1 IA
gi|393245724|gb|EJD53234.1| hypothetical protein AURDEDRAFT_1109...   128   3e-27   Auricularia subglabra TFB-10046 SS5
gi|444314831|ref|XP_004178073.1| hypothetical protein TBLA_0A076...   128   3e-27   Tetrapisispora blattae CBS 6284
gi|50550803|ref|XP_502874.1| YALI0D15752p [Yarrowia lipolytica] ...   127   5e-27   Yarrowia lipolytica CLIB122
gi|367011553|ref|XP_003680277.1| hypothetical protein TDEL_0C017...   127   6e-27   Torulaspora delbrueckii
gi|254578186|ref|XP_002495079.1| ZYRO0B02860p [Zygosaccharomyces...   127   7e-27   Zygosaccharomyces rouxii CBS 732
gi|410084657|ref|XP_003959905.1| hypothetical protein KAFR_0L016...   127   9e-27   Kazachstania africana CBS 2517
gi|50290079|ref|XP_447471.1| hypothetical protein [Candida glabr...   126   1e-26   Candida glabrata CBS 138
gi|363752651|ref|XP_003646542.1| hypothetical protein Ecym_4705 ...   126   1e-26   Eremothecium cymbalariae DBVPG#7215
gi|367001793|ref|XP_003685631.1| hypothetical protein TPHA_0E010...   124   4e-26   Tetrapisispora phaffii CBS 4417
gi|170094186|ref|XP_001878314.1| predicted protein [Laccaria bic...   124   8e-26   Laccaria bicolor S238N-H82
gi|156839391|ref|XP_001643387.1| hypothetical protein Kpol_479p1...   123   8e-26   Vanderwaltozyma polyspora DSM 70294
gi|336367805|gb|EGN96149.1| hypothetical protein SERLA73DRAFT_18...   123   9e-26   Serpula lacrymans var. lacrymans S7.3
gi|343424857|emb|CBQ68395.1| conserved hypothetical protein [Spo...   123   1e-25   Sporisorium reilianum SRZ2
gi|443896833|dbj|GAC74176.1| mRNA cleavage and polyadenylation f...   122   2e-25   Moesziomyces antarcticus T-34
gi|403214190|emb|CCK68691.1| hypothetical protein KNAG_0B02500 [...   122   3e-25   Kazachstania naganishii CBS 8797
gi|388855760|emb|CCF50544.1| uncharacterized protein [Ustilago h...   120   7e-25   Ustilago hordei
gi|71019375|ref|XP_759918.1| hypothetical protein UM03771.1 [Ust...   119   2e-24   
gi|402218448|gb|EJT98525.1| hypothetical protein DACRYDRAFT_2454...   115   2e-23   Dacryopinax primogenitus
gi|169853603|ref|XP_001833481.1| RRM/R3H domain-containing prote...   115   3e-23   Coprinopsis cinerea okayama7#130
gi|353237623|emb|CCA69592.1| hypothetical protein PIIN_03531 [Pi...   114   6e-23   Serendipita indica DSM 11827
gi|512200881|gb|EPE29713.1| RNA-binding, RBD [Glarea lozoyensis ...   114   8e-23   Glarea lozoyensis ATCC 20868
gi|449547697|gb|EMD38665.1| hypothetical protein CERSUDRAFT_1138...   112   2e-22   Gelatoporia subvermispora B
gi|395330072|gb|EJF62456.1| hypothetical protein DICSQDRAFT_5818...   112   2e-22   Dichomitus squalens LYAD-421 SS1
gi|392596031|gb|EIW85354.1| hypothetical protein CONPUDRAFT_1181...   112   3e-22   Coniophora puteana RWD-64-598 SS2
gi|389741327|gb|EIM82516.1| hypothetical protein STEHIDRAFT_1030...   111   4e-22   Stereum hirsutum FP-91666 SS1
gi|403417139|emb|CCM03839.1| predicted protein [Fibroporia radic...   110   8e-22   Fibroporia radiculosa
gi|342319827|gb|EGU11773.1| Hypothetical Protein RTG_02241 [Rhod...   106   1e-20   Rhodotorula toruloides ATCC 204091
gi|472583709|gb|EMS21333.1| RRM/R3H domain containing protein [R...   105   2e-20   Rhodotorula toruloides NP11
gi|465795920|emb|CCV00352.1| unnamed protein product [Malassezia...   104   5e-20   Malassezia sympodialis ATCC 42132
gi|323338781|gb|EGA79996.1| Pin4p [Saccharomyces cerevisiae Vin13]    103   1e-19   Saccharomyces cerevisiae Vin13
gi|66808135|ref|XP_637790.1| hypothetical protein DDB_G0286331 [...    80   1e-12   Dictyostelium discoideum AX4
gi|238611803|ref|XP_002398060.1| hypothetical protein MPER_01403...    80   2e-12   
gi|330800378|ref|XP_003288214.1| hypothetical protein DICPUDRAFT...    79   4e-12   Dictyostelium purpureum
gi|281207962|gb|EFA82140.1| hypothetical protein PPL_04560 [Poly...    77   9e-12   Polysphondylium pallidum PN500


>gi|511003292|gb|EPB84699.1| hypothetical protein HMPREF1544_08572 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 366

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 171/332 (51%), Gaps = 83/332 (25%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPFS+K+DALL+ L ++D+P  YAFNYHFDNGVFRGLAFANY+TPE+T+
Sbjct: 61  QIIPTAIVIKNIPFSVKKDALLSKLASMDVPAAYAFNYHFDNGVFRGLAFANYKTPEETE 120

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
           +VV+ +NG E+ GRKLRVEYK++LP                          ++    ND 
Sbjct: 121 IVVNTINGLEIGGRKLRVEYKKMLPN-------------------------MMDTNTND- 154

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAP------------------DQLDLNDPETLKFY 228
                        N K++RD++   P                    D LDLNDP  L+ Y
Sbjct: 155 -------------NRKKERDASSSQPGSPLQTERRLPNNNNNNSDDDTLDLNDPNVLELY 201

Query: 229 DQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASA 288
             +++FR D +  E+   KTLS+  RR   LIA +L L +Y+EG G D+ + I ++ +  
Sbjct: 202 SFLLLFRGDPNSTEIALPKTLSAKERRDAHLIADRLGLAHYSEGFGADRQVLIEKRGSVP 261

Query: 289 AINIKQTPRNGSFGKRXXXXXXXXXXXXXXPSNR--SIRGDASPLSRSPFRRSWLNDGGT 346
           A  ++   +N                    PS    ++ G+  P  R  +R+S ++   T
Sbjct: 262 APIVRLQHKNS------------RGTLKSSPSRERLNMAGNNDPNKRDSYRKSMMSTSTT 309

Query: 347 I------------VFPIRQPRGPDPSQNFAYR 366
                        + PIRQPRGP+P +NFA R
Sbjct: 310 AEVLSSSNTNSSIIHPIRQPRGPEPGKNFASR 341



>gi|477520510|gb|ENH72636.1| RNA-binding post-transcriptional regulator cip2 [Fusarium oxysporum
           f. sp. cubense race 1]
          Length = 617

 Score =  187 bits (475), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 141/223 (63%), Gaps = 3/223 (1%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ ED
Sbjct: 166 ADQLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAED 225

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDN 184
           T +V+ A+NG +V GRKLRVEYK++LP                  +E+     L  ++  
Sbjct: 226 TRMVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPMLHQQSSI 285

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSPA---PDQLDLNDPETLKFYDQVIIFRDDKSRE 241
             L      ++    +      S ++SPA   P  +DLNDP+TL+FY ++++FR D++RE
Sbjct: 286 QSLGSLSQSQARGPSHLGMLEASRVQSPALTMPGDVDLNDPQTLEFYTELVMFRRDEARE 345

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
            LVF   ++  HRR++ ++A  + L + + GDGE + L ++++
Sbjct: 346 VLVFPAGIAPEHRRSIHILAHNMGLEHQSVGDGESRQLTVLKR 388



>gi|342871442|gb|EGU74039.1| hypothetical protein FOXB_15429 [Fusarium oxysporum Fo5176]
          Length = 624

 Score =  187 bits (475), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 141/223 (63%), Gaps = 3/223 (1%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ ED
Sbjct: 173 ADQLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAED 232

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDN 184
           T +V+ A+NG +V GRKLRVEYK++LP                  +E+     L  ++  
Sbjct: 233 TRMVIEAMNGMDVHGRKLRVEYKKMLPDAERERIEREKRERRGQLEEQHRAPMLHQQSSI 292

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSPA---PDQLDLNDPETLKFYDQVIIFRDDKSRE 241
             L      ++    +      S ++SPA   P  +DLNDP+TL+FY ++++FR D++RE
Sbjct: 293 QSLGSLSQSQARGPSHLGMLEASRVQSPALTMPGDVDLNDPQTLEFYTELVMFRRDEARE 352

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
            LVF   ++  HRR++ ++A  + L + + GDGE + L ++++
Sbjct: 353 VLVFPAGIAPEHRRSIHILAHNMGLEHQSVGDGESRQLTVLKR 395



>gi|296415532|ref|XP_002837440.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633312|emb|CAZ81631.1| unnamed protein product [Tuber melanosporum]
          Length = 564

 Score =  187 bits (474), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 15/240 (6%)

Query: 53  SAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFR 112
           S  ++++  S+  +E IPTAIVIKNIPF+IK++ L+  +  L +P PYAFNYHFDNGVFR
Sbjct: 144 SPMRTETVGSDPEEELIPTAIVIKNIPFAIKKEQLVQLMTELGLPLPYAFNYHFDNGVFR 203

Query: 113 GLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK 172
           GLAFAN+ T E+T  V+  LN YE+ GRKLRVEYK++LP                  +E+
Sbjct: 204 GLAFANFTTAEETAAVIDTLNHYELQGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ 263

Query: 173 VDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVI 232
               P+ +      L +P I  S +      +         PD +DLNDP+TL+FY Q++
Sbjct: 264 --HRPVQMP-----LSQPNIPLSTSPSPSATRSK-------PD-VDLNDPQTLQFYSQLL 308

Query: 233 IFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINI 292
           +FRDD SRE L+F  TLS   RR +  +A  + L + + G+G+ + + + R P S   +I
Sbjct: 309 LFRDDVSREALIFPATLSPQQRRIVHTLAHHMALAHVSRGNGDQRQVHVFRAPISTTPSI 368



>gi|505755386|gb|EOQ99603.1| RNA-binding post-transcriptional regulator cip2 [Wallemia
           ichthyophaga EXF-994]
          Length = 521

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 148/254 (58%), Gaps = 37/254 (14%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG------VFRGLA 115
           SN   E IP A+VIKNIPFS+ +D LL+ ++ L+IP PYAFNYH+D         FRGLA
Sbjct: 6   SNTLDEIIPNAVVIKNIPFSLPKDQLLSIIHDLNIPTPYAFNYHYDTSNPSNDPAFRGLA 65

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+RT  D   +V+ALNG++V GRKLRVEYK+VL                  DKE++++
Sbjct: 66  FANFRTSHDASAIVAALNGFDVLGRKLRVEYKKVL---------------HPQDKERIER 110

Query: 176 EPLLIKTDNDFLDKP-------KIDKSDNGRNDK--EKRDSTIKSP--APDQLDLNDPET 224
           +  L +  +  ++ P         D S     D     RDS    P     +LDLNDP T
Sbjct: 111 DKALRRMASLGINNPLPFNPPDSFDDSPTNVFDSVLSDRDSQASPPTMCHAELDLNDPST 170

Query: 225 LKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           L+ Y ++++F++D+ R++L FSK L+ + RR + L+AQ+L +Y+Y+ G G+D+ + + R 
Sbjct: 171 LEIYSRILVFKEDRMRDDLAFSKNLTMSQRRIVHLVAQRLSVYHYSIGQGDDRFVIVSRN 230

Query: 285 PASAAINIKQTPRN 298
           P         TPRN
Sbjct: 231 PPEPP-----TPRN 239



>gi|46109494|ref|XP_381805.1| hypothetical protein FG01629.1 [Fusarium graminearum PH-1]
          Length = 622

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 146/241 (60%), Gaps = 14/241 (5%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ ED
Sbjct: 174 ADQLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAED 233

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLL----- 179
           T +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+L     
Sbjct: 234 TRMVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPMLHQQSS 292

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPA---PDQLDLNDPETLKFYDQVIIFRD 236
           I++            S  G  D  +    ++SP+   P  +DLNDP+TL+FY ++++FR 
Sbjct: 293 IQSLGSLSQSQARGPSHLGMLDASR----VQSPSISMPGDVDLNDPQTLEFYTELVMFRR 348

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQT 295
           D SRE LVF   ++  HRR++ ++A  + L + + G+ E + L ++ R+  S   NI   
Sbjct: 349 DDSREVLVFPPGIAPEHRRSIHILAHNMGLEHQSMGEAESRQLTVLKRQQPSPTTNIHSQ 408

Query: 296 P 296
           P
Sbjct: 409 P 409



>gi|171683814|ref|XP_001906849.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941867|emb|CAP67520.1| unnamed protein product [Podospora anserina S mat+]
          Length = 602

 Score =  183 bits (465), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 140/228 (61%), Gaps = 14/228 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L + ++ L +P+PYAFNYHFDNG+FRGLAFAN+++P DT  V
Sbjct: 193 IPTAIVIKNIPFNVRKEMLTSIMSDLGLPQPYAFNYHFDNGIFRGLAFANFQSPLDTQTV 252

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           +  LNGYEV GRKLRVEYK++LP                  +E+   +PL ++  +    
Sbjct: 253 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPLTLQHQSSM-- 308

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKT 248
                 S N  +    R S ++      +DLN+P+TL+FY ++ +FR+D +RE LVF  T
Sbjct: 309 -----HSLNAAHSTRSRTSPLR-----DVDLNNPDTLQFYTELTLFRNDPNREILVFPST 358

Query: 249 LSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINIKQTP 296
           ++   RRT+ ++A  + L + + G+G  + L ++++ A  A  +   P
Sbjct: 359 ITPHQRRTVHILAHNMGLEHRSVGEGPQRQLHVLKESAPPASLVHNLP 406



>gi|408393550|gb|EKJ72812.1| hypothetical protein FPSE_06998 [Fusarium pseudograminearum CS3096]
          Length = 714

 Score =  183 bits (465), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 146/241 (60%), Gaps = 14/241 (5%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ ED
Sbjct: 174 ADQLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAED 233

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLL----- 179
           T +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+L     
Sbjct: 234 TRMVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPMLHQQSS 292

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPA---PDQLDLNDPETLKFYDQVIIFRD 236
           I++            S  G  D  +    ++SP+   P  +DLNDP+TL+FY ++++FR 
Sbjct: 293 IQSLGSLSQSQARGPSHLGMLDASR----VQSPSISMPGDVDLNDPQTLEFYTELVMFRR 348

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQT 295
           D SRE LVF   ++  HRR++ ++A  + L + + G+ E + L ++ R+  S   NI   
Sbjct: 349 DDSREVLVFPPGIAPEHRRSIHILAHNMGLEHQSMGEAESRQLTVLKRQQPSPTTNIHSQ 408

Query: 296 P 296
           P
Sbjct: 409 P 409



>gi|388579109|gb|EIM19437.1| hypothetical protein WALSEDRAFT_61444 [Wallemia sebi CBS 633.66]
          Length = 528

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 143/245 (58%), Gaps = 42/245 (17%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG------VFRGLAFAN 118
            +E IP A+VIKNIPFS+ +D LL  ++ L+IP PYAFNYH+D         FRGLAFAN
Sbjct: 37  GEEIIPNAVVIKNIPFSLPKDQLLNIIHDLNIPTPYAFNYHYDTSNPTSDPAFRGLAFAN 96

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           +RT  D   +V+ALNG++V GRKLRVEYK+VL                  DKE++++E  
Sbjct: 97  FRTSHDASAIVAALNGFDVLGRKLRVEYKKVL---------------HPEDKERIEREKA 141

Query: 179 L------------------IKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLN 220
           L                   ++ ++F D P +  S     D +    T++     +LDLN
Sbjct: 142 LRRMASLGINNNNTSTASPFQSSDNFTDSPNLYDSVLSDRDSQASPPTMRH---AELDLN 198

Query: 221 DPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLR 280
           DP TL+ Y ++++F++D+ R++L FSK L+ + RR + L+AQ+L +Y+Y+ G  E++ + 
Sbjct: 199 DPSTLEIYSRILVFKEDRMRDDLAFSKNLTISQRRIVHLVAQRLSVYHYSIGQAEERFVV 258

Query: 281 IVRKP 285
           + R P
Sbjct: 259 VSRNP 263



>gi|367053930|ref|XP_003657343.1| hypothetical protein THITE_2122924 [Thielavia terrestris NRRL 8126]
 gi|347004609|gb|AEO71007.1| hypothetical protein THITE_2122924 [Thielavia terrestris NRRL 8126]
          Length = 617

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/234 (37%), Positives = 146/234 (62%), Gaps = 14/234 (5%)

Query: 60  EASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           EA     + IPTAIVIKNIPF+++++ L + ++ L +P+PYAFNYHFDNG+FRGLAFAN+
Sbjct: 180 EAKPLGNDLIPTAIVIKNIPFNVRKEMLTSIMSELGLPQPYAFNYHFDNGIFRGLAFANF 239

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLL 179
           ++P DT  V+  LNGYEV GRKLRVEYK++LP                  +E+   +P+ 
Sbjct: 240 QSPIDTQTVIEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPMT 297

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKS 239
           + + +       +   +   +    R+S ++      +DLNDP+TL FY ++++F++D S
Sbjct: 298 LHSQS------SMHSLNTAAHTSRSRNSPLR-----DVDLNDPDTLSFYTELMLFKNDPS 346

Query: 240 REELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASA-AINI 292
           RE +VF  T++   RRT+ ++A  + L + + G+G+ + + +++   +A AI++
Sbjct: 347 REIIVFPSTITPQQRRTVHILAHNMGLEHRSVGEGQHRQIHVIKDTGAAPAIHM 400



>gi|405119379|gb|AFR94152.1| cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
          Length = 755

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 138/249 (55%), Gaps = 46/249 (18%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF++ R+ LL  + +L  P PYAFNYH DNGVFRGLAFAN+R P++  
Sbjct: 177 DVIPTAIVIKNIPFAVTRETLLGVMESLGAPLPYAFNYHHDNGVFRGLAFANFRAPDEAA 236

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQE---------- 176
            VV+ALNGY+V GRKLRVEYK+VL                  +K+K+++E          
Sbjct: 237 SVVAALNGYDVQGRKLRVEYKKVL---------------QPGEKDKIEREKALKRMRSLQ 281

Query: 177 --------PLLI-------KTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLND 221
                   PL +        T   +   P    S    N   + D+      P  LD+ND
Sbjct: 282 FDRKEMPPPLTLPIRHQQPPTLAGYDQSPPHSASAASTNSNSQGDNL-----PSTLDMND 336

Query: 222 PETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI 281
           P TL  Y +V++F++D+ R+EL FSK LS   RR + L+AQKL L     GD E++ + +
Sbjct: 337 PMTLDIYSRVLVFKEDRMRDELAFSKNLSPTERRIVHLVAQKLGLTSVTRGD-EEQCVVV 395

Query: 282 VRKPASAAI 290
            R+P   A+
Sbjct: 396 TREPQHPAL 404



>gi|116200313|ref|XP_001225968.1| hypothetical protein CHGG_08312 [Chaetomium globosum CBS 148.51]
 gi|88179591|gb|EAQ87059.1| hypothetical protein CHGG_08312 [Chaetomium globosum CBS 148.51]
          Length = 638

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 147/249 (59%), Gaps = 25/249 (10%)

Query: 60  EASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           EA     + IPTAIVIKNIPF+++++ L   ++ L +P+PYAFNYHFDNG+FRGLAFAN+
Sbjct: 180 EAKALGNDLIPTAIVIKNIPFNVRKEMLTTIMSELGLPQPYAFNYHFDNGIFRGLAFANF 239

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLL 179
           + P DT  V+  LNGYEV GRKLRVEYK++LP                  +E+   +P+ 
Sbjct: 240 QNPVDTQTVIEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPIT 297

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKRDSTI-KSP--------------APDQLDLNDPET 224
           + + +          S N  +    R+S + KSP              AP  +DLN+P+T
Sbjct: 298 LHSQSSM-------HSLNAAHTSRTRNSPLRKSPAEAPARSAAANPHAAPGDVDLNNPDT 350

Query: 225 LKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           L FY ++++F+ D SRE +VF  T++   RRT+ ++A  + L + + G+G+ + + +++ 
Sbjct: 351 LSFYTELMLFKSDPSREIIVFPSTITPQQRRTVHILAHNMGLEHRSVGEGQHRQIHVIKD 410

Query: 285 PASA-AINI 292
             +A AI++
Sbjct: 411 SGAAPAIHM 419



>gi|134117425|ref|XP_772606.1| hypothetical protein CNBK3100 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255223|gb|EAL17959.1| hypothetical protein CNBK3100 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 718

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 139/249 (55%), Gaps = 46/249 (18%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF++ R+ LL  + +L  P PYAFNYH DNGVFRGLAFAN+R P++  
Sbjct: 156 DVIPTAIVIKNIPFAVTRETLLGVMESLGAPLPYAFNYHHDNGVFRGLAFANFRAPDEAA 215

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQE---------- 176
            VV+ALNGY+V GRKLRVEYK+VL                  +K+K+++E          
Sbjct: 216 SVVAALNGYDVQGRKLRVEYKKVL---------------QPGEKDKIEREKALKRMRSLQ 260

Query: 177 --------PLLIKTDND-------FLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLND 221
                   PL + T +        +   P    S    N   + DS      P  LD+ND
Sbjct: 261 FDRKEMPPPLTLPTRHQQPPTLAGYDQSPPHSASAASTNSNSQADSL-----PSTLDMND 315

Query: 222 PETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI 281
           P TL  Y +V++F++D+ R+EL FSK LS   RR + L+AQ+L L     G+ E++ + +
Sbjct: 316 PMTLDIYSRVLVFKEDRMRDELAFSKNLSPTERRIVHLVAQRLGLTSVTRGE-EEQCVVV 374

Query: 282 VRKPASAAI 290
            R+P   A+
Sbjct: 375 TREPQRPAL 383



>gi|321264293|ref|XP_003196864.1| cytoplasm protein [Cryptococcus gattii WM276]
 gi|317463341|gb|ADV25077.1| Cytoplasm protein, putative [Cryptococcus gattii WM276]
          Length = 748

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 140/244 (57%), Gaps = 36/244 (14%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF++ R+ LL  + +L  P PYAFNYH DNGVFRGLAFAN+R P++  
Sbjct: 177 DVIPTAIVIKNIPFAVSRETLLGVMESLGAPLPYAFNYHHDNGVFRGLAFANFRAPDEAA 236

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            VV+ALNGY+V GRKLRVEYK+VL                  +K+K+++E  L +  +  
Sbjct: 237 SVVAALNGYDVQGRKLRVEYKKVL---------------QPGEKDKIEREKALKRMRSLQ 281

Query: 187 LDKPKI-------------------DKSDNGRNDKEKRDSTIKS-PAPDQLDLNDPETLK 226
            D+ K+                   D S          +S  +S   P  LD+NDP TL 
Sbjct: 282 FDRKKMPPPLTLPIRHQQPPALAGYDHSPPHSASAASTNSNSQSDNLPSALDMNDPMTLD 341

Query: 227 FYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPA 286
            Y +V++F++D+ R+EL FSK LS   RR + L+AQKL L     G+ E++ + + R+P 
Sbjct: 342 IYSRVLVFKEDRMRDELAFSKNLSPTERRIVHLVAQKLGLTSVTRGE-EEQCVVVTREPQ 400

Query: 287 SAAI 290
             A+
Sbjct: 401 RPAL 404



>gi|58260384|ref|XP_567602.1| cytoplasm protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|57229683|gb|AAW46085.1| cytoplasm protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 712

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 139/249 (55%), Gaps = 46/249 (18%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF++ R+ LL  + +L  P PYAFNYH DNGVFRGLAFAN+R P++  
Sbjct: 152 DVIPTAIVIKNIPFAVTRETLLGVMESLGAPLPYAFNYHHDNGVFRGLAFANFRAPDEAA 211

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQE---------- 176
            VV+ALNGY+V GRKLRVEYK+VL                  +K+K+++E          
Sbjct: 212 SVVAALNGYDVQGRKLRVEYKKVL---------------QPGEKDKIEREKALKRMRSLQ 256

Query: 177 --------PLLIKTDN-------DFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLND 221
                   PL + T +        +   P    S    N   + DS      P  LD+ND
Sbjct: 257 FDRKEMPPPLTLPTRHQQPPTLAGYDQSPPHSASAASTNSNSQADSL-----PSTLDMND 311

Query: 222 PETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI 281
           P TL  Y +V++F++D+ R+EL FSK LS   RR + L+AQ+L L     G+ E++ + +
Sbjct: 312 PMTLDIYSRVLVFKEDRMRDELAFSKNLSPTERRIVHLVAQRLGLTSVTRGE-EEQCVVV 370

Query: 282 VRKPASAAI 290
            R+P   A+
Sbjct: 371 TREPQRPAL 379



>gi|401883686|gb|EJT47882.1| hypothetical protein A1Q1_03228 [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406702459|gb|EKD05475.1| hypothetical protein A1Q2_00236 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 590

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 138/252 (54%), Gaps = 50/252 (19%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF++ R+ LLA + +L  P PYAFNYH DNGVFRGLAFAN+R PE+  
Sbjct: 169 DVIPTAIVIKNIPFAVSRETLLAIIESLGAPLPYAFNYHHDNGVFRGLAFANFRAPEEAA 228

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            VV+ALNGY+V GRKLRVEYK+VL                  +K+++++E  + +  +  
Sbjct: 229 SVVAALNGYDVQGRKLRVEYKKVL---------------QPGEKDRIEREKAIKRMKSMQ 273

Query: 187 LDKPKI-----------------------------------DKSDNGRNDKEKRDSTIKS 211
           LD  K                                    D S++ R+  +   S    
Sbjct: 274 LDSVKTPIEPSHAHNNAHNNSHGNSHNNMQRNGHHQQVSYGDSSNDDRSPTQSSGSNKSD 333

Query: 212 PAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNE 271
             P  LDLNDP TL  Y+ V +F++D+ R+ELV S+ LS   RR + L+AQKL L    +
Sbjct: 334 TLPVSLDLNDPATLSIYNMVYMFKEDRMRDELVLSRNLSPTERRIVHLVAQKLSLTSVTK 393

Query: 272 GDGEDKVLRIVR 283
           GDG+ K + + +
Sbjct: 394 GDGDAKHVVVTK 405



>gi|336468708|gb|EGO56871.1| hypothetical protein NEUTE1DRAFT_84419 [Neurospora tetrasperma FGSC
           2508]
 gi|350289013|gb|EGZ70238.1| hypothetical protein NEUTE2DRAFT_112836 [Neurospora tetrasperma
           FGSC 2509]
          Length = 645

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 141/230 (61%), Gaps = 11/230 (4%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L   +  L +P+PYAFNYHFDNG+FRGLAFAN+++P DT  V
Sbjct: 191 IPTAIVIKNIPFNVRKEMLTQIMTDLGLPQPYAFNYHFDNGIFRGLAFANFQSPLDTQTV 250

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF-- 186
           +  LNGYEV GRKLRVEYK++LP                  +E+   +P+ + + +    
Sbjct: 251 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPIALHSQSSMHS 308

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ------LDLNDPETLKFYDQVIIFRDDKSR 240
           L+     +S N    K  R   +  P  +Q      +DLN+PETLKFY ++ +FR+D +R
Sbjct: 309 LNAAHTSRSRNSPLRKSSRRDLLP-PNSNQDDVTGDVDLNNPETLKFYTELTLFRNDPNR 367

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           E ++F  +++   RRT+ ++A  + L + + G+G  + L +++  A+A +
Sbjct: 368 EIIIFPASITPQQRRTVHILAHNMGLEHRSVGEGPTRQLHVIKDTATATL 417



>gi|393216626|gb|EJD02116.1| hypothetical protein FOMMEDRAFT_124369 [Fomitiporia mediterranea
           MF3/22]
          Length = 553

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 146/267 (54%), Gaps = 36/267 (13%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R P+D 
Sbjct: 132 EIIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDAQGAFRGLAFANFRQPQDA 191

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXX----XXXXXXXXXXXXDKEKVDQEPLLIK 181
           D VV+ALNG++V GRKLRVEYK+VL                      +KE+   +   + 
Sbjct: 192 DAVVAALNGFDVQGRKLRVEYKKVLQAGEKERIEREKALRRMRSMQLEKEQQAMQQQQVP 251

Query: 182 TDNDF-------LDKPKIDKS--DNGRNDKEKRDSTIKSPAP------------------ 214
           + NDF          P+   S   N    +E     +  P P                  
Sbjct: 252 SLNDFGAVGGGMYGTPRSVSSPYTNPYQHQENNSPPMPVPQPYGVGSPVAPPPPTTPSTR 311

Query: 215 ---DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNE 271
              ++LDLND  TL+ Y ++++F+DD  R+EL FS+TLS   RR + L+AQKL +++Y+ 
Sbjct: 312 GSSNELDLNDASTLEIYSRILLFKDDPMRDELAFSRTLSPKQRRVVHLVAQKLGVFHYSV 371

Query: 272 GDGEDKVLRIVR-KPASAAINIKQTPR 297
           G+GE++   + R  P     N++  PR
Sbjct: 372 GEGEERYAVVTRIDPERVNHNMQAEPR 398



>gi|28881338|emb|CAD70341.1| conserved hypothetical protein [Neurospora crassa]
          Length = 667

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 142/234 (60%), Gaps = 11/234 (4%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
             + IPTAIVIKNIPF+++++ L   +  L +P+PYAFNYHFDNG+FRGLAFAN+++P D
Sbjct: 220 GSDLIPTAIVIKNIPFNVRKEMLTQIMTDLGLPQPYAFNYHFDNGIFRGLAFANFQSPLD 279

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDN 184
           T  V+  LNGYEV GRKLRVEYK++LP                  +E+   +P+ + + +
Sbjct: 280 TQTVIEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPIALHSQS 337

Query: 185 DF--LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ------LDLNDPETLKFYDQVIIFRD 236
               L+     +S N    K  R   +  P  +Q      +DLN+PETLKFY ++ +FR+
Sbjct: 338 SMHSLNAAHTSRSRNSPLRKSSRRDLLP-PNSNQDDVTGDVDLNNPETLKFYTELTLFRN 396

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           D +RE ++F  +++   RRT+ ++A  + L + + G+G  + L +++  A+A +
Sbjct: 397 DPNREIIIFPASITPQQRRTVHILAHNMGLEHRSVGEGPTRQLHVIKDTATATL 450



>gi|85068315|ref|XP_963334.1| hypothetical protein NCU05343 [Neurospora crassa OR74A]
 gi|28925011|gb|EAA34098.1| hypothetical protein NCU05343 [Neurospora crassa OR74A]
          Length = 645

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 141/230 (61%), Gaps = 11/230 (4%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L   +  L +P+PYAFNYHFDNG+FRGLAFAN+++P DT  V
Sbjct: 191 IPTAIVIKNIPFNVRKEMLTQIMTDLGLPQPYAFNYHFDNGIFRGLAFANFQSPLDTQTV 250

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF-- 186
           +  LNGYEV GRKLRVEYK++LP                  +E+   +P+ + + +    
Sbjct: 251 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPIALHSQSSMHS 308

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ------LDLNDPETLKFYDQVIIFRDDKSR 240
           L+     +S N    K  R   +  P  +Q      +DLN+PETLKFY ++ +FR+D +R
Sbjct: 309 LNAAHTSRSRNSPLRKSSRRDLLP-PNSNQDDVTGDVDLNNPETLKFYTELTLFRNDPNR 367

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           E ++F  +++   RRT+ ++A  + L + + G+G  + L +++  A+A +
Sbjct: 368 EIIIFPASITPQQRRTVHILAHNMGLEHRSVGEGPTRQLHVIKDTATATL 417



>gi|367034492|ref|XP_003666528.1| hypothetical protein MYCTH_2311279 [Myceliophthora thermophila ATCC
           42464]
 gi|347013801|gb|AEO61283.1| hypothetical protein MYCTH_2311279 [Myceliophthora thermophila ATCC
           42464]
          Length = 618

 Score =  181 bits (459), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 142/225 (63%), Gaps = 15/225 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L + ++ L +P+PYAFNYHFDNG+FRGLAFAN+++P DT  V
Sbjct: 189 IPTAIVIKNIPFNVRKEMLTSIMSELGLPQPYAFNYHFDNGIFRGLAFANFQSPIDTQTV 248

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           +  LNGYEV GRKLRVEYK++LP                  +E+    PL  ++    L+
Sbjct: 249 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQHQPLPLHSQSSMHSLN 308

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKT 248
             +  +S N             SP  D +DLN+P+TL FY ++++F++D +RE +VF  T
Sbjct: 309 AAQTSRSRN-------------SPLRD-VDLNNPDTLSFYTELMLFKNDPNREIIVFPST 354

Query: 249 LSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASA-AINI 292
           ++   RRT+ ++A  + L + + G+G+ + + +++   +A AI++
Sbjct: 355 ITPQQRRTVHILAHNMGLEHRSVGEGQHRQIHVLKDTGAAPAIHM 399



>gi|336263802|ref|XP_003346680.1| hypothetical protein SMAC_04113 [Sordaria macrospora k-hell]
 gi|380091386|emb|CCC10882.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 642

 Score =  181 bits (459), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 141/230 (61%), Gaps = 11/230 (4%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L   +  L +P+PYAFNYHFDNG+FRGLAFAN+++P DT  V
Sbjct: 188 IPTAIVIKNIPFNVRKEMLTQIMTDLGLPQPYAFNYHFDNGIFRGLAFANFQSPLDTQTV 247

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF-- 186
           +  LNGYEV GRKLRVEYK++LP                  +E+   +P+ + + +    
Sbjct: 248 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPIALHSQSSMHS 305

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ------LDLNDPETLKFYDQVIIFRDDKSR 240
           L+     +S N    K  R   +  P  +Q      +DLN+PETLKFY ++ +FR+D +R
Sbjct: 306 LNAAHTSRSRNSPLRKSSRRDLLP-PNSNQDDVTGDVDLNNPETLKFYTELTLFRNDPNR 364

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           E ++F  +++   RRT+ ++A  + L + + G+G  + L +++  A+A +
Sbjct: 365 EIIIFPASITPQQRRTVHILAHNMGLEHRSVGEGPTRQLHVIKDTATATL 414



>gi|310795683|gb|EFQ31144.1| R3H domain-containing protein [Glomerella graminicola M1.001]
          Length = 580

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/224 (39%), Positives = 135/224 (60%), Gaps = 24/224 (10%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+++++ L A +  + +P+PYAFNYHFDNGVFRGLAFAN+++PEDT
Sbjct: 158 EQLIPTAIVIKNIPFAVRKETLAAVMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSPEDT 217

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK-----VDQEPLLI 180
            +V+ A+NG EV GRKLRVEYK++LP                  +E+     + Q+P L 
Sbjct: 218 KIVIDAMNGMEVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPMLHQQPSL- 276

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSR 240
           +T N     P                   + P    +DLNDPETL+FY ++ +F+ D SR
Sbjct: 277 QTLNSVSSNPP------------------RGPLDGDIDLNDPETLEFYTELTLFKRDTSR 318

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           E L+F  T++   RR + ++A  + L + + G+ E + + +V++
Sbjct: 319 EILIFPSTIAPEQRRRIHILAHHMGLEHSSVGEAESRQIHVVKR 362



>gi|380489902|emb|CCF36387.1| R3H domain-containing protein [Colletotrichum higginsianum]
          Length = 597

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/224 (39%), Positives = 135/224 (60%), Gaps = 24/224 (10%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+++++ L A +  + +P+PYAFNYHFDNGVFRGLAFAN+++PEDT
Sbjct: 158 EQLIPTAIVIKNIPFAVRKETLAAVMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSPEDT 217

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK-----VDQEPLLI 180
            +V+ A+NG EV GRKLRVEYK++LP                  +E+     + Q+P L 
Sbjct: 218 KIVIDAMNGMEVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPMLHQQPSL- 276

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSR 240
           +T N     P                   + P    +DLNDPETL+FY ++ +F+ D SR
Sbjct: 277 QTLNSVSSNPP------------------RGPLEGDIDLNDPETLEFYTELTLFKRDTSR 318

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           E L+F  T++   RR + ++A  + L + + G+ E + + +V++
Sbjct: 319 EILIFPSTVAPEQRRRIHILAHHMGLEHNSVGEAESRQIHVVKR 362



>gi|392567458|gb|EIW60633.1| hypothetical protein TRAVEDRAFT_165582 [Trametes versicolor
           FP-101664 SS1]
          Length = 536

 Score =  180 bits (457), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 146/269 (54%), Gaps = 65/269 (24%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTP 122
           G  E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D +G FRGLAFAN+R  
Sbjct: 128 GDDEVIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDQSGQFRGLAFANFRQS 187

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
            D D VV+ALNG++V GRKLRVEYK+VL                  +KE++++E  + + 
Sbjct: 188 VDADAVVAALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKAIRRM 232

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDST---------------------------------- 208
            +  L+K +      G +D     ST                                  
Sbjct: 233 RSMQLEKEQQQMQQGGYDDYGTVLSTPFTPQRSFSASNVYQSSQYSPPQMPPLPTSQSFT 292

Query: 209 --------------IKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHR 254
                         IKSP+  +LDLNDP TL+ Y ++++F+DD  R+EL FS+TLS   R
Sbjct: 293 VASPPLPSVSPGAGIKSPS-TELDLNDPSTLEIYSRILLFKDDPMRDELAFSRTLSPKQR 351

Query: 255 RTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           R + L+AQKL +Y+Y+ G+G+++   + R
Sbjct: 352 RVVHLVAQKLGVYHYSVGEGDERYAVVTR 380



>gi|302413487|ref|XP_003004576.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
 gi|261357152|gb|EEY19580.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
          Length = 650

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 140/230 (60%), Gaps = 11/230 (4%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
            Q D     G ++ IPTAIVIKNIPF+++R+ L   +  + +P+PYAFNYHFDNGVFRGL
Sbjct: 154 GQHDMRGGPGEEQLIPTAIVIKNIPFAVRRETLAGLMLEMHLPQPYAFNYHFDNGVFRGL 213

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD 174
           AFAN+ +P+DT +V+ A+NG +V GRKLRVEYK++LP                  +E+  
Sbjct: 214 AFANFSSPDDTKIVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-H 272

Query: 175 QEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIF 234
           + P+L +       +P +  + N  N+ + R     S A   ++LNDPETL+FY ++ +F
Sbjct: 273 RAPMLHQ-------QPSV-STLNSMNNGQSRGGA--STALGDVNLNDPETLEFYTELTLF 322

Query: 235 RDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           + D +RE L+F  T++   RR + ++A  + L + + GD + + + + ++
Sbjct: 323 KQDNNREILIFPSTVAPEQRRQIHILAHHMGLEHRSVGDADSRQIHVQKR 372



>gi|302907092|ref|XP_003049570.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256730506|gb|EEU43857.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 614

 Score =  179 bits (454), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 145/236 (61%), Gaps = 15/236 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ EDT 
Sbjct: 175 QLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAEDTR 234

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
           +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+L +     
Sbjct: 235 MVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPMLHQ----- 288

Query: 187 LDKPKIDKSDNGRNDKEKRDSTI-----KSPAPDQLDLNDPETLKFYDQVIIFRDDKSRE 241
             +  I         +++R  +      KS A D +DLNDP+TL+FY ++++FR D SRE
Sbjct: 289 --QSSIQSLGGLSQTQQQRGGSATSHLGKSKAGD-IDLNDPQTLEFYTELVMFRRDDSRE 345

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTP 296
            LVF   ++  HRR++ ++A  + L + + G+ + + L ++ R+  S   NI Q P
Sbjct: 346 ILVFPPGIAPEHRRSIHILAHHMGLEHQSIGEADSRQLTVLKRQQPSPTANIHQQP 401



>gi|346973012|gb|EGY16464.1| RNA-binding post-transcriptional regulator cip2 [Verticillium
           dahliae VdLs.17]
          Length = 601

 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 140/230 (60%), Gaps = 11/230 (4%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
            Q D     G ++ IPTAIVIKNIPF+++R+ L   +  + +P+PYAFNYHFDNGVFRGL
Sbjct: 153 GQHDMRGGPGEEQLIPTAIVIKNIPFAVRRETLAGLMLEMHLPQPYAFNYHFDNGVFRGL 212

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD 174
           AFAN+ +P+DT +V+ A+NG +V GRKLRVEYK++LP                  +E+  
Sbjct: 213 AFANFSSPDDTKIVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-H 271

Query: 175 QEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIF 234
           + P+L +       +P +  + N  N+ + R     S A   ++LNDPETL+FY ++ +F
Sbjct: 272 RAPMLHQ-------QPSV-STLNSMNNGQSRGGA--STALGDVNLNDPETLEFYTELTLF 321

Query: 235 RDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           + D +RE L+F  T++   RR + ++A  + L + + GD + + + + ++
Sbjct: 322 KQDNNREILIFPSTVAPEQRRQIHILAHHMGLEHRSVGDADSRQIHVQKR 371



>gi|494830022|gb|EON66591.1| hypothetical protein W97_05837 [Coniosporium apollinis CBS 100218]
          Length = 601

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 135/223 (60%), Gaps = 6/223 (2%)

Query: 61  ASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYR 120
            S+  ++ IPTAIVIKNIPF++K++ L+  + ++ +P PYAFNYHFDNGVFRGLAFAN+ 
Sbjct: 145 GSDADEDLIPTAIVIKNIPFAVKKEQLVDLMTSMRLPLPYAFNYHFDNGVFRGLAFANFT 204

Query: 121 TPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLI 180
           TPE+T +V+ ++N  E+ GRKLRVEYK++LP                  +E+    P+  
Sbjct: 205 TPEETAVVIDSMNHLELQGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ--HRPM-- 260

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSR 240
              +    +P +    +          + ++  P+ LDLNDP+TL+FY Q+++FR+D SR
Sbjct: 261 -AGSQLHAQPSMSSLSSHMPATSPSPVSARNIKPE-LDLNDPQTLQFYSQLLLFREDHSR 318

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           + L F  TLS A RR +  IA +  L + + G G+ + + I R
Sbjct: 319 DVLAFPATLSPAQRRIVHTIAHQFNLLHMSRGSGDQRAVHIYR 361



>gi|328859605|gb|EGG08714.1| hypothetical protein MELLADRAFT_115949 [Melampsora larici-populina
           98AG31]
          Length = 571

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/280 (37%), Positives = 156/280 (55%), Gaps = 50/280 (17%)

Query: 43  SKLWYEKTTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAF 102
           S L    T NS+    S  S+   E IPTAIVIKNIPFS++R+ LLA L+ L IP PYAF
Sbjct: 211 SSLGTPLTGNSSLVPGSAESD--DEVIPTAIVIKNIPFSVRREQLLAILDDLMIPAPYAF 268

Query: 103 NYHFDNGVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXX 162
           NYHFDNGVFRGLAFAN+R+  + D  V+ LNG+++ GRKLRVEYK+VL            
Sbjct: 269 NYHFDNGVFRGLAFANFRSASEADAAVAGLNGFDITGRKLRVEYKKVL------------ 316

Query: 163 XXXXXXDKEKVDQEPLLIKTDNDFLDK------------PKIDKSDNGRNDKEKRDSTIK 210
                 +KE++++E  + +  +  L K            P        + D E       
Sbjct: 317 ---QAGEKERIEKEKAIKRMRSMQLQKETVFDPYHHQQAPMPSSFAYHQQDSEPNQMLPT 373

Query: 211 SP-APD-------------------QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLS 250
            P  P+                   +LD+NDP+TL+ + +++IF++D  R+E  F+K+L+
Sbjct: 374 RPFVPEFLQQPPPSQSQSLQSSVAKELDMNDPQTLELFSRIVIFKEDNFRDEFAFAKSLT 433

Query: 251 SAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           S  RR +  IA+KL+L + +EG G+++ + +V KP+  A+
Sbjct: 434 SIQRRIVHQIAKKLELEHRSEGVGDERFV-VVSKPSKNAL 472



>gi|358060227|dbj|GAA93981.1| hypothetical protein E5Q_00628 [Mixia osmundae IAM 14324]
          Length = 862

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 142/241 (58%), Gaps = 19/241 (7%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRT 121
            N  ++TIPTAIVIKNIPF +++D LL  +  L++P PYAFNYH+D G+FRGLAFAN++T
Sbjct: 478 GNAPEDTIPTAIVIKNIPFQVEKDVLLQIMEELELPAPYAFNYHYDGGIFRGLAFANFKT 537

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXX-------------XXXXXXXXXXXXX 168
           P +TD  V+ALNG+++ GRKLRVEYK+VL                               
Sbjct: 538 PAETDACVAALNGFDIHGRKLRVEYKKVLQAGEKERIERDKAMKRMRSMQLEKERERFTR 597

Query: 169 DKEKVDQEPLL----IKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD--QLDLNDP 222
           D+++  Q P +     + ++   +   I  +   +       S I  P  +  +LDLNDP
Sbjct: 598 DRQESWQTPAMEYRPSQGESGIANPWSILDTGAQQMPASPGGSDIGLPGSEVRELDLNDP 657

Query: 223 ETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV 282
           +TL+ Y +V+ F+DD  R+EL F+++L    RRT+ L+AQ+L L + + G G+++ + ++
Sbjct: 658 QTLQIYSRVLSFKDDALRDELAFARSLQPLQRRTVHLVAQRLGLNHQSVGLGDERYVVVM 717

Query: 283 R 283
           +
Sbjct: 718 K 718



>gi|340514314|gb|EGR44578.1| predicted protein [Trichoderma reesei QM6a]
          Length = 615

 Score =  177 bits (450), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 145/241 (60%), Gaps = 14/241 (5%)

Query: 61  ASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYR 120
           A N A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN++
Sbjct: 167 AGNDADQLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQ 226

Query: 121 TPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLI 180
           + +DT LV+ A+NG +V GRKLRVEYK++LP                  +E+  + PLL 
Sbjct: 227 SADDTRLVIDAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPLLH 285

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-----LDLNDPETLKFYDQVIIFR 235
              +         +S +G +  + R ++  +  P       +D+NDP+TL+FY ++ +FR
Sbjct: 286 NQSS--------IQSLSGMSQAQPRTASAAAGPPTSSLLGDIDMNDPQTLEFYTELAMFR 337

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINIKQT 295
            D SRE LVF   ++  HRR + ++A  + L + + G+ + + L ++++   +     QT
Sbjct: 338 RDDSREILVFPPGIAPEHRRCIHILAHHMGLEHQSIGEADSRQLTVLKRQQPSPTANLQT 397

Query: 296 P 296
           P
Sbjct: 398 P 398



>gi|322693592|gb|EFY85447.1| R3H domain protein, putative [Metarhizium acridum CQMa 102]
          Length = 600

 Score =  177 bits (448), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 152/241 (63%), Gaps = 14/241 (5%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFAN 118
           S AS+G Q  IPTAIVIKNIPF+++++ L + +  L++P+PYAFNYHFDNGVFRGLAFAN
Sbjct: 169 STASDGDQ-LIPTAIVIKNIPFAVRKETLASIMLDLNLPQPYAFNYHFDNGVFRGLAFAN 227

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           +++ EDT +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+
Sbjct: 228 FQSAEDTRVVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPI 286

Query: 179 LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDK 238
           L +  +         +S  G +  ++R  T  S   D +DLNDP++L+FY ++++F+ D 
Sbjct: 287 LHQQSS--------IQSLGGMSQTQQR--TPSSHLGD-VDLNDPQSLEFYTELVMFKRDD 335

Query: 239 SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTPR 297
           SRE LVF   +S  HRR++ ++A  + L + + G+ + + + ++ R+  S   NI+  P 
Sbjct: 336 SREILVFPAGISPEHRRSIHILAHHMGLEHQSIGEADSRQITVLKRQQPSPTANIQNIPA 395

Query: 298 N 298
           N
Sbjct: 396 N 396



>gi|341039061|gb|EGS24053.1| hypothetical protein CTHT_0007650 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 631

 Score =  176 bits (447), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 136/228 (59%), Gaps = 14/228 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L   ++ L +P+PYAFNYHFDNGVFRGLAFAN+++  DT  V
Sbjct: 191 IPTAIVIKNIPFNVRKEMLTNIMSELGLPQPYAFNYHFDNGVFRGLAFANFQSALDTQTV 250

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           +  LNGYEV GRKLRVEYK++LP                  +E+   +P+ + + +    
Sbjct: 251 IEQLNGYEVQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ--HQPMSLHSQSSM-- 306

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKT 248
                 S N  +    R+S ++      +DLN+PETL FY ++ +FR D  RE LVF  +
Sbjct: 307 -----HSLNASHASRSRNSPLR-----DVDLNNPETLSFYTELTLFRSDPKREILVFPSS 356

Query: 249 LSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINIKQTP 296
           ++   RR + ++A  + L + + G+G  + + +++  A+   +++  P
Sbjct: 357 MTPQQRRVVHILAHNMGLEHRSVGEGPHRQIHVIKDTAATQSSMRMPP 404



>gi|399168766|emb|CCE30300.1| uncharacterized protein CPUR_04148 [Claviceps purpurea 20.1]
          Length = 613

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 150/241 (62%), Gaps = 14/241 (5%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFAN 118
           S AS+G Q  IPTAIVIKNIPF+++++ L + +  +++P+PYAFNYHFD+GVFRGLAFAN
Sbjct: 169 STASDGDQ-LIPTAIVIKNIPFAVRKETLASIMLEMNLPQPYAFNYHFDSGVFRGLAFAN 227

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           +++ EDT +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+
Sbjct: 228 FQSAEDTRVVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPM 286

Query: 179 LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDK 238
           L +  +         +S    +  ++R   + S     +DLNDP+ L+FY ++++F+ D+
Sbjct: 287 LHQQSS--------IQSLGSLSQSQQR---VPSSHLGDVDLNDPQCLEFYTELVMFKRDE 335

Query: 239 SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTPR 297
           SRE LVFS  +S  HRR++ ++A  + L + + G+ + + L ++ R+  S   NI   P 
Sbjct: 336 SREILVFSPGISPEHRRSIHILAHHMGLEHQSMGEADSRQLTVLKRQHPSPTSNIHNMPG 395

Query: 298 N 298
           N
Sbjct: 396 N 396



>gi|477536043|gb|ENH87528.1| r3h domain-containing protein [Colletotrichum orbiculare MAFF
           240422]
          Length = 596

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 141/231 (61%), Gaps = 14/231 (6%)

Query: 55  AQSDSEASNGAQE-TIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRG 113
            Q D   S+  +E  IPTAIVIKNIPF+++++ L A +  + +P+PYAFNYHFDNGVFRG
Sbjct: 146 GQGDMRPSSQTEERLIPTAIVIKNIPFAVRKETLAAVMMDMHLPQPYAFNYHFDNGVFRG 205

Query: 114 LAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV 173
           LAFAN+++PEDT +V+ A+NG EV GRKLRVEYK++LP                  +E+ 
Sbjct: 206 LAFANFQSPEDTKIVIDAMNGMEVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ- 264

Query: 174 DQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVII 233
            + P+L +       +P +   ++  ++       +       L+LNDPETL++Y ++ +
Sbjct: 265 HRAPMLHQ-------QPSLQTLNSVSSNSNNARGAL-----GDLNLNDPETLEYYTELTL 312

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           F+ D SRE L+F  T++   RR + ++A  + L + + G+ E + + +V++
Sbjct: 313 FKRDPSREILIFPSTIAPEQRRQIHILAHNMGLEHSSVGEAESRQIHVVKR 363



>gi|345560425|gb|EGX43550.1| hypothetical protein AOL_s00215g286 [Arthrobotrys oligospora ATCC
           24927]
          Length = 621

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/227 (40%), Positives = 135/227 (59%), Gaps = 6/227 (2%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  LD+P PYAFNYHFDNGVFRGLAFAN+ T E+T 
Sbjct: 145 ELIPTAIVIKNIPFAVKKEQLVQLMTDLDLPLPYAFNYHFDNGVFRGLAFANFTTAEETA 204

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V++ +N +E+ GRKLRVEYK++LP                  +E+  + P+        
Sbjct: 205 AVINIMNHFELQGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ-HRAPV----GQQQ 259

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-LDLNDPETLKFYDQVIIFRDDKSREELVF 245
                     N       R S+  +  P Q +DLN+P+TL+FY Q+++FRDD +RE L+F
Sbjct: 260 QQLQHQSSMQNLMPSLSPRPSSSSAQTPKQEIDLNNPQTLQFYSQLLLFRDDHTREALIF 319

Query: 246 SKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINI 292
             TLS + RR +  +A  + L + + G GE + +++ R   S+  NI
Sbjct: 320 PPTLSPSQRRIVHTLAHHMSLAHISRGAGETRQVQVYRHNPSSVQNI 366



>gi|429863831|gb|ELA38238.1| r3h domain-containing protein [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 527

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 135/220 (61%), Gaps = 15/220 (6%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+++++ L A +  + +P+PYAFNYHFDNGVFRGLAFAN+++PEDT
Sbjct: 94  EQLIPTAIVIKNIPFAVRKETLAAVMMDMHLPQPYAFNYHFDNGVFRGLAFANFQSPEDT 153

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
            +V+ A+NG EV GRKLRVEYK++LP                  +E+  + P+L +    
Sbjct: 154 KIVIEAMNGMEVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPMLHQ---- 208

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVF 245
              +P +              S     A   ++LNDPETL+FY ++ +F+ D SRE L+F
Sbjct: 209 ---QPSLQT-------LNSMSSNSNRSALGDVNLNDPETLEFYTELTLFKRDSSREILIF 258

Query: 246 SKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKP 285
             ++S   RR + ++A  + L + + G+ + + + I+++P
Sbjct: 259 PASVSPEQRRQIHILAHNMGLEHNSIGEADSRQIHILKRP 298



>gi|400600808|gb|EJP68476.1| R3H domain-containing protein [Beauveria bassiana ARSEF 2860]
          Length = 613

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 143/235 (60%), Gaps = 16/235 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ EDT 
Sbjct: 178 QLIPTAIVIKNIPFAVRKETLASIMLEMHLPQPYAFNYHFDNGVFRGLAFANFQSAEDTR 237

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
           +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+L +  +  
Sbjct: 238 IVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRGPMLHQQSS-- 294

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAP--DQLDLNDPETLKFYDQVIIFRDDKSREELV 244
                  +S    +  ++R     +PA     +DLNDP+TL FY ++++FR D SRE LV
Sbjct: 295 ------IQSLGAMSQSQQRG----NPAGYLGDVDLNDPQTLDFYTELVMFRRDDSREILV 344

Query: 245 FSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR-KPASAAINIKQTPRN 298
           F   ++  HRR++ ++A  + L + + G+ E + L +++ +  S   NI   P N
Sbjct: 345 FPPGIAPEHRRSIHILAHHMGLEHQSMGEAESRQLTVLKSQQPSPTPNIHSAPSN 399



>gi|407916529|gb|EKG09897.1| hypothetical protein MPH_13104 [Macrophomina phaseolina MS6]
          Length = 613

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 137/224 (61%), Gaps = 13/224 (5%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G +E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRGLAFAN+ T E
Sbjct: 171 GDEELIPTAIVIKNIPFAVKKEQLVQLMTDLRLPLPYAFNYHFDNGVFRGLAFANFTTAE 230

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           +T +V+  +N +E+ GRKLRVEYK++LP                  +E+    P+     
Sbjct: 231 ETAVVIETMNHFELQGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ--HRPM---AA 285

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAP-DQLDLNDPETLKFYDQVIIFRDDKSREE 242
           +   ++P +       +          SP+P +++D+NDP+ L+FY Q+++F++D +R+ 
Sbjct: 286 SQLTNQPSL-------SSMSSHVPPATSPSPVNEVDMNDPQVLQFYSQLLLFKEDPNRDV 338

Query: 243 LVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPA 286
           LVF  TL+ + RR    IA ++ L + ++G G+ + + + + PA
Sbjct: 339 LVFPSTLTPSQRRVCHTIAHQMGLSHNSKGMGDQRQVHVYKYPA 382



>gi|358401646|gb|EHK50947.1| hypothetical protein TRIATDRAFT_314109 [Trichoderma atroviride IMI
           206040]
          Length = 615

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 140/227 (61%), Gaps = 15/227 (6%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           N A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ 
Sbjct: 168 NDADQLIPTAIVIKNIPFAVRKETLASIMLDMHLPQPYAFNYHFDNGVFRGLAFANFQSA 227

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           EDT +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+L   
Sbjct: 228 EDTRIVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPILHSQ 286

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAP-----DQLDLNDPETLKFYDQVIIFRDD 237
            +         +S  G +  + R  +  +PA        +DLNDP+TL+FY ++ +FR D
Sbjct: 287 SS--------LQSLGGMSQAQARTPS-AAPASSISHLGDIDLNDPQTLEFYTELAMFRRD 337

Query: 238 KSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
            SRE LVF   ++  HRR++ ++A  + L + + G+ + + L ++++
Sbjct: 338 DSREILVFPPGIAPEHRRSIHILAHHMGLEHQSIGEADSRQLTVLKR 384



>gi|358378481|gb|EHK16163.1| hypothetical protein TRIVIDRAFT_80151 [Trichoderma virens Gv29-8]
          Length = 615

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 141/239 (58%), Gaps = 14/239 (5%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           N A + IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNGVFRGLAFAN+++ 
Sbjct: 169 NDADQLIPTAIVIKNIPFAVRKETLASIMLDMHLPQPYAFNYHFDNGVFRGLAFANFQSA 228

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           EDT +V+ A+NG +V GRKLRVEYK++LP                  +E+  + PLL   
Sbjct: 229 EDTRVVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPLLHNQ 287

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQL----DLNDPETLKFYDQVIIFRDDK 238
            +         +S  G    + R ++        L    D+NDP+TL+FY ++ +FR D 
Sbjct: 288 SS--------LQSLGGMPQSQPRTASAAPAPATSLLGDIDMNDPQTLEFYTELAMFRRDD 339

Query: 239 SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTP 296
           SRE LVF   ++  HRR++ ++A  + L + + G+ + + L ++ R+  S   NI   P
Sbjct: 340 SREILVFPPGIAPEHRRSIHILAHHMGLEHQSIGEADSRQLTVLKRQQPSPTANIHTPP 398



>gi|322703564|gb|EFY95171.1| R3H domain protein, putative [Metarhizium anisopliae ARSEF 23]
          Length = 647

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 148/241 (61%), Gaps = 14/241 (5%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFAN 118
           S AS+G Q  IPTAIVIKNIPF+++++ L + +  L++P+PYAFNYHFDNGVFRGLAFAN
Sbjct: 169 STASDGDQ-LIPTAIVIKNIPFAVRKETLASIMLDLNLPQPYAFNYHFDNGVFRGLAFAN 227

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           +++ EDT +V+ A+NG +V GRKLRVEYK++LP                  +E+  + P+
Sbjct: 228 FQSAEDTRVVIEAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRAPI 286

Query: 179 LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDK 238
           L +  +               +  + +  T  S   D +DLNDP++L+FY ++++F+ D 
Sbjct: 287 LHQQSSIQSLS----------SMSQTQQRTPSSHLGD-VDLNDPQSLEFYTELVMFKRDD 335

Query: 239 SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTPR 297
           SRE LVF   +S  HRR++ ++A  + L + + G+ + + + ++ R+  S   NI+  P 
Sbjct: 336 SREILVFPAGISPEHRRSIHILAHHMGLEHQSIGEADSRQITVLKRQQPSPTANIQNVPA 395

Query: 298 N 298
           N
Sbjct: 396 N 396



>gi|225679170|gb|EEH17454.1| RNA-binding protein Cip2 [Paracoccidioides brasiliensis Pb03]
          Length = 612

 Score =  170 bits (431), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 133/227 (58%), Gaps = 20/227 (8%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E
Sbjct: 156 GDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAE 215

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           +T  V+  LN +E+ GRKLRVEYK++LP                  +E+    P     +
Sbjct: 216 ETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMP-----N 270

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKFYDQVIIFRD 236
           +    +P +    +        +  + SP+P        ++++N+PETLK+Y Q+++F+ 
Sbjct: 271 SQLNSQPSLTSLTS--------NIPVTSPSPVSQRGTELKVNMNEPETLKYYSQLLLFKQ 322

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           D SRE L+FS  LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 323 DSSREALIFSAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|226290879|gb|EEH46307.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18]
          Length = 612

 Score =  170 bits (431), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 133/227 (58%), Gaps = 20/227 (8%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E
Sbjct: 156 GDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAE 215

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           +T  V+  LN +E+ GRKLRVEYK++LP                  +E+    P     +
Sbjct: 216 ETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMP-----N 270

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKFYDQVIIFRD 236
           +    +P +    +        +  + SP+P        ++++N+PETLK+Y Q+++F+ 
Sbjct: 271 SQLNSQPSLTSLTS--------NIPVTSPSPVSQRGTELKVNMNEPETLKYYSQLLLFKQ 322

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           D SRE L+FS  LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 323 DSSREALIFSAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|500252984|gb|EON96742.1| putative rna-binding post-transcriptional regulator cip2 protein
           [Togninia minima UCRPA7]
          Length = 690

 Score =  170 bits (430), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 142/241 (58%), Gaps = 20/241 (8%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L A +  L +P+PYAFNYHFDNGVFRGLAFAN+++P DT +V
Sbjct: 215 IPTAIVIKNIPFNVRKEQLAAMMIDLSLPQPYAFNYHFDNGVFRGLAFANFQSPTDTAIV 274

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFL- 187
           +  +N  EV GRKLRVEYK++LP                  +E+    PL  +T    L 
Sbjct: 275 IERMNQMEVGGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQHRPLPLQHQTSMHSLT 334

Query: 188 ---DKPK--------IDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRD 236
              + P+        + + ++G   +  RD          +DLN+PETL +Y ++ +FR+
Sbjct: 335 GGSNAPQQRTSPMSELFRENSGLGLRTNRDRV------GDIDLNNPETLNYYTELTLFRN 388

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI--NIKQ 294
           D +RE L+F   ++   RR + ++A  + L + + GDG  + + ++++ A+  +  +++Q
Sbjct: 389 DPAREILIFPNDITPEQRRQIHVLAHNMGLEHQSVGDGAHRQIHVMKRAAAPQLPAHLQQ 448

Query: 295 T 295
           T
Sbjct: 449 T 449



>gi|295658103|ref|XP_002789614.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226283167|gb|EEH38733.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 612

 Score =  170 bits (430), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 132/227 (58%), Gaps = 20/227 (8%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E
Sbjct: 156 GDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAE 215

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           +T  V+  LN +E+ GRKLRVEYK++LP                  +E+    P     +
Sbjct: 216 ETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMP-----N 270

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKFYDQVIIFRD 236
           +    +P +    +           + SP+P        ++++N+PETLK+Y Q+++F+ 
Sbjct: 271 SQLNSQPSLTSLTS--------HIPVTSPSPVSQRGTELKVNMNEPETLKYYSQLLLFKQ 322

Query: 237 DKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           D SRE L+FS  LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 323 DSSREALIFSAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|325096738|gb|EGC50048.1| R3H domain-containing protein [Ajellomyces capsulatus H88]
          Length = 604

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 136/229 (59%), Gaps = 14/229 (6%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
           ++S++ +  G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGL
Sbjct: 147 SRSENLSPEGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGL 206

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD 174
           AFAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+  
Sbjct: 207 AFANFTSAEETATVIDVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHR 266

Query: 175 QEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIF 234
             P     ++    +P +                + SP+P+ +++N+PETL++Y Q+++F
Sbjct: 267 PMP-----NSQLNSQPSL--------TSLASHIPVTSPSPE-VNMNEPETLQYYSQLLLF 312

Query: 235 RDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           + D S+E L+F   LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 313 KQDSSKEALIFPAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 361



>gi|212541891|ref|XP_002151100.1| R3H domain protein, putative [Talaromyces marneffei ATCC 18224]
 gi|210066007|gb|EEA20100.1| R3H domain protein, putative [Talaromyces marneffei ATCC 18224]
          Length = 594

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 135/238 (56%), Gaps = 16/238 (6%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFAN 118
           S + +G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN
Sbjct: 134 SSSQDGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFAN 193

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           + + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+    P+
Sbjct: 194 FTSAEETATVIDMLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPI 251

Query: 179 LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-----LDLNDPETLKFYDQVII 233
                       ++    +  +      +T  SP   +     +DLND +TL+FY Q+++
Sbjct: 252 AAS---------QLQTQSSMSSLASHIPATSPSPVSQRGPKLDVDLNDSQTLQFYSQMLL 302

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
           F++D  RE L+F   L+   RRT+  +A  + L + + G GE + + + R P  + ++
Sbjct: 303 FKEDMGREALIFPSNLTPVQRRTVHTLAHNMGLSHASRGTGEQRQVHVFRAPPGSNVS 360



>gi|258571371|ref|XP_002544489.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237904759|gb|EEP79160.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 619

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 130/228 (57%), Gaps = 22/228 (9%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           +G  E IPTAIVIKNIPF++K++ L+  +  + +P PYAFNYHFDNGVFRGLAFAN+ + 
Sbjct: 164 DGDDELIPTAIVIKNIPFAVKKEQLIQLMTEMSLPLPYAFNYHFDNGVFRGLAFANFTSA 223

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           E+T  V+  LN +++ GRKLRVEYK++LP                  +E+          
Sbjct: 224 EETATVIDVLNHFDLNGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ---------- 273

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTI--KSPAP-----DQLDLNDPETLKFYDQVIIFR 235
                 +P        +N      S +   SP+P     + LD+ND +TL+FY Q+++F+
Sbjct: 274 -----HRPMATSQLQNQNSMSSLASHLPAASPSPVSQRQNALDMNDAQTLQFYSQLLLFK 328

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            D +RE L+F+ +L+   RRT+  +A  + L + + G GE + + + R
Sbjct: 329 QDATRESLIFASSLTPLQRRTVHTLAHNMGLGHASRGTGEQRQVHVYR 376



>gi|361131274|gb|EHL02972.1| putative RNA-binding post-transcriptional regulator cip2 [Glarea
           lozoyensis 74030]
          Length = 644

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 134/228 (58%), Gaps = 11/228 (4%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K+++L+A +  +++P PYAFNYHFDNGVFRGLAFAN+ TPE+T 
Sbjct: 174 ELIPTAIVIKNIPFAVKKESLVALMTEMNLPLPYAFNYHFDNGVFRGLAFANFTTPEETS 233

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLI 180
            V+ A+N  ++ GRKLRVEYK++LP                  +E+          PL  
Sbjct: 234 TVIDAMNHMDLQGRKLRVEYKKMLPAHERERIERDKRERRGQLEEQHRPIGNGSAPPLHS 293

Query: 181 KTDNDFLDKPKIDKSDN-----GRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFR 235
           +T  + L    I  S +     G+       S+  + +   +D+NDP TL ++ ++ +F+
Sbjct: 294 QTSMNSLHSSHIPASPSPVQLRGKGGDYHASSSGPTGSIAGVDMNDPSTLGYFTELTVFK 353

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            D +RE LVF  T+S   R+ +  +A  + L + +EG G+ + ++I +
Sbjct: 354 TDSNREILVFPSTVSPHDRKIIHTLAHNMGLEHRSEGAGDSRCVQIFK 401



>gi|242770272|ref|XP_002341945.1| R3H domain protein, putative [Talaromyces stipitatus ATCC 10500]
 gi|218725141|gb|EED24558.1| R3H domain protein, putative [Talaromyces stipitatus ATCC 10500]
          Length = 595

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 136/238 (57%), Gaps = 16/238 (6%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFAN 118
           S + +G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN
Sbjct: 134 SSSQDGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAFAN 193

Query: 119 YRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPL 178
           + + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+    P+
Sbjct: 194 FTSAEETATVIDMLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPI 251

Query: 179 LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-----LDLNDPETLKFYDQVII 233
                       ++    +  +      +T  SP   +     +DLND +TL+FY Q+++
Sbjct: 252 AAS---------QLQTQSSMSSLASHIPATSPSPVSQRGPKLDVDLNDSQTLQFYSQMLL 302

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
           F++D SRE L+F   L+   RRT+  +A  + L + + G G+ + + + R P  + ++
Sbjct: 303 FKEDMSREALIFPSNLTPIQRRTVHTLAHNMGLSHASRGTGDQRQVHVFRAPPGSNVS 360



>gi|19113807|ref|NP_592895.1| RNA-binding protein Cip2 [Schizosaccharomyces pombe 972h-]
 gi|1351627|sp|Q09868.1|CIP2_SCHPO RecName: Full=RNA-binding post-transcriptional regulator cip2;
           AltName: Full=Csx1-interacting protein 2
 gi|1052521|emb|CAA91498.1| RNA-binding protein Cip2 [Schizosaccharomyces pombe]
          Length = 576

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 127/229 (55%), Gaps = 50/229 (21%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +ETIPTAIVIKNIPFS+K++ L      LDIP+PYAFNYHFDNGVFRGLAFAN+ +PE+ 
Sbjct: 227 EETIPTAIVIKNIPFSLKKEVLFKVFTALDIPRPYAFNYHFDNGVFRGLAFANFHSPEEA 286

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
             VV  LNGYE+ GR+LRVE+KR LP                 ++E+V++          
Sbjct: 287 KTVVQVLNGYEITGRRLRVEWKRQLP---------------PAERERVER---------- 321

Query: 186 FLDKPKIDKSDNGRNDK---EKRDSTIKSP-------APDQLDLNDPETLKFYDQVIIF- 234
                       G+ +K   E+R + +KSP       A    DLNDP  L  Y  +++F 
Sbjct: 322 ------------GKQEKRAVEERKNQLKSPFSVANIGAGIDFDLNDPAILNVYSHILLFY 369

Query: 235 -RDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV 282
            R D +  +LVF  + +   RR   L+A +L L +   GDGE K + I 
Sbjct: 370 YRSDNT-NDLVFDSSTTQEERRVAALLASRLNLNHSVTGDGEAKQVVIT 417



>gi|512202213|gb|EPE31041.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868]
          Length = 656

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 134/228 (58%), Gaps = 11/228 (4%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K+++L+A +  +++P PYAFNYHFDNGVFRGLAFAN+ TPE+T 
Sbjct: 174 ELIPTAIVIKNIPFAVKKESLVALMTEMNLPLPYAFNYHFDNGVFRGLAFANFTTPEETS 233

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLI 180
            V+ A+N  ++ GRKLRVEYK++LP                  +E+          PL  
Sbjct: 234 TVIDAMNHMDLQGRKLRVEYKKMLPAHERERIERDKRERRGQLEEQHRPIGNGSAPPLHS 293

Query: 181 KTDNDFLDKPKIDKSDN-----GRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFR 235
           +T  + L    I  S +     G+       S+  + +   +D+NDP TL ++ ++ +F+
Sbjct: 294 QTSMNSLHSSHIPASPSPVQLRGKGGDYHASSSGPTGSIAGVDMNDPSTLGYFTELTVFK 353

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            D +RE LVF  T+S   R+ +  +A  + L + +EG G+ + ++I +
Sbjct: 354 TDSNREILVFPSTVSPHDRKIIHTLAHNMGLEHRSEGAGDSRCVQIFK 401



>gi|430813924|emb|CCJ28772.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 586

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 148/260 (56%), Gaps = 33/260 (12%)

Query: 47  YEKTTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHF 106
           +++ T +  ++ + A +G    IP+AIV+KNIPF IK++ LL   +TLDIPKPYAFNYHF
Sbjct: 232 FQEPTMNTLKTTNRAEDGV---IPSAIVVKNIPFQIKKEQLLELFDTLDIPKPYAFNYHF 288

Query: 107 DNGVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXX 166
           DNG FRGLAFAN+ TPE+T  V+ +LNG+++ GRKLRVEYKRVLP               
Sbjct: 289 DNGNFRGLAFANFYTPEETTRVILSLNGHDIMGRKLRVEYKRVLP--------------- 333

Query: 167 XXDKEKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLK 226
             D+E+  +E            K K  + D   N      +  K      +DLND  TLK
Sbjct: 334 VGDRERPSRE-----------KKEKRTQYDEQNNSNNPGYTKGKGKFKGDIDLNDEATLK 382

Query: 227 FYDQVIIFRDDKS---REELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            Y ++++FR+D+S     E +F   L+   RR + L+A+KL L + + G+ + K + + R
Sbjct: 383 IYSRLLLFRNDQSPNAPNEFIFPPDLNPQQRRIVHLVAEKLDLEHTSCGENDAKYIVVKR 442

Query: 284 KPASAAINIKQTPRNGS-FG 302
             A+   N+ +   N S FG
Sbjct: 443 LNANNIDNMNKNFWNKSDFG 462



>gi|449301688|gb|EMC97699.1| hypothetical protein BAUCODRAFT_463078 [Baudoinia compniacensis
           UAMH 10762]
          Length = 608

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 159/297 (53%), Gaps = 26/297 (8%)

Query: 20  AISRSNSFKLKKADSQRR-KEKRRSKL---WYEKTTN------------SAAQSDSEASN 63
           A S++N+       S RR   K RS L   W ++                + + D+  S 
Sbjct: 79  AFSQNNTMNGLGTSSMRRPHSKGRSGLPSAWLDQPQQMQGNPYMNIGGFGSMRQDTLGSE 138

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
             +E IPTAIVIKNIPF+IK++ L+A +  + +P PYAFNYHFDNGVFRGLAFAN+  PE
Sbjct: 139 PDEELIPTAIVIKNIPFAIKKEQLVAIMTDMGLPLPYAFNYHFDNGVFRGLAFANFTNPE 198

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV-DQEPLLIKT 182
           +T  V+ A+N +E+ GRKLRVEYK++LP                  +E+     P  ++T
Sbjct: 199 ETGAVIDAMNHFELNGRKLRVEYKKMLPAAERERIEREKRERRGQLEEQHRPMAPSTLQT 258

Query: 183 DNDFLD--------KPKIDKSDNGRNDKEKRDSTIKSPA-PDQLDLNDPETLKFYDQVII 233
                          P    + + R +      T +SP   + +D+NDP+TL++Y ++++
Sbjct: 259 QGSISSLSSRLQNHSPSPLSARSMRPNGWVDTPTGESPQIGNDVDMNDPQTLQYYTKLLL 318

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           F++D SRE +V   TLS   RR +  +A  + L + ++G+ + + + + ++ + A +
Sbjct: 319 FKEDPSRELIVLPPTLSPPERRIVHTLAHHMGLGHMSKGEADRRAVHVYKEGSRARV 375



>gi|119182775|ref|XP_001242501.1| hypothetical protein CIMG_06397 [Coccidioides immitis RS]
 gi|392865400|gb|EAS31185.2| R3H domain-containing protein [Coccidioides immitis RS]
          Length = 620

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 130/230 (56%), Gaps = 24/230 (10%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           +G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + 
Sbjct: 162 DGEDELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSA 221

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           E+T  V+  LN +++ GRKLRVEYK++LP                  +E+          
Sbjct: 222 EETATVIEVLNHFDLNGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ---------- 271

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVII 233
                 +P        +N      S +++ +P           LD+ND +TL+FY Q+++
Sbjct: 272 -----HRPIAASQLQNQNSMSSLASHLQTTSPSPVSQRQNALDLDMNDAQTLQFYSQMLL 326

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           F+ D++RE L+F  TL+   RRT+  +A  + L + + G G+ + + + R
Sbjct: 327 FKQDQNRESLIFPSTLTPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 376



>gi|320040843|gb|EFW22776.1| hypothetical protein CPSG_00675 [Coccidioides posadasii str.
           Silveira]
          Length = 620

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 130/230 (56%), Gaps = 24/230 (10%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           +G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + 
Sbjct: 162 DGEDELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSA 221

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           E+T  V+  LN +++ GRKLRVEYK++LP                  +E+          
Sbjct: 222 EETATVIEVLNHFDLNGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ---------- 271

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVII 233
                 +P        +N      S +++ +P           LD+ND +TL+FY Q+++
Sbjct: 272 -----HRPIAASQLQNQNSMSSLASHLQTTSPSPVSQRQNALDLDMNDAQTLQFYSQMLL 326

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           F+ D++RE L+F  TL+   RRT+  +A  + L + + G G+ + + + R
Sbjct: 327 FKQDQNRESLIFPSTLTPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 376



>gi|303319421|ref|XP_003069710.1| R3H domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240109396|gb|EER27565.1| R3H domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 620

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 130/230 (56%), Gaps = 24/230 (10%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTP 122
           +G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + 
Sbjct: 162 DGEDELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSA 221

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           E+T  V+  LN +++ GRKLRVEYK++LP                  +E+          
Sbjct: 222 EETATVIEVLNHFDLNGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ---------- 271

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVII 233
                 +P        +N      S +++ +P           LD+ND +TL+FY Q+++
Sbjct: 272 -----HRPIAASQLQNQNSMSSLASHLQTTSPSPVSQRQNALDLDMNDAQTLQFYSQMLL 326

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           F+ D++RE L+F  TL+   RRT+  +A  + L + + G G+ + + + R
Sbjct: 327 FKQDQNRESLIFPSTLTPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 376



>gi|470317545|gb|EMR09257.1| hypothetical protein PNEG_02591 [Pneumocystis murina B123]
          Length = 586

 Score =  167 bits (422), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/227 (42%), Positives = 134/227 (59%), Gaps = 30/227 (13%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           +P+AIV+KNIPF IK++ LL   +TLDIPKPYAFNYHFDNG FRGLAFAN+ TPE+T  V
Sbjct: 254 LPSAIVVKNIPFQIKKEQLLELFDTLDIPKPYAFNYHFDNGNFRGLAFANFYTPEETTRV 313

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           + +LNG+++ GRKLRVEYKR+LP                 D+EK ++E            
Sbjct: 314 ILSLNGHDIMGRKLRVEYKRILP---------------IADREKANRE-----------K 347

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKS---REELVF 245
           K K ++ +   N         K  + D +DLND  TLK Y ++++FR+D+S     EL+F
Sbjct: 348 KEKRNQYEEQHNSSNPGFFKGKRKSKD-IDLNDEATLKIYSRLLLFRNDQSPNAPNELIF 406

Query: 246 SKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINI 292
               S   RR +  IA+KL L Y + G+ + K + I R  ++   NI
Sbjct: 407 PLDTSLQQRRIIHYIAEKLGLEYTSCGENDAKYIVINRLNSNNTDNI 453



>gi|430813928|emb|CCJ28776.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 461

 Score =  167 bits (422), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 146/257 (56%), Gaps = 32/257 (12%)

Query: 47  YEKTTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHF 106
           +++ T +  ++ + A +G    IP+AIV+KNIPF IK++ LL   +TLDIPKPYAFNYHF
Sbjct: 232 FQEPTMNTLKTTNRAEDGV---IPSAIVVKNIPFQIKKEQLLELFDTLDIPKPYAFNYHF 288

Query: 107 DNGVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXX 166
           DNG FRGLAFAN+ TPE+T  V+ +LNG+++ GRKLRVEYKRVLP               
Sbjct: 289 DNGNFRGLAFANFYTPEETTRVILSLNGHDIMGRKLRVEYKRVLP--------------- 333

Query: 167 XXDKEKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLK 226
             D+E+  +E            K K  + D   N      +  K      +DLND  TLK
Sbjct: 334 VGDRERPSRE-----------KKEKRTQYDEQNNSNNPGYTKGKGKFKGDIDLNDEATLK 382

Query: 227 FYDQVIIFRDDKS---REELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            Y ++++FR+D+S     E +F   L+   RR + L+A+KL L + + G+ + K + + R
Sbjct: 383 IYSRLLLFRNDQSPNAPNEFIFPPDLNPQQRRIVHLVAEKLDLEHTSCGENDAKYIVVKR 442

Query: 284 KPASAAINIKQTPRNGS 300
             A+   N+ +   N S
Sbjct: 443 LNANNIDNMNKNFWNKS 459



>gi|378728567|gb|EHY55026.1| hypothetical protein, variant [Exophiala dermatitidis NIH/UT8656]
          Length = 607

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 139/236 (58%), Gaps = 12/236 (5%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ +P++T+
Sbjct: 163 ELIPTAIVIKNIPFAVKKEQLVQLMVDMNLPLPYAFNYHFDNGVFRGLAFANFTSPQETE 222

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+ ALN  +++GRKLRVEYK++LP                  +E+    P+     ++ 
Sbjct: 223 QVIQALNHMDLSGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ--HRPIPQGQLHN- 279

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFS 246
               ++  S   RN       + +   PD +D+NDP+TL+FY ++ +F+ D SRE L+F 
Sbjct: 280 ----QVSLSSISRNTPSPL--SHRGAKPD-VDMNDPKTLEFYTEMTLFKRDPSREVLIFP 332

Query: 247 KTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINIKQTPRNGSFG 302
            TL   HRR +  +A  + L + + G G+ + + I R  +    N+     +G FG
Sbjct: 333 PTLEPHHRRIVHTLAHHMGLMHTSRGTGDQRQVHIHR--SVPGNNVSPPTLSGGFG 386



>gi|378728568|gb|EHY55027.1| hypothetical protein HMPREF1120_03184 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 608

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 139/236 (58%), Gaps = 12/236 (5%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ +P++T+
Sbjct: 164 ELIPTAIVIKNIPFAVKKEQLVQLMVDMNLPLPYAFNYHFDNGVFRGLAFANFTSPQETE 223

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+ ALN  +++GRKLRVEYK++LP                  +E+    P+     ++ 
Sbjct: 224 QVIQALNHMDLSGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ--HRPIPQGQLHN- 280

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFS 246
               ++  S   RN       + +   PD +D+NDP+TL+FY ++ +F+ D SRE L+F 
Sbjct: 281 ----QVSLSSISRNTPSPL--SHRGAKPD-VDMNDPKTLEFYTEMTLFKRDPSREVLIFP 333

Query: 247 KTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAINIKQTPRNGSFG 302
            TL   HRR +  +A  + L + + G G+ + + I R  +    N+     +G FG
Sbjct: 334 PTLEPHHRRIVHTLAHHMGLMHTSRGTGDQRQVHIHR--SVPGNNVSPPTLSGGFG 387



>gi|213402139|ref|XP_002171842.1| RNA-binding post-transcriptional regulator cip2
           [Schizosaccharomyces japonicus yFS275]
 gi|211999889|gb|EEB05549.1| RNA-binding post-transcriptional regulator cip2
           [Schizosaccharomyces japonicus yFS275]
          Length = 562

 Score =  166 bits (421), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 126/219 (57%), Gaps = 30/219 (13%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +ETIPTAIVIKNIPFS+K++ L      LDIP+PYAFNYHFDNGVFRGLAFAN+ TPE+ 
Sbjct: 233 EETIPTAIVIKNIPFSLKKEVLFKVFTALDIPRPYAFNYHFDNGVFRGLAFANFHTPEEA 292

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
            +VV +LNGYE++GR+LRVE+KR LP                 ++E++++          
Sbjct: 293 RIVVQSLNGYEISGRRLRVEWKRQLP---------------AAERERIER---------- 327

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIF--RDDKSREEL 243
              K +   SD  R   +   S     A   +D+ND  TL  Y  +I+F  R D S  EL
Sbjct: 328 --GKQEKRLSDERRKQMKTMFSVHSLGAGTDIDMNDSATLNLYSHMILFYHRTD-SMNEL 384

Query: 244 VFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV 282
           V    LS+   R  +L+A +L L     G+G D+  ++V
Sbjct: 385 VLGPNLSAEEVRVSKLLASRLGLNCTIRGEGVDEHKQVV 423



>gi|327357381|gb|EGE86238.1| R3H domain-containing protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 612

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 135/234 (57%), Gaps = 20/234 (8%)

Query: 57  SDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAF 116
           S++ +  G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAF
Sbjct: 149 SENLSPEGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAF 208

Query: 117 ANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQE 176
           AN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+    
Sbjct: 209 ANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPM 268

Query: 177 PLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKFYD 229
           P     ++    +P +    +           + SP+P        ++++N+PETL++Y 
Sbjct: 269 P-----NSQLNSQPSLSSLTS--------HIPVTSPSPVSQRGAELKVNMNEPETLQYYS 315

Query: 230 QVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           Q+++F+ D S+E L+F   LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 316 QLLLFKQDSSKEALIFPAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|261200195|ref|XP_002626498.1| R3H domain-containing protein [Ajellomyces dermatitidis SLH14081]
 gi|239593570|gb|EEQ76151.1| R3H domain-containing protein [Ajellomyces dermatitidis SLH14081]
 gi|239607551|gb|EEQ84538.1| R3H domain-containing protein [Ajellomyces dermatitidis ER-3]
          Length = 615

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 135/234 (57%), Gaps = 20/234 (8%)

Query: 57  SDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAF 116
           S++ +  G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAF
Sbjct: 152 SENLSPEGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGLAF 211

Query: 117 ANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQE 176
           AN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+    
Sbjct: 212 ANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPM 271

Query: 177 PLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKFYD 229
           P     ++    +P +    +           + SP+P        ++++N+PETL++Y 
Sbjct: 272 P-----NSQLNSQPSLSSLTS--------HIPVTSPSPVSQRGAELKVNMNEPETLQYYS 318

Query: 230 QVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           Q+++F+ D S+E L+F   LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 319 QLLLFKQDSSKEALIFPAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 372



>gi|119499163|ref|XP_001266339.1| R3H domain protein, putative [Neosartorya fischeri NRRL 181]
 gi|119414503|gb|EAW24442.1| R3H domain protein, putative [Neosartorya fischeri NRRL 181]
          Length = 607

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 129/231 (55%), Gaps = 24/231 (10%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRT 121
           S G  E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ +
Sbjct: 149 SEGEDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTS 208

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIK 181
            E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+         
Sbjct: 209 AEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--------- 259

Query: 182 TDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVI 232
                  +P        ++      S I + +P          ++DLND  TL +Y Q++
Sbjct: 260 ------HRPMAASQLQTQSSMSSLTSHIPATSPSPVSQRGQKLEVDLNDSTTLSYYSQLL 313

Query: 233 IFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           +F++D SR+ ++F  TLS   RRT+  +A  + L + + G GE + +++ +
Sbjct: 314 LFKEDPSRDSVLFPSTLSPIQRRTVHTLAHNMGLGHASRGTGEQRQVQVFK 364



>gi|189189182|ref|XP_001930930.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972536|gb|EDU40035.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 592

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 135/230 (58%), Gaps = 2/230 (0%)

Query: 54  AAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRG 113
           A Q+ S   +  +E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRG
Sbjct: 142 AMQNTSYGHDVDEELIPTAIVIKNIPFAVKKEQLVNLMTELRLPLPYAFNYHFDNGVFRG 201

Query: 114 LAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV 173
           LAFAN+ T E+T  V+ ++N +E+ GRKLRVEYK++LP                  +E+ 
Sbjct: 202 LAFANFTTAEETAAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQH 261

Query: 174 DQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVII 233
                 +++ + F        + +       R S+  +P    +DLNDP+ L FY Q+++
Sbjct: 262 RPLGGGLQSQSSFTSLASHMPATSPSPVSAMRGSS--APKTVDVDLNDPQVLSFYTQLLL 319

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           F++ K R+ + F  TL+   RRT+  +A +L L + ++G G+ + + I +
Sbjct: 320 FKETKDRDSMTFPSTLTPIMRRTIHTLAHQLGLAHISKGTGDQRQVHIFK 369



>gi|169611849|ref|XP_001799342.1| hypothetical protein SNOG_09039 [Phaeosphaeria nodorum SN15]
 gi|160702379|gb|EAT83231.2| hypothetical protein SNOG_09039 [Phaeosphaeria nodorum SN15]
          Length = 610

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 130/223 (58%), Gaps = 15/223 (6%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF++K++ L++ +  L +P PYAFNYHFDNGVFRGLAFAN+ T E+T
Sbjct: 173 EELIPTAIVIKNIPFAVKKEQLVSLMTDLRLPLPYAFNYHFDNGVFRGLAFANFTTAEET 232

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
             V+ A+N +E+ GRKLRVEYK++LP                  +E+       +++   
Sbjct: 233 ASVIDAMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQHRPLGGGLQSQAS 292

Query: 186 FLD-KPKIDKSD----NGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSR 240
           F      I  S     +G     K D          +DLNDP+ L+FY Q++IF++D +R
Sbjct: 293 FGSLASHIPASSPSPVSGMRGAPKID----------VDLNDPQVLQFYGQLLIFKEDPAR 342

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           +++ F   LS   RR +  +A +L L + ++G GE + + I +
Sbjct: 343 DQMTFPPNLSPPQRRIIHTLAHQLALAHVSKGTGEQRQVHIFK 385



>gi|225557256|gb|EEH05542.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
 gi|240280935|gb|EER44438.1| R3H domain-containing protein [Ajellomyces capsulatus H143]
          Length = 612

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 136/236 (57%), Gaps = 20/236 (8%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
           ++S++ +  G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGL
Sbjct: 147 SRSENLSPEGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGL 206

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD 174
           AFAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+  
Sbjct: 207 AFANFTSAEETATVIDVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHR 266

Query: 175 QEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKF 227
             P     ++    +P +                + SP+P        ++++N+PETL++
Sbjct: 267 PMP-----NSQLNSQPSL--------TSLASHIPVTSPSPVSQRGAELKVNMNEPETLQY 313

Query: 228 YDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           Y Q+++F+ D S+E L+F   LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 314 YSQLLLFKQDSSKEALIFPAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|154277194|ref|XP_001539438.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150413023|gb|EDN08406.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 612

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 136/236 (57%), Gaps = 20/236 (8%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
           ++S++ +  G  E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGL
Sbjct: 147 SRSENLSPEGDDELIPTAIVIKNIPFAVKKEQLVQLMTEMNLPLPYAFNYHFDNGVFRGL 206

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD 174
           AFAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+  
Sbjct: 207 AFANFTSAEETATVIDVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHR 266

Query: 175 QEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-------QLDLNDPETLKF 227
             P     ++    +P +                + SP+P        ++++N+PETL++
Sbjct: 267 PMP-----NSQLNSQPSL--------TSLASHIPVTSPSPVSQRGAELKVNMNEPETLQY 313

Query: 228 YDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           Y Q+++F+ D S+E L+F   LS   RRT+  +A  + L + + G G+ + + + R
Sbjct: 314 YSQLLLFKQDSSKEALIFPAKLSPLQRRTVHTLAHNMGLGHASRGTGDQRQVHVFR 369



>gi|471570181|gb|EMR69377.1| putative r3h domain-containing protein [Eutypa lata UCREL1]
          Length = 545

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 131/220 (59%), Gaps = 13/220 (5%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           +++ IPTAIVIKNI F  +++ L   + T+++P+PYAFNYHFD GVFRGLAFAN+ TPED
Sbjct: 141 SEQLIPTAIVIKNIQFQCRKEVLQGLMATMNLPQPYAFNYHFDKGVFRGLAFANFSTPED 200

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDN 184
           T +V+  +NG EV GRKLRVEYK++LP                  +E+  + PL     N
Sbjct: 201 TAVVIQKMNGLEVMGRKLRVEYKKMLPQDERDRIDREKREKRGQLEEQ-HRAPLPAHQQN 259

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELV 244
             L    I  +    N          SP  D +DLNDP TL+FY Q+ +F++D SRE  +
Sbjct: 260 -ALQALGISMNKQASN----------SPLRD-VDLNDPTTLEFYTQLTLFKNDHSREVHI 307

Query: 245 FSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           FS  ++   RR + ++A  + L + + G+ + + ++I+++
Sbjct: 308 FSPDVAPEQRRQIHILAHNMGLEHRSVGEADRRQIQIMKR 347



>gi|452840954|gb|EME42891.1| hypothetical protein DOTSEDRAFT_72359 [Dothistroma septosporum
           NZE10]
          Length = 618

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 134/234 (57%), Gaps = 9/234 (3%)

Query: 60  EASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           E S   +E IPTAIVIKNIPF+IK++ L+  +  + +P PYAFNYHFDNGVFRGLAFAN+
Sbjct: 149 EMSEPDEELIPTAIVIKNIPFAIKKEQLVGIMTDMGLPLPYAFNYHFDNGVFRGLAFANF 208

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQE 176
             PE+T  V+ ++N +E+ GRKLRVEYK++LP                  +E+   +  +
Sbjct: 209 TNPEETATVIDSMNHFELNGRKLRVEYKKMLPAAERERIEREKRERRGQLEEQHRPMAPQ 268

Query: 177 PLLIKTDNDFLDKPKIDKSD---NGRNDKEKRDSTIKSPAPD---QLDLNDPETLKFYDQ 230
            L  +     L    +  S    + RN   +       P P    ++DLNDP  L+ Y +
Sbjct: 269 SLQTQASASSLSSRMMAGSPSPVSARNQTARNGLPSSFPDPSAGVEVDLNDPAALQHYSK 328

Query: 231 VIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           +++F++D SR  LVFS TLS   RR +  +A  + L + ++G+ + + + + ++
Sbjct: 329 LLLFKEDTSRNLLVFSPTLSPPERRIVHTLAHHMGLGHASKGESDRRAVHVFKE 382



>gi|425772723|gb|EKV11118.1| hypothetical protein PDIG_52610 [Penicillium digitatum PHI26]
 gi|425775142|gb|EKV13425.1| hypothetical protein PDIP_47840 [Penicillium digitatum Pd1]
          Length = 582

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 132/229 (57%), Gaps = 15/229 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 132 ELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 191

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 192 TVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPM-------- 241

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-----LDLNDPETLKFYDQVIIFRDDKSRE 241
              P++    +  +      +T  SP   +     +DLND +TL +Y Q+++F++D  R+
Sbjct: 242 GGGPQLQTQSSMSSLTSHIPATSPSPVSQRGQKIDVDLNDTQTLSYYSQLLLFKEDNVRD 301

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
            ++F   L+ + RRT+  +A  + L + + G GE + +++ +  A A +
Sbjct: 302 SVIFPHNLTPSQRRTVHTLAHNMGLGHASRGSGEQRQVQVFKIAAGANV 350



>gi|115443258|ref|XP_001218436.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114188305|gb|EAU30005.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 628

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 146/276 (52%), Gaps = 20/276 (7%)

Query: 17  SDHAISRSN---SFKLKKADSQRRKEKRRSKLWYEKTTNSAAQSD-SEASNGAQETIPTA 72
           S H +SR+N    ++    D Q       S L        A +S+ S  S G  E IPTA
Sbjct: 122 SPHPLSRANVPNDYRQTWLDQQPGIPSPFSNLGPGPLQGGAMRSEPSGTSEGDDELIPTA 181

Query: 73  IVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLVVSAL 132
           IVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T  V+  L
Sbjct: 182 IVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETATVIEVL 241

Query: 133 NGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLDKPKI 192
           N +E+ GRKLRVEYK++LP                  +E+    P+            ++
Sbjct: 242 NHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPIATT---------QL 290

Query: 193 DKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSREELVFSK 247
               +  +      +T  SP        ++DLND  TL +Y Q+++F++D SR+ LVF  
Sbjct: 291 QTQSSMSSLASHLPATSPSPVSQRGQKLEVDLNDSTTLSYYSQLLLFKEDPSRDTLVFPS 350

Query: 248 TLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            LS   RRT+  +A  + L + + G G+ + + + +
Sbjct: 351 NLSPIQRRTVHTLAHNMGLGHASRGSGDQRQVHVFK 386



>gi|70985284|ref|XP_748148.1| R3H domain protein [Aspergillus fumigatus Af293]
 gi|66845776|gb|EAL86110.1| R3H domain protein, putative [Aspergillus fumigatus Af293]
 gi|159125928|gb|EDP51044.1| R3H domain protein, putative [Aspergillus fumigatus A1163]
          Length = 607

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 129/231 (55%), Gaps = 24/231 (10%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRT 121
           S G  E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ +
Sbjct: 149 SEGEDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTS 208

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIK 181
            E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+         
Sbjct: 209 AEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--------- 259

Query: 182 TDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVI 232
                  +P        ++      S I + +P          ++DLND  TL +Y Q++
Sbjct: 260 ------HRPMAASQLQTQSSMSSLTSHIPATSPSPVSQRGQKLEVDLNDSTTLSYYSQLL 313

Query: 233 IFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           +F++D SR+ ++F  TL+   RRT+  +A  + L + + G GE + +++ +
Sbjct: 314 LFKEDPSRDSVLFPPTLTPIQRRTVHTLAHNMGLGHASRGTGEQRQVQVFK 364



>gi|255955429|ref|XP_002568467.1| Pc21g14530 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590178|emb|CAP96350.1| Pc21g14530 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 596

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 132/229 (57%), Gaps = 15/229 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 148 ELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 207

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 208 TVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPM-------- 257

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ-----LDLNDPETLKFYDQVIIFRDDKSRE 241
              P++    +  +      +T  SP   +     +DLND +TL +Y Q+++F++D  R+
Sbjct: 258 GGGPQLQTQSSMSSLTSHIPATSPSPVSQRGQKIDVDLNDTQTLSYYSQLLLFKEDTVRD 317

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
            ++F   L+ + RRT+  +A  + L + + G GE + +++ +  A A +
Sbjct: 318 SVIFPHNLTPSQRRTVHTLAHNMGLGHASRGSGEQRQVQVFKIAAGANV 366



>gi|83768247|dbj|BAE58386.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 597

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 144/265 (54%), Gaps = 28/265 (10%)

Query: 52  NSAAQSDSEASNGAQ-ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGV 110
           +SA + ++ AS+ A  E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGV
Sbjct: 129 SSAMRPEASASSEADDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGV 188

Query: 111 FRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDK 170
           FRGLAFAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +
Sbjct: 189 FRGLAFANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLE 248

Query: 171 EKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETL 225
           E+    P+            ++    +  +      +T  SP        ++DLND  TL
Sbjct: 249 EQ--HRPMATS---------QLQTQSSMSSLTSHLPATSPSPVSQRGQKLEVDLNDSTTL 297

Query: 226 KFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI---- 281
            +Y Q+++F++D SR+ L F   LS   RRT+  +A  + L + + G GE + + +    
Sbjct: 298 SYYSQLLLFKEDTSRDTLCFPSNLSPVQRRTVHTLAHNMGLGHASRGSGEQRQVHVFKVA 357

Query: 282 ----VRKPAS---AAINIKQTPRNG 299
               V  P S   AA+   +T R G
Sbjct: 358 PGTNVSPPLSSIPAAVQPAETARRG 382



>gi|482812767|gb|EOA89486.1| hypothetical protein SETTUDRAFT_105857 [Setosphaeria turcica Et28A]
          Length = 593

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 135/228 (59%), Gaps = 3/228 (1%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           Q++S   +  +E IPTAIVIKNIPF++K++ L++ +  L +P PYAFNYHFDNGVFRGLA
Sbjct: 145 QTNSYGHDVDEELIPTAIVIKNIPFAVKKEQLVSLMTELRLPLPYAFNYHFDNGVFRGLA 204

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+ T E+T  V+ ++N +E+ GRKLRVEYK++LP                  +E+   
Sbjct: 205 FANFTTAEETAAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQHRP 264

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFR 235
               +++   F        + +       R S  K+     +DLNDP++L+FY Q+++F+
Sbjct: 265 LGGGLQSQASFGSLASHMPATSPSPVSAMRGSGQKT---VDVDLNDPQSLQFYTQLLLFK 321

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           + K R+ + F   L+   RRT+  +A +L L + ++G G+ + + I +
Sbjct: 322 ESKDRDSMTFPANLAPLQRRTIHTLAHQLGLAHISKGTGDQRQVHIFK 369



>gi|238485560|ref|XP_002374018.1| R3H domain protein, putative [Aspergillus flavus NRRL3357]
 gi|317144810|ref|XP_001820388.2| R3H domain protein [Aspergillus oryzae RIB40]
 gi|220698897|gb|EED55236.1| R3H domain protein, putative [Aspergillus flavus NRRL3357]
 gi|391874742|gb|EIT83587.1| mRNA cleavage and polyadenylation factor I complex, subunit RNA15
           [Aspergillus oryzae 3.042]
          Length = 605

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 144/265 (54%), Gaps = 28/265 (10%)

Query: 52  NSAAQSDSEASNGAQ-ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGV 110
           +SA + ++ AS+ A  E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGV
Sbjct: 137 SSAMRPEASASSEADDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGV 196

Query: 111 FRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDK 170
           FRGLAFAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +
Sbjct: 197 FRGLAFANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLE 256

Query: 171 EKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETL 225
           E+    P+            ++    +  +      +T  SP        ++DLND  TL
Sbjct: 257 EQ--HRPMATS---------QLQTQSSMSSLTSHLPATSPSPVSQRGQKLEVDLNDSTTL 305

Query: 226 KFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI---- 281
            +Y Q+++F++D SR+ L F   LS   RRT+  +A  + L + + G GE + + +    
Sbjct: 306 SYYSQLLLFKEDTSRDTLCFPSNLSPVQRRTVHTLAHNMGLGHASRGSGEQRQVHVFKVA 365

Query: 282 ----VRKPAS---AAINIKQTPRNG 299
               V  P S   AA+   +T R G
Sbjct: 366 PGTNVSPPLSSIPAAVQPAETARRG 390



>gi|485927467|gb|EOD51473.1| putative r3h domain protein [Neofusicoccum parvum UCRNP2]
          Length = 501

 Score =  164 bits (414), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 129/215 (60%), Gaps = 13/215 (6%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G +E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRGLAFAN+ T E
Sbjct: 170 GDEELIPTAIVIKNIPFAVKKEQLVQLMTDLRLPLPYAFNYHFDNGVFRGLAFANFTTAE 229

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           +T +V+  +N +E+ GRKLRVEYK++LP                  +E+    P+     
Sbjct: 230 ETAVVIETMNHFELQGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ--HRPMAASQ- 286

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAP-DQLDLNDPETLKFYDQVIIFRDDKSREE 242
                     +S    +          SP+P +++D+NDP+ L+FY Q+++F++D +R+ 
Sbjct: 287 ---------LQSQPSLSSMSSHVPPATSPSPVNEVDMNDPQVLQFYSQLLLFKEDPNRDV 337

Query: 243 LVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDK 277
           LVF  TL+ + RR    IA ++ L + ++G G+ +
Sbjct: 338 LVFPSTLTPSQRRVCHTIAHQMGLSHNSKGMGDQR 372



>gi|302690708|ref|XP_003035033.1| hypothetical protein SCHCODRAFT_84454 [Schizophyllum commune H4-8]
 gi|300108729|gb|EFJ00131.1| hypothetical protein SCHCODRAFT_84454 [Schizophyllum commune H4-8]
          Length = 524

 Score =  163 bits (413), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 144/266 (54%), Gaps = 61/266 (22%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTP 122
           G  E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R  
Sbjct: 113 GDDEIIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDQQGSFRGLAFANFRQA 172

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
            D D VV+ALNG++V GRKLRVEYK+VL                  +KE++++E  L + 
Sbjct: 173 ADADAVVAALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKALRRM 217

Query: 183 DNDFLDKPKIDKSDNGRNDK-----EKRDSTIKSP-------AP---------------- 214
            +  + K +      G  D+     + R     SP       AP                
Sbjct: 218 RSMQMQKEETTAPPAGMYDEFGYPTQPRGYGATSPYQQNSYQAPPGMPIPSFNPGLSSPP 277

Query: 215 -----------------DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTL 257
                            ++LDLNDP TL+ Y ++++F+DD  R+EL FS+ L++  RR +
Sbjct: 278 APPQPSVTPSSEKSSSSNELDLNDPATLEIYSRILLFKDDHMRDELAFSRNLTAKQRRIV 337

Query: 258 QLIAQKLQLYYYNEGDGEDKVLRIVR 283
            LIAQKL +++Y+ G+GE++   + R
Sbjct: 338 HLIAQKLGVFHYSVGEGEERYAVVTR 363



>gi|451995861|gb|EMD88328.1| hypothetical protein COCHEDRAFT_1226597 [Bipolaris maydis C5]
 gi|451999651|gb|EMD92113.1| hypothetical protein COCHEDRAFT_1134293 [Bipolaris maydis C5]
 gi|477585316|gb|ENI02404.1| hypothetical protein COCC4DRAFT_174315 [Bipolaris maydis ATCC
           48331]
          Length = 593

 Score =  163 bits (413), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 130/218 (59%), Gaps = 3/218 (1%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF++K++ L++ +  L +P PYAFNYHFDNGVFRGLAFAN+ T E+T
Sbjct: 156 EELIPTAIVIKNIPFAVKKEQLVSLMTELRLPLPYAFNYHFDNGVFRGLAFANFTTAEET 215

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
             V+ ++N +E+ GRKLRVEYK++LP                  +E+       +++   
Sbjct: 216 AAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQHRPLGGGLQSQAS 275

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVF 245
           F        + +       R S  K+     +DLNDP++L+FY Q+++F++ K R+ + F
Sbjct: 276 FGSLASHMPATSPSPVSAMRGSGQKT---VDVDLNDPQSLQFYTQLLLFKESKDRDSMTF 332

Query: 246 SKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
              L+   RRT+  +A +L L + ++G G+ + + I +
Sbjct: 333 PANLAPLQRRTIHTLAHQLGLAHISKGTGDQRQVHIFK 370



>gi|296817479|ref|XP_002849076.1| RNA-binding post-transcriptional regulator cip2 [Arthroderma otae
           CBS 113480]
 gi|238839529|gb|EEQ29191.1| RNA-binding post-transcriptional regulator cip2 [Arthroderma otae
           CBS 113480]
          Length = 617

 Score =  163 bits (412), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 150 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 209

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 210 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 262

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 263 ----QLQHQTSMSSLASHMPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 318

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 319 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 368



>gi|294654600|ref|XP_456659.2| DEHA2A07634p [Debaryomyces hansenii CBS767]
 gi|199429003|emb|CAG84615.2| DEHA2A07634p [Debaryomyces hansenii CBS767]
          Length = 683

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/232 (40%), Positives = 128/232 (55%), Gaps = 20/232 (8%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 165 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 224

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPLLIKTD 183
            VV  LNG E+ GRKLRVEYK++LP                  +E+        L     
Sbjct: 225 SVVGLLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSTSNASLASLLS 284

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPA--------PDQLDLNDPETLKFYDQVIIFR 235
                    + S NG ++ +     I  P+        P +L+LNDPE L+ Y Q+I+FR
Sbjct: 285 AASTTAATKNLSVNGTSNNQTERLFITFPSASGNLPLPPSELNLNDPEILELYSQLILFR 344

Query: 236 DDKSRE--ELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRK 284
           DD ++   EL F  +L  AHR+ L ++   L L   Y+ G      L I+R+
Sbjct: 345 DDMAKSIFELAFPSSLGIAHRKILSILCSYLNLLELYDNG------LIIIRR 390



>gi|358368186|dbj|GAA84803.1| R3H domain protein [Aspergillus kawachii IFO 4308]
          Length = 607

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 139/260 (53%), Gaps = 31/260 (11%)

Query: 60  EASNGAQET----IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           EAS G  E     IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLA
Sbjct: 143 EASGGPSEAEDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLA 202

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+   
Sbjct: 203 FANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--H 260

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQ 230
            P+            ++    +  +      +T  SP        ++DLND  TL +Y Q
Sbjct: 261 RPMATS---------QLQTQSSMSSLTSHLPATSPSPVSQRGQKLEVDLNDSTTLSYYSQ 311

Query: 231 VIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI--------V 282
           +++F++D +R+ LVF   LS   RRT+  +A  + L + + G G+ + + +        V
Sbjct: 312 LLLFKEDTARDTLVFPSNLSPVQRRTVHTLAHNMGLGHASRGSGDQRQVHVFKVAPGTNV 371

Query: 283 RKPAS---AAINIKQTPRNG 299
             P S   AA+   +T R G
Sbjct: 372 SPPLSSIPAAVQPAETARRG 391



>gi|451854569|gb|EMD67862.1| hypothetical protein COCSADRAFT_293939 [Bipolaris sorokiniana
           ND90Pr]
          Length = 593

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 130/218 (59%), Gaps = 3/218 (1%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF++K++ L++ +  L +P PYAFNYHFDNGVFRGLAFAN+ T E+T
Sbjct: 156 EELIPTAIVIKNIPFAVKKEQLVSLMTELRLPLPYAFNYHFDNGVFRGLAFANFTTAEET 215

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
             V+ ++N +E+ GRKLRVEYK++LP                  +E+       +++   
Sbjct: 216 AAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQHRPLGGGLQSQAS 275

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVF 245
           F        + +       R S  K+     +DLNDP++L+FY Q+++F++ K R+ + F
Sbjct: 276 FGSLASHMPATSPSPVSAMRGSGQKT---VDVDLNDPQSLQFYTQLLLFKEAKDRDSMTF 332

Query: 246 SKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
              L+   RRT+  +A +L L + ++G G+ + + I +
Sbjct: 333 PANLAPLQRRTIHTLAHQLGLAHISKGTGDQRQVHIFK 370



>gi|330928747|ref|XP_003302386.1| hypothetical protein PTT_14174 [Pyrenophora teres f. teres 0-1]
 gi|311322302|gb|EFQ89518.1| hypothetical protein PTT_14174 [Pyrenophora teres f. teres 0-1]
          Length = 593

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 133/230 (57%), Gaps = 2/230 (0%)

Query: 54  AAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRG 113
           A Q+ S   +  +E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRG
Sbjct: 143 AMQNPSYGHDVDEELIPTAIVIKNIPFAVKKEQLVNLMTELRLPLPYAFNYHFDNGVFRG 202

Query: 114 LAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV 173
           LAFAN+ T E+T  V+ ++N +E+ GRKLRVEYK++LP                  +E+ 
Sbjct: 203 LAFANFTTAEETAAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQH 262

Query: 174 DQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVII 233
                 +++ + F        + +       R  +  +P    +DLNDP+ L FY Q+ +
Sbjct: 263 RPLGGGLQSQSSFTSLASHMPATSPSPVSAMRGGS--APKTVDVDLNDPQVLSFYTQLAL 320

Query: 234 FRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           F++ K R+ + F  TL+   RRT+  +A +L L + ++G G+ + + I +
Sbjct: 321 FKETKDRDSMTFPSTLTPIMRRTIHTLAHQLGLAHISKGTGDQRQVHIFK 370



>gi|426200340|gb|EKV50264.1| hypothetical protein AGABI2DRAFT_64178 [Agaricus bisporus var.
           bisporus H97]
          Length = 535

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 145/268 (54%), Gaps = 63/268 (23%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRT 121
           N   E IPTAIVIKNIPF++KR+ LL+ + +L IP PYAFNYH D  G FRGLAFAN+R 
Sbjct: 116 NSDDEIIPTAIVIKNIPFNVKRETLLSIIESLSIPTPYAFNYHLDQAGSFRGLAFANFRQ 175

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIK 181
             D D VV+ALNG++V GRKLRVEYK+VL                  +KE++++E  + +
Sbjct: 176 SADADAVVAALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKAIRR 220

Query: 182 TDNDFLDKPKIDKSDNGRNDKEKRDSTIKS---------------------PAP------ 214
             +  L+K +  + +N     E   S I S                     P P      
Sbjct: 221 MRSMQLEK-EAQQQNNLNQLYEDYGSVINSAFNPPHTFSSTYQSQYSPPSMPTPQFNLGM 279

Query: 215 -------------------DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRR 255
                              ++LD+ND  TL+ Y ++++F++D  R+EL FS+TL+   RR
Sbjct: 280 NSAPGIPQPSTTPASDKTTNELDMNDASTLEIYSRILVFKEDPMRDELAFSRTLTPKQRR 339

Query: 256 TLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            + L+AQKL +Y+Y+ G+GE++   + R
Sbjct: 340 VVHLVAQKLGVYHYSIGEGEERYAVVTR 367



>gi|121719293|ref|XP_001276346.1| R3H domain protein, putative [Aspergillus clavatus NRRL 1]
 gi|119404544|gb|EAW14920.1| R3H domain protein, putative [Aspergillus clavatus NRRL 1]
          Length = 607

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 125/226 (55%), Gaps = 24/226 (10%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 154 ELIPTAIVIKNIPFAVKKEQLVQLMTELSLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 213

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+              
Sbjct: 214 TVIDVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ-------------- 259

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFYDQVIIFRDD 237
             +P        ++      S I + +P           +DLND  TL +Y Q+++F++D
Sbjct: 260 -HRPMASSQLQTQSSMSSLTSHIPATSPSPVSQRGQKLDVDLNDSTTLSYYSQLLLFKED 318

Query: 238 KSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            SR+ ++F  TLS   RRT+  +A  + L + + G GE + +++ +
Sbjct: 319 PSRDSVLFPATLSPVQRRTVHTLAHNMGLGHASRGSGEQRQVQVFK 364



>gi|134083035|emb|CAK42797.1| unnamed protein product [Aspergillus niger]
          Length = 615

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/249 (35%), Positives = 138/249 (55%), Gaps = 18/249 (7%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 153 ELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 212

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLL---IKTD 183
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+    ++T 
Sbjct: 213 TVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPMATSQLQTQ 270

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPA--PDQLDLNDPETLKFYDQVIIFRDDKSRE 241
           +          + +     ++    + +P     ++DLND  TL +Y Q+++F++D +R+
Sbjct: 271 SSMSSLTSHLPATSPSPVSQRGQKLVANPCRVSTEVDLNDSTTLSYYSQLLLFKEDTARD 330

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI--------VRKPAS---AAI 290
            LVF   LS   RRT+  +A  + L + + G G+ + + +        V  P S   AA+
Sbjct: 331 TLVFPSNLSPVQRRTVHTLAHNMGLGHASRGSGDQRQVHVFKVAPGTNVSPPLSSIPAAV 390

Query: 291 NIKQTPRNG 299
              +T R G
Sbjct: 391 QPAETARRG 399



>gi|302501931|ref|XP_003012957.1| hypothetical protein ARB_00840 [Arthroderma benhamiae CBS 112371]
 gi|291176518|gb|EFE32317.1| hypothetical protein ARB_00840 [Arthroderma benhamiae CBS 112371]
          Length = 620

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 150 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 209

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 210 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 262

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 263 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 318

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 319 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 368



>gi|326475561|gb|EGD99570.1| R3H domain-containing protein [Trichophyton tonsurans CBS 112818]
          Length = 618

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 149 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 208

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 209 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 261

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 262 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 317

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 318 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 367



>gi|302653313|ref|XP_003018484.1| hypothetical protein TRV_07498 [Trichophyton verrucosum HKI 0517]
 gi|291182134|gb|EFE37839.1| hypothetical protein TRV_07498 [Trichophyton verrucosum HKI 0517]
          Length = 620

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 150 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 209

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 210 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 262

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 263 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 318

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 319 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 368



>gi|327301321|ref|XP_003235353.1| R3H domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326462705|gb|EGD88158.1| R3H domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 620

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 149 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 208

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 209 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 261

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 262 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 317

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 318 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 367



>gi|315049051|ref|XP_003173900.1| hypothetical protein MGYG_04073 [Arthroderma gypseum CBS 118893]
 gi|311341867|gb|EFR01070.1| hypothetical protein MGYG_04073 [Arthroderma gypseum CBS 118893]
          Length = 616

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 16/230 (6%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 150 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 209

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 210 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 262

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 263 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 318

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAIN 291
            L+F   L+ A RR +  I+  + L + + G G+ + + + R    A ++
Sbjct: 319 ALIFGTNLTPAQRRIVHTISHNMGLAHTSRGTGDQRQVHVYRAGPGANVS 368



>gi|409082508|gb|EKM82866.1| hypothetical protein AGABI1DRAFT_111430 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 538

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 144/264 (54%), Gaps = 63/264 (23%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL+ + +L IP PYAFNYH D  G FRGLAFAN+R   D 
Sbjct: 120 EIIPTAIVIKNIPFNVKRETLLSIIESLSIPTPYAFNYHLDQAGSFRGLAFANFRQSADA 179

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
           D VV+ALNG++V GRKLRVEYK+VL                  +KE++++E  + +  + 
Sbjct: 180 DAVVAALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKAIRRMRSM 224

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKS---------------------PAP---------- 214
            L+K +  + +N     E   S I S                     P P          
Sbjct: 225 QLEK-EAQQQNNLNQLYEDYGSVINSAFNPPHTFSSTYQNQYSPPSMPTPQFNLGMNSAP 283

Query: 215 ---------------DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQL 259
                          ++LD+ND  TL+ Y ++++F++D  R+EL FS+TL+   RR + L
Sbjct: 284 GIPQPSTTPASDKTTNELDMNDASTLEIYSRILVFKEDPMRDELAFSRTLTPKQRRVVHL 343

Query: 260 IAQKLQLYYYNEGDGEDKVLRIVR 283
           +AQKL +Y+Y+ G+GE++   + R
Sbjct: 344 VAQKLGVYHYSIGEGEERYAVVTR 367



>gi|452982066|gb|EME81825.1| hypothetical protein MYCFIDRAFT_116428, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 593

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 133/226 (58%), Gaps = 18/226 (7%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF++K++ L+  +  + +P PYAFNYHFDNGVFRGLAFAN+  PE+T
Sbjct: 145 EELIPTAIVIKNIPFAVKKEQLVHIMTEMGLPLPYAFNYHFDNGVFRGLAFANFTNPEET 204

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPLLIKT 182
             V+ A+N +E+ GRKLRVEYK++LP                  +E+   +  + L  + 
Sbjct: 205 ATVIDAMNHFELNGRKLRVEYKKMLPAAERERIEREKRERRGQLEEQHRPMAPQSLQTQA 264

Query: 183 DNDFLDKPKIDKSD----NGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDK 238
               L    ++ S     + RN K           PD +DLNDP  L+ Y ++++F++D 
Sbjct: 265 SASSLSSRVLNASSPSPVSARNHK----------MPD-VDLNDPLVLQHYSKLLLFKEDP 313

Query: 239 SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           +R+ LVF+ TLS   RR +  +A  + L + ++G+ + + + + ++
Sbjct: 314 ARDLLVFAPTLSPPERRIVHTLAHHMGLGHMSKGEADRRAVHVYKE 359



>gi|317036029|ref|XP_001397493.2| R3H domain protein [Aspergillus niger CBS 513.88]
 gi|317036031|ref|XP_003188932.1| R3H domain protein [Aspergillus niger CBS 513.88]
 gi|350633402|gb|EHA21767.1| hypothetical protein ASPNIDRAFT_53682 [Aspergillus niger ATCC 1015]
          Length = 606

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 135/249 (54%), Gaps = 27/249 (10%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 153 ELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 212

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 213 TVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--HRPMATS----- 265

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++DLND  TL +Y Q+++F++D +R+
Sbjct: 266 ----QLQTQSSMSSLTSHLPATSPSPVSQRGQKLEVDLNDSTTLSYYSQLLLFKEDTARD 321

Query: 242 ELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI--------VRKPAS---AAI 290
            LVF   LS   RRT+  +A  + L + + G G+ + + +        V  P S   AA+
Sbjct: 322 TLVFPSNLSPVQRRTVHTLAHNMGLGHASRGSGDQRQVHVFKVAPGTNVSPPLSSIPAAV 381

Query: 291 NIKQTPRNG 299
              +T R G
Sbjct: 382 QPAETARRG 390



>gi|67902102|ref|XP_681307.1| hypothetical protein AN8038.2 [Aspergillus nidulans FGSC A4]
 gi|40740470|gb|EAA59660.1| hypothetical protein AN8038.2 [Aspergillus nidulans FGSC A4]
 gi|259480790|tpe|CBF73754.1| TPA: R3H domain protein, putative (AFU_orthologue; AFUA_5G01940)
           [Aspergillus nidulans FGSC A4]
          Length = 602

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 139/262 (53%), Gaps = 35/262 (13%)

Query: 58  DSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFA 117
           D+  S    E IPTAIVIKNIPF++K++ L+  +  L++P PYAFNYHFDNGVFRGLAFA
Sbjct: 140 DAGPSEADDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFA 199

Query: 118 NYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEP 177
           N+ + E+T  V+  LN +E+ GRKLRVEYK++LP                  +E+     
Sbjct: 200 NFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ----- 254

Query: 178 LLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPD---------QLDLNDPETLKFY 228
                      +P        ++      S I + +P          ++DLND +TL +Y
Sbjct: 255 ----------HRPMAASQLQTQSSMSSLTSHIPATSPSPVSQRGQKLEVDLNDSQTLSYY 304

Query: 229 DQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI------- 281
            Q+++F++D SR+ ++F   L+   RRT+  +A  + L + + G G+ + +++       
Sbjct: 305 SQLLLFKEDTSRDSIIFPPNLTPVQRRTVHTLAHNMGLGHASRGTGDQRQVQVFKVAPGT 364

Query: 282 -VRKPAS---AAINIKQTPRNG 299
            V  P S   AA+   +T R G
Sbjct: 365 NVSPPLSAIPAAVQPTETARRG 386



>gi|472243329|gb|EMR87986.1| putative r3h domain protein [Botryotinia fuckeliana BcDW1]
          Length = 630

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 140/247 (56%), Gaps = 17/247 (6%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           QSD E      E IPTAIVIKNIPF++K++ L   ++ + +P PYAFNYHFDNGVFRGLA
Sbjct: 160 QSDHE------ELIPTAIVIKNIPFAVKKEQLTEMMSNMGLPLPYAFNYHFDNGVFRGLA 213

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+    +T  V+ ALN  ++ GRKLRVEYK++LP                  +E+  +
Sbjct: 214 FANFTDARETQQVIDALNHMDLQGRKLRVEYKKMLPAAERDRIERDKRERRGQLEEQ-HR 272

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGR-------NDKEKRDSTIKSPAPDQLDLNDPETLKFY 228
            P +I T +          +   R       N ++   +T  + A  + DLNDP TL +Y
Sbjct: 273 APNVISTGSLHTAGSMTSMNSGLRTTSPSPVNMRQNVAATNGTAA--EYDLNDPTTLNYY 330

Query: 229 DQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR-KPAS 287
            +++ F+ D  RE L F+ T+S A RR +  +A  + L ++++G GE + ++IV+ K AS
Sbjct: 331 TELLFFKQDAEREVLTFAPTVSPADRRIIHTLAHNMGLDHHSQGHGELRQVQIVKPKLAS 390

Query: 288 AAINIKQ 294
             +N  Q
Sbjct: 391 PPLNQIQ 397



>gi|347830526|emb|CCD46223.1| similar to R3H domain protein [Botryotinia fuckeliana T4]
          Length = 629

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 140/247 (56%), Gaps = 17/247 (6%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           QSD E      E IPTAIVIKNIPF++K++ L   ++ + +P PYAFNYHFDNGVFRGLA
Sbjct: 159 QSDHE------ELIPTAIVIKNIPFAVKKEQLTEMMSNMGLPLPYAFNYHFDNGVFRGLA 212

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+    +T  V+ ALN  ++ GRKLRVEYK++LP                  +E+  +
Sbjct: 213 FANFTDARETQQVIDALNHMDLQGRKLRVEYKKMLPAAERDRIERDKRERRGQLEEQ-HR 271

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGR-------NDKEKRDSTIKSPAPDQLDLNDPETLKFY 228
            P +I T +          +   R       N ++   +T  + A  + DLNDP TL +Y
Sbjct: 272 APNVISTGSLHTAGSMTSMNSGLRTTSPSPVNMRQNVAATNGTAA--EYDLNDPTTLNYY 329

Query: 229 DQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR-KPAS 287
            +++ F+ D  RE L F+ T+S A RR +  +A  + L ++++G GE + ++IV+ K AS
Sbjct: 330 TELLFFKQDAEREVLTFAPTVSPADRRIIHTLAHNMGLDHHSQGHGELRQVQIVKPKLAS 389

Query: 288 AAINIKQ 294
             +N  Q
Sbjct: 390 PPLNQIQ 396



>gi|390598267|gb|EIN07665.1| hypothetical protein PUNSTDRAFT_53067 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 456

 Score =  161 bits (407), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 137/265 (51%), Gaps = 53/265 (20%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTP 122
           G  E IPTAIVIKNIPF++K++ LL  + +L IP PYAFNYH D +G FRGLAFAN+R P
Sbjct: 42  GDDEIIPTAIVIKNIPFNVKKETLLDIITSLSIPTPYAFNYHLDQSGAFRGLAFANFRQP 101

Query: 123 EDTDLVVSALNGYEV--------------AGRKLRVEYKRVL------------------ 150
            D D VV ALNG++V              AG K R+E ++ L                  
Sbjct: 102 ADADAVVVALNGFDVQGRKLRVEYKKVLQAGEKERIEREKALRRMRSMQLEKEHISVQSP 161

Query: 151 -------PXXXXXXXXXXXXXXXXXDKE-----KVDQEPLLIKTDNDFLDKPKIDKSDNG 198
                  P                  ++     +V   P L +  +  +  P +     G
Sbjct: 162 YEDYGSPPVPPAFTPSRSFSGVPFQGQQQYSPPRVPPMPNLQQQYSGLMGTPPLPAGTPG 221

Query: 199 RNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQ 258
                    + K+ + ++LDLNDP TL+ Y ++++F+DD  R+EL FS+TLS+  RR + 
Sbjct: 222 --------GSAKTSSSNELDLNDPATLEIYSRILLFKDDPMRDELAFSRTLSAKQRRVVH 273

Query: 259 LIAQKLQLYYYNEGDGEDKVLRIVR 283
           L+AQKL +Y+Y+ G+GE++   + R
Sbjct: 274 LVAQKLGVYHYSVGEGEERYAVVTR 298



>gi|254569752|ref|XP_002491986.1| Protein involved in G2/M phase progression and response to DNA
           damage, interacts with Rad53p [Komagataella pastoris
           GS115]
 gi|238031783|emb|CAY69706.1| Protein involved in G2/M phase progression and response to DNA
           damage, interacts with Rad53p [Komagataella pastoris
           GS115]
 gi|328351519|emb|CCA37918.1| RNA-binding post-transcriptional regulator cip2 [Komagataella
           pastoris CBS 7435]
          Length = 565

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 127/219 (57%), Gaps = 8/219 (3%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRT 121
           +N  ++ IPTAIVIKNIPF+IK++ LL  +    +P PYAFNYHFDNGVFRGLAFAN+ +
Sbjct: 127 TNDDEDVIPTAIVIKNIPFAIKKEQLLDVMTKFSLPLPYAFNYHFDNGVFRGLAFANFTS 186

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIK 181
            ++  LVV  LNG E+ GRKLRVEYK++LP                  +E+         
Sbjct: 187 TDEACLVVENLNGKEIGGRKLRVEYKKMLPLPERERIEREKREKRGQLEEQHRSMSSASL 246

Query: 182 TDNDFLDKPKIDKSDN---GRNDKEKRDSTIKS---PAPDQLDLNDPETLKFYDQVIIFR 235
                +     + S N    +N  ++  +TI S   P P  LD+NDPETL+ Y Q+++FR
Sbjct: 247 ASLYSVASAPPNVSKNVLSQQNAPDRLYATIPSQLTPIPSGLDMNDPETLELYTQLLLFR 306

Query: 236 DDKSR--EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEG 272
           +DK +   EL F  T +S+ RR L L++Q L L    EG
Sbjct: 307 EDKDQRHSELAFPTTANSSLRRVLPLLSQFLGLADTFEG 345



>gi|402078447|gb|EJT73712.1| RNA-binding post-transcriptional regulator cip2 [Gaeumannomyces
           graminis var. tritici R3-111a-1]
          Length = 657

 Score =  160 bits (405), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 132/234 (56%), Gaps = 20/234 (8%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           I TAIVIKNIPF+++++ L A +  L++P+PYAFNYHFD GVFRGLAFAN+  PE+T +V
Sbjct: 219 IKTAIVIKNIPFNVRKETLQALMVELNLPQPYAFNYHFDQGVFRGLAFANFAHPEETKVV 278

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK-----VDQEPLLIKTD 183
           ++A+NG +V+GRKLRVEYK++LP                  +E+     +  +P L    
Sbjct: 279 INAMNGMDVSGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQHRAVPLHHQPSLGSIG 338

Query: 184 NDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREEL 243
           N+ +                  D+   S     +D+N   T+ FY ++ +FR D +RE +
Sbjct: 339 NNVVSC--------------LSDAAASSYREHGIDMNKQSTITFYLELFMFRKDPAREIM 384

Query: 244 VFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAA-INIKQTP 296
           +F   LS   RR + +I+  L L + + GDG+++ + + + P+S   +N    P
Sbjct: 385 IFPPDLSPEARRDIHVISHSLGLSHTSVGDGDNRQVVVKKTPSSGGQVNTLAMP 438



>gi|448114719|ref|XP_004202646.1| Piso0_001492 [Millerozyma farinosa CBS 7064]
 gi|359383514|emb|CCE79430.1| Piso0_001492 [Millerozyma farinosa CBS 7064]
          Length = 701

 Score =  160 bits (405), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 131/243 (53%), Gaps = 21/243 (8%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T LV
Sbjct: 197 IPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTEETALV 256

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPLLIKTDND 185
           V+ LNG E+ GRKLRVEYK++LP                  +E+        L       
Sbjct: 257 VNQLNGREIGGRKLRVEYKKMLPLQERERIEREKREKRGQLEEQHRSTSNASLASMISAA 316

Query: 186 FLDKPKIDKSDNGRNDKEKR---------DSTIKSPAPDQLDLNDPETLKFYDQVIIFRD 236
                  + S +G   + +R          S I  P P +L+ NDPE L  Y Q++I+++
Sbjct: 317 STTAATKNLSLSGTVSQTERLYLSIPNPNSSAIHIP-PSELNFNDPEILDLYGQLLIYKE 375

Query: 237 D--KSREELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASAAINIK 293
           D  KS  EL F   +S  HR++L ++   L L   Y+ G     ++ I RKP     +  
Sbjct: 376 DLTKSVYELAFPSNMSLPHRKSLSVLCSFLNLLELYDNG-----LIIIRRKPGQQGGHFS 430

Query: 294 QTP 296
           Q P
Sbjct: 431 QQP 433



>gi|440640241|gb|ELR10160.1| hypothetical protein GMDG_04554 [Geomyces destructans 20631-21]
          Length = 625

 Score =  160 bits (404), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 131/228 (57%), Gaps = 7/228 (3%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           Q+ S   + ++E IPTAIVIKNIPF+IKR+ L   ++ + +P PYAFNYHFDNGVFRGLA
Sbjct: 173 QAASTEDSASEELIPTAIVIKNIPFAIKREQLTDVMSEMHLPLPYAFNYHFDNGVFRGLA 232

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+ +PE+T  V+ A+N  E+ GRKLRVEYK++LP                  +E+   
Sbjct: 233 FANFSSPEETAAVIDAMNHMELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQ--H 290

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFR 235
            P+ +   N          S +          +++     ++D+ND  TL +Y ++++F+
Sbjct: 291 RPMQMGVHNS-----ASISSLSSALPASPSPVSMRGQQETKIDMNDATTLDYYGRLVVFK 345

Query: 236 DDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           DD++R   V    + + +RR L  +A KL L + + G G+ + ++I +
Sbjct: 346 DDETRRMFVVEPPVPATYRRVLHELAHKLGLEHESAGTGDMRHVQIFK 393



>gi|392580244|gb|EIW73371.1| hypothetical protein TREMEDRAFT_70956 [Tremella mesenterica DSM
           1558]
          Length = 511

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/230 (42%), Positives = 137/230 (59%), Gaps = 27/230 (11%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           +TIPTAIVIKNIPF++ ++ L   + +L  P PYAFNYH DNGVFRGLAFAN+R  E+  
Sbjct: 98  DTIPTAIVIKNIPFAVTKETLEQVIKSLGAPLPYAFNYHLDNGVFRGLAFANFRAYEEAA 157

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            VV+ALNGY+V GRKLRVEYK+VL                  +K+K+++E  L +  +  
Sbjct: 158 AVVAALNGYDVHGRKLRVEYKKVL---------------QPGEKDKIEREKALKRMRSIH 202

Query: 187 LDK---PKIDKS-DNG-RNDKEKRDSTIKSPA-------PDQLDLNDPETLKFYDQVIIF 234
            +K   P I  S  NG  N     DS  +S +       P  LD NDP TL  + ++ +F
Sbjct: 203 FEKELPPPISVSRANGFSNGLLSTDSPPQSASSATSDSLPVTLDFNDPITLDIHTRIAVF 262

Query: 235 RDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           ++D+ R+EL FS+ LS   RR + L+AQKL +    + DG+ K + + R+
Sbjct: 263 KEDRMRDELAFSRNLSPTERRIVHLVAQKLGVTTITKADGDIKYVVVTRE 312



>gi|406863143|gb|EKD16191.1| RNA-binding protein Cip2 [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 658

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 135/241 (56%), Gaps = 25/241 (10%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+A +  + +P PYAFNYHFD+GVFRGLAFAN+   E+T 
Sbjct: 158 ELIPTAIVIKNIPFAVKKEQLIACMTDMRLPLPYAFNYHFDSGVFRGLAFANFTNAEETQ 217

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVD-------QEPLL 179
            V+ A+N  E+ GRKLRVEYK++LP                  +E+         Q PL 
Sbjct: 218 TVIQAMNHMELQGRKLRVEYKKMLPVQERERIERDKREKRGQLQEQHQPLAPNQVQNPLH 277

Query: 180 IKTDNDFLDKPKIDKSDNGRND-------KEKRDSTIKSPAPDQL---------DLNDPE 223
            ++    L    +  +++           + K  + I +   D L         DLN+P 
Sbjct: 278 AQSSMASLT--SLSSANHPPPASPSPVSFRGKLGNLIPTQYLDALPSKLTWPDLDLNEPV 335

Query: 224 TLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           TL +Y ++++F++D  RE L+F  T+  A RRT+  +A  + L + +EG GE + ++I++
Sbjct: 336 TLGYYSELMLFKNDPKRETLIFPPTIIPADRRTIHTLAHHMGLEHRSEGQGESRCVQILK 395

Query: 284 K 284
           +
Sbjct: 396 R 396



>gi|448112143|ref|XP_004202020.1| Piso0_001492 [Millerozyma farinosa CBS 7064]
 gi|359465009|emb|CCE88714.1| Piso0_001492 [Millerozyma farinosa CBS 7064]
          Length = 701

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 133/245 (54%), Gaps = 21/245 (8%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 195 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTEETA 254

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPLLIKTD 183
           LVV+ LNG E+ GRKLRVEYK++LP                  +E+        L     
Sbjct: 255 LVVNQLNGREIGGRKLRVEYKKMLPLQERERIEREKREKRGQLEEQHRSTSNASLASLLS 314

Query: 184 NDFLDKPKIDKSDNGRNDKEKR---------DSTIKSPAPDQLDLNDPETLKFYDQVIIF 234
                    + S +G   + +R          S +  P P +L+ NDPE L  Y Q++I+
Sbjct: 315 AASTTAATKNLSLSGTVSQTERLYLSIPNPNSSAVHIP-PSELNFNDPEILDLYGQLLIY 373

Query: 235 RDD--KSREELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASAAIN 291
           ++D  KS  EL F   +S  HR++L ++   L L   Y+ G     ++ I RKP   + +
Sbjct: 374 KEDLTKSVYELAFPSNMSLPHRKSLSVLCSFLNLLELYDNG-----LIIIRRKPGQQSGH 428

Query: 292 IKQTP 296
             Q P
Sbjct: 429 FSQQP 433



>gi|398393764|ref|XP_003850341.1| hypothetical protein MYCGRDRAFT_110503 [Zymoseptoria tritici
           IPO323]
 gi|339470219|gb|EGP85317.1| hypothetical protein MYCGRDRAFT_110503 [Zymoseptoria tritici
           IPO323]
          Length = 743

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 129/224 (57%), Gaps = 5/224 (2%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+IK++ L+  +  + +P PYAFNYHFDNGVFRGLAFAN+  P++T
Sbjct: 288 EDLIPTAIVIKNIPFAIKKEQLVGIMTEMGLPLPYAFNYHFDNGVFRGLAFANFTNPDET 347

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
             V+ ++N +E+ GRKLRVEYK++LP                  +E+    P        
Sbjct: 348 AAVIDSMNHFELNGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQHRPIPAHALQTQP 407

Query: 186 FLDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSR 240
            +            +    R+  + +  P      ++DLNDP+ L+ Y ++++F++D SR
Sbjct: 408 SVSSLSSRVLAGSPSPVSARNPQMGASFPPADAGVEVDLNDPQALQHYSKLLLFKEDPSR 467

Query: 241 EELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           + LVF+ +LS   RR +  +A  + L + ++G+ + + + + ++
Sbjct: 468 DLLVFAPSLSPPERRIVHTLAHHMGLGHISKGESDHRAVHVYKE 511



>gi|156063878|ref|XP_001597861.1| hypothetical protein SS1G_02057 [Sclerotinia sclerotiorum 1980]
 gi|154697391|gb|EDN97129.1| hypothetical protein SS1G_02057 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 627

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 132/233 (56%), Gaps = 12/233 (5%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLA 115
           QSD E      E IPTAIVIKNIPF++K++ L   ++ + +P PYAFNYHFDNGVFRGLA
Sbjct: 158 QSDHE------ELIPTAIVIKNIPFAVKKEQLTEMMSNMGLPLPYAFNYHFDNGVFRGLA 211

Query: 116 FANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQ 175
           FAN+    +T  V+ ALN  ++ GRKLRVEYK++LP                  +E+  +
Sbjct: 212 FANFTDARETQQVIDALNHMDLQGRKLRVEYKKMLPAAERDRIERDKRERRGQLEEQ-HR 270

Query: 176 EPLLIKTDNDFLDKPKIDKSDNGRNDKE-----KRDSTIKSPAPDQLDLNDPETLKFYDQ 230
            P +I T +          +   R         +++    +    + DLNDP TL +Y +
Sbjct: 271 APNMISTGSLHTAGSMTSMNSGLRTTSPSPVNMRQNVVTPNSNTAEYDLNDPTTLGYYTE 330

Query: 231 VIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
           +++F++D  RE   F+ T+S A RR +  +A  + L ++++G GE + ++I++
Sbjct: 331 LLLFKNDPEREAYTFAPTVSPADRRIIHTLAHNMGLDHHSQGHGELRQVQIIK 383



>gi|396495944|ref|XP_003844668.1| similar to R3H domain protein [Leptosphaeria maculans JN3]
 gi|312221248|emb|CBY01189.1| similar to R3H domain protein [Leptosphaeria maculans JN3]
          Length = 627

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 130/240 (54%), Gaps = 24/240 (10%)

Query: 54  AAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRG 113
           A Q+ S      +E IPTAIVIKNIPF++K++ L+  +  L +P PYAFNYHFDNGVFRG
Sbjct: 175 AMQNPSYGHEVDEELIPTAIVIKNIPFAVKKEQLVQLMTDLRLPLPYAFNYHFDNGVFRG 234

Query: 114 LAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV 173
           LAFAN+ T ++T  V+ ++N +E+ GRKLRVEYK++LP                  +E+ 
Sbjct: 235 LAFANFTTADETAAVIESMNHFELNGRKLRVEYKKMLPLAERERIEREKRERRGQLEEQ- 293

Query: 174 DQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQ----------LDLNDPE 223
              PL          +P      +             SP+P            +DLNDP+
Sbjct: 294 -HRPL----GGGLQSQPSFGSLAS--------HIPATSPSPVSAMRGGSKAVDVDLNDPQ 340

Query: 224 TLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            L+FY Q+++F++   R+ + F  TL+   RR +  +A +L L + ++G GE + + I +
Sbjct: 341 VLQFYSQLLLFKETPERDNMTFPSTLAPLQRRMIHTLAHQLGLAHVSKGTGESRQVHIFK 400



>gi|453084029|gb|EMF12074.1| hypothetical protein SEPMUDRAFT_149855 [Mycosphaerella populorum
           SO2202]
          Length = 621

 Score =  158 bits (399), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 130/233 (55%), Gaps = 17/233 (7%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF++K++ L+  +  + +P PYAFNYHFDNGVFRGLAFAN+  P++T
Sbjct: 157 EELIPTAIVIKNIPFAVKKEQLVGIMTEMGLPLPYAFNYHFDNGVFRGLAFANFTNPDET 216

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPLLIKT 182
             V+ A+N +E+ GRKLRVEYK++LP                  +E+   +    L  + 
Sbjct: 217 ATVIEAMNHFELNGRKLRVEYKKMLPAAERERIEREKRERRGQLEEQHRPMAGATLQTQA 276

Query: 183 DNDFLDKPKIDKSDNGRNDKEKR-----------DSTIKSPAPDQLDLNDPETLKFYDQV 231
               L    I+ S        ++           DS    P   +++LND   L +Y ++
Sbjct: 277 SASSLSSRMINASSPSPVSARQKIGPAFSELSYTDSATGGP---EVNLNDATQLNYYTKL 333

Query: 232 IIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           ++F++D S++ LVF+ TLS   RR +  +A  + L + ++GD   + + + ++
Sbjct: 334 MLFKEDASKDLLVFAPTLSPPERRIVHTLAHHMGLGHASKGDANQRAVHVFKE 386



>gi|501756490|emb|CCG80543.1| putative R3H domain protein [Taphrina deformans PYCC 5710]
          Length = 376

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 128/229 (55%), Gaps = 47/229 (20%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATL----------------NTLDIPKPYAFNYHFDNGV 110
           E I TA+V+KNIPFS+K++ LL                   + + +PKPYAFNYHFDNG 
Sbjct: 15  EVISTAVVVKNIPFSLKKETLLELFVSSYPICHPPRILIIKDQMALPKPYAFNYHFDNGT 74

Query: 111 FRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDK 170
           FRGLAFAN+ + E+T  V+ ALNGYE+ GRKLRVEYK+VLP                  +
Sbjct: 75  FRGLAFANFHSSEETQHVIRALNGYELIGRKLRVEYKKVLP---------------ADQR 119

Query: 171 EKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQ 230
           E+++ +            + +  + ++       R  T++     +LDLNDP TL+ Y Q
Sbjct: 120 ERIELQ-----------KRQRTVQEESAATMNALRAKTVEKKL--ELDLNDPATLQIYSQ 166

Query: 231 VIIFRDD---KSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGED 276
           +++FRDD   +SR ++ F    S   RR + LI+Q+L L + + G+G++
Sbjct: 167 LLLFRDDNSPQSRTQMAFPPEFSMHQRRVVHLISQRLGLEHSSRGEGDE 215



>gi|440476149|gb|ELQ44775.1| RNA-binding post-transcriptional regulator cip2 [Magnaporthe oryzae
           Y34]
 gi|440484769|gb|ELQ64794.1| RNA-binding post-transcriptional regulator cip2 [Magnaporthe oryzae
           P131]
          Length = 669

 Score =  156 bits (394), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 139/249 (55%), Gaps = 23/249 (9%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G    I TAIVIKNIPF+++++ L + +  +++P+PYAFNYHFD GVFRGLAFAN+  PE
Sbjct: 196 GGPGLIKTAIVIKNIPFNVRKETLQSLMVDMNLPQPYAFNYHFDQGVFRGLAFANFAHPE 255

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV-DQEPLLIKT 182
           +T +V++++NG +V+GRKLRVEYK++LP                  +E+     PL  + 
Sbjct: 256 ETKVVINSMNGMDVSGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQHRSVAPLQHQA 315

Query: 183 DNDFLDK----------------PKIDKSDNGRNDKEKRDST--IKSPAPDQ---LDLND 221
               L+                 P    S NG   +    S   I+   P +   +DLN+
Sbjct: 316 SISSLNAASTVSDAAHTYSKHQMPAYSMSGNGEEAQASDGSGMLIQVAGPSEQHPIDLNN 375

Query: 222 PETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRI 281
             TLK Y ++ +F++D +RE +VF   L+   RR + +++  L L + + GDG+++ + +
Sbjct: 376 ESTLKAYMELYMFKNDVNREIMVFPSNLTPEQRRDIHILSHNLGLNHTSVGDGDNRQV-V 434

Query: 282 VRKPASAAI 290
           VRK +S  +
Sbjct: 435 VRKLSSGGM 443



>gi|344229806|gb|EGV61691.1| hypothetical protein CANTEDRAFT_124688 [Candida tenuis ATCC 10573]
          Length = 636

 Score =  156 bits (394), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 129/236 (54%), Gaps = 24/236 (10%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN+ + ++T LV
Sbjct: 143 IPTAIVIKNIPFAIKKEQLLDVMTKLSLPLPYAFNYHFDNGVFRGLAFANFTSTDETSLV 202

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLIKT 182
           V+ LNG E+ GRKLRVEYK++LP                  +E+           L+  T
Sbjct: 203 VNQLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSNSNASLASLMSTT 262

Query: 183 DNDFLDKPKIDKSDNGRNDKEKR-------DSTIKSPAPDQLDLNDPETLKFYDQVIIFR 235
                 K   + S NG N  +           T+ +P P+ ++ ND ETL+ Y Q+++F+
Sbjct: 263 STTAATK---NLSVNGSNASQPERLFMSLPSQTLTAPIPNDVNFNDIETLELYTQLVVFK 319

Query: 236 DDKSRE--ELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASA 288
           DD ++   EL +   L  A R+ L  +   L L   Y+ G     ++ I RKP  +
Sbjct: 320 DDNTKTIMELAYPPNLGIAQRKLLSSLCSWLNLLELYDNG-----LIIIRRKPGQS 370



>gi|344304227|gb|EGW34476.1| hypothetical protein SPAPADRAFT_149411 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 714

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 133/244 (54%), Gaps = 26/244 (10%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T LV
Sbjct: 184 IPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETSLV 243

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLIKT 182
           V+ LNG E+ GRKLRVEYK++LP                  +E+           L+   
Sbjct: 244 VNQLNGREIGGRKLRVEYKKMLPLQERERIEREKREKRGQLEEQHRSTSNASLASLMSAA 303

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRD--------STIKSPAPDQLDLNDPETLKFYDQVIIF 234
                 K   + S NG       +        +TI +  P  L+ NDPE L+ Y Q++++
Sbjct: 304 STTAATK---NLSINGATPSGTTERLFVNLPFATISAAPPMDLNFNDPEILELYTQLVLY 360

Query: 235 RDD--KSREELVFS-KTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASAAI 290
           RDD  KS  EL  S  TL+   R+ L LI+  L L   ++ G     ++ I RKP   A 
Sbjct: 361 RDDVTKSIYELAISPATLNINQRKNLSLISNYLNLLELFDNG-----LIIIRRKPGYIAQ 415

Query: 291 NIKQ 294
           +I Q
Sbjct: 416 SIIQ 419



>gi|260949655|ref|XP_002619124.1| hypothetical protein CLUG_00283 [Clavispora lusitaniae ATCC 42720]
 gi|238846696|gb|EEQ36160.1| hypothetical protein CLUG_00283 [Clavispora lusitaniae ATCC 42720]
          Length = 661

 Score =  154 bits (388), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 129/237 (54%), Gaps = 25/237 (10%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 164 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTEETS 223

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLI 180
           +VV+ LNG E+ GRKLRVEYK++LP                  +E+           L+ 
Sbjct: 224 MVVNNLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSGSNASLASLIS 283

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRD-------STIKSP-APDQLDLNDPETLKFYDQVI 232
                   K   + S NG+    + +       S   +P  P +L+LNDPE L+ Y Q++
Sbjct: 284 AASTTAATK---NLSVNGQQYSTQTERVFVHFPSGSNAPQPPPELNLNDPEILELYSQLL 340

Query: 233 IFRDDKSRE--ELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPA 286
            +RDD S+   EL F   L+ + R+ +  +   L L   Y+ G      + I RKP 
Sbjct: 341 TYRDDNSKLIFELAFPSNLTMSQRKVISHLCSFLNLLELYDNG-----YIIIRRKPG 392



>gi|354545030|emb|CCE41755.1| hypothetical protein CPAR2_803060 [Candida parapsilosis]
          Length = 516

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 135/245 (55%), Gaps = 23/245 (9%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T
Sbjct: 117 EELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDET 176

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLL 179
            LVV+ LNG E+ GRKLRVEYK++LP                  +E+           LL
Sbjct: 177 SLVVNQLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSTSNASLASLL 236

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKRDST-----IKSPAPDQLDLNDPETLKFYDQVIIF 234
            +       K   + S  G +  ++R          S AP +++ NDPE L+ Y Q++++
Sbjct: 237 SQASTTAATK---NLSVAGTSSSQERILLNLPFGCSSFAPPEINFNDPEILELYTQLVLY 293

Query: 235 RDDKSRE--ELVFSK-TLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASAAI 290
           RDD S+   EL  S   L+ A R+ +  I   L L   ++ G     ++ I RKP   +I
Sbjct: 294 RDDASKSVFELAISPLNLNIAQRKIISYICNYLHLLELFDNG-----MIIIRRKPGHISI 348

Query: 291 NIKQT 295
              QT
Sbjct: 349 APGQT 353



>gi|512191377|gb|EPE07138.1| rna-binding post-transcriptional regulator cip2 [Ophiostoma piceae
           UAMH 11346]
          Length = 672

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 126/215 (58%), Gaps = 6/215 (2%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L   +  L +P+PYAFNYHFDNGVFRGLAFAN+++P DT  V
Sbjct: 208 IPTAIVIKNIPFNVRKEVLTNIMVELHLPQPYAFNYHFDNGVFRGLAFANFQSPTDTKHV 267

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           + ++NG ++ GRKLRVEYK++LP                  +E+  + P    + +    
Sbjct: 268 IESMNGLDIHGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ-HRGPAHQISISSMAA 326

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKT 248
               + +      +  R++  + P     D+NDP TL++Y Q+ +F  D+S+E L+F   
Sbjct: 327 AAAANNATRAPAPQPDRNAVGRVP-----DMNDPITLRYYVQLCMFIKDESQEVLIFPAD 381

Query: 249 LSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
                RR + ++A  + L + + G+G+++ + + R
Sbjct: 382 TPPEDRRLVHILAHNMGLEHTSIGEGDNRQIHVSR 416



>gi|389628906|ref|XP_003712106.1| RNA-binding post-transcriptional regulator cip2 [Magnaporthe oryzae
           70-15]
 gi|351644438|gb|EHA52299.1| RNA-binding post-transcriptional regulator cip2 [Magnaporthe oryzae
           70-15]
          Length = 639

 Score =  153 bits (387), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 82/228 (35%), Positives = 132/228 (57%), Gaps = 11/228 (4%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G    I TAIVIKNIPF+++++ L + +  +++P+PYAFNYHFD GVFRGLAFAN+  PE
Sbjct: 196 GGPGLIKTAIVIKNIPFNVRKETLQSLMVDMNLPQPYAFNYHFDQGVFRGLAFANFAHPE 255

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV-DQEPLLIKT 182
           +T +V++++NG +V+GRKLRVEYK++LP                  +E+     PL  + 
Sbjct: 256 ETKVVINSMNGMDVSGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQHRSVAPLQHQA 315

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREE 242
               L         N  +       T +      +DLN+  TLK Y ++ +F++D +RE 
Sbjct: 316 SISSL---------NAASTVSDAAHTYRPSEQHPIDLNNESTLKAYMELYMFKNDVNREI 366

Query: 243 LVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPASAAI 290
           +VF   L+   RR + +++  L L + + GDG+++ + +VRK +S  +
Sbjct: 367 MVFPSNLTPEQRRDIHILSHNLGLNHTSVGDGDNRQV-VVRKLSSGGM 413



>gi|448509388|ref|XP_003866133.1| Pin4 protein [Candida orthopsilosis Co 90-125]
 gi|380350471|emb|CCG20693.1| Pin4 protein [Candida orthopsilosis Co 90-125]
          Length = 491

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 134/244 (54%), Gaps = 23/244 (9%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 110 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 169

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLLI 180
           LVV+ LNG E+ GRKLRVEYK++LP                  +E+           LL 
Sbjct: 170 LVVNQLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSTSNASLASLLS 229

Query: 181 KTDNDFLDKPKIDKSDNGRNDKEKRDST-----IKSPAPDQLDLNDPETLKFYDQVIIFR 235
           +       K   + S  G +  ++R          S +P +L+ NDPE L+ Y Q++++R
Sbjct: 230 QASTTAATK---NLSVAGTSTSQERILLNLPFGCSSFSPPELNFNDPEILELYTQLVLYR 286

Query: 236 DDKSRE--ELVFSK-TLSSAHRRTLQLIAQKLQLY-YYNEGDGEDKVLRIVRKPASAAIN 291
           DD S+   EL  S   L+ A R+ +  I   L L   ++ G     ++ I RKP   +I 
Sbjct: 287 DDASKTVFELAISPLNLNIAQRKIISYICNYLNLLELFDNG-----MIIIRRKPGHMSIA 341

Query: 292 IKQT 295
             QT
Sbjct: 342 PGQT 345



>gi|213409449|ref|XP_002175495.1| RNA-binding post-transcriptional regulator cip1
           [Schizosaccharomyces japonicus yFS275]
 gi|212003542|gb|EEB09202.1| RNA-binding post-transcriptional regulator cip1
           [Schizosaccharomyces japonicus yFS275]
          Length = 456

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 134/239 (56%), Gaps = 33/239 (13%)

Query: 50  TTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG 109
           ++N++  S +      ++TIPTAIVIKNIPFS+++D+L+     L IPKPYAFNYH+DNG
Sbjct: 151 SSNTSVASTTPVPQPTEDTIPTAIVIKNIPFSLEKDSLIECFKKLGIPKPYAFNYHYDNG 210

Query: 110 VFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXD 169
           VFRGLAFAN+  PE+   VV ALNGYE+ GR+LRVE+KR LP                 +
Sbjct: 211 VFRGLAFANFYMPEEARAVVQALNGYEINGRRLRVEWKRQLP---------------AAE 255

Query: 170 KEKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYD 229
           +EK              L++ K   ++  R  ++ +       A   LD+NDP TL+ Y 
Sbjct: 256 REK--------------LERGKKRVAEERRKQQQTKQYCYNFSA-YGLDMNDPATLEVYT 300

Query: 230 QVIIFRDDK--SREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRKPA 286
           ++++F + +  +RE ++ + +  +     +++    L L YY   +GE   L +V  PA
Sbjct: 301 RILLFMNQRPPARELVLEAGSEDTRMLNIIRVFCLHLDLEYYAVPNGETCKL-VVSSPA 358



>gi|149246387|ref|XP_001527663.1| hypothetical protein LELG_00183 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146447617|gb|EDK42005.1| hypothetical protein LELG_00183 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 842

 Score =  151 bits (381), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 130/241 (53%), Gaps = 21/241 (8%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           +E IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN+ + ++T
Sbjct: 292 EELIPTAIVIKNIPFAIKKEQLLDVMTKLGLPLPYAFNYHFDNGVFRGLAFANFTSTDET 351

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK------VDQEPLL 179
            LVV+ LNG E+ GRKLRVEYK++LP                  +E+           L 
Sbjct: 352 SLVVNLLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRNTSNASLASLY 411

Query: 180 IKTDNDFLDKPKIDKSDNGRNDKEKR------DSTIKSPAPDQLDLNDPETLKFYDQVII 233
            +       K          + +E+        +T+ +P   ++DLNDPE L+ Y Q+++
Sbjct: 412 SQASTTAATKNLSVAGGQASSTQERAFINLPFGNTLFAPPSMEIDLNDPEILELYTQLVL 471

Query: 234 FRDD--KSREELVFSK-TLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAA 289
           +RDD  KS  EL  S   L+   R+T+  +       Y N  +  D  L IV RKP   +
Sbjct: 472 YRDDVTKSIFELAISPINLTVIQRKTISYLCN-----YLNLLELFDNGLVIVRRKPGYIS 526

Query: 290 I 290
           I
Sbjct: 527 I 527



>gi|320593824|gb|EFX06227.1| r3h domain protein [Grosmannia clavigera kw1407]
          Length = 662

 Score =  151 bits (381), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 125/216 (57%), Gaps = 13/216 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+++++ L + +  + +P+PYAFNYHFDNG+FRGLAFAN++  +DT LV
Sbjct: 211 IPTAIVIKNIPFNVRKEYLTSVMIEMHLPQPYAFNYHFDNGIFRGLAFANFQNAQDTALV 270

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDFLD 188
           +  +NG ++ GRKLRVEYK++LP                  +E+  + P           
Sbjct: 271 IDRMNGLDIQGRKLRVEYKKMLPEHERERIEREKREKRGQLEEQ-HRGPAH--------- 320

Query: 189 KPKIDKSDNGRNDKEKRDSTIKSPA-PDQLDLNDPETLKFYDQVIIFRDDKSREELVFSK 247
             ++  S        +R     +P    ++DLNDP TL+FY  + +FR+D +RE  +F  
Sbjct: 321 --QVSISSLATTTSLQRAPVNDNPGISGRVDLNDPHTLQFYLDLYMFRNDDNREVHIFPA 378

Query: 248 TLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
             +   RR + ++A  + L + + G+GE++ + + +
Sbjct: 379 DTAPEDRRMIHILAHNMGLEHTSIGEGENRQVHVSK 414



>gi|126140076|ref|XP_001386560.1| hypothetical protein PICST_68534 [Scheffersomyces stipitis CBS
           6054]
 gi|126093844|gb|ABN68531.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 698

 Score =  150 bits (378), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 128/233 (54%), Gaps = 20/233 (8%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 172 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTEETS 231

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK---VDQEPL--LIK 181
           LVV+ LNG E+ GRKLRVEYK++LP                  +E+        L  L+ 
Sbjct: 232 LVVNHLNGREIGGRKLRVEYKKMLPLQERERIEREKREKRGQLEEQHRSTSNASLASLMS 291

Query: 182 TDNDFLDKPKIDKSDNGRNDKEKR-------DSTIKSPAPDQLDLNDPETLKFYDQVIIF 234
             +       +  S    +   +R       ++ + S  P +L+ ND ETL+ Y Q+++F
Sbjct: 292 AASTTAATKNLSVSAATPSGTTERLYLQLPLNALLVSTPPMELNFNDSETLELYSQLLLF 351

Query: 235 RDD--KSREELVFS-KTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIVRK 284
           RDD  KS  EL  S   L+   R+ L ++   L L      +  D  L I+R+
Sbjct: 352 RDDIGKSVFELAISPANLNLTQRKILSILCNFLNLL-----EMFDNGLIIIRR 399



>gi|326483162|gb|EGE07172.1| hypothetical protein TEQG_06159 [Trichophyton equinum CBS 127.97]
          Length = 409

 Score =  150 bits (378), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 115/198 (58%), Gaps = 16/198 (8%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF++K++ L+  +  +++P PYAFNYHFDNGVFRGLAFAN+ + E+T 
Sbjct: 149 ELIPTAIVIKNIPFAVKKEQLIQLMTEMNLPLPYAFNYHFDNGVFRGLAFANFTSAEETA 208

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            V+  LN +E+ GRKLRVEYK++LP                  +E+    P+        
Sbjct: 209 TVIELLNHFELQGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQ--HRPMATS----- 261

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPD-----QLDLNDPETLKFYDQVIIFRDDKSRE 241
               ++    +  +      +T  SP        ++D+ND +TL++Y Q+++F+ D S+E
Sbjct: 262 ----QLQHQTSMSSLASHLPTTSPSPVSQRAGKLEVDMNDAQTLQYYSQLLLFKQDLSKE 317

Query: 242 ELVFSKTLSSAHRRTLQL 259
            L+F   L+ A RR + +
Sbjct: 318 ALIFGTNLTPAQRRIVHV 335



>gi|385302604|gb|EIF46728.1| r3h domain-containing protein [Dekkera bruxellensis AWRI1499]
          Length = 738

 Score =  149 bits (376), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 124/225 (55%), Gaps = 20/225 (8%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  E IPTA+VIKNIPF+IK++ LL  +   ++P PYAFNYHFDNGVFRGLAFAN+ T +
Sbjct: 287 GNDEIIPTAVVIKNIPFAIKKEQLLDFMAKCNLPLPYAFNYHFDNGVFRGLAFANFNTTD 346

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVL-PXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKT 182
           +T LVV+ LNG E+ GRKLRVEYK++L P                 +++        + +
Sbjct: 347 ETALVVNLLNGREIGGRKLRVEYKKMLPPAERERIEREKRERRGQLEEQHRSASATSLAS 406

Query: 183 DNDFLDKPKIDKSDNGRNDKEKRDSTIKSPA------PDQLDLNDPETLKFYDQVIIFRD 236
                  P    + NG+ D   R     +PA      P  +D N P+ L+ Y ++++FRD
Sbjct: 407 MYSIASAPP--TTXNGQMD---RLYVTLAPASQLPQPPQGVDFNGPDALELYTKLVLFRD 461

Query: 237 D-------KSREELVF-SKTLSSAHRRTLQLIAQKLQLYYYNEGD 273
           +        S  EL F + +L+   RR++ LIAQ L L    EG 
Sbjct: 462 EPRINTAGASPVELAFHAASLTGNQRRSVSLIAQFLGLADTLEGG 506



>gi|320582732|gb|EFW96949.1| hypothetical protein HPODL_1659 [Ogataea parapolymorpha DL-1]
          Length = 586

 Score =  148 bits (374), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 118/225 (52%), Gaps = 24/225 (10%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+IK++ LL  ++ L +P PYAFNYHFDNGVFRGLAFAN+ + E+T
Sbjct: 171 EDVIPTAIVIKNIPFAIKKEQLLDVMSKLSLPLPYAFNYHFDNGVFRGLAFANFNSTEET 230

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKV-DQEPLLIKTDN 184
            +VV+ LNG E+ GRKLRVEYK++LP                  +E+        + +  
Sbjct: 231 SMVVNVLNGREIGGRKLRVEYKKMLPMVERERIEREKREKRGQLEEQHRSTSATSLASLY 290

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQL---------------DLNDPETLKFYD 229
                P                ST     PD+L               D NDPETL+ Y 
Sbjct: 291 SISSMPNSSTPAQTNMSLLNNASTAHKLMPDRLYVTLSAQPPSLPSNVDFNDPETLEIYS 350

Query: 230 QVIIFRDD-------KSREELVFS-KTLSSAHRRTLQLIAQKLQL 266
           ++I+FRD+        S  EL F   +++S  R+ + ++ Q L L
Sbjct: 351 KLIVFRDEFKNPTLPASVSELAFPLASMNSNQRKVISVLCQFLNL 395



>gi|409046266|gb|EKM55746.1| hypothetical protein PHACADRAFT_53738, partial [Phanerochaete
           carnosa HHB-10118-sp]
          Length = 529

 Score =  147 bits (370), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 144/271 (53%), Gaps = 69/271 (25%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R   D 
Sbjct: 122 EIIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDQAGQFRGLAFANFRQAADA 181

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDND 185
           D VV ALNG++V GRKLRVEYK+VL                  +KE++++E  L +  + 
Sbjct: 182 DAVVVALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKALRRMRSM 226

Query: 186 FLDK----------PKID-------------KSDNGRNDKEKRDS----------TIKSP 212
            L+K          P+ D             +S  G +   ++ +          ++ +P
Sbjct: 227 QLEKEQAAMQQQQTPQYDDFGPVIAPPFTPSRSFQGTSPFPQQYTPPVPPVPQIPSLPTP 286

Query: 213 APDQLD-----------LNDPET---------LKFYDQVIIFRDDKSREELVFSKTLSSA 252
           +P  L            L  P T         L+ Y ++++F+DD  R+EL FS+ L++ 
Sbjct: 287 SPYNLSTSPLPSSTPGGLKSPSTELDLNDPSTLEIYSRILLFKDDHMRDELAFSRALTAK 346

Query: 253 HRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            RR + L+AQKL +Y+Y+ G+G+++   + R
Sbjct: 347 QRRVVHLVAQKLGVYHYSVGEGDERYAVVTR 377



>gi|346324277|gb|EGX93874.1| R3H domain protein [Cordyceps militaris CM01]
          Length = 667

 Score =  144 bits (363), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 129/233 (55%), Gaps = 29/233 (12%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF+++++ L + +  L +P+PYAFNYHFDNGVFRGLAFAN+++ EDT 
Sbjct: 249 QLIPTAIVIKNIPFAVRKETLASIMLDLHLPQPYAFNYHFDNGVFRGLAFANFQSAEDTR 308

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
           LV+  +NG +V  RKLRVEYK++LP                  +E+  + P+L +  +  
Sbjct: 309 LVIETMNGMDVQTRKLRVEYKKMLPEAERERIEREKRERRGQLEEQ-HRGPMLHQQSS-- 365

Query: 187 LDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFS 246
                  +S    +  ++R     +PA                 +++FR D SRE LVF 
Sbjct: 366 ------IQSLGAMSQSQQRG----NPA---------------GYLVMFRRDDSREILVFP 400

Query: 247 KTLSSAHRRTLQLIAQKLQLYYYNEGDGEDKVLRIV-RKPASAAINIKQTPRN 298
             ++  HRR++ ++A  + L + + G+ + + L ++ R+  S   N+   P N
Sbjct: 401 PGIAPEHRRSIHILAHHMGLEHQSIGEADSRQLTVLKRQQPSPTANVHSAPAN 453



>gi|146420080|ref|XP_001485998.1| hypothetical protein PGUG_01669 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 549

 Score =  143 bits (360), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 117/216 (54%), Gaps = 13/216 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN+   ++T LV
Sbjct: 140 IPTAIVIKNIPFAIKKEQLLDVMTKLSLPLPYAFNYHFDNGVFRGLAFANFTLTDETTLV 199

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK----VDQEPLLIKTDN 184
           V+ LNG E+ GRKLRVEYK++LP                  +E+     +    L+ +  
Sbjct: 200 VNQLNGREIGGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQHRTNSNASLALLLSAA 259

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSP-----APDQLDLNDPETLKFYDQVIIFRDDKS 239
                 K      G          +  P      P +L++ND + L+ Y Q++++RD+ +
Sbjct: 260 STTAATKNLSVGTGITTTHTERLAVSYPVGSTPVPTELNMNDGDVLELYSQLLLYRDEPT 319

Query: 240 RE--ELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEG 272
           +   EL F   L  A R+TL L+   L L   Y+ G
Sbjct: 320 KAVYELAFPALL-PAQRKTLSLLCGVLNLLELYDNG 354



>gi|190345648|gb|EDK37571.2| hypothetical protein PGUG_01669 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 549

 Score =  140 bits (354), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 116/216 (53%), Gaps = 13/216 (6%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN+ + ++T  V
Sbjct: 140 IPTAIVIKNIPFAIKKEQLLDVMTKLSLPLPYAFNYHFDNGVFRGLAFANFTSTDETTSV 199

Query: 129 VSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK----VDQEPLLIKTDN 184
           V+ LNG E+ GRKLRVEYK++LP                  +E+     +     + +  
Sbjct: 200 VNQLNGREIGGRKLRVEYKKMLPAQERERIEREKRERRGQLEEQHRTNSNASLASLLSAA 259

Query: 185 DFLDKPKIDKSDNGRNDKEKRDSTIKSP-----APDQLDLNDPETLKFYDQVIIFRDDKS 239
                 K      G          +  P      P +L++ND + L+ Y Q++++RD+ +
Sbjct: 260 STTAATKNLSVGTGITTTHTERLAVSYPVGSTPVPTELNMNDGDVLELYSQLLLYRDEPT 319

Query: 240 RE--ELVFSKTLSSAHRRTLQLIAQKLQLY-YYNEG 272
           +   EL F   L  A R+TL L+   L L   Y+ G
Sbjct: 320 KAVYELAFPALL-PAQRKTLSLLCGVLNLLELYDNG 354



>gi|366997765|ref|XP_003683619.1| hypothetical protein TPHA_0A01000 [Tetrapisispora phaffii CBS 4417]
 gi|357521914|emb|CCE61185.1| hypothetical protein TPHA_0A01000 [Tetrapisispora phaffii CBS 4417]
          Length = 437

 Score =  139 bits (351), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 117/222 (52%), Gaps = 13/222 (5%)

Query: 48  EKTTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD 107
           E  +   A S    ++  QE I  AIVIKNIPF+IK++ LL  +N+L +P PYAFNYHFD
Sbjct: 13  ESESEVCANSLDPCASNEQEIIKNAIVIKNIPFTIKKEELLEFINSLQLPLPYAFNYHFD 72

Query: 108 NGVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXX 167
           NG+FRGLAFAN+ T E+T  +V  LN  E+ GRKLRVE K++LP                
Sbjct: 73  NGIFRGLAFANFNTVEETKRIVKELNSQEIGGRKLRVEMKKMLP-QSEKERVEKEEKLRK 131

Query: 168 XDKEKVDQEP---------LLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSP---APD 215
            +  K  Q+P         +  K +N           +          S I +P    P 
Sbjct: 132 QNFNKHHQQPSFENDHYTQIYYKNNNYTTAAISTPVQERYYAPAFCSPSCIVNPNMQIPT 191

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTL 257
            +D ND E+L+ + Q++IFR++ + +EL +  +LS  HR  L
Sbjct: 192 SVDFNDSESLELFAQLLIFRENDNYDELAYPISLSPNHRNIL 233



>gi|19113563|ref|NP_596771.1| RNA-binding protein Cip1 [Schizosaccharomyces pombe 972h-]
 gi|74675988|sp|O42923.1|CIP1_SCHPO RecName: Full=RNA-binding post-transcriptional regulator cip1;
           AltName: Full=Csx1-interacting protein 1
 gi|2842517|emb|CAA16869.1| RNA-binding protein Cip1 [Schizosaccharomyces pombe]
          Length = 490

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 126/232 (54%), Gaps = 34/232 (14%)

Query: 53  SAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFR 112
           S A S+S      ++TIPTAIV+KNIPFS+++D LL     L IP+PYAFNYH+DNG+FR
Sbjct: 184 STANSNSTPVEPGEDTIPTAIVVKNIPFSLEKDTLLDHFKQLGIPRPYAFNYHYDNGIFR 243

Query: 113 GLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEK 172
           GLAFAN+  PE+  +VV  LNGYE+ GR+LRVE+KR LP                 ++EK
Sbjct: 244 GLAFANFYRPEEAQVVVQTLNGYEINGRRLRVEWKRQLP---------------AAEREK 288

Query: 173 VDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAPDQLDLNDPETLKFYDQVI 232
           V              +K K  +++  R  ++ +   + S     L+LND  TL+ Y +++
Sbjct: 289 V--------------EKAKKRQAEERRRKQQYKMFEV-SFTDQGLNLNDTGTLETYSRLL 333

Query: 233 IFRDDK-SREELVFSKTLSSAH-RRTLQLIAQKLQLYYYNEGDGEDKVLRIV 282
           +F        E+ F  T    +    +++      L YY   +GE  VL++V
Sbjct: 334 LFAHQCIPSREITFETTSKDGNLLNAIRIFCLYFDLDYYARPNGE--VLKLV 383



>gi|401840506|gb|EJT43303.1| PIN4-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 675

 Score =  137 bits (344), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 52  NSAAQSDSEASNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG 109
           NSAA   + +SN A   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG
Sbjct: 65  NSAANLGNSSSNAALDDDVIPNAIVIKNIPFAIKKEQLLDIIEDMDLPLPYAFNYHFDNG 124

Query: 110 VFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           +FRGLAFAN+ TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 125 IFRGLAFANFTTPEETTQVITSLNGKEISGRKLKVEYKKMLP 166



>gi|365762148|gb|EHN03754.1| Pin4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 675

 Score =  137 bits (344), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 52  NSAAQSDSEASNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG 109
           NSAA   + +SN A   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG
Sbjct: 65  NSAANLGNSSSNAALDDDVIPNAIVIKNIPFAIKKEQLLDIIEDMDLPLPYAFNYHFDNG 124

Query: 110 VFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           +FRGLAFAN+ TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 125 IFRGLAFANFTTPEETTQVITSLNGKEISGRKLKVEYKKMLP 166



>gi|384483868|gb|EIE76048.1| hypothetical protein RO3G_00752 [Rhizopus delemar RA 99-880]
          Length = 176

 Score =  136 bits (343), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/82 (71%), Positives = 74/82 (90%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPFS+K+DALL+ L++L +P+ +AFNYHFDNG+FRGLAFANYRTPE+T+ V
Sbjct: 46  IPTAIVIKNIPFSVKKDALLSKLSSLGVPEAFAFNYHFDNGIFRGLAFANYRTPEETEEV 105

Query: 129 VSALNGYEVAGRKLRVEYKRVL 150
           V+ +NG E+ GR LRVEYK+VL
Sbjct: 106 VNTINGLEIGGRTLRVEYKKVL 127



>gi|259144796|emb|CAY77735.1| Pin4p [Saccharomyces cerevisiae EC1118]
          Length = 660

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|349576329|dbj|GAA21500.1| K7_Pin4p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 668

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|392301164|gb|EIW12253.1| Pin4p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 668

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|6319420|ref|NP_009502.1| Pin4p [Saccharomyces cerevisiae S288c]
 gi|465511|sp|P34217.1|PIN4_YEAST RecName: Full=RNA-binding protein PIN4; AltName: Full=Psi
           inducibility protein 4
 gi|313746|emb|CAA80795.1| YBLO506 [Saccharomyces cerevisiae]
 gi|536077|emb|CAA84871.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285810283|tpg|DAA07068.1| TPA: Pin4p [Saccharomyces cerevisiae S288c]
          Length = 668

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|365981491|ref|XP_003667579.1| hypothetical protein NDAI_0A01780 [Naumovozyma dairenensis CBS 421]
 gi|343766345|emb|CCD22336.1| hypothetical protein NDAI_0A01780 [Naumovozyma dairenensis CBS 421]
          Length = 696

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 69/83 (83%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IKR+ LL  L+ +D+P PYAFNYHFDNGVFRGLAFAN+   E+T  V
Sbjct: 100 IPTAIVIKNIPFAIKREQLLDVLSRMDLPLPYAFNYHFDNGVFRGLAFANFTNTEETTAV 159

Query: 129 VSALNGYEVAGRKLRVEYKRVLP 151
           +  LNG E+ GRKLRVEYK++LP
Sbjct: 160 IEGLNGKEIGGRKLRVEYKKMLP 182



>gi|151946344|gb|EDN64566.1| protein involved in G2/M phase progression and response to DNA
           damage [Saccharomyces cerevisiae YJM789]
          Length = 668

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|401626707|gb|EJS44632.1| pin4p [Saccharomyces arboricola H-6]
          Length = 689

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 52  NSAAQSDSEASNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNG 109
           N+AA   + ++N A   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG
Sbjct: 64  NAAANLGNTSTNAALDDDVIPNAIVIKNIPFAIKKEQLLDIIEDMDLPLPYAFNYHFDNG 123

Query: 110 VFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           +FRGLAFAN+ TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 124 IFRGLAFANFTTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|190408876|gb|EDV12141.1| hypothetical protein SCRG_03014 [Saccharomyces cerevisiae RM11-1a]
          Length = 668

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|256272727|gb|EEU07700.1| Pin4p [Saccharomyces cerevisiae JAY291]
          Length = 668

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (83%), Gaps = 2/92 (2%)

Query: 62  SNGA--QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           +NGA   + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+
Sbjct: 74  TNGALDDDVIPNAIVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANF 133

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 134 TTPEETTQVITSLNGKEISGRKLKVEYKKMLP 165



>gi|501302947|dbj|GAC92492.1| hypothetical protein PHSY_000045 [Pseudozyma hubeiensis SY62]
          Length = 690

 Score =  134 bits (338), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 15/135 (11%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIV+KNIPFS+KR+ LL  +  L IP PYAFNYH D GVFRGLAFAN+R+ E+ D
Sbjct: 206 DVIPTAIVVKNIPFSVKREQLLQIIEDLGIPMPYAFNYHMDQGVFRGLAFANFRSSEEAD 265

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTDNDF 186
            VV+ALNG++V+GRKLRVEYK+VL                  +KE++++E  + +  +  
Sbjct: 266 AVVAALNGFDVSGRKLRVEYKKVL---------------QAGEKERIEKEKAIKRMQSMQ 310

Query: 187 LDKPKIDKSDNGRND 201
           L+K +  ++D   N+
Sbjct: 311 LEKERRRQNDEYANN 325



 Score = 78.6 bits (192), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 54/69 (78%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLND  TL+ Y +V++F+DD+ R+EL FS++L+   RRT+ L+AQ+L L++Y+ G+G
Sbjct: 410 EELDLNDAATLEIYSRVLLFKDDRMRDELSFSRSLTPLERRTVHLVAQRLGLFHYSMGEG 469

Query: 275 EDKVLRIVR 283
           E++ + + +
Sbjct: 470 EERYVIVTK 478



>gi|403164952|ref|XP_003324997.2| hypothetical protein PGTG_06534 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375165470|gb|EFP80578.2| hypothetical protein PGTG_06534 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 639

 Score =  134 bits (337), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 1/100 (1%)

Query: 51  TNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGV 110
           T S  QS   A  G  + IPTAIVIKNIPFS++R+ LLA +  L IP PYAFNYHFDNGV
Sbjct: 158 TTSTNQS-GPAPEGDDDIIPTAIVIKNIPFSVRREQLLAIIEDLMIPLPYAFNYHFDNGV 216

Query: 111 FRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           FRGLAFAN+R+  + D  V+ LNG++++GRKLRVEYK+VL
Sbjct: 217 FRGLAFANFRSASEADAAVAGLNGFDISGRKLRVEYKKVL 256



 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 59/88 (67%)

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGE 275
           +LD+NDP+TL+ Y +V++F++DK R+EL F+K+LS   RR +  IA+KL L + +EG GE
Sbjct: 379 ELDMNDPQTLELYSRVVVFKEDKLRDELAFAKSLSGPQRRIVHQIAKKLGLVHRSEGVGE 438

Query: 276 DKVLRIVRKPASAAINIKQTPRNGSFGK 303
           ++ + + +  +  A  I +   + + G+
Sbjct: 439 ERFVVVSKLASGGAPRISRVASSANMGR 466



>gi|156841836|ref|XP_001644289.1| hypothetical protein Kpol_1030p41 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114928|gb|EDO16431.1| hypothetical protein Kpol_1030p41 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 603

 Score =  133 bits (334), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN++T E+T 
Sbjct: 59  EVIPTAIVIKNIPFAIKKEQLLEFIENLGLPLPYAFNYHFDNGVFRGLAFANFQTTEETT 118

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            V+  LNG E+ GRKLRVEYK++LP
Sbjct: 119 KVIDLLNGEEIGGRKLRVEYKKMLP 143



>gi|513031453|gb|AGO11477.1| AaceriACR235Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 577

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 75/94 (79%)

Query: 58  DSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFA 117
           D+ A+   ++ IPTAIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNGVFRGLAFA
Sbjct: 36  DAGAAPQGEDVIPTAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFA 95

Query: 118 NYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           N+ T E+T  VV  LNG E+ GR+LRVEYK++LP
Sbjct: 96  NFTTTEETMQVVQHLNGKEIGGRRLRVEYKKMLP 129



>gi|45185921|ref|NP_983637.1| ACR235Wp [Ashbya gossypii ATCC 10895]
 gi|44981711|gb|AAS51461.1| ACR235Wp [Ashbya gossypii ATCC 10895]
 gi|374106843|gb|AEY95752.1| FACR235Wp [Ashbya gossypii FDAG1]
          Length = 578

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 75/94 (79%)

Query: 58  DSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFA 117
           D+ A+   ++ IPTAIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNGVFRGLAFA
Sbjct: 36  DAGAAPQGEDVIPTAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFA 95

Query: 118 NYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           N+ T E+T  VV  LNG E+ GR+LRVEYK++LP
Sbjct: 96  NFTTTEETMQVVQHLNGKEIGGRRLRVEYKKMLP 129



>gi|366989193|ref|XP_003674364.1| hypothetical protein NCAS_0A14270 [Naumovozyma castellii CBS 4309]
 gi|342300227|emb|CCC67985.1| hypothetical protein NCAS_0A14270 [Naumovozyma castellii CBS 4309]
          Length = 621

 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (82%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+IKR+ LL  +  +D+P PYAFNYHFDNGVFRGLAFAN+ T ++T
Sbjct: 48  EDIIPTAIVIKNIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDET 107

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLP 151
             V+  LNG E+ GRKLRVEYK++LP
Sbjct: 108 TRVIECLNGKEIGGRKLRVEYKKMLP 133



>gi|255722443|ref|XP_002546156.1| predicted protein [Candida tropicalis MYA-3404]
 gi|240136645|gb|EER36198.1| predicted protein [Candida tropicalis MYA-3404]
          Length = 763

 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (84%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 183 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 242

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
           LVV+ LNG E+ GRKLRVEYK++LP
Sbjct: 243 LVVNQLNGREIGGRKLRVEYKKMLP 267



>gi|164657424|ref|XP_001729838.1| hypothetical protein MGL_2824 [Malassezia globosa CBS 7966]
 gi|159103732|gb|EDP42624.1| hypothetical protein MGL_2824 [Malassezia globosa CBS 7966]
          Length = 700

 Score =  131 bits (330), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 71/87 (81%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  + IPTAIVIKNIPF+IKR+ LL  +  L IP PYAFNYHFD G+FRGLAFAN+ +P 
Sbjct: 185 GEADIIPTAIVIKNIPFNIKREQLLHVIRDLGIPVPYAFNYHFDQGIFRGLAFANFHSPA 244

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVL 150
           D + VV+ALNG +V+GRKLRVEYK+VL
Sbjct: 245 DANEVVAALNGLDVSGRKLRVEYKKVL 271



>gi|459371117|gb|EMG49008.1| hypothetical protein G210_0323, partial [Candida maltosa Xu316]
          Length = 727

 Score =  131 bits (330), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (84%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 163 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 222

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
           LVV+ LNG E+ GRKLRVEYK++LP
Sbjct: 223 LVVNQLNGREIGGRKLRVEYKKMLP 247



>gi|255711438|ref|XP_002552002.1| KLTH0B04950p [Lachancea thermotolerans]
 gi|238933380|emb|CAR21564.1| KLTH0B04950p [Lachancea thermotolerans CBS 6340]
          Length = 580

 Score =  131 bits (329), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNGVFRGLAFAN+ T ++T 
Sbjct: 33  DVIPTAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFATTDETT 92

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV +LNG E+ GRKLRVEYK++LP
Sbjct: 93  QVVHSLNGKEIGGRKLRVEYKKMLP 117



>gi|50285043|ref|XP_444950.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524252|emb|CAG57843.1| unnamed protein product [Candida glabrata]
          Length = 639

 Score =  130 bits (328), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (82%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IP AIVIKNIPF+IK++ LL  +  + +P PYAFNYHFDNG+FRGLAFAN+ TPEDT
Sbjct: 51  EDVIPNAIVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDT 110

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLP 151
             V+S LNG E+ GRKL+VEYK++LP
Sbjct: 111 SRVISDLNGKEINGRKLKVEYKKMLP 136



>gi|50309675|ref|XP_454849.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643984|emb|CAG99936.1| KLLA0E19845p [Kluyveromyces lactis]
          Length = 592

 Score =  130 bits (327), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 73/87 (83%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
           A+E IPTAIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNGVFRGLAFAN+ T E+
Sbjct: 31  AEELIPTAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEE 90

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLP 151
           T  VV +LNG E+ GRKLRVEYK++LP
Sbjct: 91  TTTVVQSLNGKEIGGRKLRVEYKKMLP 117



>gi|68475166|ref|XP_718301.1| hypothetical protein CaO19.10069 [Candida albicans SC5314]
 gi|46440062|gb|EAK99372.1| hypothetical protein CaO19.10069 [Candida albicans SC5314]
          Length = 860

 Score =  130 bits (327), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 253 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 312

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV+ LNG E+ GRKLRVEYK++LP
Sbjct: 313 AVVNQLNGREIGGRKLRVEYKKMLP 337



>gi|68475359|ref|XP_718202.1| hypothetical protein CaO19.2534 [Candida albicans SC5314]
 gi|46439959|gb|EAK99270.1| hypothetical protein CaO19.2534 [Candida albicans SC5314]
          Length = 861

 Score =  130 bits (327), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 253 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 312

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV+ LNG E+ GRKLRVEYK++LP
Sbjct: 313 AVVNQLNGREIGGRKLRVEYKKMLP 337



>gi|406607166|emb|CCH41427.1| Polyadenylate-binding protein, cytoplasmic and nuclear
           [Wickerhamomyces ciferrii]
          Length = 877

 Score =  130 bits (326), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 293 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETT 352

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV+ LNG E+ GRKLRVEYK++LP
Sbjct: 353 AVVNLLNGREIGGRKLRVEYKKMLP 377



>gi|238879631|gb|EEQ43269.1| predicted protein [Candida albicans WO-1]
          Length = 763

 Score =  130 bits (326), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 253 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 312

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV+ LNG E+ GRKLRVEYK++LP
Sbjct: 313 AVVNQLNGREIGGRKLRVEYKKMLP 337



>gi|241958046|ref|XP_002421742.1| RNA-binding protein, putative; psi inducibility protein, putative
           [Candida dubliniensis CD36]
 gi|223645087|emb|CAX39682.1| RNA-binding protein, putative [Candida dubliniensis CD36]
          Length = 826

 Score =  130 bits (326), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           E IPTAIVIKNIPF+IK++ LL  +  L++P PYAFNYHFDNGVFRGLAFAN+ + ++T 
Sbjct: 238 ELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDETS 297

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            VV+ LNG E+ GRKLRVEYK++LP
Sbjct: 298 AVVNQLNGREIGGRKLRVEYKKMLP 322



>gi|471894780|emb|CCO31444.1| RNA-binding post-transcriptional regulator cip2 AltName:
           Full=Csx1-interacting protein 2 [Rhizoctonia solani AG-1
           IB]
          Length = 547

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 1/85 (1%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R P+D 
Sbjct: 129 EIIPTAIVIKNIPFTVKRETLLDIIASLSIPTPYAFNYHLDTQGQFRGLAFANFRLPQDA 188

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVL 150
           D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 189 DAVVAALNGFDVQGRKLRVEYKKVL 213



 Score = 80.5 bits (197), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 53/71 (74%)

Query: 213 APDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEG 272
           A ++LD+NDP TL+ Y ++++F++D  R+EL FS+TL+   RR + L+AQKL +Y+Y+ G
Sbjct: 314 ASNELDMNDPSTLEIYSRILVFKEDHMRDELAFSRTLTPKQRRVVHLVAQKLGVYHYSVG 373

Query: 273 DGEDKVLRIVR 283
           +GE++   + R
Sbjct: 374 EGENRYAVVTR 384



>gi|443925376|gb|ELU44229.1| RRM/R3H domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 1787

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 1/85 (1%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R P+D 
Sbjct: 135 EIIPTAIVIKNIPFTVKRETLLDIIASLSIPTPYAFNYHLDTQGQFRGLAFANFRLPQDA 194

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVL 150
           D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 195 DAVVAALNGFDVQGRKLRVEYKKVL 219



 Score = 80.5 bits (197), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 53/71 (74%)

Query: 213 APDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEG 272
           A ++LD+NDP TL+ Y ++++F++D  R+EL FS+TL+   RR + L+AQKL +Y+Y+ G
Sbjct: 318 ASNELDMNDPSTLEIYSRILVFKEDHMRDELAFSRTLTPKQRRVVHLVAQKLGVYHYSVG 377

Query: 273 DGEDKVLRIVR 283
           +GE++   + R
Sbjct: 378 EGENRYAVVTR 388



>gi|393245724|gb|EJD53234.1| hypothetical protein AURDEDRAFT_110935 [Auricularia delicata
           TFB-10046 SS5]
          Length = 527

 Score =  128 bits (322), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 137/271 (50%), Gaps = 56/271 (20%)

Query: 59  SEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFA 117
           ++   G  E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFA
Sbjct: 94  AQTPAGDDEIIPTAIVIKNIPFNVKRETLLDIIASLAIPTPYAFNYHLDPQGNFRGLAFA 153

Query: 118 NYRTPEDTDLVVSALNGYEV--------------AGRKLRVEYKRVLPXXXXXXXXXXXX 163
           N+R   D D VV+ALNG++V              AG K R+E ++ L             
Sbjct: 154 NFRAAADADAVVAALNGFDVQGRKLRVEYKKVLQAGEKERIEREKAL----------RRM 203

Query: 164 XXXXXDKEKVDQEPL----LIKTDNDFLDKPKIDKSDNGRNDKEKRDSTI---------- 209
                +KE+  Q P      + T      +P    + +G     +  S            
Sbjct: 204 RSMQLEKEQSGQTPFDDFGPVGTPAYSATRPFPTSNVSGYGFPPQAQSPPLPASLPQQSF 263

Query: 210 ----------KSPAPD-------QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSA 252
                      SP P        +LDLNDP TL+ Y ++++F+DD+ R+EL FS++L+  
Sbjct: 264 LGSQQPYVPPTSPGPKSAGNATTELDLNDPSTLEIYSRILLFKDDRMRDELAFSRSLAPK 323

Query: 253 HRRTLQLIAQKLQLYYYNEGDGEDKVLRIVR 283
            RR + LIA+KL LY+Y+ G+G D+   + R
Sbjct: 324 ERRVVHLIAKKLGLYHYSVGEGADRYAVVTR 354



>gi|444314831|ref|XP_004178073.1| hypothetical protein TBLA_0A07650 [Tetrapisispora blattae CBS 6284]
 gi|387511112|emb|CCH58554.1| hypothetical protein TBLA_0A07650 [Tetrapisispora blattae CBS 6284]
          Length = 736

 Score =  128 bits (321), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 71/86 (82%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPF+IK++ LL  +  +++P PYAFNYHFDNGVFRGLAFAN+   E+T
Sbjct: 77  EDVIPTAIVIKNIPFAIKKEQLLDVIAKMELPLPYAFNYHFDNGVFRGLAFANFTNSEET 136

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLP 151
             V++ LNG E+ GRKLRVEYK++LP
Sbjct: 137 VKVITNLNGKEIGGRKLRVEYKKMLP 162



>gi|50550803|ref|XP_502874.1| YALI0D15752p [Yarrowia lipolytica]
 gi|49648742|emb|CAG81062.1| YALI0D15752p [Yarrowia lipolytica CLIB122]
          Length = 474

 Score =  127 bits (320), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF+IK++ LL  +  L +P PYAFNYHFDNGVFRGLAFAN+ T ++T  V
Sbjct: 215 IPTAIVIKNIPFAIKKEQLLDVMTQLRLPLPYAFNYHFDNGVFRGLAFANFTTADETAAV 274

Query: 129 VSALNGYEVAGRKLRVEYKRVLP 151
           + +LNG E+ GRKLRVEYK++LP
Sbjct: 275 IGSLNGREIGGRKLRVEYKKMLP 297



>gi|367011553|ref|XP_003680277.1| hypothetical protein TDEL_0C01770 [Torulaspora delbrueckii]
 gi|359747936|emb|CCE91066.1| hypothetical protein TDEL_0C01770 [Torulaspora delbrueckii]
          Length = 632

 Score =  127 bits (319), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 70/85 (82%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IPTAIVIKNIPF+IK++ LL  +  LD+P PYAFNYHFDNGVFRGLAFAN+    +T 
Sbjct: 41  DVIPTAIVIKNIPFAIKKEQLLDVIANLDLPLPYAFNYHFDNGVFRGLAFANFTNTNETT 100

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            V+++LNG E+ GRKLRVE+K++LP
Sbjct: 101 QVLNSLNGKEIGGRKLRVEFKKMLP 125



>gi|254578186|ref|XP_002495079.1| ZYRO0B02860p [Zygosaccharomyces rouxii]
 gi|238937969|emb|CAR26146.1| ZYRO0B02860p [Zygosaccharomyces rouxii]
          Length = 688

 Score =  127 bits (319), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (75%), Gaps = 5/103 (4%)

Query: 49  KTTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN 108
           K T S+ Q   E     ++ IPTAIVIKNIPF+IK++ LL  +  +++P PYAFNYHFDN
Sbjct: 39  KDTKSSTQQQQE-----EDVIPTAIVIKNIPFAIKKEQLLDVIAKMELPLPYAFNYHFDN 93

Query: 109 GVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           GVFRGLAFAN+   ++T  V+++LNG E+ GRKLRVEYK++LP
Sbjct: 94  GVFRGLAFANFTNTDETTKVLTSLNGKEIGGRKLRVEYKKMLP 136



>gi|410084657|ref|XP_003959905.1| hypothetical protein KAFR_0L01600 [Kazachstania africana CBS 2517]
 gi|372466498|emb|CCF60770.1| hypothetical protein KAFR_0L01600 [Kazachstania africana CBS 2517]
          Length = 570

 Score =  127 bits (318), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 71/85 (83%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IP AIVIKNIPF++K++ LL  ++ + +P PYAFNYHFDNG+FRGLAFAN+ TP++T 
Sbjct: 21  DVIPNAIVIKNIPFAVKKEQLLDIISDMCLPLPYAFNYHFDNGIFRGLAFANFTTPDETM 80

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
           LV+  LNG E+ GRKL+VEYK++LP
Sbjct: 81  LVIENLNGKEINGRKLKVEYKKLLP 105



>gi|50290079|ref|XP_447471.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526781|emb|CAG60408.1| unnamed protein product [Candida glabrata]
          Length = 604

 Score =  126 bits (316), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 67/83 (80%)

Query: 69  IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLV 128
           IPTAIVIKNIPF++KR+ LL  + +LD+P PYAFNYHFDNG FRGLAFANY +  DT  V
Sbjct: 64  IPTAIVIKNIPFALKREQLLDFMTSLDLPLPYAFNYHFDNGTFRGLAFANYNSEVDTAKV 123

Query: 129 VSALNGYEVAGRKLRVEYKRVLP 151
           V+ LN  EV GR LRVEYK+VLP
Sbjct: 124 VNELNEKEVGGRNLRVEYKKVLP 146



>gi|363752651|ref|XP_003646542.1| hypothetical protein Ecym_4705 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356890177|gb|AET39725.1| hypothetical protein Ecym_4705 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 609

 Score =  126 bits (316), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/87 (65%), Positives = 72/87 (82%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPED 124
            ++ IPTAIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNGVFRGLAFAN+ T E+
Sbjct: 59  GEDVIPTAIVIKNIPFAIKKEQLLGVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEE 118

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVLP 151
           T  VV +LNG E+ GR+LRVEYK++LP
Sbjct: 119 TTQVVESLNGKEIGGRRLRVEYKKMLP 145



>gi|367001793|ref|XP_003685631.1| hypothetical protein TPHA_0E01030 [Tetrapisispora phaffii CBS 4417]
 gi|357523930|emb|CCE63197.1| hypothetical protein TPHA_0E01030 [Tetrapisispora phaffii CBS 4417]
          Length = 623

 Score =  124 bits (312), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (80%)

Query: 68  TIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDL 127
            IPTAIVIKNIPF+IK++ LL  +    +P PYAFNYHFDNGVFRGLAFAN+++ ++T  
Sbjct: 64  VIPTAIVIKNIPFAIKKEQLLEFIEKKGLPLPYAFNYHFDNGVFRGLAFANFQSTDETTK 123

Query: 128 VVSALNGYEVAGRKLRVEYKRVLP 151
           V+  LNG E+ GRKLRVEYK++LP
Sbjct: 124 VIDVLNGEEIGGRKLRVEYKKMLP 147



>gi|170094186|ref|XP_001878314.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646768|gb|EDR11013.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 536

 Score =  124 bits (310), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTPED 124
           +E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R   D
Sbjct: 111 EEIIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDQQGSFRGLAFANFRQSAD 170

Query: 125 TDLVVSALNGYEVAGRKLRVEYKRVL 150
            D VV ALNG++V GRKLRVEYK+VL
Sbjct: 171 ADAVVVALNGFDVQGRKLRVEYKKVL 196



 Score = 84.7 bits (208), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 53/69 (76%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLNDP TL+ Y ++++F+DD+ R+EL FS+TLS   RR + LIAQKL +Y+Y+ G+G
Sbjct: 302 NELDLNDPSTLEIYSRILLFKDDRMRDELAFSRTLSPKQRRVVHLIAQKLGVYHYSVGEG 361

Query: 275 EDKVLRIVR 283
           E++   + R
Sbjct: 362 EERYAVVTR 370



>gi|156839391|ref|XP_001643387.1| hypothetical protein Kpol_479p17 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113995|gb|EDO15529.1| hypothetical protein Kpol_479p17 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 507

 Score =  123 bits (309), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 69/86 (80%)

Query: 66  QETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDT 125
           ++ IPTAIVIKNIPFS+KR+ LL  +  LD+P PYAFNYHFDNGVFRGLAFAN+ T  + 
Sbjct: 25  EDVIPTAIVIKNIPFSVKREQLLDFMTELDLPLPYAFNYHFDNGVFRGLAFANFSTSIEA 84

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVLP 151
             ++ +LNG ++ GRKLRVE K++LP
Sbjct: 85  QQIIDSLNGRDIGGRKLRVELKKMLP 110



>gi|336367805|gb|EGN96149.1| hypothetical protein SERLA73DRAFT_185740 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336380538|gb|EGO21691.1| hypothetical protein SERLADRAFT_474425 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 538

 Score =  123 bits (309), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/91 (64%), Positives = 70/91 (76%), Gaps = 1/91 (1%)

Query: 61  ASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANY 119
           + N   E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+
Sbjct: 122 SQNADDEIIPTAIVIKNIPFNVKRETLLDIIASLSIPTPYAFNYHLDQQGSFRGLAFANF 181

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           R   D D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 182 RQSIDADAVVAALNGFDVQGRKLRVEYKKVL 212



 Score = 89.0 bits (219), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 56/74 (75%)

Query: 210 KSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYY 269
           K+ A  +LDLNDP TL+ Y +V++FRDD+ R+EL FS+TL+   RRT+ LIAQKL +Y+Y
Sbjct: 305 KATASAELDLNDPSTLEIYSRVLLFRDDRMRDELAFSRTLTPKQRRTVHLIAQKLGVYHY 364

Query: 270 NEGDGEDKVLRIVR 283
           + G+GED+   + R
Sbjct: 365 SVGEGEDRYAVVTR 378



>gi|343424857|emb|CBQ68395.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 694

 Score =  123 bits (308), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
           +Q D   + G  + IPTAIV+KNIPFS+KR+ LL  +  L IP PYAFNYH D GVFRGL
Sbjct: 181 SQQDVTPAGGDDDVIPTAIVVKNIPFSVKREQLLQIIEDLGIPMPYAFNYHMDQGVFRGL 240

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           AFAN+R+ E+ D VV+ALNG++V+GRKLRVEYK+VL
Sbjct: 241 AFANFRSAEEADAVVAALNGFDVSGRKLRVEYKKVL 276



 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 54/69 (78%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLND  TL+ Y +V++F+DD+ R+EL FS++L+   RRT+ L+AQ+L L++Y+ G+G
Sbjct: 413 EELDLNDAATLEIYSRVLLFKDDRMRDELSFSRSLTPLERRTVHLVAQRLGLFHYSMGEG 472

Query: 275 EDKVLRIVR 283
           +++ + + +
Sbjct: 473 DERYVIVTK 481



>gi|443896833|dbj|GAC74176.1| mRNA cleavage and polyadenylation factor I complex, subunit RNA15
           [Pseudozyma antarctica T-34]
          Length = 720

 Score =  122 bits (307), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 75/89 (84%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRT 121
           ++G  + IPTAIV+KNIPFS+KR+ LL  +  L IP PYAFNYHFD G+FRGLAFAN+R+
Sbjct: 215 ASGDDDVIPTAIVVKNIPFSVKREQLLEIIGDLGIPMPYAFNYHFDQGIFRGLAFANFRS 274

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
            E+ D VV+ALNG++V+GRKLRVEYK+VL
Sbjct: 275 AEEADAVVAALNGFDVSGRKLRVEYKKVL 303



 Score = 80.5 bits (197), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 56/74 (75%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLND  TL+ Y +V++F+DD+ R+EL FS++L+   RRT+ L+AQ+L L++Y+ GDG
Sbjct: 429 EELDLNDAATLEIYSRVLLFKDDRMRDELAFSRSLTPMERRTVHLVAQRLGLFHYSLGDG 488

Query: 275 EDKVLRIVRKPASA 288
           +++ + + +   SA
Sbjct: 489 DERYVIVTKNEVSA 502



>gi|403214190|emb|CCK68691.1| hypothetical protein KNAG_0B02500 [Kazachstania naganishii CBS
           8797]
          Length = 698

 Score =  122 bits (305), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTD 126
           + IP AIVIKNIPF+IK++ LL  +  +D+P PYAFNYHFDNG+FRGLAFAN+ T ++T 
Sbjct: 50  DVIPNAIVIKNIPFAIKKEQLLDIIEDMDLPLPYAFNYHFDNGIFRGLAFANFTTADETY 109

Query: 127 LVVSALNGYEVAGRKLRVEYKRVLP 151
            V++ LNG ++ GRKL+VEYK++LP
Sbjct: 110 QVINNLNGKDINGRKLKVEYKKMLP 134



>gi|388855760|emb|CCF50544.1| uncharacterized protein [Ustilago hordei]
          Length = 718

 Score =  120 bits (301), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/90 (66%), Positives = 73/90 (81%)

Query: 61  ASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYR 120
           AS G  + IPTAIV+KNIPFS+ R+ LL  +  L IP PYAFNYH D GVFRGLAFAN+R
Sbjct: 202 ASGGDDDVIPTAIVLKNIPFSVTREQLLQIIEDLGIPMPYAFNYHMDQGVFRGLAFANFR 261

Query: 121 TPEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           + E+ D VV+ALNG++V+GRKLRVEYK+VL
Sbjct: 262 SAEEADAVVAALNGFDVSGRKLRVEYKKVL 291



>gi|71019375|ref|XP_759918.1| hypothetical protein UM03771.1 [Ustilago maydis 521]
 gi|46099573|gb|EAK84806.1| hypothetical protein UM03771.1 [Ustilago maydis 521]
          Length = 738

 Score =  119 bits (298), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (67%), Gaps = 15/133 (11%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANYRTPE 123
           G  + IPTAIV+KNIPFS+K++ LL  +  L IP PYAFNYH D GVFRGLAFAN+R+ E
Sbjct: 220 GDDDVIPTAIVVKNIPFSVKKEQLLQIIEDLGIPMPYAFNYHMDQGVFRGLAFANFRSAE 279

Query: 124 DTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLIKTD 183
           + D VV+ALNG++V+GRKLRVEYK+VL                  +KE++++E  + +  
Sbjct: 280 EADAVVAALNGFDVSGRKLRVEYKKVL---------------QAGEKERIEKEKAIKRMQ 324

Query: 184 NDFLDKPKIDKSD 196
           +  L+K +  ++D
Sbjct: 325 SMQLEKERRRQND 337



 Score = 78.2 bits (191), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 53/69 (76%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLND  TL+ Y +V++F+DD+ R+EL FS++L+   RRT+ L+AQ+L L++Y+ GDG
Sbjct: 435 EELDLNDAATLEIYSRVLLFKDDRMRDELAFSRSLTPLERRTVHLVAQRLGLFHYSMGDG 494

Query: 275 EDKVLRIVR 283
           +++   + +
Sbjct: 495 DERYAIVTK 503



>gi|402218448|gb|EJT98525.1| hypothetical protein DACRYDRAFT_24545 [Dacryopinax sp. DJM-731 SS1]
          Length = 604

 Score =  115 bits (288), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (66%), Gaps = 16/130 (12%)

Query: 62  SNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYR 120
           +NG ++ IPTAIVIKNIPF++KR+ LL  + +L+IP PYAFNYH D  G FRGLAFAN+R
Sbjct: 125 ANGDEDIIPTAIVIKNIPFNVKRETLLDIIASLNIPTPYAFNYHLDALGAFRGLAFANFR 184

Query: 121 TPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXXDKEKVDQEPLLI 180
              D D VV+ALNG++V GRKLRVEYK+VL                  +KE++++E  L 
Sbjct: 185 QAADADAVVAALNGFDVQGRKLRVEYKKVL---------------QAGEKERIEREKALR 229

Query: 181 KTDNDFLDKP 190
           +  +   D+P
Sbjct: 230 RMRSMGFDRP 239



 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 58/81 (71%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           +++D+NDP TL  Y ++++F+DD+ R+EL FS+TL+   RRT+ LIAQKL +Y+Y+ G+G
Sbjct: 326 NEIDMNDPTTLDIYSRILLFKDDRMRDELAFSRTLTPKQRRTVHLIAQKLGVYHYSVGEG 385

Query: 275 EDKVLRIVRKPASAAINIKQT 295
           +D+   + R+P      ++ +
Sbjct: 386 DDRYAVVTREPPEGRTPVRHS 406



>gi|169853603|ref|XP_001833481.1| RRM/R3H domain-containing protein [Coprinopsis cinerea
           okayama7#130]
 gi|116505520|gb|EAU88415.1| RRM/R3H domain-containing protein [Coprinopsis cinerea
           okayama7#130]
          Length = 560

 Score =  115 bits (287), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 56  QSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGL 114
           QS +    G ++ IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGL
Sbjct: 117 QSTASGPAGDEDIIPTAIVIKNIPFNVKRETLLDIITSLSIPTPYAFNYHLDQQGQFRGL 176

Query: 115 AFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           AFAN+R   D D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 177 AFANFRQAADADAVVAALNGFDVQGRKLRVEYKKVL 212



 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 51/68 (75%)

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGE 275
           +LDLNDP TL+ Y ++++F+DD  R+EL FS+TL+   RR + LIAQKL +Y+Y+ G+G+
Sbjct: 323 ELDLNDPSTLEIYSRILLFKDDPMRDELAFSRTLTPKQRRIVHLIAQKLGVYHYSVGEGD 382

Query: 276 DKVLRIVR 283
           ++   + R
Sbjct: 383 ERYAVVTR 390



>gi|353237623|emb|CCA69592.1| hypothetical protein PIIN_03531 [Piriformospora indica DSM 11827]
          Length = 637

 Score =  114 bits (285), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 100/166 (60%), Gaps = 20/166 (12%)

Query: 50  TTNSAAQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-N 108
           +TN       +++    + IPTAIVIKNIPF++KR+ LL  +++L IP PYAFNYH D  
Sbjct: 93  STNQQTLGGVQSAGAEDDIIPTAIVIKNIPFNVKRETLLDIISSLSIPTPYAFNYHLDPA 152

Query: 109 GVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLPXXXXXXXXXXXXXXXXX 168
           G FRGLAFAN+R   D D VV+ALNG++V GRKLRVEYK+VL                  
Sbjct: 153 GQFRGLAFANFRVAADADAVVAALNGFDVQGRKLRVEYKKVL---------------QAG 197

Query: 169 DKEKVDQEPLLIKTDNDFLDKPKIDKSDNGRNDKEKRDSTIKSPAP 214
           +KE++++E  L +  +  L+K + +++      ++  +S +  P P
Sbjct: 198 EKERIEREKALRRMHSMKLEKERHEQAQ----QQQMMNSGMGGPIP 239



 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 52/69 (75%)

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGE 275
           +LD+NDP TL+ Y +V++F+DD  R+EL F+++LS   RR + L+AQKL +Y+Y+ G+G+
Sbjct: 316 ELDMNDPATLEIYSRVLLFKDDHMRDELAFARSLSPKQRRIVHLVAQKLGVYHYSIGEGD 375

Query: 276 DKVLRIVRK 284
           ++   + R+
Sbjct: 376 ERYAVVTRR 384



>gi|512200881|gb|EPE29713.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868]
          Length = 875

 Score =  114 bits (284), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 71/92 (77%), Gaps = 3/92 (3%)

Query: 63  NGAQET---IPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGLAFANY 119
           NGA+E+   IPTA+VIKNIPF+ +++  +A ++ + +P PYA NYHFD GVFRGLAFAN+
Sbjct: 101 NGARESDEFIPTAVVIKNIPFAFRKEQFIALVSEMRLPLPYALNYHFDKGVFRGLAFANF 160

Query: 120 RTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
            + ++T L + ++N  EV GR+LRVE+K +LP
Sbjct: 161 SSAQETRLFIDSMNEREVQGRRLRVEHKSMLP 192



>gi|449547697|gb|EMD38665.1| hypothetical protein CERSUDRAFT_113840, partial [Ceriporiopsis
           subvermispora B]
          Length = 542

 Score =  112 bits (280), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (78%), Gaps = 1/89 (1%)

Query: 63  NGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRT 121
            G  E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D +G FRGLAFAN+R 
Sbjct: 124 GGDDEIIPTAIVIKNIPFNVKRETLLDIIASLAIPTPYAFNYHLDQSGQFRGLAFANFRQ 183

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
             D D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 184 AADADAVVAALNGFDVQGRKLRVEYKKVL 212



 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 57/77 (74%), Gaps = 1/77 (1%)

Query: 207 STIKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQL 266
           S  KSP+ ++LDLND  TL+ Y ++++F+DD+ R+EL FS+TL+   RR + L+AQKL +
Sbjct: 308 SVAKSPS-NELDLNDASTLEIYSRILLFKDDRMRDELAFSRTLTPKQRRVVHLVAQKLGV 366

Query: 267 YYYNEGDGEDKVLRIVR 283
           Y+Y+ G+G+++   + R
Sbjct: 367 YHYSVGEGDERYAVVTR 383



>gi|395330072|gb|EJF62456.1| hypothetical protein DICSQDRAFT_58188 [Dichomitus squalens LYAD-421
           SS1]
          Length = 541

 Score =  112 bits (280), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (79%), Gaps = 1/88 (1%)

Query: 64  GAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTP 122
           G  E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D +G FRGLAFAN+R  
Sbjct: 129 GDDEIIPTAIVIKNIPFNVKRETLLDIIASLAIPTPYAFNYHLDQSGQFRGLAFANFRQA 188

Query: 123 EDTDLVVSALNGYEVAGRKLRVEYKRVL 150
            D D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 189 SDADAVVAALNGFDVQGRKLRVEYKKVL 216



 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 52/69 (75%)

Query: 215 DQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDG 274
           ++LDLNDP TL+ Y ++++F+DD  R+EL FS+ L++  RR + L+AQKL +Y+Y+ G+G
Sbjct: 318 NELDLNDPSTLEIYSRILLFKDDPMRDELAFSRALTAKQRRVVHLVAQKLGVYHYSVGEG 377

Query: 275 EDKVLRIVR 283
           +++   + R
Sbjct: 378 DERYAVVTR 386



>gi|392596031|gb|EIW85354.1| hypothetical protein CONPUDRAFT_118133 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 547

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 1/85 (1%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D  G FRGLAFAN+R   D 
Sbjct: 124 EIIPTAIVIKNIPFNVKRETLLDIIASLAIPTPYAFNYHLDQQGAFRGLAFANFRQAIDA 183

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVL 150
           D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 184 DAVVAALNGFDVQGRKLRVEYKKVL 208



 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 54/74 (72%)

Query: 210 KSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYY 269
           K+ A  +LDLNDP TL+ Y ++++F+DD  R+EL FS+TLS   RR + LIAQKL +Y+Y
Sbjct: 310 KTAANTELDLNDPSTLEIYSRILLFKDDPMRDELAFSRTLSPKQRRVVHLIAQKLGVYHY 369

Query: 270 NEGDGEDKVLRIVR 283
           + G+G+++   + R
Sbjct: 370 SVGEGDERYAVVTR 383



>gi|389741327|gb|EIM82516.1| hypothetical protein STEHIDRAFT_103023 [Stereum hirsutum FP-91666
           SS1]
          Length = 589

 Score =  111 bits (278), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D +G FRGLAFAN+R   D 
Sbjct: 130 EIIPTAIVIKNIPFNVKRETLLDIIVSLSIPTPYAFNYHLDQSGSFRGLAFANFRQASDA 189

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVL 150
           D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 190 DAVVAALNGFDVQGRKLRVEYKKVL 214



 Score = 87.4 bits (215), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 57/75 (76%), Gaps = 1/75 (1%)

Query: 209 IKSPAPDQLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYY 268
           +KSP+ ++LDLNDP TL+ Y ++++F+DD  R+EL FS+TLS   RR + LIAQKL +Y+
Sbjct: 339 VKSPS-NELDLNDPSTLEIYSRILLFKDDPMRDELAFSRTLSPKQRRVVHLIAQKLGVYH 397

Query: 269 YNEGDGEDKVLRIVR 283
           Y+ G+GED+   + R
Sbjct: 398 YSTGEGEDRHAVVTR 412



>gi|403417139|emb|CCM03839.1| predicted protein [Fibroporia radiculosa]
          Length = 535

 Score =  110 bits (275), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)

Query: 67  ETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFD-NGVFRGLAFANYRTPEDT 125
           E IPTAIVIKNIPF++KR+ LL  + +L IP PYAFNYH D +G FRGLAFAN+R   D 
Sbjct: 131 EIIPTAIVIKNIPFNVKRETLLEIITSLSIPTPYAFNYHLDQSGQFRGLAFANFRQALDA 190

Query: 126 DLVVSALNGYEVAGRKLRVEYKRVL 150
           D VV+ALNG++V GRKLRVEYK+VL
Sbjct: 191 DAVVAALNGFDVQGRKLRVEYKKVL 215



 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 52/68 (76%)

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGE 275
           +LDLNDP TL+ Y ++++F+DD+ R+EL FS+TLS   RR + L+AQ+L +Y+Y+ G+GE
Sbjct: 315 ELDLNDPSTLEIYSRILLFKDDRMRDELAFSRTLSPKQRRVVHLVAQRLGVYHYSVGEGE 374

Query: 276 DKVLRIVR 283
           ++   + R
Sbjct: 375 ERYAVVTR 382



>gi|342319827|gb|EGU11773.1| Hypothetical Protein RTG_02241 [Rhodotorula glutinis ATCC 204091]
          Length = 813

 Score =  106 bits (264), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%), Gaps = 3/89 (3%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHF---DNGVFRGLAFANYRT 121
            +E I TAIVIK+IPF+  R+ LLA + +L +P P+AFNYH+   D   FRGLAFAN+RT
Sbjct: 219 GEEIIETAIVIKSIPFACPREQLLAIMASLALPAPFAFNYHYAAEDPTSFRGLAFANFRT 278

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           P +  +V +A++G EV GRKLR E+K+ L
Sbjct: 279 PSEASIVRAAMDGLEVMGRKLRAEFKKAL 307



>gi|472583709|gb|EMS21333.1| RRM/R3H domain containing protein [Rhodosporidium toruloides NP11]
          Length = 806

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%), Gaps = 3/89 (3%)

Query: 65  AQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHF---DNGVFRGLAFANYRT 121
            +E I TAIVIK+IPF+  R+ LLA + +L +P P+AFNYH+   D   FRGLAFAN+RT
Sbjct: 213 GEEIIETAIVIKSIPFACPREQLLAIMASLALPAPFAFNYHYAAEDPTSFRGLAFANFRT 272

Query: 122 PEDTDLVVSALNGYEVAGRKLRVEYKRVL 150
           P +  +V +A++G EV GRKLR E+K+ L
Sbjct: 273 PSEASIVRAAMDGLEVMGRKLRAEFKKAL 301



>gi|465795920|emb|CCV00352.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 137

 Score =  104 bits (259), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/82 (59%), Positives = 60/82 (73%)

Query: 55  AQSDSEASNGAQETIPTAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDNGVFRGL 114
             S   A +G  + IPTAIVIKNIPF+IKR+ LL  +  L IP PYAFNYHFD G+FRGL
Sbjct: 49  GNSLPAAVSGETDIIPTAIVIKNIPFNIKREQLLHVIRDLGIPVPYAFNYHFDQGIFRGL 108

Query: 115 AFANYRTPEDTDLVVSALNGYE 136
           AFAN+ +P + + VV+ALNG E
Sbjct: 109 AFANFHSPVEANEVVNALNGLE 130



>gi|323338781|gb|EGA79996.1| Pin4p [Saccharomyces cerevisiae Vin13]
          Length = 561

 Score =  103 bits (256), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 53/58 (91%)

Query: 94  LDIPKPYAFNYHFDNGVFRGLAFANYRTPEDTDLVVSALNGYEVAGRKLRVEYKRVLP 151
           +D+P PYAFNYHFDNG+FRGLAFAN+ TPE+T  V+++LNG E++GRKL+VEYK++LP
Sbjct: 1   MDLPLPYAFNYHFDNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKVEYKKMLP 58



>gi|66808135|ref|XP_637790.1| hypothetical protein DDB_G0286331 [Dictyostelium discoideum AX4]
 gi|60466279|gb|EAL64341.1| hypothetical protein DDB_G0286331 [Dictyostelium discoideum AX4]
          Length = 922

 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 71  TAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDTDLVV 129
           + +V+KN+PF++K+  L   L  ++   P + N+H+DN GVFRG+AF  YR  ED   V 
Sbjct: 306 STLVLKNLPFNLKQVQLQEILEGINPSAPQSVNFHYDNIGVFRGMAFVKYRLVEDAVKVF 365

Query: 130 SALNGYEVAGRKLRVEYKR 148
            ALNG +V GR++R+EYKR
Sbjct: 366 DALNGTDVHGRRVRLEYKR 384



>gi|238611803|ref|XP_002398060.1| hypothetical protein MPER_01403 [Moniliophthora perniciosa FA553]
 gi|215473815|gb|EEB98990.1| hypothetical protein MPER_01403 [Moniliophthora perniciosa FA553]
          Length = 193

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 59/85 (69%), Gaps = 4/85 (4%)

Query: 216 QLDLNDPETLKFYDQVIIFRDDKSREELVFSKTLSSAHRRTLQLIAQKLQLYYYNEGDGE 275
           +LDLNDP TL+ Y ++++F+DD+ R+EL FS+TL+   RR + LIAQKL +Y+Y+ G+G+
Sbjct: 92  ELDLNDPSTLEIYSRILLFKDDRMRDELAFSRTLTPKQRRVVHLIAQKLGVYHYSVGEGD 151

Query: 276 DKVLRIVRKPASAAINIKQTPRNGS 300
           ++   + R       N +Q PR+ S
Sbjct: 152 ERYAVVTR----IDPNRQQQPRSTS 172



>gi|330800378|ref|XP_003288214.1| hypothetical protein DICPUDRAFT_79027 [Dictyostelium purpureum]
 gi|325081784|gb|EGC35288.1| hypothetical protein DICPUDRAFT_79027 [Dictyostelium purpureum]
          Length = 835

 Score = 78.6 bits (192), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 71  TAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDTDLVV 129
           + +V+KN+PF++++  L   L  ++   P + N+H+DN GVFRG+AF  YR  ED   V 
Sbjct: 250 STLVLKNLPFNLRQLQLQEILEGINPSAPQSVNFHYDNIGVFRGMAFVKYRLVEDAVKVY 309

Query: 130 SALNGYEVAGRKLRVEYKR 148
            ALNG +V GR++R+EYKR
Sbjct: 310 EALNGADVHGRRVRLEYKR 328



>gi|281207962|gb|EFA82140.1| hypothetical protein PPL_04560 [Polysphondylium pallidum PN500]
          Length = 600

 Score = 77.0 bits (188), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 71  TAIVIKNIPFSIKRDALLATLNTLDIPKPYAFNYHFDN-GVFRGLAFANYRTPEDTDLVV 129
           + +V+KN+PF++++  L   L  ++   P + N+H+D+ GVFRG+AF  YR  ED   V 
Sbjct: 191 STLVLKNLPFNLRQVQLQEILENINPSAPQSVNFHYDSIGVFRGMAFVKYRLLEDAIKVF 250

Query: 130 SALNGYEVAGRKLRVEYKR 148
            ALNG +V GR++R+EYKR
Sbjct: 251 DALNGADVHGRRVRLEYKR 269