BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10054_c0_seq1-m.22 5prime_partial 1-1125(+) 375 (+)
         (374 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511003159|gb|EPB84571.1| hypothetical protein HMPREF1544_0866...   305   1e-80   Mucor circinelloides f. circinelloides 1006PhL
gi|510999985|gb|EPB81557.1| hypothetical protein HMPREF1544_1170...   291   2e-76   Mucor circinelloides f. circinelloides 1006PhL
gi|384485200|gb|EIE77380.1| hypothetical protein RO3G_02084 [Rhi...   275   2e-71   Rhizopus delemar RA 99-880
gi|348671552|gb|EGZ11373.1| hypothetical protein PHYSODRAFT_3524...   230   4e-58   Phytophthora sojae
gi|348671557|gb|EGZ11378.1| hypothetical protein PHYSODRAFT_3524...   230   6e-58   Phytophthora sojae
gi|301096227|ref|XP_002897211.1| choline/ethanolamine kinase, pu...   221   4e-55   Phytophthora infestans T30-4
gi|299755103|ref|XP_001828432.2| protein kinase subdomain-contai...   219   1e-54   Coprinopsis cinerea okayama7#130
gi|449550651|gb|EMD41615.1| hypothetical protein CERSUDRAFT_4228...   218   2e-54   Gelatoporia subvermispora B
gi|460374761|ref|XP_004233178.1| PREDICTED: probable mitochondri...   217   4e-54   
gi|409051357|gb|EKM60833.1| hypothetical protein PHACADRAFT_2470...   217   4e-54   Phanerochaete carnosa HHB-10118-sp
gi|325184869|emb|CCA19361.1| unnamed protein product [Albugo lai...   211   3e-52   Albugo laibachii Nc14
gi|340975826|gb|EGS22941.1| choline kinase-like protein [Chaetom...   210   5e-52   Chaetomium thermophilum var. thermophilum DSM 1495
gi|508727709|gb|EOY19606.1| Kinase superfamily protein isoform 4...   208   2e-51   Theobroma cacao [chocolate]
gi|460384271|ref|XP_004237836.1| PREDICTED: choline/ethanolamine...   207   3e-51   Solanum lycopersicum
gi|508727706|gb|EOY19603.1| Kinase superfamily protein isoform 1...   207   4e-51   Theobroma cacao [chocolate]
gi|482571183|gb|EOA35371.1| hypothetical protein CARUB_v10020564...   207   5e-51   Capsella rubella
gi|168046258|ref|XP_001775591.1| predicted protein [Physcomitrel...   207   6e-51   Physcomitrella patens
gi|118486233|gb|ABK94958.1| unknown [Populus trichocarpa]             206   6e-51   Populus trichocarpa [western balsam poplar]
gi|224073007|ref|XP_002303949.1| predicted protein [Populus tric...   206   8e-51   
gi|363808234|ref|NP_001241979.1| uncharacterized protein LOC1007...   205   2e-50   Glycine max [soybeans]
gi|403414934|emb|CCM01634.1| predicted protein [Fibroporia radic...   204   3e-50   Fibroporia radiculosa
gi|148906600|gb|ABR16452.1| unknown [Picea sitchensis]                204   3e-50   Picea sitchensis
gi|395334077|gb|EJF66453.1| kinase-like protein [Dichomitus squa...   203   5e-50   Dichomitus squalens LYAD-421 SS1
gi|390604242|gb|EIN13633.1| choline kinase cytoplasm [Punctulari...   203   8e-50   Punctularia strigosozonata HHB-11173 SS5
gi|302787302|ref|XP_002975421.1| hypothetical protein SELMODRAFT...   203   8e-50   Selaginella moellendorffii
gi|389742286|gb|EIM83473.1| kinase-like protein [Stereum hirsutu...   202   2e-49   Stereum hirsutum FP-91666 SS1
gi|224057232|ref|XP_002299185.1| predicted protein [Populus tric...   202   2e-49   
gi|33149685|gb|AAP96922.1| choline kinase [Oryza sativa Indica G...   201   2e-49   Oryza sativa Indica Group [Indian rice]
gi|302822897|ref|XP_002993104.1| hypothetical protein SELMODRAFT...   201   2e-49   Selaginella moellendorffii
gi|326516406|dbj|BAJ92358.1| predicted protein [Hordeum vulgare ...   201   2e-49   Hordeum vulgare subsp. vulgare [barley]
gi|393247883|gb|EJD55390.1| kinase-like protein [Auricularia del...   201   3e-49   Auricularia subglabra TFB-10046 SS5
gi|223947745|gb|ACN27956.1| unknown [Zea mays] >gi|413947636|gb|...   201   4e-49   Zea mays [maize]
gi|328697438|ref|XP_001942911.2| PREDICTED: choline/ethanolamine...   200   4e-49   Acyrthosiphon pisum
gi|399168318|emb|CCE30800.1| related to choline kinase [Clavicep...   200   5e-49   Claviceps purpurea 20.1
gi|413947637|gb|AFW80286.1| choline/ethanolamine kinase [Zea mays]    200   6e-49   Zea mays [maize]
gi|391329745|ref|XP_003739328.1| PREDICTED: choline/ethanolamine...   200   6e-49   Metaseiulus occidentalis
gi|342881467|gb|EGU82361.1| hypothetical protein FOXB_07190 [Fus...   200   7e-49   Fusarium oxysporum Fo5176
gi|22330627|ref|NP_177572.2| protein kinase domain-containing pr...   199   8e-49   Arabidopsis thaliana [mouse-ear cress]
gi|12324898|gb|AAG52400.1|AC020579_2 putative choline kinase; 11...   199   9e-49   Arabidopsis thaliana [mouse-ear cress]
gi|391343675|ref|XP_003746132.1| PREDICTED: choline/ethanolamine...   199   1e-48   Metaseiulus occidentalis
gi|171680099|ref|XP_001904995.1| hypothetical protein [Podospora...   199   1e-48   Podospora anserina S mat+
gi|462414648|gb|EMJ19385.1| hypothetical protein PRUPE_ppa007687...   199   1e-48   Prunus persica
gi|212721530|ref|NP_001131578.1| uncharacterized protein LOC1001...   199   1e-48   Zea mays [maize]
gi|358381268|gb|EHK18944.1| hypothetical protein TRIVIDRAFT_4356...   199   1e-48   Trichoderma virens Gv29-8
gi|115439587|ref|NP_001044073.1| Os01g0717000 [Oryza sativa Japo...   199   2e-48   
gi|46136047|ref|XP_389715.1| hypothetical protein FG09539.1 [Fus...   199   2e-48   
gi|340515188|gb|EGR45444.1| predicted protein [Trichoderma reese...   198   2e-48   Trichoderma reesei QM6a
gi|470143054|ref|XP_004307202.1| PREDICTED: choline/ethanolamine...   198   2e-48   Fragaria vesca subsp. vesca
gi|357125430|ref|XP_003564397.1| PREDICTED: choline/ethanolamine...   198   2e-48   Brachypodium distachyon [annual false brome]
gi|125553114|gb|EAY98823.1| hypothetical protein OsI_20768 [Oryz...   198   2e-48   Oryza sativa Indica Group [Indian rice]
gi|449443853|ref|XP_004139690.1| PREDICTED: choline/ethanolamine...   198   2e-48   Cucumis sativus [cucumbers]
gi|408397341|gb|EKJ76486.1| hypothetical protein FPSE_03328 [Fus...   197   3e-48   Fusarium pseudograminearum CS3096
gi|217030951|gb|ACJ74076.1| choline kinase [Oryza sativa Japonic...   197   4e-48   Oryza sativa Japonica Group [Japonica rice]
gi|336464398|gb|EGO52638.1| hypothetical protein NEUTE1DRAFT_911...   197   4e-48   Neurospora tetrasperma FGSC 2508
gi|350296488|gb|EGZ77465.1| hypothetical protein NEUTE2DRAFT_100...   197   4e-48   Neurospora tetrasperma FGSC 2509
gi|357136189|ref|XP_003569688.1| PREDICTED: choline/ethanolamine...   197   6e-48   Brachypodium distachyon [annual false brome]
gi|242058527|ref|XP_002458409.1| hypothetical protein SORBIDRAFT...   197   6e-48   Sorghum bicolor [broomcorn]
gi|195659359|gb|ACG49147.1| choline/ethanolamine kinase [Zea mays]    196   6e-48   Zea mays [maize]
gi|297839309|ref|XP_002887536.1| hypothetical protein ARALYDRAFT...   196   7e-48   Arabidopsis lyrata subsp. lyrata
gi|393218797|gb|EJD04285.1| kinase-like protein [Fomitiporia med...   196   8e-48   Fomitiporia mediterranea MF3/22
gi|195642300|gb|ACG40618.1| choline/ethanolamine kinase [Zea mays]    196   9e-48   Zea mays [maize]
gi|392571358|gb|EIW64530.1| kinase-like protein [Trametes versic...   196   9e-48   Trametes versicolor FP-101664 SS1
gi|195646466|gb|ACG42701.1| choline/ethanolamine kinase [Zea may...   196   1e-47   Zea mays [maize]
gi|55295919|dbj|BAD67787.1| putative choline kinase [Oryza sativ...   196   1e-47   Oryza sativa Japonica Group [Japonica rice]
gi|297724277|ref|NP_001174502.1| Os05g0535400 [Oryza sativa Japo...   196   1e-47   
gi|358396456|gb|EHK45837.1| choline kinase [Trichoderma atroviri...   196   1e-47   Trichoderma atroviride IMI 206040
gi|297596235|ref|NP_001042223.2| Os01g0183000 [Oryza sativa Japo...   196   1e-47   
gi|336267276|ref|XP_003348404.1| hypothetical protein SMAC_12598...   195   1e-47   Sordaria macrospora k-hell
gi|94420695|gb|ABF18675.1| choline kinase [Oryza sativa Indica G...   195   2e-47   Oryza sativa Indica Group [Indian rice]
gi|242056163|ref|XP_002457227.1| hypothetical protein SORBIDRAFT...   195   2e-47   Sorghum bicolor [broomcorn]
gi|348506106|ref|XP_003440601.1| PREDICTED: choline kinase alpha...   195   2e-47   
gi|367042468|ref|XP_003651614.1| hypothetical protein THITE_2112...   195   2e-47   Thielavia terrestris NRRL 8126
gi|302894513|ref|XP_003046137.1| hypothetical protein NECHADRAFT...   195   2e-47   Nectria haematococca mpVI 77-13-4
gi|359487126|ref|XP_002265527.2| PREDICTED: choline/ethanolamine...   195   2e-47   
gi|392597122|gb|EIW86444.1| choline kinase cytoplasm [Coniophora...   195   2e-47   Coniophora puteana RWD-64-598 SS2
gi|226497006|ref|NP_001152424.1| LOC100286064 [Zea mays] >gi|195...   194   2e-47   Zea mays [maize]
gi|296087811|emb|CBI35067.3| unnamed protein product [Vitis vini...   194   3e-47   Vitis vinifera
gi|500255389|gb|EON98770.1| putative choline kinase protein [Tog...   194   3e-47   Phaeoacremonium minimum UCRPA7
gi|218187637|gb|EEC70064.1| hypothetical protein OsI_00666 [Oryz...   194   3e-47   Oryza sativa Indica Group [Indian rice]
gi|498995012|ref|XP_004553391.1| PREDICTED: choline kinase alpha...   194   3e-47   Maylandia zebra
gi|91085145|ref|XP_966691.1| PREDICTED: similar to choline/ethan...   194   3e-47   Tribolium castaneum [rust-red flour beetle]
gi|351726586|ref|NP_001235340.1| GmCK2p [Glycine max] >gi|143888...   194   4e-47   Glycine max [soybeans]
gi|270009349|gb|EFA05797.1| hypothetical protein TcasGA2_TC03058...   194   4e-47   
gi|326528423|dbj|BAJ93400.1| predicted protein [Hordeum vulgare ...   194   4e-47   Hordeum vulgare subsp. vulgare [barley]
gi|482572360|gb|EOA36547.1| hypothetical protein CARUB_v10011655...   194   4e-47   Capsella rubella
gi|402221070|gb|EJU01140.1| kinase-like protein [Dacryopinax sp....   194   5e-47   Dacryopinax primogenitus
gi|302419617|ref|XP_003007639.1| choline kinase [Verticillium al...   194   5e-47   Verticillium alfalfae VaMs.102
gi|440637053|gb|ELR06972.1| hypothetical protein GMDG_08206 [Geo...   193   5e-47   Pseudogymnoascus destructans 20631-21
gi|452823806|gb|EME30813.1| choline/ethanolamine kinase isoform ...   193   7e-47   Galdieria sulphuraria
gi|296413944|ref|XP_002836666.1| hypothetical protein [Tuber mel...   193   8e-47   Tuber melanosporum Mel28
gi|449449250|ref|XP_004142378.1| PREDICTED: ethanolamine kinase ...   192   2e-46   Cucumis sativus [cucumbers]
gi|322704538|gb|EFY96132.1| putative choline kinase [Metarhizium...   192   2e-46   Metarhizium robertsii ARSEF 23
gi|508724948|gb|EOY16845.1| Choline kinase 1 isoform 1 [Theobrom...   192   2e-46   Theobroma cacao [chocolate]
gi|508724950|gb|EOY16847.1| Choline kinase 1 isoform 3 [Theobrom...   192   2e-46   Theobroma cacao [chocolate]
gi|322695505|gb|EFY87312.1| putative choline kinase [Metarhizium...   192   2e-46   Metarhizium acridum CQMa 102
gi|502087424|ref|XP_004488529.1| PREDICTED: probable ethanolamin...   191   2e-46   Cicer arietinum [garbanzo]
gi|356516955|ref|XP_003527156.1| PREDICTED: probable ethanolamin...   191   3e-46   
gi|367021362|ref|XP_003659966.1| hypothetical protein MYCTH_2297...   191   3e-46   Myceliophthora thermophila ATCC 42464
gi|329663412|ref|NP_001193023.1| choline/ethanolamine kinase [Bo...   191   3e-46   Bos taurus [bovine]
gi|297846390|ref|XP_002891076.1| predicted protein [Arabidopsis ...   191   4e-46   Arabidopsis lyrata subsp. lyrata
gi|356510434|ref|XP_003523943.1| PREDICTED: uncharacterized prot...   191   4e-46   Glycine max [soybeans]
gi|471562834|gb|EMR64251.1| putative choline kinase protein [Eut...   191   4e-46   Eutypa lata UCREL1
gi|356508317|ref|XP_003522904.1| PREDICTED: probable ethanolamin...   191   4e-46   
gi|413947638|gb|AFW80287.1| hypothetical protein ZEAMMB73_022982...   191   4e-46   Zea mays [maize]
gi|224068861|ref|XP_002326218.1| predicted protein [Populus tric...   191   4e-46   
gi|401887856|gb|EJT51832.1| choline kinase [Trichosporon asahii ...   190   4e-46   Trichosporon asahii var. asahii CBS 2479
gi|170084833|ref|XP_001873640.1| choline kinase, cytoplasm [Lacc...   190   5e-46   Laccaria bicolor S238N-H82
gi|470108341|ref|XP_004290479.1| PREDICTED: choline/ethanolamine...   190   5e-46   
gi|156031082|ref|XP_001584866.1| hypothetical protein SS1G_14149...   190   5e-46   Sclerotinia sclerotiorum 1980 UF-70
gi|388514709|gb|AFK45416.1| unknown [Lotus japonicus]                 190   5e-46   Lotus japonicus
gi|475570304|gb|EMT15991.1| hypothetical protein F775_12153 [Aeg...   190   6e-46   Aegilops tauschii
gi|346323885|gb|EGX93483.1| choline kinase [Cordyceps militaris ...   190   7e-46   Cordyceps militaris CM01
gi|255569147|ref|XP_002525542.1| choline/ethanolamine kinase, pu...   190   7e-46   
gi|225445456|ref|XP_002285099.1| PREDICTED: probable ethanolamin...   190   7e-46   Vitis vinifera
gi|147821402|emb|CAN63497.1| hypothetical protein VITISV_011672 ...   189   8e-46   Vitis vinifera
gi|474069865|gb|EMS54304.1| Choline/ethanolamine kinase [Triticu...   189   8e-46   Triticum urartu
gi|429855531|gb|ELA30481.1| choline kinase [Colletotrichum gloeo...   189   8e-46   Colletotrichum gloeosporioides Nara gc5
gi|1438883|gb|AAC49376.1| GmCK3p, partial [Glycine max]               189   9e-46   Glycine max [soybeans]
gi|475556926|gb|EMT12726.1| hypothetical protein F775_25923 [Aeg...   189   1e-45   Aegilops tauschii
gi|297261387|ref|XP_002808018.1| PREDICTED: LOW QUALITY PROTEIN:...   189   1e-45   
gi|478527781|ref|XP_004438072.1| PREDICTED: choline/ethanolamine...   189   1e-45   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|326524796|dbj|BAK04334.1| predicted protein [Hordeum vulgare ...   189   1e-45   Hordeum vulgare subsp. vulgare [barley]
gi|357456273|ref|XP_003598417.1| Choline/ethanolamine kinase [Me...   189   1e-45   Medicago truncatula
gi|502127679|ref|XP_004499796.1| PREDICTED: choline/ethanolamine...   189   2e-45   Cicer arietinum [garbanzo]
gi|224066603|ref|XP_002302158.1| predicted protein [Populus tric...   188   2e-45   
gi|326507218|dbj|BAJ95686.1| predicted protein [Hordeum vulgare ...   188   2e-45   Hordeum vulgare subsp. vulgare [barley]
gi|482556509|gb|EOA20701.1| hypothetical protein CARUB_v10001015...   188   2e-45   Capsella rubella
gi|357132810|ref|XP_003568021.1| PREDICTED: choline/ethanolamine...   188   2e-45   Brachypodium distachyon [annual false brome]
gi|15234032|ref|NP_192714.1| choline synthase [Arabidopsis thali...   188   2e-45   Arabidopsis thaliana [mouse-ear cress]
gi|255566742|ref|XP_002524355.1| choline/ethanolamine kinase, pu...   188   2e-45   Ricinus communis
gi|460399299|ref|XP_004245179.1| PREDICTED: probable ethanolamin...   188   2e-45   Solanum lycopersicum
gi|380494560|emb|CCF33061.1| choline/ethanolamine kinase [Collet...   188   2e-45   Colletotrichum higginsianum
gi|482570262|gb|EOA34450.1| hypothetical protein CARUB_v10021986...   188   2e-45   Capsella rubella
gi|297813407|ref|XP_002874587.1| hypothetical protein ARALYDRAFT...   188   2e-45   Arabidopsis lyrata subsp. lyrata
gi|15217543|ref|NP_177315.1| choline kinase 1 [Arabidopsis thali...   188   2e-45   Arabidopsis thaliana [mouse-ear cress]
gi|512197570|gb|EPE26405.1| Protein kinase-like (PK-like) [Glare...   188   2e-45   Glarea lozoyensis ATCC 20868
gi|488561028|ref|XP_004470401.1| PREDICTED: choline/ethanolamine...   188   3e-45   Dasypus novemcinctus
gi|504155672|ref|XP_004589749.1| PREDICTED: choline/ethanolamine...   188   3e-45   Ochotona princeps [southern American pika]
gi|361129117|gb|EHL01035.1| putative Choline kinase [Glarea lozo...   188   3e-45   Glarea lozoyensis 74030
gi|125569295|gb|EAZ10810.1| hypothetical protein OsJ_00644 [Oryz...   188   3e-45   Oryza sativa Japonica Group [Japonica rice]
gi|242044794|ref|XP_002460268.1| hypothetical protein SORBIDRAFT...   188   3e-45   Sorghum bicolor [broomcorn]
gi|195620822|gb|ACG32241.1| choline/ethanolamine kinase [Zea mays]    187   3e-45   Zea mays [maize]
gi|462396019|gb|EMJ01818.1| hypothetical protein PRUPE_ppa008037...   187   3e-45   Prunus persica
gi|226507172|ref|NP_001146697.1| uncharacterized protein LOC1002...   187   3e-45   Zea mays [maize]
gi|195636804|gb|ACG37870.1| choline/ethanolamine kinase [Zea mays]    187   4e-45   Zea mays [maize]
gi|353234831|emb|CCA66852.1| hypothetical protein PIIN_00614 [Pi...   187   4e-45   Serendipita indica DSM 11827
gi|164427253|ref|XP_964582.2| hypothetical protein NCU03176 [Neu...   187   4e-45   
gi|297839003|ref|XP_002887383.1| hypothetical protein ARALYDRAFT...   187   4e-45   Arabidopsis lyrata subsp. lyrata
gi|402078159|gb|EJT73508.1| choline kinase [Gaeumannomyces grami...   187   4e-45   Gaeumannomyces graminis var. tritici R3-111a-1
gi|226503203|ref|NP_001146264.1| uncharacterized protein LOC1002...   187   4e-45   Zea mays [maize]
gi|482808438|gb|EOA85371.1| hypothetical protein SETTUDRAFT_1722...   187   5e-45   Setosphaeria turcica Et28A
gi|440482680|gb|ELQ63148.1| choline kinase [Magnaporthe oryzae P...   187   5e-45   Magnaporthe oryzae P131
gi|312282637|dbj|BAJ34184.1| unnamed protein product [Thellungie...   187   5e-45   Eutrema halophilum
gi|414885624|tpg|DAA61638.1| TPA: choline/ethanolamine kinase [Z...   187   5e-45   Zea mays [maize]
gi|21594823|gb|AAM66047.1| choline kinase GmCK2p-like protein [A...   187   6e-45   Arabidopsis thaliana [mouse-ear cress]
gi|389646107|ref|XP_003720685.1| choline kinase [Magnaporthe ory...   187   6e-45   Magnaporthe oryzae 70-15
gi|440472681|gb|ELQ41531.1| choline kinase [Magnaporthe oryzae Y34]   186   7e-45   Magnaporthe oryzae Y34
gi|356517680|ref|XP_003527514.1| PREDICTED: choline/ethanolamine...   186   8e-45   Glycine max [soybeans]
gi|357515433|ref|XP_003628005.1| Choline/ethanolamine kinase [Me...   186   8e-45   
gi|194696992|gb|ACF82580.1| unknown [Zea mays]                        186   8e-45   Zea mays [maize]
gi|502158268|ref|XP_004511086.1| PREDICTED: choline/ethanolamine...   186   8e-45   Cicer arietinum [garbanzo]
gi|38567241|emb|CAE76532.1| related to choline kinase [Neurospor...   186   8e-45   Neurospora crassa
gi|21537276|gb|AAM61617.1| choline kinase GmCK2p-like protein [A...   186   8e-45   Arabidopsis thaliana [mouse-ear cress]
gi|398407731|ref|XP_003855331.1| hypothetical protein MYCGRDRAFT...   186   9e-45   Zymoseptoria tritici IPO323
gi|471916269|emb|CCO26245.1| hypothetical protein BN14_00265 [Rh...   186   9e-45   Rhizoctonia solani AG-1 IB
gi|452846045|gb|EME47978.1| hypothetical protein DOTSEDRAFT_4227...   186   1e-44   Dothistroma septosporum NZE10
gi|86196743|gb|EAQ71381.1| hypothetical protein MGCH7_ch7g788 [M...   186   1e-44   Magnaporthe oryzae 70-15
gi|6978649|ref|NP_005189.2| choline/ethanolamine kinase [Homo sa...   186   1e-44   Homo sapiens [man]
gi|502158274|ref|XP_004511087.1| PREDICTED: choline/ethanolamine...   186   1e-44   
gi|114687093|ref|XP_001144556.1| PREDICTED: choline/ethanolamine...   186   1e-44   Pan troglodytes
gi|477534512|gb|ENH86050.1| choline kinase [Colletotrichum orbic...   186   1e-44   Colletotrichum orbiculare MAFF 240422
gi|295789466|pdb|3LQ3|A Chain A, Crystal Structure Of Human Chol...   186   1e-44   Homo sapiens [man]
gi|33304029|gb|AAQ02522.1| choline kinase-like, partial [synthet...   186   1e-44   synthetic construct
gi|218766919|pdb|3FEG|A Chain A, Crystal Structure Of Human Chol...   186   1e-44   Homo sapiens [man]
gi|402884714|ref|XP_003905820.1| PREDICTED: choline/ethanolamine...   186   1e-44   Papio anubis [Doguera baboon]
gi|462397678|gb|EMJ03346.1| hypothetical protein PRUPE_ppa007064...   185   2e-44   Prunus persica
gi|400597974|gb|EJP65698.1| choline kinase [Beauveria bassiana A...   185   2e-44   Beauveria bassiana ARSEF 2860
gi|414885625|tpg|DAA61639.1| TPA: hypothetical protein ZEAMMB73_...   185   2e-44   Zea mays [maize]
gi|212720894|ref|NP_001132180.1| uncharacterized protein LOC1001...   185   2e-44   Zea mays [maize]
gi|344309119|ref|XP_003423224.1| PREDICTED: choline/ethanolamine...   185   2e-44   
gi|426394972|ref|XP_004063756.1| PREDICTED: choline/ethanolamine...   185   2e-44   Gorilla gorilla gorilla [lowland gorilla]
gi|471390854|ref|XP_004380089.1| PREDICTED: choline/ethanolamine...   185   2e-44   Trichechus manatus latirostris
gi|407919190|gb|EKG12444.1| Choline/ethanolamine kinase [Macroph...   185   2e-44   Macrophomina phaseolina MS6
gi|6671748|ref|NP_031718.1| choline/ethanolamine kinase [Mus mus...   185   2e-44   Mus musculus [mouse]
gi|303318056|ref|XP_003069030.1| Choline/ethanolamine kinase fam...   184   3e-44   Coccidioides posadasii C735 delta SOWgp
gi|320036804|gb|EFW18742.1| ethanolamine kinase [Coccidioides po...   184   3e-44   Coccidioides posadasii str. Silveira
gi|449441185|ref|XP_004138364.1| PREDICTED: probable ethanolamin...   184   3e-44   Cucumis sativus [cucumbers]
gi|310797778|gb|EFQ32671.1| choline/ethanolamine kinase [Glomere...   184   3e-44   Colletotrichum graminicola M1.001
gi|388498224|gb|AFK37178.1| unknown [Lotus japonicus]                 184   3e-44   Lotus japonicus
gi|354506926|ref|XP_003515510.1| PREDICTED: choline/ethanolamine...   184   4e-44   Cricetulus griseus [Chinese hamsters]
gi|395753620|ref|XP_003779632.1| PREDICTED: choline/ethanolamine...   184   4e-44   Pongo abelii [Orang-utan]
gi|501756460|emb|CCG80513.1| Ethanolamine kinase [Taphrina defor...   184   5e-44   Taphrina deformans PYCC 5710
gi|255566975|ref|XP_002524470.1| choline/ethanolamine kinase, pu...   184   5e-44   
gi|12311795|emb|CAC24490.1| choline kinase [Pisum sativum]            184   5e-44   Pisum sativum [garden pea]
gi|507693039|ref|XP_004642493.1| PREDICTED: choline/ethanolamine...   183   6e-44   Octodon degus
gi|406859236|gb|EKD12305.1| choline kinase [Marssonina brunnea f...   183   6e-44   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|452823805|gb|EME30812.1| choline/ethanolamine kinase isoform ...   183   7e-44   Galdieria sulphuraria
gi|50553266|ref|XP_504043.1| YALI0E16907p [Yarrowia lipolytica] ...   183   8e-44   Yarrowia lipolytica CLIB122
gi|502093357|ref|XP_004489916.1| PREDICTED: choline/ethanolamine...   183   8e-44   Cicer arietinum [garbanzo]
gi|410907399|ref|XP_003967179.1| PREDICTED: choline kinase alpha...   183   8e-44   Takifugu rubripes [tiger puffer]
gi|508783766|gb|EOY31022.1| Kinase superfamily protein isoform 1...   182   9e-44   Theobroma cacao [chocolate]
gi|507532817|ref|XP_004650480.1| PREDICTED: choline/ethanolamine...   182   1e-43   Jaculus jaculus
gi|58271652|ref|XP_572982.1| choline kinase [Cryptococcus neofor...   182   1e-43   Cryptococcus neoformans var. neoformans JEC21
gi|153792296|ref|NP_001093482.1| choline/ethanolamine kinase [Da...   182   1e-43   Danio rerio [leopard danio]
gi|494825067|gb|EON62285.1| hypothetical protein W97_01506 [Coni...   182   1e-43   Coniosporium apollinis CBS 100218
gi|217072234|gb|ACJ84477.1| unknown [Medicago truncatula] >gi|38...   182   1e-43   Medicago truncatula
gi|329744645|ref|NP_001193289.1| choline/ethanolamine kinase [Su...   182   1e-43   Sus scrofa [pigs]
gi|488561022|ref|XP_004470399.1| PREDICTED: choline/ethanolamine...   182   1e-43   Dasypus novemcinctus
gi|73968807|ref|XP_848257.1| PREDICTED: choline/ethanolamine kin...   182   1e-43   Canis lupus familiaris [dogs]
gi|449441183|ref|XP_004138363.1| PREDICTED: probable ethanolamin...   182   1e-43   
gi|466057553|ref|XP_004279673.1| PREDICTED: choline/ethanolamine...   182   1e-43   Orcinus orca [Orca]
gi|242088613|ref|XP_002440139.1| hypothetical protein SORBIDRAFT...   182   2e-43   Sorghum bicolor [broomcorn]
gi|315043496|ref|XP_003171124.1| choline kinase [Arthroderma gyp...   182   2e-43   Microsporum gypseum CBS 118893
gi|224082510|ref|XP_002306722.1| predicted protein [Populus tric...   182   2e-43   
gi|502087427|ref|XP_004488530.1| PREDICTED: probable ethanolamin...   182   2e-43   
gi|302760153|ref|XP_002963499.1| hypothetical protein SELMODRAFT...   182   2e-43   Selaginella moellendorffii
gi|392870339|gb|EAS32131.2| choline kinase [Coccidioides immitis...   182   2e-43   
gi|403282836|ref|XP_003932844.1| PREDICTED: choline/ethanolamine...   181   3e-43   Saimiri boliviensis boliviensis
gi|225470840|ref|XP_002265759.1| PREDICTED: choline/ethanolamine...   181   3e-43   Vitis vinifera
gi|426227258|ref|XP_004007736.1| PREDICTED: choline/ethanolamine...   181   3e-43   
gi|189208991|ref|XP_001940828.1| ethanolamine kinase [Pyrenophor...   181   4e-43   Pyrenophora tritici-repentis Pt-1C-BFP
gi|348551576|ref|XP_003461606.1| PREDICTED: choline/ethanolamine...   181   4e-43   Cavia porcellus [guinea pig]
gi|470101773|ref|XP_004287343.1| PREDICTED: probable ethanolamin...   180   5e-43   Fragaria vesca subsp. vesca
gi|505831106|ref|XP_004610841.1| PREDICTED: choline/ethanolamine...   180   6e-43   Sorex araneus [Eurasian shrew]
gi|330936666|ref|XP_003305482.1| hypothetical protein PTT_18336 ...   180   6e-43   Pyrenophora teres f. teres 0-1
gi|355563803|gb|EHH20365.1| hypothetical protein EGK_03208, part...   180   6e-43   Macaca mulatta [rhesus macaque]
gi|118138368|pdb|2IG7|A Chain A, Crystal Structure Of Human Chol...   180   7e-43   Homo sapiens [man]
gi|357158571|ref|XP_003578170.1| PREDICTED: probable ethanolamin...   180   8e-43   Brachypodium distachyon [annual false brome]
gi|395819506|ref|XP_003783124.1| PREDICTED: choline/ethanolamine...   179   8e-43   Otolemur garnettii
gi|504178583|ref|XP_004598314.1| PREDICTED: choline kinase alpha...   179   9e-43   
gi|405122372|gb|AFR97139.1| choline kinase [Cryptococcus neoform...   179   9e-43   Cryptococcus neoformans var. grubii H99
gi|321261890|ref|XP_003195664.1| choline kinase [Cryptococcus ga...   179   1e-42   Cryptococcus gattii WM276
gi|395537764|ref|XP_003770861.1| PREDICTED: choline/ethanolamine...   179   1e-42   Sarcophilus harrisii
gi|8393104|ref|NP_058873.1| choline/ethanolamine kinase [Rattus ...   179   1e-42   Rattus norvegicus [brown rat]
gi|502118880|ref|XP_004496428.1| PREDICTED: choline/ethanolamine...   179   2e-42   Cicer arietinum [garbanzo]
gi|15225800|ref|NP_180251.1| protein embryo defective 1187  [Ara...   179   2e-42   Arabidopsis thaliana [mouse-ear cress]
gi|512966314|ref|XP_004845343.1| PREDICTED: choline/ethanolamine...   178   2e-42   Heterocephalus glaber [naked mole rat]
gi|383849571|ref|XP_003700418.1| PREDICTED: choline/ethanolamine...   178   3e-42   
gi|347835591|emb|CCD50163.1| similar to choline kinase [Botryoti...   178   3e-42   Botrytis cinerea T4
gi|472242603|gb|EMR87290.1| putative choline kinase protein [Bot...   178   3e-42   Botrytis cinerea BcDW1
gi|380014375|ref|XP_003691209.1| PREDICTED: choline/ethanolamine...   178   3e-42   
gi|328775933|ref|XP_624492.2| PREDICTED: choline/ethanolamine ki...   177   3e-42   
gi|297822263|ref|XP_002879014.1| EMB1187 [Arabidopsis lyrata sub...   177   3e-42   Arabidopsis lyrata subsp. lyrata
gi|327293163|ref|XP_003231278.1| choline kinase [Trichophyton ru...   177   4e-42   Trichophyton rubrum CBS 118892
gi|225677693|gb|EEH15977.1| choline kinase [Paracoccidioides bra...   177   4e-42   
gi|259488783|tpe|CBF88506.1| TPA: choline kinase, putative (AFU_...   177   4e-42   Aspergillus nidulans FGSC A4
gi|67517310|ref|XP_658533.1| hypothetical protein AN0929.2 [Aspe...   177   5e-42   Aspergillus nidulans FGSC A4
gi|187607543|ref|NP_001120148.1| choline kinase beta [Xenopus (S...   177   5e-42   Xenopus tropicalis [western clawed frog]
gi|426201843|gb|EKV51766.1| hypothetical protein AGABI2DRAFT_198...   177   5e-42   Agaricus bisporus var. bisporus H97
gi|351724363|ref|NP_001236799.1| GmCK1p [Glycine max] >gi|143887...   177   5e-42   Glycine max [soybeans]
gi|345563709|gb|EGX46694.1| hypothetical protein AOL_s00097g442 ...   177   5e-42   Arthrobotrys oligospora ATCC 24927
gi|302812897|ref|XP_002988135.1| hypothetical protein SELMODRAFT...   177   5e-42   Selaginella moellendorffii
gi|302499108|ref|XP_003011550.1| choline kinase, putative [Arthr...   177   5e-42   Arthroderma benhamiae CBS 112371
gi|346976258|gb|EGY19710.1| choline kinase [Verticillium dahliae...   177   6e-42   Verticillium dahliae VdLs.17
gi|392578819|gb|EIW71946.1| hypothetical protein TREMEDRAFT_3634...   177   6e-42   Tremella mesenterica DSM 1558
gi|512188163|gb|EPE03937.1| choline kinase [Ophiostoma piceae UA...   177   6e-42   Ophiostoma piceae UAMH 11346
gi|472380614|ref|XP_004409707.1| PREDICTED: choline/ethanolamine...   176   8e-42   Odobenus rosmarus divergens
gi|302665393|ref|XP_003024307.1| choline kinase, putative [Trich...   176   8e-42   Trichophyton verrucosum HKI 0517
gi|388512247|gb|AFK44185.1| unknown [Medicago truncatula]             176   8e-42   Medicago truncatula
gi|47078278|ref|NP_997634.1| choline kinase alpha isoform b [Hom...   176   8e-42   Homo sapiens [man]
gi|452002274|gb|EMD94732.1| hypothetical protein COCHEDRAFT_1167...   176   1e-41   Bipolaris maydis C5
gi|51091337|dbj|BAD36072.1| putative ethanolamine kinase 1 [Oryz...   176   1e-41   Oryza sativa Japonica Group [Japonica rice]
gi|302813048|ref|XP_002988210.1| hypothetical protein SELMODRAFT...   176   1e-41   Selaginella moellendorffii
gi|118137437|pdb|2CKO|A Chain A, Crystal Structure Of Human Chol...   176   1e-41   Homo sapiens [man]
gi|482564781|gb|EOA28971.1| hypothetical protein CARUB_v10025223...   176   1e-41   Capsella rubella
gi|453086869|gb|EMF14910.1| kinase-like protein [Mycosphaerella ...   176   1e-41   Sphaerulina musiva SO2202
gi|301763791|ref|XP_002917319.1| PREDICTED: choline/ethanolamine...   176   1e-41   
gi|431899537|gb|ELK07500.1| Carnitine O-palmitoyltransferase 1, ...   176   1e-41   Pteropus alecto
gi|459172732|ref|XP_004225563.1| PREDICTED: choline/ethanolamine...   176   1e-41   Ciona intestinalis [sea vase]
gi|195996151|ref|XP_002107944.1| hypothetical protein TRIADDRAFT...   175   1e-41   Trichoplax adhaerens
gi|350418816|ref|XP_003491976.1| PREDICTED: choline/ethanolamine...   175   2e-41   Bombus impatiens
gi|302694943|ref|XP_003037150.1| hypothetical protein SCHCODRAFT...   175   2e-41   Schizophyllum commune H4-8
gi|410965902|ref|XP_003989477.1| PREDICTED: choline/ethanolamine...   175   2e-41   
gi|451845357|gb|EMD58670.1| hypothetical protein COCSADRAFT_1764...   175   2e-41   Bipolaris sorokiniana ND90Pr
gi|507545736|ref|XP_004656832.1| PREDICTED: choline kinase alpha...   175   2e-41   Jaculus jaculus
gi|21593269|gb|AAM65218.1| putative choline kinase [Arabidopsis ...   175   2e-41   Arabidopsis thaliana [mouse-ear cress]
gi|12323732|gb|AAG51828.1|AC016163_17 putative choline kinase; 4...   175   2e-41   Arabidopsis thaliana [mouse-ear cress]
gi|19114626|ref|NP_593714.1| choline kinase (predicted) [Schizos...   175   2e-41   Schizosaccharomyces pombe 972h-
gi|409083105|gb|EKM83462.1| hypothetical protein AGABI1DRAFT_660...   175   2e-41   Agaricus bisporus var. burnettii JB137-S8
gi|511912308|ref|XP_004775513.1| PREDICTED: choline/ethanolamine...   175   2e-41   
gi|432862127|ref|XP_004069736.1| PREDICTED: choline kinase alpha...   174   3e-41   
gi|126339029|ref|XP_001366578.1| PREDICTED: choline/ethanolamine...   174   3e-41   
gi|212375101|pdb|3F2R|A Chain A, Crystal Structure Of Human Chol...   174   3e-41   
gi|332837127|ref|XP_508602.3| PREDICTED: choline kinase alpha [P...   174   3e-41   
gi|116668040|pdb|2I7Q|A Chain A, Crystal Structure Of Human Chol...   174   3e-41   
gi|470636028|ref|XP_004323445.1| PREDICTED: choline kinase alpha...   174   3e-41   
gi|307177427|gb|EFN66565.1| Choline/ethanolamine kinase [Campono...   174   4e-41   
gi|340722523|ref|XP_003399654.1| PREDICTED: choline/ethanolamine...   174   4e-41   
gi|47078276|ref|NP_001268.2| choline kinase alpha isoform a [Hom...   174   4e-41   
gi|466049696|ref|XP_004278081.1| PREDICTED: choline kinase alpha...   174   4e-41   
gi|219541|dbj|BAA01547.1| choline kinase [Homo sapiens] >gi|2288...   174   4e-41   
gi|307207343|gb|EFN85093.1| Choline/ethanolamine kinase [Harpegn...   174   4e-41   
gi|453055623|pdb|3ZM9|A Chain A, The Mechanism Of Allosteric Cou...   174   4e-41   
gi|70908364|ref|NP_038518.2| choline kinase alpha isoform 1 [Mus...   174   5e-41   
gi|261191460|ref|XP_002622138.1| choline kinase [Ajellomyces der...   174   5e-41   
gi|443704458|gb|ELU01520.1| hypothetical protein CAPTEDRAFT_1735...   174   5e-41   
gi|327351763|gb|EGE80620.1| choline kinase [Ajellomyces dermatit...   174   5e-41   
gi|116794179|gb|ABK27035.1| unknown [Picea sitchensis]                174   5e-41   
gi|512844485|ref|XP_004885501.1| PREDICTED: LOW QUALITY PROTEIN:...   173   6e-41   
gi|351700551|gb|EHB03470.1| Choline/ethanolamine kinase, partial...   173   6e-41   
gi|326484918|gb|EGE08928.1| choline kinase [Trichophyton equinum...   173   6e-41   
gi|332249867|ref|XP_003274076.1| PREDICTED: choline kinase alpha...   173   6e-41   
gi|465961563|gb|EMP29393.1| Carnitine O-palmitoyltransferase 1, ...   173   8e-41   
gi|22209091|gb|AAH36471.1| Choline kinase alpha [Homo sapiens]        173   8e-41   
gi|74151332|dbj|BAE38793.1| unnamed protein product [Mus musculus]    173   8e-41   
gi|302781791|ref|XP_002972669.1| hypothetical protein SELMODRAFT...   173   8e-41   
gi|326471761|gb|EGD95770.1| choline kinase [Trichophyton tonsura...   173   8e-41   
gi|2897733|dbj|BAA24898.1| choline kinase [Mus musculus] >gi|653...   173   8e-41   
gi|505850346|ref|XP_004618626.1| PREDICTED: choline kinase alpha...   173   8e-41   
gi|357443479|ref|XP_003592017.1| Choline/ethanolamine kinase [Me...   173   9e-41   
gi|8393107|ref|NP_058823.1| choline kinase alpha [Rattus norvegi...   173   9e-41   
gi|168005868|ref|XP_001755632.1| predicted protein [Physcomitrel...   173   9e-41   
gi|396489683|ref|XP_003843166.1| hypothetical protein LEMA_P0892...   172   1e-40   
gi|281339524|gb|EFB15108.1| hypothetical protein PANDA_005526 [A...   172   1e-40   
gi|402892594|ref|XP_003909495.1| PREDICTED: choline kinase alpha...   172   1e-40   
gi|343962335|dbj|BAK62755.1| choline kinase alpha [Pan troglodytes]   172   1e-40   
gi|507545734|ref|XP_004656831.1| PREDICTED: choline kinase alpha...   172   2e-40   
gi|336366549|gb|EGN94896.1| hypothetical protein SERLA73DRAFT_18...   172   2e-40   
gi|242023751|ref|XP_002432294.1| choline/ethanolamine kinase, pu...   172   2e-40   
gi|449296394|gb|EMC92414.1| hypothetical protein BAUCODRAFT_3846...   171   2e-40   
gi|119186051|ref|XP_001243632.1| hypothetical protein CIMG_03073...   171   2e-40   
gi|410920637|ref|XP_003973790.1| PREDICTED: ethanolamine kinase ...   171   2e-40   
gi|240274502|gb|EER38018.1| choline kinase [Ajellomyces capsulat...   171   3e-40   
gi|154282521|ref|XP_001542056.1| predicted protein [Ajellomyces ...   171   3e-40   
gi|325090842|gb|EGC44152.1| choline kinase [Ajellomyces capsulat...   171   3e-40   
gi|299472462|emb|CBN79735.1| choline/ethanolamine kinase [Ectoca...   171   3e-40   
gi|50294251|ref|XP_449537.1| hypothetical protein [Candida glabr...   171   3e-40   
gi|317418571|emb|CBN80609.1| Ethanolamine kinase 1 [Dicentrarchu...   171   3e-40   
gi|58332782|ref|NP_001011466.1| choline kinase alpha [Xenopus (S...   171   4e-40   
gi|440899499|gb|ELR50795.1| Choline/ethanolamine kinase, partial...   171   4e-40   
gi|334349293|ref|XP_003342184.1| PREDICTED: choline kinase alpha...   171   4e-40   
gi|499050665|ref|XP_004575851.1| PREDICTED: choline kinase alpha...   170   5e-40   
gi|452987374|gb|EME87130.1| choline kinase [Pseudocercospora fij...   170   6e-40   
gi|508727710|gb|EOY19607.1| Kinase superfamily protein isoform 5...   170   6e-40   
gi|470636024|ref|XP_004323444.1| PREDICTED: choline kinase alpha...   170   6e-40   
gi|466049693|ref|XP_004278080.1| PREDICTED: choline kinase alpha...   170   6e-40   
gi|512980484|ref|XP_004852254.1| PREDICTED: choline kinase alpha...   170   7e-40   
gi|296471559|tpg|DAA13674.1| TPA: choline kinase alpha-like [Bos...   170   8e-40   
gi|326500676|dbj|BAJ95004.1| predicted protein [Hordeum vulgare ...   169   8e-40   
gi|134055646|emb|CAK44020.1| unnamed protein product [Aspergillu...   169   8e-40   
gi|499018328|ref|XP_004559958.1| PREDICTED: ethanolamine kinase ...   169   9e-40   
gi|407970974|ref|NP_001258425.1| choline kinase alpha isoform 3 ...   169   9e-40   
gi|213404762|ref|XP_002173153.1| ethanolamine kinase [Schizosacc...   169   1e-39   
gi|241998820|ref|XP_002434053.1| ethanolamine kinase, putative [...   169   1e-39   
gi|414885623|tpg|DAA61637.1| TPA: hypothetical protein ZEAMMB73_...   169   1e-39   
gi|332024720|gb|EGI64909.1| Choline/ethanolamine kinase [Acromyr...   169   1e-39   
gi|254566809|ref|XP_002490515.1| Choline kinase, catalyzing the ...   169   2e-39   
gi|317025663|ref|XP_001389528.2| choline kinase [Aspergillus nig...   169   2e-39   
gi|350579886|ref|XP_003122495.3| PREDICTED: choline kinase alpha...   168   2e-39   
gi|499050661|ref|XP_004575849.1| PREDICTED: choline kinase alpha...   168   2e-39   
gi|350638544|gb|EHA26900.1| hypothetical protein ASPNIDRAFT_2056...   168   2e-39   
gi|410907379|ref|XP_003967169.1| PREDICTED: choline kinase alpha...   168   2e-39   
gi|6686290|sp|Q01134.2|CHKA_RAT RecName: Full=Choline kinase alp...   168   2e-39   
gi|156555927|ref|XP_001603632.1| PREDICTED: choline/ethanolamine...   168   2e-39   
gi|332265010|ref|XP_003281523.1| PREDICTED: choline/ethanolamine...   168   3e-39   
gi|639869|dbj|BAA07127.1| choline kinase R2 [Rattus norvegicus]       168   3e-39   
gi|363734317|ref|XP_421045.3| PREDICTED: LOW QUALITY PROTEIN: ch...   168   3e-39   
gi|241953427|ref|XP_002419435.1| choline kinase, putative [Candi...   167   3e-39   
gi|459368556|gb|EMG47241.1| Choline kinase, putative [Candida ma...   167   4e-39   
gi|512980482|ref|XP_004852253.1| PREDICTED: choline kinase alpha...   167   4e-39   
gi|507930349|ref|XP_004676422.1| PREDICTED: choline/ethanolamine...   167   4e-39   
gi|507628414|ref|XP_004627188.1| PREDICTED: choline kinase alpha...   167   4e-39   
gi|512903846|ref|XP_004900070.1| PREDICTED: choline kinase alpha...   167   4e-39   
gi|338712433|ref|XP_001492339.3| PREDICTED: choline kinase alpha...   167   4e-39   
gi|472348795|ref|XP_004394103.1| PREDICTED: choline kinase alpha...   167   5e-39   
gi|348510536|ref|XP_003442801.1| PREDICTED: ethanolamine kinase ...   167   5e-39   
gi|426252588|ref|XP_004019988.1| PREDICTED: choline kinase alpha...   167   5e-39   
gi|355566228|gb|EHH22607.1| Choline kinase alpha, partial [Macac...   167   5e-39   
gi|390470883|ref|XP_002755685.2| PREDICTED: choline kinase alpha...   167   6e-39   
gi|358370741|dbj|GAA87351.1| choline kinase [Aspergillus kawachi...   166   7e-39   
gi|499027635|ref|XP_004564550.1| PREDICTED: ethanolamine kinase ...   166   7e-39   
gi|348504036|ref|XP_003439568.1| PREDICTED: choline kinase alpha...   166   7e-39   
gi|126343098|ref|XP_001367466.1| PREDICTED: choline kinase alpha...   166   7e-39   
gi|499050663|ref|XP_004575850.1| PREDICTED: choline kinase alpha...   166   8e-39   
gi|168063767|ref|XP_001783840.1| predicted protein [Physcomitrel...   166   8e-39   
gi|507111301|emb|CDF35029.1| Choline/ethanolamine kinase, putati...   166   9e-39   
gi|338721451|ref|XP_001490887.3| PREDICTED: LOW QUALITY PROTEIN:...   166   9e-39   
gi|113678160|ref|NP_001038330.1| choline kinase alpha [Danio rerio]   166   9e-39   
gi|66821497|ref|XP_644218.1| ethanolamine kinase A [Dictyosteliu...   166   9e-39   
gi|359081303|ref|XP_002699448.2| PREDICTED: choline kinase alpha...   166   9e-39   
gi|397517309|ref|XP_003828858.1| PREDICTED: choline kinase alpha...   166   1e-38   
gi|169598402|ref|XP_001792624.1| hypothetical protein SNOG_02006...   166   1e-38   
gi|498935182|ref|XP_004520078.1| PREDICTED: ethanolamine kinase-...   166   1e-38   
gi|77681590|ref|NP_001029347.1| ethanolamine kinase 2 [Danio rer...   166   1e-38   
gi|405955266|gb|EKC22445.1| Choline/ethanolamine kinase [Crassos...   165   2e-38   
gi|403301197|ref|XP_003941283.1| PREDICTED: choline kinase alpha...   165   2e-38   
gi|115397559|ref|XP_001214371.1| conserved hypothetical protein ...   165   2e-38   
gi|358419758|ref|XP_874526.4| PREDICTED: choline kinase alpha is...   165   2e-38   
gi|260940329|ref|XP_002614464.1| hypothetical protein CLUG_05242...   165   2e-38   
gi|507637391|ref|XP_004700661.1| PREDICTED: choline/ethanolamine...   165   2e-38   
gi|238880931|gb|EEQ44569.1| conserved hypothetical protein [Cand...   165   2e-38   
gi|68482725|ref|XP_714672.1| likely choline kinase [Candida albi...   165   2e-38   
gi|472396356|ref|XP_004417405.1| PREDICTED: choline/ethanolamine...   165   2e-38   
gi|507628410|ref|XP_004627187.1| PREDICTED: choline kinase alpha...   165   2e-38   
gi|320589474|gb|EFX01935.1| choline/ethanolamine kinase [Grosman...   165   2e-38   
gi|121700795|ref|XP_001268662.1| choline kinase, putative [Asper...   164   3e-38   
gi|221043630|dbj|BAH13492.1| unnamed protein product [Homo sapiens]   164   3e-38   
gi|354545457|emb|CCE42185.1| hypothetical protein CPAR2_807340 [...   164   3e-38   
gi|148701012|gb|EDL32959.1| choline kinase alpha, isoform CRA_d ...   164   3e-38   
gi|327260139|ref|XP_003214893.1| PREDICTED: choline kinase alpha...   164   3e-38   
gi|395742357|ref|XP_003780429.1| PREDICTED: LOW QUALITY PROTEIN:...   164   4e-38   
gi|224050967|ref|XP_002199515.1| PREDICTED: choline kinase alpha...   164   4e-38   
gi|291228888|ref|XP_002734408.1| PREDICTED: choline kinase beta-...   164   4e-38   
gi|119595101|gb|EAW74695.1| choline kinase alpha, isoform CRA_b ...   164   4e-38   
gi|499050659|ref|XP_004575848.1| PREDICTED: choline kinase alpha...   164   4e-38   
gi|512925043|ref|XP_004930742.1| PREDICTED: choline/ethanolamine...   164   5e-38   
gi|348535899|ref|XP_003455435.1| PREDICTED: ethanolamine kinase ...   164   6e-38   
gi|189518151|ref|XP_689471.3| PREDICTED: ethanolamine kinase 1 i...   164   6e-38   
gi|432859404|ref|XP_004069091.1| PREDICTED: ethanolamine kinase ...   164   6e-38   
gi|512925045|ref|XP_004930743.1| PREDICTED: choline/ethanolamine...   163   6e-38   
gi|512925039|ref|XP_004930741.1| PREDICTED: choline/ethanolamine...   163   6e-38   
gi|344295472|ref|XP_003419436.1| PREDICTED: choline kinase alpha...   163   6e-38   
gi|448088628|ref|XP_004196591.1| Piso0_003813 [Millerozyma farin...   163   7e-38   
gi|190338254|gb|AAI63083.1| Chka protein [Danio rerio]                163   7e-38   
gi|242773964|ref|XP_002478347.1| choline kinase, putative [Talar...   163   7e-38   
gi|253314491|ref|NP_001156612.1| easily shocked [Acyrthosiphon p...   163   8e-38   
gi|294656675|ref|XP_458983.2| DEHA2D11836p [Debaryomyces hanseni...   163   8e-38   
gi|326920236|ref|XP_003206380.1| PREDICTED: choline kinase alpha...   163   9e-38   
gi|395544584|ref|XP_003774188.1| PREDICTED: choline kinase alpha...   162   1e-37   
gi|471402471|ref|XP_004383701.1| PREDICTED: choline kinase alpha...   162   1e-37   
gi|401624670|gb|EJS42722.1| cki1p [Saccharomyces arboricola H-6]      162   1e-37   
gi|212531797|ref|XP_002146055.1| choline kinase, putative [Talar...   162   1e-37   
gi|512002789|ref|XP_004818892.1| PREDICTED: LOW QUALITY PROTEIN:...   162   2e-37   
gi|213511180|ref|NP_001135277.1| Ethanolamine kinase 1 [Salmo sa...   162   2e-37   
gi|321478735|gb|EFX89692.1| hypothetical protein DAPPUDRAFT_2331...   161   2e-37   
gi|474174359|gb|EMS57702.1| Choline kinase alpha [Triticum urartu]    161   3e-37   
gi|255726576|ref|XP_002548214.1| conserved hypothetical protein ...   161   3e-37   
gi|297738933|emb|CBI28178.3| unnamed protein product [Vitis vini...   161   3e-37   
gi|448521244|ref|XP_003868461.1| Cki1 protein [Candida orthopsil...   160   5e-37   
gi|366991823|ref|XP_003675677.1| hypothetical protein NCAS_0C032...   160   5e-37   
gi|258578367|ref|XP_002543365.1| predicted protein [Uncinocarpus...   160   5e-37   
gi|190346102|gb|EDK38108.2| hypothetical protein PGUG_02206 [Mey...   160   5e-37   
gi|335295212|ref|XP_003357431.1| PREDICTED: ethanolamine kinase ...   160   5e-37   
gi|268535368|ref|XP_002632817.1| C. briggsae CBR-CKA-1 protein [...   160   5e-37   
gi|301771872|ref|XP_002921357.1| PREDICTED: choline kinase alpha...   160   6e-37   
gi|432091034|gb|ELK24246.1| Choline kinase alpha [Myotis davidii]     160   6e-37   
gi|83765928|dbj|BAE56071.1| unnamed protein product [Aspergillus...   160   8e-37   
gi|391870692|gb|EIT79868.1| choline kinase [Aspergillus oryzae 3...   160   8e-37   
gi|317140245|ref|XP_001818073.2| choline kinase [Aspergillus ory...   160   8e-37   
gi|322695012|gb|EFY86828.1| choline/ethanolamine kinase, putativ...   159   9e-37   
gi|440894215|gb|ELR46721.1| Choline kinase alpha, partial [Bos g...   159   1e-36   
gi|472346268|ref|XP_004392864.1| PREDICTED: ethanolamine kinase ...   159   1e-36   
gi|432091633|gb|ELK24655.1| Choline/ethanolamine kinase [Myotis ...   159   1e-36   
gi|431892910|gb|ELK03338.1| Ethanolamine kinase 2 [Pteropus alecto]   159   1e-36   
gi|488592884|ref|XP_004481678.1| PREDICTED: choline kinase alpha...   159   1e-36   
gi|344301266|gb|EGW31578.1| hypothetical protein SPAPADRAFT_6219...   159   1e-36   
gi|422295205|gb|EKU22504.1| choline/ethanolamine kinase [Nannoch...   159   1e-36   
gi|399170721|emb|CCE28262.1| related to ethanolamine kinase [Cla...   159   1e-36   
gi|345783692|ref|XP_533210.3| PREDICTED: choline kinase alpha [C...   159   1e-36   
gi|388582818|gb|EIM23121.1| kinase-like protein [Wallemia sebi C...   159   1e-36   
gi|410974744|ref|XP_003993802.1| PREDICTED: choline kinase alpha...   159   1e-36   
gi|156848605|ref|XP_001647184.1| hypothetical protein Kpol_1036p...   159   2e-36   
gi|148707702|gb|EDL39649.1| ethanolamine kinase 2, isoform CRA_b...   158   2e-36   
gi|299473024|emb|CBN77417.1| choline/ethanolamine kinase [Ectoca...   158   2e-36   
gi|410082375|ref|XP_003958766.1| hypothetical protein KAFR_0H022...   158   3e-36   
gi|37786753|gb|AAP47267.1| putative ethanolamine kinase, partial...   158   3e-36   
gi|320581667|gb|EFW95886.1| Choline kinase [Ogataea parapolymorp...   158   3e-36   
gi|395838794|ref|XP_003792291.1| PREDICTED: ethanolamine kinase ...   158   3e-36   
gi|158303302|ref|NP_780652.2| ethanolamine kinase 2 [Mus musculu...   158   3e-36   
gi|410928385|ref|XP_003977581.1| PREDICTED: ethanolamine kinase ...   157   3e-36   
gi|367015952|ref|XP_003682475.1| hypothetical protein TDEL_0F045...   157   3e-36   
gi|365759445|gb|EHN01231.1| Cki1p [Saccharomyces cerevisiae x Sa...   157   4e-36   
gi|512913400|ref|XP_004927886.1| PREDICTED: ethanolamine kinase-...   157   4e-36   
gi|301109172|ref|XP_002903667.1| ethanolamine kinase, putative [...   157   4e-36   
gi|148701011|gb|EDL32958.1| choline kinase alpha, isoform CRA_c ...   157   4e-36   
gi|401839311|gb|EJT42592.1| CKI1-like protein [Saccharomyces kud...   157   4e-36   
gi|322711544|gb|EFZ03117.1| choline/ethanolamine kinase, putativ...   157   5e-36   
gi|298712530|emb|CBJ26798.1| choline/ethanolamine kinase [Ectoca...   157   5e-36   
gi|440903923|gb|ELR54510.1| Ethanolamine kinase 2, partial [Bos ...   157   5e-36   
gi|403216810|emb|CCK71306.1| hypothetical protein KNAG_0G02490 [...   157   5e-36   
gi|61806723|ref|NP_001013592.1| uncharacterized protein LOC54144...   157   5e-36   
gi|6539496|dbj|BAA88154.1| choline/ethanolamine kinase-alpha [Mu...   157   6e-36   
gi|47227401|emb|CAF96950.1| unnamed protein product [Tetraodon n...   157   7e-36   
gi|148707701|gb|EDL39648.1| ethanolamine kinase 2, isoform CRA_a...   157   7e-36   
gi|254584170|ref|XP_002497653.1| ZYRO0F10472p [Zygosaccharomyces...   156   8e-36   
gi|149058613|gb|EDM09770.1| ethanolamine kinase 2 (predicted), i...   156   8e-36   
gi|365761493|gb|EHN03143.1| Eki1p [Saccharomyces cerevisiae x Sa...   156   8e-36   
gi|511879691|ref|XP_004759773.1| PREDICTED: choline kinase alpha...   156   8e-36   
gi|302425024|sp|D3ZRW8.1|EKI2_RAT RecName: Full=Ethanolamine kin...   156   9e-36   
gi|281353401|gb|EFB28985.1| hypothetical protein PANDA_010243 [A...   156   9e-36   
gi|511981713|ref|XP_004808695.1| PREDICTED: choline kinase alpha...   156   1e-35   
gi|281200559|gb|EFA74777.1| ethanolamine kinase A [Polysphondyli...   156   1e-35   
gi|149061880|gb|EDM12303.1| choline kinase alpha, isoform CRA_b ...   156   1e-35   
gi|295664030|ref|XP_002792567.1| conserved hypothetical protein ...   156   1e-35   
gi|119494667|ref|XP_001264156.1| choline kinase, putative [Neosa...   156   1e-35   
gi|291234579|ref|XP_002737227.1| PREDICTED: ethanolamine kinase ...   156   1e-35   
gi|395851793|ref|XP_003798436.1| PREDICTED: LOW QUALITY PROTEIN:...   156   1e-35   
gi|255941982|ref|XP_002561760.1| Pc16g14630 [Penicillium chrysog...   156   1e-35   
gi|47209573|emb|CAF89833.1| unnamed protein product [Tetraodon n...   155   1e-35   
gi|507956362|ref|XP_004685589.1| PREDICTED: ethanolamine kinase ...   155   1e-35   
gi|260805134|ref|XP_002597442.1| hypothetical protein BRAFLDRAFT...   155   1e-35   
gi|508724949|gb|EOY16846.1| Kinase superfamily protein isoform 2...   155   1e-35   
gi|124481880|gb|AAI33117.1| Zgc:113516 protein [Danio rerio]          155   1e-35   
gi|508724951|gb|EOY16848.1| Kinase superfamily protein isoform 4...   155   1e-35   
gi|478501768|ref|XP_004425196.1| PREDICTED: ethanolamine kinase ...   155   2e-35   
gi|334322271|ref|XP_001370544.2| PREDICTED: ethanolamine kinase ...   155   2e-35   
gi|327272088|ref|XP_003220818.1| PREDICTED: ethanolamine kinase ...   155   2e-35   
gi|432953327|ref|XP_004085351.1| PREDICTED: choline kinase alpha...   155   2e-35   
gi|308460074|ref|XP_003092345.1| CRE-CKA-1 protein [Caenorhabdit...   155   2e-35   
gi|13435711|gb|AAH04719.1| Chka protein [Mus musculus]                155   2e-35   


>gi|511003159|gb|EPB84571.1| hypothetical protein HMPREF1544_08666 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 369

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/351 (47%), Positives = 225/351 (64%), Gaps = 18/351 (5%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L N ++ LI  + P +   N   I++ RVSGALTN VFF+           NK+  R+LL
Sbjct: 29  LTNKVLKLIQVLFPDY-AENLEKIELNRVSGALTNAVFFV--------NAPNKR--RLLL 77

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           RVYGNGVDQ+ DR+ EL +L  LS+L IGP LLG+F NGRFE++L S TL  +D+RDP T
Sbjct: 78  RVYGNGVDQIIDRENELAWLARLSSLNIGPSLLGIFGNGRFEEYLPSTTLTHHDIRDPET 137

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-KCTEEQRKGLEE 189
           SK IA  + +LH+I+ + P   E    E+W NIDKWY + ++ +  L K ++   + L  
Sbjct: 138 SKGIAACIRELHDIVAVYPFSPEKNHLEIWANIDKWYQVVMSLLPVLYKKSDGWTQVLTT 197

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL-TDGSLVVVDFEYAGYNYQA 248
           F+ + L  EIEE K ++     SPIVF HNDTQYGN+L+L     LV+VDFEYAGYN + 
Sbjct: 198 FNLERLTFEIEECK-QILEAAKSPIVFGHNDTQYGNVLKLEKTNELVIVDFEYAGYNPRG 256

Query: 249 FDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           FDIANHFCEWTYDY S  P  M+   YP  ++QI FL AY++  S   +  I + + T +
Sbjct: 257 FDIANHFCEWTYDYHSEQPASMDTSQYPTYEEQIRFLNAYLETKSKNDNPDILDKAVTAE 316

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE 359
             LQK   E   + +ASH+ WGLWGL+Q+ QS+IDFDY  +  +RL+ FRE
Sbjct: 317 -CLQK---EAAMWLMASHLSWGLWGLIQASQSEIDFDYFLFSTQRLNAFRE 363



>gi|510999985|gb|EPB81557.1| hypothetical protein HMPREF1544_11706 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 414

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 212/334 (63%), Gaps = 32/334 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           + +  D++++RVSGA+TN VFF+T        TK     R+LLRVYG G DQ+ DR KEL
Sbjct: 102 IKDGEDVKLDRVSGAMTNAVFFVTI-----GSTK-----RMLLRVYGVGCDQILDRDKEL 151

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
           ++L  LS L IGPKLLG+F NGRFE++L S TL   D+R+P  S  IA RL QLH+I+  
Sbjct: 152 DWLSRLSQLSIGPKLLGIFGNGRFEEYLPSTTLTRQDIREPQISTQIASRLHQLHSIVET 211

Query: 148 CPPPQENIKPEVWVNIDKWY-PLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
            PP   N   EVW NIDKWY  +    + +L   E  +  LEE D   L  +I++ K   
Sbjct: 212 FPPAH-NETLEVWANIDKWYTTITTELVPALSKNETWKTQLEEIDLVQLGHDIQQCKLAC 270

Query: 207 SHNIDSPIVFAHNDTQYGNILRL--TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           +   +SPIVFAHND QYGNIL++  TD  LVV+DFEYAGYN +A DIANHFCEW YDY S
Sbjct: 271 N---NSPIVFAHNDLQYGNILKINGTD-ELVVIDFEYAGYNPRAVDIANHFCEWMYDYHS 326

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
           S    M+LD YP+  +Q  FL +Y+        HT +       + + +L+ EV  + ++
Sbjct: 327 SNSATMHLDQYPSLQEQNKFLASYL--------HTEDQ------SLVMELQKEVDQWKMS 372

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFR 358
            H+ WGLWGLVQ+ QS+IDFDY  Y ++R++ FR
Sbjct: 373 CHLFWGLWGLVQASQSEIDFDYFYYSVQRINEFR 406



>gi|384485200|gb|EIE77380.1| hypothetical protein RO3G_02084 [Rhizopus delemar RA 99-880]
          Length = 346

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/317 (47%), Positives = 195/317 (61%), Gaps = 34/317 (10%)

Query: 46  CVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGV 105
            V+F+T   K           R+LLR+YG G +Q+ DR KEL++L  LS L IGP LLG 
Sbjct: 51  AVYFVTIGSK-----------RMLLRIYGIGCEQILDRDKELDWLSRLSRLNIGPSLLGT 99

Query: 106 FKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDK 165
           F NGRFE++LES TL  +DLRDP  S  IA RL+QLH+I++  PP  EN   EVW NIDK
Sbjct: 100 FDNGRFEEYLESTTLTWHDLRDPFISAQIASRLNQLHSIVDTFPPA-ENEPLEVWQNIDK 158

Query: 166 WY-PLALNAISSLKCTEEQRKGLEE-FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQY 223
           WY  L    +S+LK      K +E+  D   L  +IE  K  L+  + +P VFAHNDTQY
Sbjct: 159 WYRSLESEVLSTLKKNPVWAKMIEQSLDLSQLHKDIETCKSILN-TLSTPTVFAHNDTQY 217

Query: 224 GNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQI 282
           GNIL++ +   LVV+DFEYAGYN + +DIANHFCEW YDY SS P KMN   YP   +Q+
Sbjct: 218 GNILKIENTDELVVIDFEYAGYNPRGYDIANHFCEWMYDYHSSEPAKMNHKSYPTHKEQV 277

Query: 283 DFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI 342
            FL AY                    +++ +L  EV  + +A H+ WGLWGLVQ+ QS+I
Sbjct: 278 RFLTAY------------------DKHHVTELLREVELWKMACHLFWGLWGLVQASQSEI 319

Query: 343 DFDYLSYGMERLHRFRE 359
           DFDY  Y +ERL  F++
Sbjct: 320 DFDYFGYSLERLSVFKQ 336



>gi|348671552|gb|EGZ11373.1| hypothetical protein PHYSODRAFT_352481 [Phytophthora sojae]
          Length = 359

 Score =  230 bits (587), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 197/350 (56%), Gaps = 31/350 (8%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L+ +L+  +T  +P W       + +E + GA+TN +F + + +  H          VL+
Sbjct: 30  LQASLVSALTKSVPSWSDVEPDSVDVEHLGGAMTNLIFAVHKPEGKHRD--------VLV 81

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           RVYG G +    R +E    ++LS+ KIG +LLG F NGR E+ +   T  S  +R P  
Sbjct: 82  RVYGEGTESFFSRVEETRLFQLLSDKKIGVELLGQFANGRAEKLIHGTTYTSKRMRQPEE 141

Query: 131 SKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEE 189
           S+ IA++L   H + I+I      + KP    +I K     L  ++ +KCT ++ +G+  
Sbjct: 142 SRIIAKQLRVFHELDIDI------DRKPTYLSSIRK-----LLEVARVKCTADKFQGV-- 188

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLVVVDFEYAGYNYQAF 249
            D K L  +++EL+ K+   + SPIV +HND QYGNI++   G  V++DFEY  YN + +
Sbjct: 189 LDLKQLAKDVDELE-KVLAQVPSPIVLSHNDLQYGNIMKNDAGDAVLIDFEYTSYNPRGY 247

Query: 250 DIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           D+ NHFCEW YDY  +V  H  +   YP ++QQ +F RAY+            + S+  +
Sbjct: 248 DVGNHFCEWAYDYHKTVNAHLGDFSKYPTKEQQRNFCRAYLAGKD-------GDESDVSE 300

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFR 358
           N +++L+LE   ++LASH+ W +WG +Q+ QS IDFD+L+YG  R   F+
Sbjct: 301 NEIEQLRLEANTYSLASHMFWSIWGYIQAAQSDIDFDFLAYGKCRYDAFK 350



>gi|348671557|gb|EGZ11378.1| hypothetical protein PHYSODRAFT_352482 [Phytophthora sojae]
          Length = 361

 Score =  230 bits (586), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 200/357 (56%), Gaps = 34/357 (9%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L+ +++  +T  +P W       + +E + GA+TN +F + + +  H          VL+
Sbjct: 34  LQASIVSALTKSVPSWSDVEPDSVDVEHLGGAMTNLIFAVHKPEGKHRD--------VLV 85

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           RVYG G +    R +E    ++LS+ KIG +LLG F NGR E+ +   T  S  +R P  
Sbjct: 86  RVYGEGTESFFSRVEETRLFQLLSDKKIGVELLGQFANGRAEKLIHGTTYTSKRMRQPEE 145

Query: 131 SKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEE 189
           S+ IA++L   H + I+I      + KP    +I K     L  ++ +KCT ++ +G+  
Sbjct: 146 SRIIAKQLRVFHELDIDI------DRKPTYLSSIRK-----LLEVARVKCTADKFQGV-- 192

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLVVVDFEYAGYNYQAF 249
            D K L  +++EL+ K+   + SPIV +HND QYGNI++   G  V++DFEY  YN + +
Sbjct: 193 LDLKQLAKDVDELE-KVLAQVPSPIVLSHNDLQYGNIMKNDAGDAVLIDFEYTSYNPRGY 251

Query: 250 DIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           D+ NHFCEW YDY  +V  H  +   YP ++QQ +F RAY+            + S+  +
Sbjct: 252 DVGNHFCEWAYDYHKTVNAHLGDFSKYPTKEQQRNFCRAYLAGKD-------GDESDVSE 304

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE---LKN 362
           N +++L+LE   ++LASH+ W +WG +Q+ QS IDFD+L+YG  R   F+    LKN
Sbjct: 305 NEIEQLRLEANTYSLASHMFWSIWGYIQAAQSDIDFDFLAYGKCRYDAFKSRVTLKN 361



>gi|301096227|ref|XP_002897211.1| choline/ethanolamine kinase, putative [Phytophthora infestans
           T30-4]
 gi|262107296|gb|EEY65348.1| choline/ethanolamine kinase, putative [Phytophthora infestans
           T30-4]
          Length = 359

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 122/357 (34%), Positives = 196/357 (54%), Gaps = 34/357 (9%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L+ +++  +T  +P W+      + +E + GA+TN +F + + +         K   VL+
Sbjct: 32  LQASIVSTLTKCIPSWNDVVPDSVDVEHLGGAMTNLIFSVHKPEG--------KDRDVLV 83

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           RVYG G +    R +E    ++LS+ KIG +LLG F NGR E+ +   T  S  +R P  
Sbjct: 84  RVYGEGTESFFSRVEETRLFQLLSDKKIGVELLGQFANGRAEKLIHGSTYTSKRMRLPDE 143

Query: 131 SKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEE 189
           S+ IA++L   H + I+I      + KP    ++ K     L  ++ +KCT +  K +  
Sbjct: 144 SRIIARQLRVFHELDIDI------DRKPTYISSVRK-----LLEVARVKCTADTFKDI-- 190

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLVVVDFEYAGYNYQAF 249
            D K +  +++E++ K+   + SPIV +HND QYGNI++   G  V++DFEY  YN + +
Sbjct: 191 LDLKQVASDVDEME-KILAEVPSPIVLSHNDMQYGNIMKKDTGDAVLIDFEYTSYNPRGY 249

Query: 250 DIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           D+ NHFCEW YDY  +V PH  +   YP ++QQ +F RAY+            +  +  +
Sbjct: 250 DLGNHFCEWAYDYHKTVNPHLGDFSKYPTQEQQRNFCRAYLAGKD-------GDEKDVSE 302

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE---LKN 362
           N ++ L+ E   ++LA H+ W LWG +Q+ QS IDFD+L+YG  R   F+    LKN
Sbjct: 303 NEIESLRREANTYSLACHLFWALWGYIQASQSTIDFDFLAYGKCRYDAFKSRVTLKN 359



>gi|299755103|ref|XP_001828432.2| protein kinase subdomain-containing protein PKL/CAK/ChoK
           [Coprinopsis cinerea okayama7#130]
 gi|298411070|gb|EAU93424.2| protein kinase subdomain-containing protein PKL/CAK/ChoK
           [Coprinopsis cinerea okayama7#130]
          Length = 451

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 193/356 (54%), Gaps = 39/356 (10%)

Query: 30  NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNF 89
           N  D+ I ++SGALTN VFF++          NK+   +LLR+YG+    L  R +EL+ 
Sbjct: 99  NPEDVNIRKISGALTNAVFFVS-------HKTNKRVPTLLLRIYGSSSGSLISRPRELHI 151

Query: 90  LEMLSNL-KIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI-INI 147
           L  LS++ +IGP L G F+NGR EQ+ +S TL  +D+R+P+ S++I  R+++ H++ I +
Sbjct: 152 LHKLSSVYRIGPLLYGTFENGRIEQYFKSTTLTESDIREPTVSRWIGARMAEFHSVDIEV 211

Query: 148 CPPPQENIKPEVW-----VNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIE-- 200
             PP  +  P  W       +  W P A   +S    +   R   +E D    + E    
Sbjct: 212 VSPPS-DATPTGWELSVKKCVSSWMPAAHKVLSLPGVSHAVR---QELDLARFEKEWSIY 267

Query: 201 ---ELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS--------LVVVDFEYAGYNYQAF 249
                K +  H+  S +VFAHNDTQYGN+L+L D +        L+VVDFEYAG N  A+
Sbjct: 268 VQWAAKVQDKHS-GSKVVFAHNDTQYGNLLKLEDSNEVADEHRQLIVVDFEYAGPNPAAY 326

Query: 250 DIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDN 309
           DIANHF EWT +Y    PH +N   YP   ++ +F  AYI   ++  +  + + SE  + 
Sbjct: 327 DIANHFHEWTANYHGDTPHLLNRARYPTFAERRNFYSAYIHHSNMLGEDPVYDKSE-FEQ 385

Query: 310 YLQKLKLEVYAFTLASHVMWGLWGLVQS------GQSQIDFDYLSYGMERLHRFRE 359
            +  L  +V  ++ ASH MW +WG+VQ       G  + +FDY+ Y   R+  FR+
Sbjct: 386 LIAALDYQVRIWSPASHGMWAIWGIVQGREDVENGVEEPEFDYIGYAKGRMALFRQ 441



>gi|449550651|gb|EMD41615.1| hypothetical protein CERSUDRAFT_42288, partial [Ceriporiopsis
           subvermispora B]
          Length = 384

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 137/352 (38%), Positives = 201/352 (57%), Gaps = 36/352 (10%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           +++ +VSG+LTN VFF++     H +T       VLLRVYG     L  R +EL+ L +L
Sbjct: 32  MKVYKVSGSLTNDVFFVSCPAVPHTRT-------VLLRVYGPSSGALISRPRELHTLHVL 84

Query: 94  SN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINIC---- 148
           S+  +IGP++ G F+NGR E++ ES  L ++DLRD + S +I  R+++LH +  +     
Sbjct: 85  SSQYQIGPRVYGTFENGRVEEYFESTALTADDLRDKTISSWIGGRMAELHGVDVVAVEGR 144

Query: 149 -PPP--QEN-IKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEEL-- 202
            PP   +EN  +     N++ W  LA + +      E  R+GL+   F+   ++  +   
Sbjct: 145 LPPADGEENRWRVATEQNVESWLILARDVLRLPAAPEAIREGLDLDTFEREWNQYVQWLH 204

Query: 203 KYKLSHNIDSPIVFAHNDTQYGNILRLTD--------GSLVVVDFEYAGYNYQAFDIANH 254
            Y+ SH   S  VF+HNDTQYGN+LRL           S++VVDFEYAG N  AFDIANH
Sbjct: 205 DYESSHG-PSRRVFSHNDTQYGNLLRLKTLKPGLPEHHSIIVVDFEYAGLNAAAFDIANH 263

Query: 255 FCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYI--DAYSIPSDHTINNPSETHDNYLQ 312
           F EWT +Y SS PH +N  +YP  DQ+ +F RAY+  DA    +D    + S   +  LQ
Sbjct: 264 FHEWTANYHSSTPHLLNPKVYPTGDQRRNFYRAYLKHDASGRTADDAPKSASSDEEK-LQ 322

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQ------SQIDFDYLSYGMERLHRFR 358
            L+ +V A++ ASH MW +WG+VQ+ +       + +FDYL Y   R+  FR
Sbjct: 323 TLEDQVRAWSPASHAMWSVWGVVQAREFLEGLDGEPEFDYLGYAQCRIDAFR 374



>gi|460374761|ref|XP_004233178.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like isoform 2
           [Solanum lycopersicum]
          Length = 396

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 194/339 (57%), Gaps = 28/339 (8%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           D+ + + + + R+ GA+TN V+ I    K  ++ +++K   VL+R+YG GVD   DRQ E
Sbjct: 76  DIVDPNALDVFRLKGAMTNEVYQIKWPSKNPEKQRSRK---VLVRIYGKGVDVFFDRQNE 132

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F++GR E+ + + TL + DLRDP  S  IA ++ + H +++
Sbjct: 133 IKIFEFMSKQGQGPRLLGRFQSGRIEEFIRARTLSAPDLRDPEISSLIAAKMREFH-VLD 191

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
           + P P+  I   +W  +  W    LN    L  TEE +    +F   +LKDEI  L+  L
Sbjct: 192 M-PGPKTVI---LWDRLQNW----LNVAKGLASTEEAK----DFKLDLLKDEIVLLEKNL 239

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           + N  S     HND QYGNI+   +  S+  +D+EYAGYN+ AFDIANHFCE   DY + 
Sbjct: 240 AGNHLSTGC-CHNDLQYGNIMMDEETRSITFIDYEYAGYNHVAFDIANHFCEMVADYHTE 298

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH M+   YP  +++  FL  Y+ +       +  +PSE     L+KL  EV  +TLAS
Sbjct: 299 TPHIMDFRKYPGLEERKRFLSTYLFS-------SGRSPSEPE---LEKLVQEVEKYTLAS 348

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           H+ WGLWG++    ++IDFDYL Y  +R   +   K+E+
Sbjct: 349 HLFWGLWGIISHHVNKIDFDYLGYARQRFQPYWSKKSEL 387



>gi|409051357|gb|EKM60833.1| hypothetical protein PHACADRAFT_247010 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 459

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 142/385 (36%), Positives = 212/385 (55%), Gaps = 50/385 (12%)

Query: 8   NVTLRNALIPLITDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           +V +   L  L+   +P W    ++ E+ ++I++VSG+LTN VFF++     H       
Sbjct: 83  SVFVEQLLTILLKLCIPTWTHRGITAET-VKIQKVSGSLTNAVFFVSCPSVPHTSI---- 137

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSN 123
              +LLR+YG+    L  R +EL+ L  LS+   IGP++ G F+NGR E++ +S  L ++
Sbjct: 138 ---LLLRIYGSSSGTLISRPRELHTLHSLSSRYHIGPRVYGTFENGRVEEYFDSSALAAD 194

Query: 124 DLRDPSTSKYIAQRLSQLHNI-INI--------CPPPQENIKP---EVWVNIDKWYPLAL 171
           DLR+   S +I  R+++LH + +N         C  P +   P    V  N+  W   A 
Sbjct: 195 DLRNAQISTWIGARMAELHQVDVNAVELQEPLACSHPTDAPHPWQLGVEKNVKSWLSSAQ 254

Query: 172 NAISSLKCTEEQRK--GLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL 229
             +S    ++E RK   L+EF+ +  +  +  LK     +  SP VFAHNDTQYGN+LRL
Sbjct: 255 EVLSLPAVSDELRKSFALDEFEVEWTR-YVTWLKEWEGKHGASPAVFAHNDTQYGNLLRL 313

Query: 230 ---TDGSL-----VVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQ 281
                GSL     +VVDFEYA  N  AFDIANHF EWT DY    PH ++   YP  +Q+
Sbjct: 314 NSCAPGSLEHHQIIVVDFEYASPNPAAFDIANHFHEWTADYHGETPHILDPSRYPTREQR 373

Query: 282 IDFLRAYIDAY--SIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQ 339
            +F RAY+  Y  SI S     +P E  +   ++L+ +V A++ ASH MW LWGLVQ+ +
Sbjct: 374 FNFYRAYLTHYKPSIVSP----DPLEVQE---ERLEAQVGAWSPASHGMWALWGLVQARE 426

Query: 340 S------QIDFDYLSYGMERLHRFR 358
           +      + +FDY+SY + R+  FR
Sbjct: 427 ALDGTDGEPEFDYVSYALCRMEGFR 451



>gi|325184869|emb|CCA19361.1| unnamed protein product [Albugo laibachii Nc14]
          Length = 353

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 192/356 (53%), Gaps = 33/356 (9%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L ++++  ++    GWD     D+ I  + GA+TN +F        H    N     V++
Sbjct: 26  LHSSIVSSLSTCTSGWDAVRSEDVNITHIGGAMTNLIF--------HASKPNGDNADVIV 77

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG G +    R +E+   ++LS   IG  LLG F+NGR E+ ++   + +  +R+ + 
Sbjct: 78  RIYGEGTESFFSRMEEIRVFQLLSAQNIGVALLGEFENGRVEKRIDGFAINAKMMRNEAV 137

Query: 131 SKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKW-YPLALNAISSLKCTEEQRKGLE 188
           S  IAQ+L + H + +++   P+ + +    +++ +  YP        +  TE+ +   +
Sbjct: 138 SHQIAQQLRRFHELDVDMEKKPRWDTELHRLLSLARTKYP------DRIFDTEDAKSFFD 191

Query: 189 EFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLVVVDFEYAGYNYQA 248
           +F   +   E    KY +S  I SP+V +HND QYGNI+ L D S+V++DFEY  YN + 
Sbjct: 192 QFACDIGDTE----KYLMS--IPSPLVLSHNDLQYGNIMSLKDQSVVLIDFEYCSYNPRG 245

Query: 249 FDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETH 307
           FDI NHFCEW +DY  S+ PH  +   YP+  QQ  F RAY     + S   I  P E  
Sbjct: 246 FDIGNHFCEWAFDYHKSINPHIGDFSKYPSITQQRHFCRAY-----LTSGQAI-IPEEQV 299

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNE 363
           D     L +E  A+  ASH++W LWGL+Q+ QS+IDFDYLSY   R   F++ + E
Sbjct: 300 D----ALCVEANAYAQASHLLWALWGLIQASQSEIDFDYLSYAQCRYEAFKKRQME 351



>gi|340975826|gb|EGS22941.1| choline kinase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 755

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 213/457 (46%), Gaps = 110/457 (24%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +T +N +I +  T  L GW    +     I +ER+SGALTN V+ ++   +  L  Q   
Sbjct: 273 ITFKNEIIRIAHTLKLKGWRRVPLDGGETISVERLSGALTNAVYVVSPPSEAVLPPQEGK 332

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           K+P +VLLRVYG  V+ L DR+ EL  L  L+  KIGP+LLG F NGRFEQ+L +  L S
Sbjct: 333 KQPSKVLLRVYGPQVEHLIDREHELEVLRRLARKKIGPRLLGTFLNGRFEQYLNATALTS 392

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIK-PEVWVNIDKW--------------- 166
           + +R+P TSK IA+R+ +LH+ + +    +E ++ P VW N DKW               
Sbjct: 393 DSMREPETSKQIAKRMRELHDGVELL--DEERVQGPNVWRNWDKWLGQVEKTVLYLDEQV 450

Query: 167 --YPLALNAISSLKCTEEQRK---GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAH 218
             Y +A  + +      + R    G+E   FK L ++     E  Y  + NI   +VFAH
Sbjct: 451 KAYAMANGSFAKPSSAWKARGFVCGVEWPKFKALVEKYRRYLENYYGNAENIRRKLVFAH 510

Query: 219 NDTQYGNILRLTDGS--------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           ND QYGNILR+   +              LVV+DFEYAG N    + ANHF EWTY+Y  
Sbjct: 511 NDAQYGNILRVRPDNQKSPLLRPANEHKQLVVIDFEYAGANLPGCEFANHFSEWTYNYHD 570

Query: 265 SV-PHKMNLDLYPNEDQQIDFLRAYID----------AYSIPSDHT-INNPSETHD---- 308
            V PH  N   YP  +QQ+ F+RAY+D          A  +P+  T I + S   D    
Sbjct: 571 PVRPHACNTSRYPTPEQQLRFIRAYVDHHPQVSVTSPASPVPASATPITSASLASDFDLD 630

Query: 309 ---------------------NYLQKLKLEVYAFTLASHVMWGLWGLVQS---------- 337
                                  +++L  E   +  A+   W  WG+VQ+          
Sbjct: 631 SRMNPSGSWREEEQRKEEETEAKVRELMEETRLWRTANSAQWVAWGIVQAKVPGVNTRCS 690

Query: 338 --GQSQID---------------FDYLSYGMERLHRF 357
             G++  D               FDYL Y  ER   F
Sbjct: 691 TNGRAGSDGEAGESSEEEADSDEFDYLGYAQERAFFF 727



>gi|508727709|gb|EOY19606.1| Kinase superfamily protein isoform 4 [Theobroma cacao]
          Length = 342

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 195/352 (55%), Gaps = 40/352 (11%)

Query: 11  LRNALIPLITDMLPGWD-VSNESDIQIERVSGALTNCVFFI---TRTKKLHDQTKNKKPL 66
           +++AL  L +D    WD V +   +Q+  + GA+TN VF I   TRT    D+   K   
Sbjct: 15  VKDALQLLASD----WDDVVDSKALQVIPLKGAMTNQVFQIKWPTRT----DEVSRK--- 63

Query: 67  RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLR 126
            VL+R+YG GV+   DR  E+   E +S  + GP+LLG F NGR E+ + + TL ++DLR
Sbjct: 64  -VLVRIYGEGVEVFFDRDNEIRTFEFMSKHRQGPRLLGRFPNGRIEEFIRARTLSASDLR 122

Query: 127 DPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKG 186
           DP+ S  IA +L + H +    P P+   K  +W  +  W    LNA   + C  E+ K 
Sbjct: 123 DPNVSALIAAKLREFHEL--DMPGPK---KVWLWDRLQNW----LNAAKRV-CPLEEAKA 172

Query: 187 LEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYN 245
              F  +++++EI  L+ KLS      I F HND QYGNI+   +  S+ ++D+EYA YN
Sbjct: 173 ---FRLEVIEEEISMLEKKLS-GCHQHIGFCHNDLQYGNIMIDEETKSITIIDYEYASYN 228

Query: 246 YQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSE 305
             A+DIANHFCE   DY + +PH M+   YP   +++ FLR Y+ +         +   E
Sbjct: 229 PVAYDIANHFCEMAADYHTEMPHIMDYSKYPGWGERLRFLRIYLHS---------SGSKE 279

Query: 306 THDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
             D  + +L  +V  FTLASH+ WGLWG++    ++IDFDY  Y  +R  ++
Sbjct: 280 PRDTEVDQLLKDVEKFTLASHLTWGLWGIISEHVNEIDFDYKEYAKQRFQQY 331



>gi|460384271|ref|XP_004237836.1| PREDICTED: choline/ethanolamine kinase-like isoform 1 [Solanum
           lycopersicum]
 gi|460384273|ref|XP_004237837.1| PREDICTED: choline/ethanolamine kinase-like isoform 2 [Solanum
           lycopersicum]
          Length = 365

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 197/347 (56%), Gaps = 35/347 (10%)

Query: 15  LIPLITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK-PLRVLLRV 72
           L+ L+  +   W DV +  ++++  +SGA+TN V+ I+        TKN+  P RVL+R+
Sbjct: 17  LMKLLMSLATKWGDVLDLKNLKVHHLSGAMTNEVYRISWP------TKNENVPRRVLVRM 70

Query: 73  YGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSK 132
           YG GVD+  +R +E+   E LS    GPKLLG F NGR E+ + + TL + DLRD   S 
Sbjct: 71  YGEGVDRFFNRDEEIRTFECLSKKGQGPKLLGQFANGRVEEFIHARTLSAEDLRDSEISS 130

Query: 133 YIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDF 192
            IA +L + HN+     P   N+   +W  + KW    LN    L C+ E    L+EF  
Sbjct: 131 LIAAKLREFHNLD---MPGSRNVL--LWDRLRKW----LNEAKGL-CSPEH---LKEFSL 177

Query: 193 KMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD--GSLVVVDFEYAGYNYQAFD 250
             L +EI  L+ +L     + I F HND QYGNI+ + D   ++ ++D+EY GYN  A+D
Sbjct: 178 GNLDEEISLLEKELPTESQN-IAFCHNDMQYGNIM-IDDKTKAVTIIDYEYGGYNPIAYD 235

Query: 251 IANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
            ANHFCE T +Y +  PH M+ + YP+ +++  F+RAY+ +       + N PS   D  
Sbjct: 236 FANHFCEMTANYHTDTPHIMHFNTYPDFEERQRFVRAYLSS-------SGNQPS---DEE 285

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           ++KL  E   +TLA+H+ WGLWG++ +  + I+FDY+ Y   R  ++
Sbjct: 286 VKKLVDESEKYTLANHLFWGLWGVISAYVNNIEFDYMEYARGRFKQY 332



>gi|508727706|gb|EOY19603.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gi|508727707|gb|EOY19604.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gi|508727708|gb|EOY19605.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
          Length = 341

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 194/349 (55%), Gaps = 35/349 (10%)

Query: 11  LRNALIPLITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVL 69
           +++AL  L +D    WD V +   +Q+  + GA+TN VF I    +  + ++     +VL
Sbjct: 15  VKDALQLLASD----WDDVVDSKALQVIPLKGAMTNQVFQIKWPTRTDEVSR-----KVL 65

Query: 70  LRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPS 129
           +R+YG GV+   DR  E+   E +S  + GP+LLG F NGR E+ + + TL ++DLRDP+
Sbjct: 66  VRIYGEGVEVFFDRDNEIRTFEFMSKHRQGPRLLGRFPNGRIEEFIRARTLSASDLRDPN 125

Query: 130 TSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEE 189
            S  IA +L + H +    P P+   K  +W  +  W    LNA   + C  E+ K    
Sbjct: 126 VSALIAAKLREFHEL--DMPGPK---KVWLWDRLQNW----LNAAKRV-CPLEEAKA--- 172

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQA 248
           F  +++++EI  L+ KLS      I F HND QYGNI+   +  S+ ++D+EYA YN  A
Sbjct: 173 FRLEVIEEEISMLEKKLS-GCHQHIGFCHNDLQYGNIMIDEETKSITIIDYEYASYNPVA 231

Query: 249 FDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           +DIANHFCE   DY + +PH M+   YP   +++ FLR Y+ +          +  E  D
Sbjct: 232 YDIANHFCEMAADYHTEMPHIMDYSKYPGWGERLRFLRIYLHS----------SGKEPRD 281

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
             + +L  +V  FTLASH+ WGLWG++    ++IDFDY  Y  +R  ++
Sbjct: 282 TEVDQLLKDVEKFTLASHLTWGLWGIISEHVNEIDFDYKEYAKQRFQQY 330



>gi|482571183|gb|EOA35371.1| hypothetical protein CARUB_v10020564mg [Capsella rubella]
 gi|482571184|gb|EOA35372.1| hypothetical protein CARUB_v10020564mg [Capsella rubella]
          Length = 350

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/333 (37%), Positives = 182/333 (54%), Gaps = 32/333 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQK 85
           DV +   +Q+  + GA+TN VF I         T+ K P R VL+R+YG GVD   DR+ 
Sbjct: 34  DVIDSKALQVIPLKGAMTNEVFQIKWP------TREKGPSRKVLVRIYGEGVDIFFDRED 87

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           E+   E +SN   GP LLG F NGR E+ L + TL + DLRDP+ S  IA R+ + H + 
Sbjct: 88  EIRTFEFMSNHGHGPLLLGRFGNGRIEEFLNARTLSAADLRDPAISGRIATRMKEFHGL- 146

Query: 146 NICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
              P  +  +   +W  +  W    L A   L   EE +     F   +++ EI  L+  
Sbjct: 147 -EMPGVKRAL---LWDRLRNW----LTACKRLASPEEAKS----FRLDVMETEINLLEKS 194

Query: 206 LSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           L +N D  I F HND QYGNI+   +  ++ ++D+EY+ YN  A+DIANHFCE   DY +
Sbjct: 195 LFNN-DENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDIANHFCEMAADYHT 253

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH M    YP  +++  FL+ Y+ +YS           E  D  ++KLK +V  +TLA
Sbjct: 254 ETPHIMEYSKYPGVEERQQFLKTYM-SYS---------GEEPSDAMVEKLKEDVEKYTLA 303

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           SH+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 304 SHLTWGLWGIISEHVNEIDFDYMEYARQRFAQY 336



>gi|168046258|ref|XP_001775591.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673009|gb|EDQ59538.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 323

 Score =  207 bits (526), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 188/341 (55%), Gaps = 33/341 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN-KKPLRVLLRVYGNGVDQLCDRQK 85
           D+ +  D+ + R+ GA+TN V+      + H +  N  +P  VL+R+YG G     +R  
Sbjct: 11  DILDPKDLTLTRLKGAMTNYVY------QCHWERDNGHRPRTVLVRIYGEGSSMFFNRND 64

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           E+   E++S    GP LLG F NGR E+ L + TL+ +DLRDP  SK IA++L + H++ 
Sbjct: 65  EVLTFELMSQKGQGPHLLGRFPNGRVEEFLRARTLEKHDLRDPEISKRIAEKLQEFHSL- 123

Query: 146 NICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
              P P+   K ++W  +  W          +K  E      E+F    L DEI +L+ +
Sbjct: 124 -DMPGPR---KAKLWERLRDWL---------VKIFEHSDSTEEDFGINKLDDEINDLQRR 170

Query: 206 LSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           L    D+ I F HND QYGNI+    D S+ ++D+EYA YN  AFDIANHFCE T DY S
Sbjct: 171 LM-KPDTRIGFCHNDLQYGNIMVSEKDDSITLIDYEYASYNPVAFDIANHFCEMTADYHS 229

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH +N   +P+ +++  F RAY++A S  S   I+         +++   EV  F +A
Sbjct: 230 DEPHLLNQASFPDYEERSRFCRAYLEA-SGDSATQID---------VERFVKEVDEFVVA 279

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
           SH+ W LWGL+ +    ++FD+ SY  +R   +  LK++++
Sbjct: 280 SHLHWALWGLLSAAHQDVEFDFFSYSRQRFAEYYRLKHDLF 320



>gi|118486233|gb|ABK94958.1| unknown [Populus trichocarpa]
          Length = 359

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 185/332 (55%), Gaps = 31/332 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           DV++ + +Q+  + GA+TN VF I    K  + +      +VL+R+YG GV+   DR+ E
Sbjct: 32  DVADANSLQVIPLKGAMTNEVFQIKWPTKTENVSH-----KVLVRIYGEGVEVFFDRENE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           ++  E +S    GP+LLG F NGR E+ + + TL ++DLRDP  S  IA ++ + H +  
Sbjct: 87  IHTFEFISKEGQGPRLLGRFSNGRIEEFIHARTLSASDLRDPDMSALIAAKMKEFHGL-- 144

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
             P P+ NI   +W  +  W   A        CT E+ K    F    +++EI  L+ +L
Sbjct: 145 EMPGPK-NIS--LWDRLRNWLETAKRL-----CTPEEAK---PFRLDSIEEEISLLEKEL 193

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S   D  I F HND QYGNI+      ++ ++D+EYA YN  AFDIANHFCE T DY + 
Sbjct: 194 SG--DRSIGFCHNDLQYGNIMIDEKTRVITIIDYEYASYNPIAFDIANHFCEMTADYHTD 251

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++   YP  D++  FLR Y+ +       +   PS   DN +++L   V  + LAS
Sbjct: 252 TPHILDYSKYPGLDERQRFLRVYLSS-------SGGQPS---DNEVEQLLENVEKYKLAS 301

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 302 HLFWGLWGIISEHVNEIDFDYMEYARQRFEQY 333



>gi|224073007|ref|XP_002303949.1| predicted protein [Populus trichocarpa]
 gi|222841381|gb|EEE78928.1| predicted protein [Populus trichocarpa]
          Length = 343

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 185/332 (55%), Gaps = 31/332 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           DV++ + +Q+  + GA+TN VF I    K  + +      +VL+R+YG GV+   DR+ E
Sbjct: 32  DVADANSLQVIPLKGAMTNEVFQIKWPTKTENVSH-----KVLVRIYGEGVEVFFDRENE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           ++  E +S    GP+LLG F NGR E+ + + TL ++DLRDP  S  IA ++ + H +  
Sbjct: 87  IHTFEFISKQGQGPRLLGRFSNGRIEEFIHARTLSASDLRDPDMSALIAAKMKEFHGL-- 144

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
             P P+ NI   +W  +  W   A        CT E+ K    F    +++EI  L+ +L
Sbjct: 145 EMPGPK-NIS--LWDRLRNWLETAKRL-----CTPEEAK---PFRLDSIEEEISLLEKEL 193

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S   D  I F HND QYGNI+      ++ ++D+EYA YN  AFDIANHFCE T DY + 
Sbjct: 194 SG--DRSIGFCHNDLQYGNIMIDEKTRVITIIDYEYASYNPIAFDIANHFCEMTADYHTD 251

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++   YP  D++  FLR Y+ +       +   PS   DN +++L   V  + LAS
Sbjct: 252 TPHILDYSKYPGLDERQRFLRVYLSS-------SGGQPS---DNEVEQLIENVEKYKLAS 301

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 302 HLFWGLWGIISEHVNEIDFDYMEYARQRFGQY 333



>gi|363808234|ref|NP_001241979.1| uncharacterized protein LOC100799515 [Glycine max]
 gi|255645201|gb|ACU23098.1| unknown [Glycine max]
          Length = 362

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 183/326 (56%), Gaps = 32/326 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFLEM 92
           +Q+  ++GALTN VF      +++  TKN   +R VL+R+YG GV+   DR++E+   E 
Sbjct: 39  LQVIPLNGALTNEVF------QINWPTKNDGEVRKVLIRLYGEGVEVFFDREEEIRTFEC 92

Query: 93  LSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQ 152
           +S    GP+LLG F +GR E+ + + TL + DLRDP  S  IA ++ + HN+    P  +
Sbjct: 93  ISKHGQGPRLLGRFTSGRVEEFIHARTLSAADLRDPEVSALIASKMREFHNL--HMPGAK 150

Query: 153 ENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDS 212
              K ++W  + KW    L    SL   ++ +K    F    L +EI  L+ KLS     
Sbjct: 151 ---KAQIWHRVRKW----LGQAKSLCSPKDAKK----FGLDNLDEEINILEKKLSEGYQE 199

Query: 213 PIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMN 271
            IVF HND QYGNI+   +  L+ ++D+EYAGYN  A+D+ANHFCE   DY S  PH ++
Sbjct: 200 -IVFCHNDLQYGNIMMDEETRLITIIDYEYAGYNPIAYDLANHFCEMVADYHSDTPHVLD 258

Query: 272 LDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGL 331
              YP  +++  F+R Y+ +         N PS    N L K       +TLA+H+ WGL
Sbjct: 259 YKKYPGLEERQRFIRNYLSSED-------NKPSNAKVNQLVK---AAEKYTLANHLFWGL 308

Query: 332 WGLVQSGQSQIDFDYLSYGMERLHRF 357
           WGL+ S  ++IDFDY  YG +R  ++
Sbjct: 309 WGLISSYVNKIDFDYKEYGRQRFQQY 334



>gi|403414934|emb|CCM01634.1| predicted protein [Fibroporia radiculosa]
          Length = 460

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 189/349 (54%), Gaps = 30/349 (8%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           I+I++VSG++TN VFF++       +        +LLR+YG     L  R KEL  L +L
Sbjct: 112 IEIQKVSGSMTNAVFFVSCPSVPGTRI-------LLLRIYGPSSGSLISRPKELQTLHVL 164

Query: 94  SN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICP-- 149
           S+  +IGP++ G F+NGR E+  ++ TL + D+R+P  S +I  R+++LH + IN     
Sbjct: 165 SSQYRIGPRVYGTFENGRIEEFFDATTLTAADMREPKISSWIGARMAELHGVDINAVTQG 224

Query: 150 ----PPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKM-LKDEIEELKY 204
                 +EN    V  N+  W   A   ++     E+  + L+   F+   K  +  L  
Sbjct: 225 SKVDAHEENEWSAVEQNVQSWLGYAREVLALASAPEQVCRDLDLDRFEHEWKQYLRWLHE 284

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLT---DG-----SLVVVDFEYAGYNYQAFDIANHFC 256
           K      S  +FAHNDTQYGN+LRL    +G      ++VVDFEYA  N  AFDIANHF 
Sbjct: 285 KEECEGKSKRIFAHNDTQYGNLLRLKTLKEGLPEHRQIIVVDFEYASPNPAAFDIANHFH 344

Query: 257 EWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKL 316
           EWT +Y S +PH +N  LYP+  Q+ +F R+Y+   ++ +D          +  +Q L+ 
Sbjct: 345 EWTANYHSDMPHILNPALYPSHGQRRNFYRSYLTHVALAADDASEMSDVLLETQMQDLES 404

Query: 317 EVYAFTLASHVMWGLWGLVQSGQ------SQIDFDYLSYGMERLHRFRE 359
            V A++ ASH MW LWG+VQ+ +       + +FDYL Y   R+  FRE
Sbjct: 405 LVRAWSPASHAMWALWGVVQAREIVEGKDGEPEFDYLGYSRCRMDGFRE 453



>gi|148906600|gb|ABR16452.1| unknown [Picea sitchensis]
          Length = 351

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 117/348 (33%), Positives = 185/348 (53%), Gaps = 31/348 (8%)

Query: 12  RNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLR 71
           R A I L +  L   DV +   ++I  + GA+TN V+      +     K +KP + L+R
Sbjct: 25  REAEIVLHSLALNWADVVDAKQLEITPLKGAMTNEVYQCNWKTR-----KGEKPRKALVR 79

Query: 72  VYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTS 131
           +YG GVD   +R+ E+   E +S L  GP+LLG F  GR E+ L + TL + DLR P  S
Sbjct: 80  IYGEGVDLFFNRENEIRTFECMSRLGQGPRLLGRFPEGRIEEFLNARTLSAPDLRCPEIS 139

Query: 132 KYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFD 191
             IA +L + H +    P P+   KP++W  +  W   AL     ++          EF 
Sbjct: 140 AQIAAKLREFHQL--DVPGPR---KPKLWTRLRDWVKTALAVCPKIEAA--------EFQ 186

Query: 192 FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFD 250
              +++E++ L+  LS   D  I F HND QYGNI L   D SL ++D+EY+ YN  A+D
Sbjct: 187 LDCMEEEVDNLEKLLSRE-DETIGFCHNDLQYGNIMLHEEDKSLTIIDYEYSSYNPVAYD 245

Query: 251 IANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           IANHFCE   +Y +  PH ++   YP+ +++  F++ Y           + +  E   + 
Sbjct: 246 IANHFCEMAANYHTDTPHILDYSKYPDFEERQRFVKEY-----------LKSSGEMESDR 294

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFR 358
           + +L  +V  + LASH++WGLWG++    + I+FDY+ Y  +R  +++
Sbjct: 295 VGQLLEDVEKYALASHLLWGLWGVISDHVNNIEFDYIDYARQRFQQYQ 342



>gi|395334077|gb|EJF66453.1| kinase-like protein [Dichomitus squalens LYAD-421 SS1]
          Length = 403

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 132/370 (35%), Positives = 190/370 (51%), Gaps = 42/370 (11%)

Query: 24  PGWD--VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           P W   V   S + I++VSG+LTN VFF++            K   VLLRVYG     L 
Sbjct: 26  PSWSDPVIVSSKVSIQKVSGSLTNAVFFVS-------CPSVPKARIVLLRVYGPSSGNLI 78

Query: 82  DRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQ 140
            R  EL+ L +LS+  +IGP++ G F+NGR E++ +S  L +NDLRDP  S +I  R+++
Sbjct: 79  SRPHELHTLHVLSSEYRIGPRVYGTFENGRIEEYFDSTALTANDLRDPEISSWIGARMAE 138

Query: 141 LHNI--------INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDF 192
           LH +              P+   +  V  N+  W P A   +      EE RK L+   F
Sbjct: 139 LHGVDIDAVTYGAQPADGPERGNQLGVHKNVKAWLPSAREVLELPGAPEEVRKSLDLDRF 198

Query: 193 -KMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL--------TDGSLVVVDFEYAG 243
            +  +   + L  K   +  S  VFAHND QYGN+LRL            ++VVDFEYA 
Sbjct: 199 EREWQLYAQWLHQKEKTSGASRRVFAHNDAQYGNLLRLRTLKEGLPAHRQIIVVDFEYAA 258

Query: 244 YNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNP 303
            N  AFD+ANHF EWT +Y  + PH ++   YP+ +++ +F RAY+       D   + P
Sbjct: 259 PNPAAFDLANHFHEWTANYHGNTPHILDPSRYPSAEERRNFYRAYLTHADRHIDAPASAP 318

Query: 304 -----SETHDNYL----QKLKLEVYAFTLASHVMWGLWGLVQSGQ------SQIDFDYLS 348
                S+  D+ L    +KL+  V A+  ASH MW +WG+VQ+ +       + +FDYL 
Sbjct: 319 IPAVVSDVSDDALAAKMEKLEEHVRAWNPASHGMWAIWGVVQARELVEGKDGEPEFDYLG 378

Query: 349 YGMERLHRFR 358
           Y   R+  FR
Sbjct: 379 YAQCRMDGFR 388



>gi|390604242|gb|EIN13633.1| choline kinase cytoplasm [Punctularia strigosozonata HHB-11173 SS5]
          Length = 473

 Score =  203 bits (516), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 192/376 (51%), Gaps = 62/376 (16%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           ++IE+V+G+LTN VFF++       +T       +LLR+YG     L +R +EL  L +L
Sbjct: 108 VKIEKVAGSLTNAVFFVSCPSIPKART-------LLLRIYGPSSGALINRARELYTLHVL 160

Query: 94  SN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPP 151
           S+  +IGP++ G F+NGR E++ +S  L +++LRDP  S+YI  R+++LH + I      
Sbjct: 161 SSQYRIGPRIYGTFENGRIEEYFDSTALTASELRDPRISRYIGARMAELHCVDIEAV--- 217

Query: 152 QENIKPEV------W-----VNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDE-- 198
            E   PE       W      N   W P A + +     T E R    E D  +LKD   
Sbjct: 218 -EQTTPETRGEGRGWEVAAKKNFRTWLPAARDVLELPSVTAETRA---ELDLDVLKDRWI 273

Query: 199 --IEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD--------------------GSLVV 236
             I+ L         S  VFAHNDTQYGN+LRLT                       ++V
Sbjct: 274 TYIQWLDQFEREEGPSKRVFAHNDTQYGNLLRLTKPKEGIPEHRQVCSCCPADDFTQIIV 333

Query: 237 VDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYID--AYSI 294
           VDFEYA  N  AFDIANHF EWT +Y  S PH ++   YP  +Q+ +F   Y++     +
Sbjct: 334 VDFEYAAPNSAAFDIANHFHEWTANYHGSTPHLLDHTRYPTLEQRRNFYATYLEHSCPPL 393

Query: 295 PSDHTINNPSETHD--NYLQKLKLEVYAFTLASHVMWGLWGLVQS------GQSQIDFDY 346
           PS      P    D    +QKL+ +V A++ ASH MW +WG+VQ+         Q +F+Y
Sbjct: 394 PSSEQACIPLTGSDLEKEMQKLEEQVRAWSPASHAMWTVWGIVQARDDMERNDGQAEFNY 453

Query: 347 LSYGMERLHRF-RELK 361
           + Y   RL  F REL+
Sbjct: 454 IGYAQCRLEGFHRELQ 469



>gi|302787302|ref|XP_002975421.1| hypothetical protein SELMODRAFT_103062 [Selaginella moellendorffii]
 gi|300156995|gb|EFJ23622.1| hypothetical protein SELMODRAFT_103062 [Selaginella moellendorffii]
          Length = 369

 Score =  203 bits (516), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 127/382 (33%), Positives = 200/382 (52%), Gaps = 47/382 (12%)

Query: 3   LGNDDNVTLRNALIP-----LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRT 53
           +G+ D+  + + +IP     L+  +   W DV +  D+    + GA+TN ++   +   +
Sbjct: 1   MGSLDDSEVSSGIIPSEVFPLLHKLAGKWPDVLDALDVTWRPLKGAMTNHIYECQWPGGS 60

Query: 54  KKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQ 113
            ++ +Q +     + L+R+YG+ VD L  R+ E+   E +S    GP+LLG F NGR E+
Sbjct: 61  GRVGEQQR-----KALVRIYGDSVDILFKREDEVRIFEFVSRKGQGPRLLGRFPNGRVEE 115

Query: 114 HLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNA 173
            + + TL + DLRDP  S  IA ++ + H +        E+ +P++W  +  W   A   
Sbjct: 116 FIHARTLTAADLRDPGISARIAAKMWEFHRL-----DLPESHEPKLWERLRDWLQKAEKL 170

Query: 174 ISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILR--LTD 231
            S         + ++EF  K L+ EI E +  +    D  I F HND QYGNI+    TD
Sbjct: 171 CSP--------QSMQEFHMKRLESEIREAERTIPEPGDV-IGFCHNDLQYGNIMHNDATD 221

Query: 232 GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPN------EDQQIDFL 285
            +L ++D+EYA YN  AFDIANHFCE   DY +  PH+++   YP       ED++  F+
Sbjct: 222 -ALTIIDYEYASYNPVAFDIANHFCEMAADYHTESPHRLDYAKYPGKYFSPYEDERRRFI 280

Query: 286 RAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFD 345
            AY+D+          + S+     +  L L V  + LASH+ WGLWG++    S IDFD
Sbjct: 281 EAYLDS----------SGSKASRGDVDTLLLRVDLYELASHLHWGLWGIISVPISDIDFD 330

Query: 346 YLSYGMERLHRFRELKNEVYER 367
           +L Y  +R  R+ E K E++ R
Sbjct: 331 FLEYARQRFQRYDERKRELWPR 352



>gi|389742286|gb|EIM83473.1| kinase-like protein [Stereum hirsutum FP-91666 SS1]
          Length = 523

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 129/369 (34%), Positives = 196/369 (53%), Gaps = 45/369 (12%)

Query: 23  LPGWDVSN--ESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQL 80
           +P W  +    + I+I +VSG+LTN VFF++     H+ T+      +LLR+YG     L
Sbjct: 157 VPSWSKATIVPNAIKIHKVSGSLTNAVFFVSLP---HNSTRT-----LLLRIYGGSSGAL 208

Query: 81  CDRQKELNFLEMLSNL-KIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLS 139
             R +EL+ L +LS+   +GP++ G F+NGR E++ +SETL + D+R P  S++I  R++
Sbjct: 209 ISRPRELHTLHVLSSTYHMGPRVYGTFENGRLEEYFDSETLTAADIRVPKISRHIGARMA 268

Query: 140 QLHNI-INICPPPQ--ENIKPEVW-----VNIDKWYPLALNAISSLKCTEEQRKGLEEFD 191
           +LH + I     P          W      N+  W P A   I+    ++E ++   E D
Sbjct: 269 ELHGVDIAAIEDPSVFAQGATRSWQIGAQKNVKSWLPPARKVIALPVISDEIKR---ELD 325

Query: 192 FKMLKDEIEE----LKYKLSHNIDSPIVFAHNDTQYGNILRL---TDGS-----LVVVDF 239
             + ++  E+    +K        S  VF HND QYGN+L+L    +G+     ++VVDF
Sbjct: 326 LDVFEERWEKYMKWMKVLEKAEGASKRVFCHNDAQYGNLLKLRKMQEGTPEHRQIIVVDF 385

Query: 240 EYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHT 299
           EYA  N  AFDIANHF EWT +Y    PH ++   YP+ DQ+ +F +AY+     P   +
Sbjct: 386 EYASPNPLAFDIANHFHEWTANYHGPTPHLLDPSNYPSPDQRRNFYKAYLTHAQRPLPSS 445

Query: 300 INNP----SET-HDNYLQKLKLEVYAFTLASHVMWGLWGLVQS------GQSQIDFDYLS 348
              P    SE      L KL++ V A++ ASH MW +WGLVQ+      G  + +FDY+S
Sbjct: 446 CTTPFLSLSEGDQQRELSKLEMHVRAWSPASHAMWTIWGLVQAREDLEGGVEEPEFDYIS 505

Query: 349 YGMERLHRF 357
           Y   R+  F
Sbjct: 506 YSRCRMAAF 514



>gi|224057232|ref|XP_002299185.1| predicted protein [Populus trichocarpa]
 gi|222846443|gb|EEE83990.1| predicted protein [Populus trichocarpa]
          Length = 360

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 184/335 (54%), Gaps = 36/335 (10%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           D+ + + +Q+  + GA+TN VF I    K  + ++     +V++R+YG GV+   DR  E
Sbjct: 32  DIDDANSLQVIPLKGAMTNEVFQIKWPTKTQNMSR-----KVVVRIYGEGVEVFFDRDTE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F NGR E+ + + TL ++DL DP  S  IA ++ + H +  
Sbjct: 87  ILTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTLSASDLHDPDISALIAAKMKEFHGL-- 144

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLK--CTEEQRKGLEEFDFKMLKDEIEELKY 204
             P P+         ++  W+ L LN + + K  CT E+ K   +F    + DEI  ++ 
Sbjct: 145 EMPGPK---------DVSLWHRLRLNWLKTAKSLCTPEEAK---DFRLDSIGDEISLIEK 192

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR 263
           +LS   D  I F HND QYGNI+   +  S+ ++D+EYA YN  AFDIANHFCE T DY 
Sbjct: 193 ELSG--DQSIGFCHNDLQYGNIMIDEETRSITIIDYEYASYNPIAFDIANHFCEMTADYH 250

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAY-SIPSDHTINNPSETHDNYLQKLKLEVYAFT 322
           +  PH ++   YP  +++  FL  Y+ +   +PSD             L++L   V  + 
Sbjct: 251 TDTPHILDYSKYPGLEERQRFLHLYLSSSGGLPSDIE-----------LEQLLENVEKYK 299

Query: 323 LASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LASH+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 300 LASHLFWGLWGIISEHVNEIDFDYMEYARQRFEQY 334



>gi|33149685|gb|AAP96922.1| choline kinase [Oryza sativa Indica Group]
          Length = 368

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 196/358 (54%), Gaps = 38/358 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI-----------TRTKKLHDQTKNKKP 65
           L+ +M   W DV++   +Q+  + GA+TN V+ +           +   +     + ++ 
Sbjct: 29  LLHEMAASWADVADCRALQVIPLKGAMTNEVYHVRWLNGAPATADSGEVEAEAAAREREV 88

Query: 66  LRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDL 125
            +VL+R+YG+GV+   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DL
Sbjct: 89  RKVLVRIYGDGVELFFDREDEVRTFECMSRHGQGPRLLGRFTNGRVEEFIHARTLSAADL 148

Query: 126 RDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK 185
           RDP  S  +A +L + HN+    P P+  +   +W  +  W   A N    L+ ++E +K
Sbjct: 149 RDPEISALVASKLREFHNL--DMPGPKSVL---IWDRLKNWLKTARN----LRSSDESKK 199

Query: 186 GLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGY 244
               F    L++EI  L+ + S +    I F HND QYGNI+   D + L ++D+EYA +
Sbjct: 200 ----FRLGSLENEIAALEKEFSGDYHG-IGFCHNDLQYGNIMIDEDTNMLTIIDYEYASF 254

Query: 245 NYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNP- 303
           N  A+DIANHFCE   DY S  PH+++   YP+ D+Q  F++ Y+      S+     P 
Sbjct: 255 NPVAYDIANHFCEMPADYHSEKPHRLDYSKYPDTDEQKRFVKTYL------SNSVSEEPD 308

Query: 304 SETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           +E  +N LQ ++     +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K
Sbjct: 309 AEEVENLLQSIE----KYTLASHIVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKK 362



>gi|302822897|ref|XP_002993104.1| hypothetical protein SELMODRAFT_136490 [Selaginella moellendorffii]
 gi|300139104|gb|EFJ05852.1| hypothetical protein SELMODRAFT_136490 [Selaginella moellendorffii]
          Length = 373

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 201/386 (52%), Gaps = 51/386 (13%)

Query: 3   LGNDDNVTLRNALIP-----LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRT 53
           +G+ D+  + + +IP     L+  +   W DV +  D+    + GA+TN ++   +   +
Sbjct: 1   MGSLDDSEVSSGIIPSEVFPLLHKLAGKWPDVLDALDVTWRPLKGAMTNHIYECQWPGGS 60

Query: 54  KKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQ 113
            ++ +Q +     + L+R+YG+ VD L  R+ E+   E +S    GP+LLG F NGR E+
Sbjct: 61  GRVGEQQR-----KALVRIYGDSVDILFKREDEVRIFEFVSRKGQGPRLLGRFPNGRVEE 115

Query: 114 HLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNA 173
            + + TL + DLRDP  S  IA ++ + H +        E+ +P++W  +  W   A   
Sbjct: 116 FIHARTLTAADLRDPGISARIAAKMWEFHRL-----DLPESHEPKLWERLRDWLQKAEKL 170

Query: 174 ISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILR--LTD 231
            S         + ++EF  K L+ EI E +  +    D  I F HND QYGNI+    TD
Sbjct: 171 CSP--------QSMQEFHMKRLESEIREAESTIPEPGDV-IGFCHNDLQYGNIMHNDATD 221

Query: 232 GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYP----------NEDQQ 281
            +L ++D+EYA YN  AFDIANHFCE   DY +  PH+++   YP          +ED++
Sbjct: 222 -ALTIIDYEYASYNPVAFDIANHFCEMAADYHTESPHRLDYAKYPGNLHCCSHSADEDER 280

Query: 282 IDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQ 341
             F+ AY+D+          + S+     +  L L V  + LASH+ WGLWG++    S 
Sbjct: 281 RRFIEAYLDS----------SGSKASRGDVDTLLLRVDLYELASHLHWGLWGIISVPISD 330

Query: 342 IDFDYLSYGMERLHRFRELKNEVYER 367
           IDFD+L Y  +R  R+ E K E++ R
Sbjct: 331 IDFDFLEYARQRFQRYDERKRELWPR 356



>gi|326516406|dbj|BAJ92358.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 311

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 181/331 (54%), Gaps = 32/331 (9%)

Query: 36  IERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSN 95
           + ++ GALTN VF IT      D      P +VL+R+YG GV+   DR  E+   E +S 
Sbjct: 3   VSQLQGALTNEVFRITWPGGEGD------PRKVLVRIYGQGVEVFFDRADEVRTFECMSR 56

Query: 96  LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENI 155
              GP+LLG F  GR E+ + + TL + DLRDP  S  IA++L + H +     P  ++I
Sbjct: 57  HGQGPRLLGRFPQGRVEEFINARTLSAPDLRDPGISSLIARKLREFHELDM---PGSKDI 113

Query: 156 KPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIV 215
              +W  + +W   A +     +C+ E+ +   +F  + L DEI EL+  LS  +D  +V
Sbjct: 114 S--LWQRLRRWLEEARS-----RCSAEEAR---QFRLEALGDEIAELENALS-GVDQRVV 162

Query: 216 FAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDL 274
           F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY S  PH M+   
Sbjct: 163 FCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYHSDTPHVMDFTK 222

Query: 275 YPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGL 334
           YP+ D+Q  FL AY+ +          +  E  D  ++ L   +  ++L+SH+ WGLWG+
Sbjct: 223 YPDMDEQWRFLEAYLSS----------SGEEPSDAEVETLLGLIAKYSLSSHLFWGLWGI 272

Query: 335 VQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           V    ++ IDF+Y  Y   R +++ + K  +
Sbjct: 273 VSEHVNKNIDFEYKEYARHRFNQYWDTKPRI 303



>gi|393247883|gb|EJD55390.1| kinase-like protein [Auricularia delicata TFB-10046 SS5]
          Length = 446

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 193/365 (52%), Gaps = 57/365 (15%)

Query: 20  TDMLPGW-DVSNE-SDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV 77
           T ++P W  V  E  D++I +VSG+LTN VFF++ +     QT+      VLLR+YG   
Sbjct: 105 TVVVPSWAGVEVEVGDVKIHKVSGSLTNAVFFVSCSVP---QTRT-----VLLRIYGPSS 156

Query: 78  DQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
             L  R  EL  L +LS+  +IGP+L G F NGR E++ +S+ L   ++R P  S++IA+
Sbjct: 157 GNLISRPDELRMLHVLSSRYRIGPRLYGTFANGRLEEYFDSDALTPEEMRSPQISEWIAK 216

Query: 137 RLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK---GLEEFD- 191
           R++++H + I     P   I      N+ KW P A   ++ L   E  R+    L+EF  
Sbjct: 217 RMAEMHRVDIEAVVGPNWAIA--AVENVQKWLPPAREVVA-LVADERLRELGLNLDEFQA 273

Query: 192 -FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLT----------DGSLVVVDFE 240
            +K   D++E   ++ SH   SP VFAHND QYGN+L+L              ++VVDFE
Sbjct: 274 AWKSYLDKVE--AWEQSHR-PSPRVFAHNDAQYGNLLKLRAPPANKPAHHQSEIIVVDFE 330

Query: 241 YAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTI 300
           Y+  N  AFDIANHF EWT  Y SS PH +  + YP+  ++ +F RAY+           
Sbjct: 331 YSAPNPAAFDIANHFQEWTTAYNSSTPHILRPEAYPDASERHNFYRAYLGG--------- 381

Query: 301 NNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQ------SGQSQI--DFDYLSYGME 352
                  +  L  L+ +V  ++ A H MW +W LVQ      +GQ  +  DFDYL Y   
Sbjct: 382 -------ETGLDLLEGQVRVWSAACHGMWAVWSLVQAREQVEAGQLNVFEDFDYLGYASS 434

Query: 353 RLHRF 357
           RL  F
Sbjct: 435 RLGEF 439



>gi|223947745|gb|ACN27956.1| unknown [Zea mays]
 gi|413947636|gb|AFW80285.1| choline/ethanolamine kinase [Zea mays]
          Length = 410

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 187/342 (54%), Gaps = 30/342 (8%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV +   + + ++ GA+TN VF IT       + +   P +VL+R+YG GV+   DR 
Sbjct: 93  GGDV-DPGALAVSQLRGAMTNEVFRITWPG---GEAEGNGPRKVLVRIYGRGVEVFFDRA 148

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 149 DEVRTFECMSRHGQGPRLLGRFANGRVEEFINARTLSAADLRDPEMSALIARKLREFHDL 208

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A +     +C+EE+     +F    L DEI  L+ 
Sbjct: 209 --DMPGPRD---VSLWQRLKRWLGEARD-----RCSEEESN---QFQLNKLGDEISVLEK 255

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  +   + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 256 TLS-GLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYH 314

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTL 323
           +S PH ++   YP+  +Q  F+ AY+ +           P+   D  +++L   +  +TL
Sbjct: 315 TSTPHVLDFTKYPDTGEQRRFVEAYLSSAG-------KKPT---DGEVEELLGLIAKYTL 364

Query: 324 ASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           ASH+ WGLWG++ +  ++ IDF Y  Y  +RL ++ + K  +
Sbjct: 365 ASHLFWGLWGIISAHVNENIDFAYKEYARQRLDQYWQTKPRI 406



>gi|328697438|ref|XP_001942911.2| PREDICTED: choline/ethanolamine kinase-like [Acyrthosiphon pisum]
          Length = 397

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 192/354 (54%), Gaps = 38/354 (10%)

Query: 18  LITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG-- 74
           L    LPG W      DI ++R+SG L+N ++ +T  K       N  P  VL+R+YG  
Sbjct: 65  LCRSYLPGSWKKITSKDISVKRISGGLSNWLYRVTLLKG------NADPRDVLMRLYGQT 118

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
           +G + + +   E     +LS   +GPKL G+F  GR E+++ + ++KS +L DP  S  I
Sbjct: 119 HGENAIENIITESVIFTLLSERGLGPKLHGIFPGGRLEEYIPARSMKSEELSDPKLSLMI 178

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKM 194
           A+++++LH + NI   P       +W  +D+W    +  ++      E    L++     
Sbjct: 179 AEKMAELHQL-NI---PINKDSTWLWDTMDRWLQQPIKDVNWSSDNME----LDQILSIN 230

Query: 195 LKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-----SLVVVDFEYAGYNYQAF 249
           L DE   LK  LS  + SP+VF HND Q GNIL   +      SL ++D+EY  YNY+ F
Sbjct: 231 LSDETRWLKKHLS-KLRSPVVFCHNDLQEGNILMKENDPPGSRSLCLIDYEYCAYNYRGF 289

Query: 250 DIANHFCEWTYDYRSSV-PH-KMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETH 307
           DIANHF EWTYDY + + PH  +N +L+P +DQQI+FL+ Y         H + N     
Sbjct: 290 DIANHFVEWTYDYTNPIYPHYTVNRELFPTKDQQIEFLKRY--------SHCMEN----- 336

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           +  ++ +  EV  F LASH+ WG+W +V S  S+I F Y  Y MERL  + +LK
Sbjct: 337 EESIELILNEVNNFILASHLFWGIWSIVNSRMSKITFGYREYAMERLKSYFKLK 390



>gi|399168318|emb|CCE30800.1| related to choline kinase [Claviceps purpurea 20.1]
          Length = 749

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 146/461 (31%), Positives = 210/461 (45%), Gaps = 109/461 (23%)

Query: 5   NDDNVTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQT 60
           +D  +T +N +I +  T  L GW    + +   I +ER+SGALTN V+ +T  K L +  
Sbjct: 262 SDAWLTFKNEIIRIAHTLRLKGWRRISLGSGDLIDVERLSGALTNAVYVVTPPKNLGESV 321

Query: 61  KNKK-PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESET 119
           + +K P ++LLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG FKNGRFEQ+  + T
Sbjct: 322 EGRKTPEKILLRVYGPQVEHLIDRENELKVLQRLARKKIGPRLLGTFKNGRFEQYFNAIT 381

Query: 120 LKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-- 177
           L    LR+P TSK IA+R+ +LH+ I++ P  +E   P VW N D+W        + L  
Sbjct: 382 LTPAHLREPDTSKSIAKRMRELHDGIDLLPLEREG-GPNVWRNWDQWLANVAKITTYLDQ 440

Query: 178 ---KCTEEQRKGL-----------------EEFDFKMLKDEIE-ELKYKLSHNIDSPIVF 216
              +  + Q +G                  E+F   ++K     E  YK    I   +VF
Sbjct: 441 QYERGRDAQSEGASVVHAWKENGYVCGVPWEQFLQMVVKYRTHVESCYKTKRTIKDRLVF 500

Query: 217 AHNDTQYGNILRL--------------TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDY 262
           AHNDTQYGNILR+                  L+V+DFEYA  N    + ANHF EWTY+Y
Sbjct: 501 AHNDTQYGNILRIRPDDEKSPLLQPANKHKQLIVIDFEYAAANTPGLEFANHFSEWTYNY 560

Query: 263 R-SSVPHKMNLDLYPNEDQQIDFLRAYIDAYS-----------IPSDHTINNPS------ 304
             ++ P+  N + YP  ++Q  F++AY+D              +P D     PS      
Sbjct: 561 HDATSPYVCNHERYPTPEEQRRFIKAYVDHRPQFPSASATPRLVPQDSGSCTPSLNPITS 620

Query: 305 --------------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSG 338
                                     E  D  +++L  E   +   +  MW  WG+VQ+ 
Sbjct: 621 SSSIVDFMLDARVPPGGWSAAERAREEQSDLQVRELMEEARLWRPGNSAMWVAWGIVQAR 680

Query: 339 QSQID----------------------FDYLSYGMERLHRF 357
              +D                      FDYL Y  +R   F
Sbjct: 681 IPGLDADNEPACEADVLKAEQDIGPDEFDYLRYAQDRASFF 721



>gi|413947637|gb|AFW80286.1| choline/ethanolamine kinase [Zea mays]
          Length = 359

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 187/342 (54%), Gaps = 30/342 (8%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV +   + + ++ GA+TN VF IT       + +   P +VL+R+YG GV+   DR 
Sbjct: 42  GGDV-DPGALAVSQLRGAMTNEVFRITWPG---GEAEGNGPRKVLVRIYGRGVEVFFDRA 97

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 98  DEVRTFECMSRHGQGPRLLGRFANGRVEEFINARTLSAADLRDPEMSALIARKLREFHDL 157

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A +     +C+EE+     +F    L DEI  L+ 
Sbjct: 158 --DMPGPRDV---SLWQRLKRWLGEARD-----RCSEEESN---QFQLNKLGDEISVLEK 204

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  +   + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 205 TLS-GLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYH 263

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTL 323
           +S PH ++   YP+  +Q  F+ AY+ +           P+   D  +++L   +  +TL
Sbjct: 264 TSTPHVLDFTKYPDTGEQRRFVEAYLSSAG-------KKPT---DGEVEELLGLIAKYTL 313

Query: 324 ASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           ASH+ WGLWG++ +  ++ IDF Y  Y  +RL ++ + K  +
Sbjct: 314 ASHLFWGLWGIISAHVNENIDFAYKEYARQRLDQYWQTKPRI 355



>gi|391329745|ref|XP_003739328.1| PREDICTED: choline/ethanolamine kinase-like [Metaseiulus
           occidentalis]
          Length = 404

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 135/380 (35%), Positives = 200/380 (52%), Gaps = 38/380 (10%)

Query: 11  LRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVL 69
           ++N    +  + L G W   + +D+  + V G L+N +++ +   + H     + P +VL
Sbjct: 40  MKNKAYKICREFLSGSWKSISSNDMVFKTVGGGLSNLLYYCS-LPETHTPLCGE-PSQVL 97

Query: 70  LRVYGN-GVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           +R+YG    DQ      E     +LS   +GPKL GVF  GR E+++ +  L +  +R+P
Sbjct: 98  MRMYGQIQGDQDASTITESIICTLLSERALGPKLFGVFPGGRLEEYIPARALVTEQIREP 157

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPE-VWV--NIDKWYPLALNAI--SSLKCTEEQ 183
             S  I+++L++LH +       Q  +  E  W+  N++KW  +    +  S  K  +  
Sbjct: 158 EISLSISRKLARLHAL-------QAPLTKEPTWLFDNMEKWLAVRNEILPNSIPKAVKPF 210

Query: 184 RKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL----TDGS-----L 234
            K L EFD+K    E+  L+ ++     SP++F HND Q GNIL +    +DGS     L
Sbjct: 211 AKKLMEFDYK---REMAWLR-EIFKRAQSPVMFCHNDLQEGNILHMESKESDGSSADENL 266

Query: 235 VVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPH----KMNLDLYPNEDQQIDFLRAYID 290
           V +DFEY  YNY+ FDIANHFCEW YDY  S P     K ++D YP E+Q+  FL  Y+ 
Sbjct: 267 VFIDFEYCSYNYRGFDIANHFCEWAYDY--SHPEYPLFKESIDQYPTEEQRRAFLEEYLK 324

Query: 291 AYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYG 350
                S H   +P     N ++ L  E   FTLASH+MW LW L  +  S+I+F Y  YG
Sbjct: 325 TLKSSSIHGDIDPK---VNTIEHLLEETETFTLASHIMWSLWSLNSAHSSKINFGYWEYG 381

Query: 351 MERLHRFRELKNEVYERLPL 370
             RL R+ ELK  + ERL L
Sbjct: 382 AARLRRYLELKERLMERLEL 401



>gi|342881467|gb|EGU82361.1| hypothetical protein FOXB_07190 [Fusarium oxysporum Fo5176]
 gi|477521829|gb|ENH73913.1| Putative choline kinase [Fusarium oxysporum f. sp. cubense race 1]
          Length = 785

 Score =  200 bits (508), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 141/457 (30%), Positives = 211/457 (46%), Gaps = 109/457 (23%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           ++ +N +I +  T  L GW    +     I +ER+SGALTN V+ +T  K++ +    +K
Sbjct: 302 LSFKNEIIRIAHTLRLKGWRRIPLGGGDKISVERLSGALTNAVYVVTPPKEIDEAEGKRK 361

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P +VLLR+YG  V+ L DR  EL+ L+ L+  KIGP+LLG FKNGRFEQ+ +S TL   D
Sbjct: 362 PKKVLLRIYGPQVEHLIDRDNELSVLQRLARKKIGPRLLGTFKNGRFEQYFDSITLTPAD 421

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKW--------------YPLA 170
           LRD   S+ IA+R+ +LH+ I++ P  +E   P  W + D+W              Y   
Sbjct: 422 LRDADMSRQIAKRMRELHDGIDLLPHEREG-GPATWKSWDQWLDNVERIATYLDNEYEKE 480

Query: 171 LNAIS----SLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS-------HNIDSPIVFAHN 219
             A +    S+    + R  +    +   +D + + +  L+         I   +VFAH+
Sbjct: 481 AQAQNGRRDSVVHAWKSRGYVCGTPWPQFRDMMTKYRVHLNSFYKGGQREIKDSLVFAHS 540

Query: 220 DTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-S 264
           DTQYGNILR+                  L+V+DFEYAG N +  + ANHF EWTY+Y  +
Sbjct: 541 DTQYGNILRIRPDDEKSPLLQAANKHKQLIVIDFEYAGPNTRGLEFANHFNEWTYNYHDA 600

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYID-----------------------AYSIPSDHTIN 301
           +VP   ++  YP  D+Q  F++AY+D                         S P     N
Sbjct: 601 AVPWACDVRRYPTPDEQRRFIKAYVDHRPRFQGSNSTPRLAPADSNVSSGMSTPLATPTN 660

Query: 302 NPS----------------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWG 333
            P+                            E  D  +++L  E   +  A+H  W  WG
Sbjct: 661 PPASSSSSIVEFMLDARVPPGGWSAAERANDERSDQRVRELLEETRQWRPANHAHWIAWG 720

Query: 334 LVQSGQSQID-------------FDYLSYGMERLHRF 357
           +VQ+    +D             FDYLSY  +R+  F
Sbjct: 721 IVQAKIPGLDETIKEEDLLNPDEFDYLSYAQDRVMFF 757



>gi|22330627|ref|NP_177572.2| protein kinase domain-containing protein [Arabidopsis thaliana]
 gi|20453122|gb|AAM19803.1| At1g74320/F1O17_1 [Arabidopsis thaliana]
 gi|22655288|gb|AAM98234.1| putative choline kinase [Arabidopsis thaliana]
 gi|30984574|gb|AAP42750.1| At1g74320 [Arabidopsis thaliana]
 gi|332197456|gb|AEE35577.1| protein kinase domain-containing protein [Arabidopsis thaliana]
          Length = 350

 Score =  199 bits (507), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 181/333 (54%), Gaps = 32/333 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQK 85
           DV +   +Q+  + GA+TN VF I         T+ K P R VL+R+YG GV+   DR+ 
Sbjct: 34  DVIDSKALQVIPLKGAMTNEVFQIKWP------TREKGPSRKVLVRIYGEGVEIFFDRED 87

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           E+   E +S    GP LLG F NGR E+ L + TL + DLRDP  S  IA R+ + H + 
Sbjct: 88  EIRTFEFMSKHGHGPLLLGRFGNGRIEEFLHARTLSACDLRDPEISGRIATRMKEFHGL- 146

Query: 146 NICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
              P  ++ +   +W  +  W    L A   L   EE +     F   +++ EI  L+  
Sbjct: 147 -EMPGAKKAL---LWDRLRNW----LTACKRLASPEEAKS----FRLDVMEMEINMLEKS 194

Query: 206 LSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           L  N D  I F HND QYGNI+   +  ++ ++D+EY+ YN  A+DIANHFCE   DY +
Sbjct: 195 LFDN-DENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDIANHFCEMAADYHT 253

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH M+   YP  +++  FL+ Y+        ++   PS   D  ++KL  +V  +TLA
Sbjct: 254 ETPHIMDYSKYPGVEERQRFLKTYM-------SYSDEKPS---DTMVKKLLEDVEKYTLA 303

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           SH++WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 304 SHLIWGLWGIISEHVNEIDFDYMEYARQRFEQY 336



>gi|12324898|gb|AAG52400.1|AC020579_2 putative choline kinase; 11757-10052 [Arabidopsis thaliana]
          Length = 348

 Score =  199 bits (507), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 181/333 (54%), Gaps = 32/333 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQK 85
           DV +   +Q+  + GA+TN VF I         T+ K P R VL+R+YG GV+   DR+ 
Sbjct: 32  DVIDSKALQVIPLKGAMTNEVFQIKWP------TREKGPSRKVLVRIYGEGVEIFFDRED 85

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           E+   E +S    GP LLG F NGR E+ L + TL + DLRDP  S  IA R+ + H + 
Sbjct: 86  EIRTFEFMSKHGHGPLLLGRFGNGRIEEFLHARTLSACDLRDPEISGRIATRMKEFHGL- 144

Query: 146 NICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
              P  ++ +   +W  +  W    L A   L   EE +     F   +++ EI  L+  
Sbjct: 145 -EMPGAKKAL---LWDRLRNW----LTACKRLASPEEAKS----FRLDVMEMEINMLEKS 192

Query: 206 LSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           L  N D  I F HND QYGNI+   +  ++ ++D+EY+ YN  A+DIANHFCE   DY +
Sbjct: 193 LFDN-DENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDIANHFCEMAADYHT 251

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH M+   YP  +++  FL+ Y+        ++   PS   D  ++KL  +V  +TLA
Sbjct: 252 ETPHIMDYSKYPGVEERQRFLKTYM-------SYSDEKPS---DTMVKKLLEDVEKYTLA 301

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           SH++WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 302 SHLIWGLWGIISEHVNEIDFDYMEYARQRFEQY 334



>gi|391343675|ref|XP_003746132.1| PREDICTED: choline/ethanolamine kinase-like [Metaseiulus
           occidentalis]
          Length = 429

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 135/380 (35%), Positives = 199/380 (52%), Gaps = 38/380 (10%)

Query: 11  LRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVL 69
           ++N    +  + L G W   + +D+  + V G L+N +++ +   + H     + P +VL
Sbjct: 65  MKNKAYKICREFLSGSWKSISSNDMIFKTVGGGLSNLLYYCS-LPETHTPLCGE-PSQVL 122

Query: 70  LRVYGN-GVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           +R+YG    DQ      E     +LS   +GPKL GVF  GR E+++ +  L +  +R P
Sbjct: 123 MRMYGQIHGDQDASTITESIICTLLSERALGPKLFGVFPGGRLEEYIPARALVTEQIRKP 182

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPE-VWV--NIDKWYPLALNAI--SSLKCTEEQ 183
             S  I+++L++LH +       Q  +  E  W+  N++KW  +    +  S  K  +  
Sbjct: 183 EISLSISRKLARLHAL-------QAPLTKEPTWLFDNMEKWLAVRNEILPNSIPKAVKPF 235

Query: 184 RKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL----TDGS-----L 234
            K L EFD+K    E+  L+ ++     SP++F HND Q GNIL +    +DGS     L
Sbjct: 236 AKKLMEFDYK---REMAWLR-EIFKRAQSPVMFCHNDLQEGNILHMESKESDGSSADENL 291

Query: 235 VVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPH----KMNLDLYPNEDQQIDFLRAYID 290
           V +DFEY  YNY+ FDIANHFCEW YDY  S P     K ++D YP E+Q+  FL  Y+ 
Sbjct: 292 VFIDFEYCSYNYRGFDIANHFCEWAYDY--SHPEYPLFKESIDQYPTEEQRRAFLEEYLK 349

Query: 291 AYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYG 350
                S H   +P     N ++ L  E   FTLASH+MW LW L  +  S+I+F Y  YG
Sbjct: 350 TLKSSSIHGDIDPK---VNTIEHLLEETETFTLASHIMWSLWSLNSAHSSKINFGYWEYG 406

Query: 351 MERLHRFRELKNEVYERLPL 370
             RL R+ ELK  + ERL L
Sbjct: 407 AARLRRYLELKERLMERLEL 426



>gi|171680099|ref|XP_001904995.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939676|emb|CAP64902.1| unnamed protein product [Podospora anserina S mat+]
          Length = 752

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 172/324 (53%), Gaps = 43/324 (13%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
              +N +I L  T  L GW    + +   I +ER+SGALTN V+ ++   +  L      
Sbjct: 267 TVFKNEIIRLAHTLRLKGWRRVPLDSGEQISVERLSGALTNAVYVVSPPPESALLPAEGK 326

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           K P +VLLR+YG  V+ L DR+ EL+ L  L+  KIGP+LLG F NGRFEQ+L +  L S
Sbjct: 327 KTPGKVLLRIYGPQVEHLIDRENELSVLRRLARKKIGPRLLGTFLNGRFEQYLNAAALTS 386

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKW--------------YP 168
             +R+P TS+ IA+R+ +LH+ + +    ++++ P VW N DKW              Y 
Sbjct: 387 QSMREPDTSRQIAKRMRELHDGVELL-EEEKDLGPSVWRNWDKWLAQVEKTVLFLDKQYN 445

Query: 169 LALNAISSLKCTEEQRK----GLEEFDFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDT 221
              N +S       ++K    G+E   FK L  +  +    +Y     I   +VFAHNDT
Sbjct: 446 DGPNDLSRGPSDSWKKKGYVCGVEWPAFKELVRKYRQFLDGQYGNPKKIREKLVFAHNDT 505

Query: 222 QYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSV 266
           QYGNILR+                  LVV+DFEYAG N    + ANHF EWTYDY  +  
Sbjct: 506 QYGNILRVRPDDQKSPLLQPANEHKQLVVIDFEYAGANIPGLEFANHFSEWTYDYHDARY 565

Query: 267 PHKMNLDLYPNEDQQIDFLRAYID 290
           PH  +   YPN DQQ  F+RAY+D
Sbjct: 566 PHVCDTAKYPNVDQQRRFIRAYVD 589



>gi|462414648|gb|EMJ19385.1| hypothetical protein PRUPE_ppa007687mg [Prunus persica]
          Length = 359

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 186/337 (55%), Gaps = 32/337 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           DV +   +Q+  + GA+TN VF I    K  + ++     +V++R+YG GVD   DR  E
Sbjct: 32  DVVDSKALQVIPLKGAMTNEVFEIKWPAKTGELSR-----KVVVRIYGEGVDVFFDRDNE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F NGR E  + + TL + DLRDP  S  IA +L + H  +N
Sbjct: 87  IRTFEYMSKNGQGPRLLGRFPNGRIEAFIHARTLSACDLRDPDISALIAAKLKEFHE-LN 145

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
           + P P++     +W  +  W    L+    L   EE       F    ++ EI  L+ +L
Sbjct: 146 M-PGPKDVT---LWDRLRNW----LSTAKRLSTPEEANA----FQLDSIEKEISLLEKEL 193

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDG--SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           S    S + F HND QYGNI+ L +G  S+ ++D+EYA YN  AFDI+NHFCE   DY +
Sbjct: 194 SGPSQS-MGFCHNDLQYGNIM-LEEGSKSITIIDYEYASYNAVAFDISNHFCEMAADYHT 251

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH ++   YP  +++  F+R Y+ +       + N+P+E   N +++L  +V  +TLA
Sbjct: 252 DTPHILDYSKYPGLEERQRFVRLYLSS-------SGNHPTE---NEVEQLVQDVENYTLA 301

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           SH+ WGLWG++    + IDFDY+ Y  +R  ++ + K
Sbjct: 302 SHLFWGLWGIISEHVNDIDFDYMEYARQRFQQYWKTK 338



>gi|212721530|ref|NP_001131578.1| uncharacterized protein LOC100192922 [Zea mays]
 gi|194691910|gb|ACF80039.1| unknown [Zea mays]
          Length = 359

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 188/342 (54%), Gaps = 30/342 (8%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV +   + + ++ GA+TN VF IT       + +   P +VL+R+YG GV+   DR 
Sbjct: 42  GGDV-DPGALAVSQLRGAMTNEVFRITWPG---GEAEGNGPRKVLVRIYGRGVEVFFDRA 97

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 98  DEVRTFECMSRHGQGPRLLGRFANGRVEEFINARTLSAADLRDPEMSTLIARKLREFHDL 157

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A +     +C++E+     +F    L DEI  L+ 
Sbjct: 158 --DMPGPRDV---SLWQRLKRWLGEARD-----RCSQEESN---QFQLNKLGDEISVLEK 204

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  +   + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 205 TLS-GLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYH 263

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTL 323
           ++ PH ++   YP+  +Q  F+ AY+ +           P+   D  +++L   +  +TL
Sbjct: 264 TATPHVLDFTKYPDTGEQRRFVEAYLSSAG-------EKPT---DGEVEELLGLIAKYTL 313

Query: 324 ASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           ASH+ WGLWG++ +  ++ IDF+Y  Y  +RL ++ + K  +
Sbjct: 314 ASHLFWGLWGIISAHVNEHIDFEYKEYARQRLDQYWQTKPRI 355



>gi|358381268|gb|EHK18944.1| hypothetical protein TRIVIDRAFT_43568 [Trichoderma virens Gv29-8]
          Length = 739

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 141/432 (32%), Positives = 198/432 (45%), Gaps = 98/432 (22%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQ 79
           L GW    + +   + +ER+SGALTN V+ +T   +L      K P +VLLRVYG  V+ 
Sbjct: 281 LKGWRRIPLGSGESMSVERLSGALTNAVYVVTPPAELPQADGKKPPTKVLLRVYGPQVEH 340

Query: 80  LCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLS 139
           L DR+ EL  L+ L+  KIGP+LLG FKNGRFEQ   + TL   +LR+P TS+ IA+R+ 
Sbjct: 341 LIDRENELQVLQRLARKKIGPRLLGTFKNGRFEQFFNAITLTPLNLREPETSRQIAKRMR 400

Query: 140 QLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-----KCTEEQRKG-------- 186
           +LH+ + +    +EN  P VW N D+W        S L     K  E +RK         
Sbjct: 401 ELHDGVEVLLHEREN-GPGVWKNWDQWLDNVGRITSFLDKELEKTPETERKNSVVNAWKA 459

Query: 187 ---LEEFDFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYGNILRLTD------ 231
              +    ++  K+ + + +      YK    I   +VFAHNDTQYGNILR+        
Sbjct: 460 NGYVCGVPWEQFKEVVIKYRAHLNNCYKGHRAIKDRLVFAHNDTQYGNILRIRPDDEKSP 519

Query: 232 --------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS-VPHKMNLDLYPNEDQQI 282
                     LVV+DFEYA  N    + ANHF EW Y+Y    +P   + D YP+ ++Q 
Sbjct: 520 LLQPANKHKQLVVIDFEYAAPNTAGLEFANHFTEWMYNYHDPLIPFACHADRYPSLEEQK 579

Query: 283 DFLRAYID-------AYSIPSDHTINNPS------------------------------- 304
            F+RAY+D       A S P    ++ PS                               
Sbjct: 580 RFIRAYVDHRPQFPQASSTPRLTPLDTPSAAATPSLLPTASSSSIVDFMLDARYPGGDWG 639

Query: 305 -------ETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQID------------FD 345
                  E  D  +++L  E   +  A+   W  WG+VQ+    +D            FD
Sbjct: 640 AVEKAREEQVDQQVRELIEEARLWQPANSAQWIAWGIVQAKVPGLDGNPAEEEPGADEFD 699

Query: 346 YLSYGMERLHRF 357
           YLSY  +R   F
Sbjct: 700 YLSYAQDRAMFF 711



>gi|115439587|ref|NP_001044073.1| Os01g0717000 [Oryza sativa Japonica Group]
 gi|57899680|dbj|BAD87386.1| putative choline kinase CK2 [Oryza sativa Japonica Group]
 gi|113533604|dbj|BAF05987.1| Os01g0717000 [Oryza sativa Japonica Group]
 gi|125527499|gb|EAY75613.1| hypothetical protein OsI_03517 [Oryza sativa Indica Group]
 gi|125571820|gb|EAZ13335.1| hypothetical protein OsJ_03257 [Oryza sativa Japonica Group]
 gi|215701348|dbj|BAG92772.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215704374|dbj|BAG93808.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 368

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 195/358 (54%), Gaps = 38/358 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRTKKLHD--------QTKNKKP 65
           L+ +M   W DV++   +Q+  + GA+TN V+   ++       D          + ++ 
Sbjct: 29  LLHEMAASWADVADCRALQVIPLKGAMTNEVYQVRWLNGAPATADGGEVEAEAAAREREV 88

Query: 66  LRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDL 125
            +VL+R+YG+GV+   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DL
Sbjct: 89  RKVLVRIYGDGVELFFDREDEVRTFECMSRHGQGPRLLGRFTNGRVEEFIHARTLSAADL 148

Query: 126 RDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK 185
           RDP  S  +A +L + HN+    P P+  +   +W  +  W   A N  SS    +E +K
Sbjct: 149 RDPEISALVASKLREFHNL--DMPGPKSVL---IWDRLKNWLKTARNLCSS----DESKK 199

Query: 186 GLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGY 244
               F    L++EI  L+ + S +    I F HND QYGNI+   D + L ++D+EYA +
Sbjct: 200 ----FRLGSLENEIAALEKEFSGDYHG-IGFCHNDLQYGNIMIDEDTNMLTIIDYEYASF 254

Query: 245 NYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNP- 303
           N  A+DIANHFCE   DY S  PH+++   YP+ D+Q  F++ Y+      S+     P 
Sbjct: 255 NPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYL------SNSVSEEPD 308

Query: 304 SETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           +E  +N LQ ++     +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K
Sbjct: 309 AEEVENLLQSIE----KYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKK 362



>gi|46136047|ref|XP_389715.1| hypothetical protein FG09539.1 [Fusarium graminearum PH-1]
          Length = 790

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 211/457 (46%), Gaps = 109/457 (23%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           ++ +N +I +  T  L GW    +     I + R+SGALTN V+ +T  K++ +    +K
Sbjct: 307 LSFKNEIIRIAHTLRLKGWRRIPLGGGDSISVVRLSGALTNAVYVVTPPKEIDETDGKRK 366

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P +VLLR+YG  V+ L DR  EL+ L+ L+  KIGP+LLG F+NGRFEQ+ ES TL   D
Sbjct: 367 PTKVLLRIYGPQVEHLIDRDNELSVLQRLARKKIGPRLLGTFQNGRFEQYFESITLTPMD 426

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYP----LALNAISSLKCT 180
           LRDP TS+ IA+R+ +LH  I++ P  +E   P  W + D+W      +A    +  +  
Sbjct: 427 LRDPDTSRSIAKRMRELHEGIDLLPHEREG-GPATWKSWDQWLDNVERIATYLDNEYEKH 485

Query: 181 EEQRKGLEEFDFKMLKD----------EIEEL--KYKLSHN---------IDSPIVFAHN 219
            E + G ++      K           E   +  KY++  N         +   +VFAH+
Sbjct: 486 VEGQHGQQDSVAHAWKSRGYVCGTTWPEFRNMMTKYRVHLNSFYKGGQREVKDSLVFAHS 545

Query: 220 DTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-S 264
           DTQYGNILR+                  L+V+DFEYAG N +  + ANHF EWTY+Y  +
Sbjct: 546 DTQYGNILRIRPDDEKSPLLQAANKHKQLIVIDFEYAGPNTRGLEFANHFNEWTYNYHDA 605

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYID---------------------------AYSIPSD 297
           + P   ++  YP  D+Q  F++AY+D                             + P +
Sbjct: 606 AAPWACDVRRYPTPDEQRRFIKAYVDHRPRFQGSNSTPRLAPVDSNASSGMSTPLATPGN 665

Query: 298 HTINNPS------------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWG 333
              N+ S                        E  D  +++L  E   +  A+H  W  WG
Sbjct: 666 PAANSSSSIVEFMLDARVPPGGWSAAERANDEQRDQRVRELLEETRQWRPANHAHWIAWG 725

Query: 334 LVQSGQSQID-------------FDYLSYGMERLHRF 357
           LVQ+    +D             FDYLSY  +R   F
Sbjct: 726 LVQAKIPGLDESIKEEDLLSPDEFDYLSYAQDRTMFF 762



>gi|340515188|gb|EGR45444.1| predicted protein [Trichoderma reesei QM6a]
          Length = 726

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 142/434 (32%), Positives = 196/434 (45%), Gaps = 100/434 (23%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQ 79
           L GW    + +   + +ER+SGALTN V+ +T    +      K P +VLLRVYG  V+ 
Sbjct: 265 LKGWRRIPLGSGEALSVERLSGALTNAVYVVTPPADMPQLEGKKPPTKVLLRVYGPQVEH 324

Query: 80  LCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLS 139
           L DR+ EL  L+ L+  KIGP+LLG FKNGRFEQ   ++TL   DLR+P TS+ IA+R+ 
Sbjct: 325 LIDRENELQVLQRLARKKIGPRLLGTFKNGRFEQFFNAQTLTPTDLREPETSRQIAKRMR 384

Query: 140 QLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-----KCTEEQRK--------- 185
           +LH+ + +    +E+  P VW N D+W        S L     K  E  RK         
Sbjct: 385 ELHDGVEVLLHERES-GPGVWKNWDQWVDNVGRITSFLDQELEKTPEAARKDSLVHGWKA 443

Query: 186 -----GLEEFDFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYGNILRLTD------ 231
                G+    FK + ++        YK   +I   +VFAHNDTQYGNILR+        
Sbjct: 444 NGYVCGVPWEQFKEMVNKYRAYLNNCYKGHGSIRDRLVFAHNDTQYGNILRIRPDDEKSP 503

Query: 232 --------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS-VPHKMNLDLYPNEDQQI 282
                     LVV+DFEYA  N    + ANHF EW Y+Y    VP   N D YP+ +QQ 
Sbjct: 504 LLQPANKHKQLVVIDFEYAAPNTAGLEFANHFTEWMYNYHDPLVPWACNPDRYPSLEQQK 563

Query: 283 DFLRAYID-----------------------AYSIPSDHTINNPS--------------- 304
            F++AY++                         + PS H   + S               
Sbjct: 564 RFIKAYVEHRPYSQHSNSTPRLTPIDSQAASGSATPSLHPTASSSSIVDFMLDARYPGGD 623

Query: 305 ---------ETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI------------D 343
                    E  D  +++L  E   +  A+   W  WG+VQ+    +            D
Sbjct: 624 WNAVEKAREEQVDQQVRELIEEARLWQPANSAQWIAWGIVQAKVPGLDGMAANEELGADD 683

Query: 344 FDYLSYGMERLHRF 357
           FDYLSY  +R   F
Sbjct: 684 FDYLSYAQDRAMFF 697



>gi|470143054|ref|XP_004307202.1| PREDICTED: choline/ethanolamine kinase-like [Fragaria vesca subsp.
           vesca]
          Length = 358

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 183/336 (54%), Gaps = 30/336 (8%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           +V + + +Q+  + GA+TN VF I         +  +   +VL+R+YG GV+   DR  E
Sbjct: 31  NVDDSTALQVIPLKGAMTNEVFQIKWPT-----STGEVSCKVLVRIYGEGVEVFFDRDNE 85

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F NGR E+ + + TL ++DLRDP  S  IA ++ + H++  
Sbjct: 86  IRTFEYMSKNGQGPRLLGRFPNGRIEEFIHARTLSASDLRDPDISALIATKMKEFHDL-- 143

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
             P P++ +   +W  +  W   A        C+ E+     EF    +++EI  L+ +L
Sbjct: 144 EMPGPKDVV---LWGRLRNWLSTAKKL-----CSPEEAN---EFRLDSIEEEISILEKEL 192

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S   +  + F HND QYGNI+   +  S+ ++D+EYA YN  AFDIANHFCE   DY + 
Sbjct: 193 SVP-NQQMGFCHNDLQYGNIMIEEESKSITIIDYEYASYNPIAFDIANHFCEMAADYHTD 251

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++ + YP  +++  F+R Y+ +         N PS   DN L++L  EV  +TL  
Sbjct: 252 TPHILDYNKYPGIEERKRFVRVYLSSSG-------NQPS---DNDLEQLVQEVEKYTLPD 301

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           H+ WGLWG++    + IDFDYL Y  +R  ++   K
Sbjct: 302 HLFWGLWGIISEHVNDIDFDYLEYAKQRFQQYWRTK 337



>gi|357125430|ref|XP_003564397.1| PREDICTED: choline/ethanolamine kinase-like [Brachypodium
           distachyon]
          Length = 354

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 190/347 (54%), Gaps = 33/347 (9%)

Query: 23  LPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCD 82
           L G DV + + + + ++ GALTN VF IT      D      P +VL+R+YG GV+   D
Sbjct: 37  LWGGDV-DPAALVVSQLKGALTNEVFRITWPGGEGD------PRKVLVRIYGQGVEVFFD 89

Query: 83  RQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLH 142
           R  E+   E +S    GP+LLG F  GR E+ + + TL + DLRD   S  IA++L + H
Sbjct: 90  RADEVRTFECMSRHGQGPRLLGRFPQGRVEEFINARTLSAEDLRDEQISSLIAKKLREFH 149

Query: 143 NIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEEL 202
            +    P P+ N+   +W  + +W   A       +C+ E+ K   EF  + L +EI EL
Sbjct: 150 EL--DMPGPK-NVS--LWQRLRRWLEEARG-----RCSAEEAK---EFRLETLGNEITEL 196

Query: 203 KYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYD 261
           +  LS   D  +VF HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE + D
Sbjct: 197 EDALS-GFDQRVVFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMSAD 255

Query: 262 YRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAF 321
           Y ++ PH ++   YP+ D+Q  F++ Y+   S P +    +P    +N L+ +      +
Sbjct: 256 YHTATPHVLDFTKYPDMDEQRRFVQTYL---SYPGE---KSPEVEVENLLELIG----KY 305

Query: 322 TLASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEVYER 367
           TLASH+ WGLWG V    ++ IDF+Y  Y  +R  R+ + K  +  R
Sbjct: 306 TLASHLFWGLWGAVSEHVNKNIDFEYDEYARQRFDRYWQTKAGILRR 352



>gi|125553114|gb|EAY98823.1| hypothetical protein OsI_20768 [Oryza sativa Indica Group]
          Length = 354

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 188/342 (54%), Gaps = 27/342 (7%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           L+ ++  GW DV++   +++  + GA+TN V+   R     +        RVL+RVYG G
Sbjct: 24  LLHELAAGWGDVADCRALEVVPLRGAMTNEVY-QARWPPAAEAEVEAAGRRVLVRVYGEG 82

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA 
Sbjct: 83  VEVFFDREAEVRTFESMSRHGHGPRLLGRFPNGRVEEFIHARTLSAVDLRDPEISAIIAS 142

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           +L + HN+    P P+  +   +W  +  W   A N      C  ++ K   EF    ++
Sbjct: 143 KLREFHNL--DMPGPKSVL---IWDRLRNWLKTAKNL-----CPSDEAK---EFCLDSME 189

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHF 255
           +EI  L+ +LS +    + F HND QYGNI+   +  L+ ++D+EYA +   A+DIANHF
Sbjct: 190 NEITALENELSEDYQC-VGFCHNDLQYGNIMIDEETKLLTIIDYEYASFGPVAYDIANHF 248

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           CE   DY S  PH ++   YP+ D+Q  F+++Y+ +     D      +E  +N ++ ++
Sbjct: 249 CEMAADYHSEKPHILDYTKYPDTDEQKQFVQSYLSSSGEEPD------AEKVNNLIKSIE 302

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
                +TLASH++WGLWG++    + IDFDY+ Y  +R  ++
Sbjct: 303 ----KYTLASHLIWGLWGIISEHVNDIDFDYMGYARQRFEQY 340



>gi|449443853|ref|XP_004139690.1| PREDICTED: choline/ethanolamine kinase-like [Cucumis sativus]
 gi|449503233|ref|XP_004161900.1| PREDICTED: choline/ethanolamine kinase-like [Cucumis sativus]
          Length = 346

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 184/335 (54%), Gaps = 28/335 (8%)

Query: 31  ESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFL 90
           E  +++ R++GA+TN V+ +    K        +P +V++RVYG G +   +R  E+   
Sbjct: 36  EEGLEVSRLTGAMTNEVYEM----KWMSSRSGDEPRKVVVRVYGEGTEIFFNRDDEIRTF 91

Query: 91  EMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPP 150
           E +S    GP+LLG F +GR E+ + ++TL + DLRDP  S  IA +L + HN+    P 
Sbjct: 92  ECVSKHGRGPRLLGRFSHGRIEEFINAKTLSARDLRDPKISARIASKLREFHNL--DMPT 149

Query: 151 PQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNI 210
           P   I   +W  +  W    L     L    E    +EEF  + L +EI+ L+ +LS + 
Sbjct: 150 P---ITVVLWDRMRNW----LKEAKRLSSPHE----MEEFCLEKLDEEIDLLQRELSKD- 197

Query: 211 DSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHK 269
             PI F HND QYGNI+   D  SL ++D+EYA YN  A+DIANHFCE   DY S  PH 
Sbjct: 198 SQPIGFCHNDLQYGNIMMDEDTSSLTLIDYEYASYNPIAYDIANHFCEMAADYHSKTPHI 257

Query: 270 MNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMW 329
           ++   YP+ +++  F+ AY+   S  +DH            ++KL  +   +TLA+H+ W
Sbjct: 258 LDYTSYPDVEERKRFVSAYL-GTSGENDHKEEE--------VEKLLEDAERYTLANHLFW 308

Query: 330 GLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           GLW ++ S  ++IDFDY  Y  +R  +F   K+E+
Sbjct: 309 GLWAIISSHVNKIDFDYFEYAKQRFDQFWLRKSEL 343



>gi|408397341|gb|EKJ76486.1| hypothetical protein FPSE_03328 [Fusarium pseudograminearum CS3096]
          Length = 791

 Score =  197 bits (502), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 144/457 (31%), Positives = 211/457 (46%), Gaps = 109/457 (23%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           ++ +N +I +  T  L GW    +     I + R+SGALTN V+ +T  K++ +    +K
Sbjct: 308 LSFKNEIIRIAHTLRLKGWRRIPLGGGDIISVVRLSGALTNAVYVVTPPKEIDETDGKRK 367

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P +VLLR+YG  V+ L DR  EL+ L+ L+  KIGP+LLG F+NGRFEQ+ ES TL   D
Sbjct: 368 PTKVLLRIYGPQVEHLIDRDNELSVLQRLARKKIGPRLLGTFQNGRFEQYFESITLTPMD 427

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-----KC 179
           LRDP TS+ IA+R+ +LH  I++ P  +E   P  W + D+W        + L     K 
Sbjct: 428 LRDPDTSRSIAKRMRELHEGIDLLPHEREG-GPATWKSWDQWLDNVERIATYLDNEYEKH 486

Query: 180 TEEQ--RKGLEEFDFKMLK-------DEIEEL--KYKLSHN---------IDSPIVFAHN 219
            E Q  ++G     +K           E   +  KY++  N         +   +VFAH+
Sbjct: 487 VEGQHGQQGSVAHAWKSRGYVCGTTWPEFRNMMTKYRVHLNSFYKGGQREVKDSLVFAHS 546

Query: 220 DTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-S 264
           DTQYGNILR+                  L+V+DFEYAG N +  + ANHF EWTY+Y  +
Sbjct: 547 DTQYGNILRIRPDDEKSPLLQAANKHKQLIVIDFEYAGPNTRGLEFANHFNEWTYNYHDA 606

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYID---------------------------AYSIPSD 297
           + P   ++  YP  D+Q  F++AY+D                             + P +
Sbjct: 607 AAPWACDVRRYPTPDEQRRFIKAYVDHRPRFQGSNSTPRLAPVDSNASSGMSTPLATPGN 666

Query: 298 HTINNPS------------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWG 333
              N+ S                        E  D  +++L  E   +  A+H  W  WG
Sbjct: 667 PATNSSSSIVEFMLDARVPPGGWSAAERANDEQRDQRVRELLEETRQWRPANHAHWIAWG 726

Query: 334 LVQSGQSQID-------------FDYLSYGMERLHRF 357
           LVQ+    +D             FDYLSY  +R   F
Sbjct: 727 LVQAKIPGLDESIKEEDLLSPDEFDYLSYAQDRTMFF 763



>gi|217030951|gb|ACJ74076.1| choline kinase [Oryza sativa Japonica Group]
          Length = 368

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 194/361 (53%), Gaps = 38/361 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRTKKLHD--------QTKNKKP 65
           L+ +M   W DV++   +Q+  + GA+TN V+   ++       D          + ++ 
Sbjct: 29  LLHEMAASWADVADCRALQVIPLKGAMTNEVYQVRWLNGAPATADGGEVEAEAAAREREV 88

Query: 66  LRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDL 125
            +VL+R+YG+GV+   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DL
Sbjct: 89  RKVLVRIYGDGVELFFDREDEVRTFECMSRHGQGPRLLGRFTNGRVEEFIHARTLSAADL 148

Query: 126 RDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK 185
           RDP  S  +A +L + HN+    P P+  +   +W  +  W   A N  SS    +E +K
Sbjct: 149 RDPEISALVASKLREFHNL--DMPGPKSVL---IWDRLKNWLKTARNLCSS----DESKK 199

Query: 186 GLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGY 244
               F    L++EI  L+ + S +    I F HND QYGNI+   D + L ++D+EYA +
Sbjct: 200 ----FRLGSLENEIAALEKEFSGDYHG-IGFCHNDLQYGNIMIDEDTNMLTIIDYEYASF 254

Query: 245 NYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPS 304
           N  A+DIANHFCE   DY S  PH+++   YP+ D+Q  F++ Y+           N+ S
Sbjct: 255 NPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYLS----------NSVS 304

Query: 305 ETHD-NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNE 363
           E  D   ++ L   +  +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K  
Sbjct: 305 EELDAEEVETLLQSIEKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKKQA 364

Query: 364 V 364
           +
Sbjct: 365 L 365



>gi|336464398|gb|EGO52638.1| hypothetical protein NEUTE1DRAFT_91169 [Neurospora tetrasperma FGSC
           2508]
          Length = 760

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 182/340 (53%), Gaps = 43/340 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +T +N +I L  T  L GW    ++    I +ER+SGALTN V+ ++   +  L  Q   
Sbjct: 271 LTFKNEIIRLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVYVVSPPPESILPPQEGK 330

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           ++P +VLLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+  S TL  
Sbjct: 331 RQPEKVLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTP 390

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA------------ 170
            +LR+P TSK IA+R+ +LH+ + +    +++  P VW N D+W   A            
Sbjct: 391 ENLREPETSKQIAKRMRELHDGVELL-EHEKDEGPGVWRNWDRWLDQAEKTAMYLDNQVA 449

Query: 171 --LNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP------IVFAHNDTQ 222
             L   +  K T + R  +   ++ + +  +++ +  L     SP      +VFAHNDTQ
Sbjct: 450 AQLQETTRHKETWKTRGFVCGVEWPVFRKMVQKYRKFLEDYYGSPTKIREKLVFAHNDTQ 509

Query: 223 YGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-P 267
           YGNILR+                  L+V+DFEYAG N    + ANHF EWTY+Y   V P
Sbjct: 510 YGNILRIRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTP 569

Query: 268 HKMNLDLYPNEDQQIDFLRAYID-AYSIPSDHTINNPSET 306
           H  +   YP  +QQ  F++AY+D     PS   ++ PS T
Sbjct: 570 HVCDATKYPTLEQQRRFIKAYVDHQPKFPSVPGVSTPSVT 609



>gi|350296488|gb|EGZ77465.1| hypothetical protein NEUTE2DRAFT_100400 [Neurospora tetrasperma
           FGSC 2509]
          Length = 770

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 182/340 (53%), Gaps = 43/340 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +T +N +I L  T  L GW    ++    I +ER+SGALTN V+ ++   +  L  Q   
Sbjct: 281 LTFKNEIIRLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVYVVSPPPESILPPQEGK 340

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           ++P +VLLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+  S TL  
Sbjct: 341 RQPEKVLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTP 400

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA------------ 170
            +LR+P TSK IA+R+ +LH+ + +    +++  P VW N D+W   A            
Sbjct: 401 ENLREPETSKQIAKRMRELHDGVELL-EHEKDEGPGVWRNWDRWLDQAEKTAMYLDNQVA 459

Query: 171 --LNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP------IVFAHNDTQ 222
             L   +  K T + R  +   ++ + +  +++ +  L     SP      +VFAHNDTQ
Sbjct: 460 AQLQETTRHKETWKTRGFVCGVEWPVFRQMVQKYRKFLEDYYGSPTKIREKLVFAHNDTQ 519

Query: 223 YGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-P 267
           YGNILR+                  L+V+DFEYAG N    + ANHF EWTY+Y   V P
Sbjct: 520 YGNILRIRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTP 579

Query: 268 HKMNLDLYPNEDQQIDFLRAYID-AYSIPSDHTINNPSET 306
           H  +   YP  +QQ  F++AY+D     PS   ++ PS T
Sbjct: 580 HVCDATKYPTLEQQRRFIKAYVDHQPKFPSVPGVSTPSVT 619



>gi|357136189|ref|XP_003569688.1| PREDICTED: choline/ethanolamine kinase-like [Brachypodium
           distachyon]
          Length = 368

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 187/355 (52%), Gaps = 34/355 (9%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRTKKLHDQTKNKKPLR------ 67
           L+ ++   W +V++   +++  + GA+TN V+   ++T         K K+ L+      
Sbjct: 31  LLHELAAAWPNVADCRALEVVPLKGAMTNEVYQVRWLTAPAAAAGGEKEKEALKEREIRK 90

Query: 68  VLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRD 127
           VL+R+YG+GV+   DR+ EL   E +S    GP+LLG F NGR E+ + + TL + DLRD
Sbjct: 91  VLVRIYGDGVELFFDREDELRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRD 150

Query: 128 PSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGL 187
           P  S  +A +L + HN+    P P+  +   +W  +  W   A N      C  +Q    
Sbjct: 151 PEISALVATKLREFHNL--DMPGPKHVL---LWDRLKNWLKTAKNL-----CPTDQAN-- 198

Query: 188 EEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNY 246
            E     L+DEI  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N 
Sbjct: 199 -ELRLDCLEDEIATLEKEFSGDYHHWIGFCHNDLQYGNIMIDEETNMLTIIDYEYASFNP 257

Query: 247 QAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSET 306
            A+DIANHFCE   DY S  PH ++   YP+ D+Q  F++ Y+            +  E 
Sbjct: 258 VAYDIANHFCEMAADYHSEKPHVLDYSKYPDIDEQRRFVKTYLS----------TSGEEP 307

Query: 307 HDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
               +Q L   +  +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K
Sbjct: 308 EAEEVQNLLQSIDKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKK 362



>gi|242058527|ref|XP_002458409.1| hypothetical protein SORBIDRAFT_03g032950 [Sorghum bicolor]
 gi|241930384|gb|EES03529.1| hypothetical protein SORBIDRAFT_03g032950 [Sorghum bicolor]
          Length = 369

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 194/355 (54%), Gaps = 32/355 (9%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI------TRTKKLHDQTKNKKPLRVLL 70
           L+ ++   W DV++   +++  + GA+TN V+ +          +  +  + ++  +VL+
Sbjct: 36  LLHELAAAWADVADCRALEVVPLKGAMTNEVYQVRWLTGPAAAGEKEEPRREREVRKVLV 95

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG+GVD   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  
Sbjct: 96  RIYGDGVDLFFDREDEVRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEI 155

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEF 190
           S  +A +L + HN+    P P+  +   +W  +  W   A N      C  E+ K   EF
Sbjct: 156 SALVASKLREFHNL--DMPGPKSVL---IWDRLRNWLRTAKNL-----CPSEEAK---EF 202

Query: 191 DFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAF 249
               L++EI  L+ + S +    I F HND QYGNI+   + + L ++DFEYA +N  A+
Sbjct: 203 RLDSLENEITALENECSGDYQW-IGFCHNDLQYGNIMIDEETNVLTIIDFEYASFNPVAY 261

Query: 250 DIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDN 309
           DIANHFCE   DY SS PH ++   YP+ D+Q  F++ Y++      D      +E  +N
Sbjct: 262 DIANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTYLNISGEEPD------AEVVEN 315

Query: 310 YLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            LQ++      + LASH++WGLWG++    + IDFDY  Y  +R  ++ + K+ +
Sbjct: 316 LLQRID----KYMLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKKSAI 366



>gi|195659359|gb|ACG49147.1| choline/ethanolamine kinase [Zea mays]
          Length = 359

 Score =  196 bits (499), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/342 (34%), Positives = 186/342 (54%), Gaps = 30/342 (8%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV +   + + ++ GA+TN VF IT       + +   P +VL+R+YG GV+   DR 
Sbjct: 42  GGDV-DPGALAVSQLRGAMTNEVFRITWPG---GEAEGNGPRKVLVRIYGRGVEVFFDRA 97

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S     P+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 98  DEVRTFECMSRHGQRPRLLGRFANGRVEEFINARTLSAADLRDPEMSALIARKLREFHDL 157

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A +     +C+EE+     +F    L DEI  L+ 
Sbjct: 158 --DMPGPRDV---SLWQRLKRWLGEARD-----RCSEEESN---QFQLNKLGDEISVLEK 204

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  +   + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 205 TLS-GLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYH 263

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTL 323
           +S PH ++   YP+  +Q  F+ AY+ +           P+   D  +++L   +  +TL
Sbjct: 264 TSTPHVLDFTKYPDTGEQRRFVEAYLSSAG-------KKPT---DGEVEELLGLIAKYTL 313

Query: 324 ASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           ASH+ WGLWG++ +  ++ IDF Y  Y  +RL ++ + K  +
Sbjct: 314 ASHLFWGLWGIISAHVNENIDFAYKEYARQRLDQYWQTKPRI 355



>gi|297839309|ref|XP_002887536.1| hypothetical protein ARALYDRAFT_895300 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333377|gb|EFH63795.1| hypothetical protein ARALYDRAFT_895300 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 348

 Score =  196 bits (499), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 180/333 (54%), Gaps = 32/333 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQK 85
           DV +   +Q+  + GA+TN VF I         T+ K P R VL+R+YG GV+   DR+ 
Sbjct: 32  DVIDSKALQVIPLKGAMTNEVFQIKWP------TREKGPSRKVLVRIYGEGVEIFFDRED 85

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           E+   E +S    GP LLG F NGR E+ L + TL + DLRDP  S  IA R+ + H + 
Sbjct: 86  EIRTFEFMSKHGHGPLLLGRFGNGRIEEFLHARTLSACDLRDPEISGRIATRMKEFHGL- 144

Query: 146 NICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
              P  ++ +   +W  +  W    L A   L   EE       F   +++ EI  L+  
Sbjct: 145 -EMPGVKKAL---LWDRLRNW----LTACKRLASPEEANS----FRLDVMEMEIHLLEKS 192

Query: 206 LSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS 264
           L +N D  I F HND QYGNI+   +  ++ ++D+EY+ YN  A+DIANHFCE   DY +
Sbjct: 193 LFNN-DENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDIANHFCEMAADYHT 251

Query: 265 SVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLA 324
             PH M+   YP  +++  FL+ Y+        ++   PS T    ++KL  +V  +TLA
Sbjct: 252 ETPHIMDYSKYPGVEERQRFLKTYL-------SYSGEEPSNT---MVEKLLEDVEKYTLA 301

Query: 325 SHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           SH+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 302 SHLTWGLWGIISEHVNEIDFDYMEYARQRFEQY 334



>gi|393218797|gb|EJD04285.1| kinase-like protein [Fomitiporia mediterranea MF3/22]
          Length = 497

 Score =  196 bits (498), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 205/403 (50%), Gaps = 70/403 (17%)

Query: 18  LITDMLPGWDVSNE---SDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           L++  +P W  +       +++ +VSG+LTN VFFI+       +T       +LLR+YG
Sbjct: 102 LVSLRIPTWASAGSLSPEGVKVFKVSGSLTNAVFFISYPNSPSLKT-------LLLRIYG 154

Query: 75  NGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKY 133
               +L  R +EL+ L +LS+  +IGP++ G F+NGR E++ +S  L ++++RDP  S +
Sbjct: 155 PSSSELISRPRELHTLHVLSSRYRIGPRVYGTFENGRVEEYFDSTALTASEIRDPVISGW 214

Query: 134 IAQRLSQLHNI----INICPPPQ--ENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRK 185
           I  R+++LH +    I    P    EN+  +     N  +W  L    +  LK   E  K
Sbjct: 215 IGSRMAELHCVDIEAIEETTPETRGENVGWDTAARKNFREWT-LPAREVLRLKSVSEDYK 273

Query: 186 GLEEFDFKMLKDEIEEL-----KYKLSHNIDSPIVFAHNDTQYGNILR---LTDGS---- 233
                DF    DE         K++ +H   S  VFAHNDTQYGN+LR   + +G+    
Sbjct: 274 --ITLDFDRFVDEWGRYMLWLDKWERAHGA-SKRVFAHNDTQYGNLLRRKEIKEGTPEHR 330

Query: 234 -LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAY 292
            ++VVDFEYA  N  AFDIANHF EWT DY +S PH ++   YP E ++ +F +AY+   
Sbjct: 331 QIIVVDFEYAAPNSAAFDIANHFHEWTADYHNSTPHILDPKRYPIEQERKNFYKAYLTHA 390

Query: 293 SIPSDHT-----INNPSET-------------HDNYLQKLKLEVYAFTLASHVMWGLWGL 334
             P   T     +N PS                    QKL+ +V  ++ ASH MW +WGL
Sbjct: 391 CPPFTTTSVATDVNTPSAKLVTVGSGGDIPLDLTTESQKLEAQVRVWSPASHAMWAVWGL 450

Query: 335 VQSGQ---------------SQIDFDYLSYGMERLHRFR-ELK 361
           VQ+ +                + +FDYL Y + R+ RFR ELK
Sbjct: 451 VQAREDLELAAQAQAKGAQPDRPEFDYLGYSLCRVERFRAELK 493



>gi|195642300|gb|ACG40618.1| choline/ethanolamine kinase [Zea mays]
          Length = 366

 Score =  196 bits (498), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 191/347 (55%), Gaps = 31/347 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF----FITRTKKLHDQTKNKKPLR-VLLR 71
           L+ ++   W DV++   +++  + GA+TN V+             ++ + ++ +R VL+R
Sbjct: 35  LLHELAAAWADVADCRALEVVPLKGAMTNEVYQARWLTAGPAGQKEEPRAEREVRKVLVR 94

Query: 72  VYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTS 131
           +YG+GVD   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S
Sbjct: 95  IYGDGVDLFFDREDEVRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEIS 154

Query: 132 KYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFD 191
             +A +L + HN+    P P+  +   +W  +  W    L    SL C  E+ K   EF 
Sbjct: 155 ALVASKLREFHNL--DMPGPKSVL---IWDRLRNW----LRTAKSL-CPPEEAK---EFR 201

Query: 192 FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAFD 250
              L+++I  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N  A+D
Sbjct: 202 LDSLENQITALENECSGDYQW-IGFCHNDLQYGNIMIDEETNVLTIIDYEYASFNPVAYD 260

Query: 251 IANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           IANHFCE   DY SS PH ++   YP+ D+Q  F++ Y++      D      +E  +N 
Sbjct: 261 IANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTYLNISGEEPD------AEVVENL 314

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LQ ++      TLASH++WGLWG++    + IDFDY  Y  +R  ++
Sbjct: 315 LQSIE----KHTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQY 357



>gi|392571358|gb|EIW64530.1| kinase-like protein [Trametes versicolor FP-101664 SS1]
          Length = 473

 Score =  196 bits (498), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 187/376 (49%), Gaps = 45/376 (11%)

Query: 18  LITDMLPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGN 75
           L T   P W  S      I I++VSG+LTN V+F++       +T       VLLR+YG 
Sbjct: 96  LHTIRTPSWSESEITPDRISIQKVSGSLTNAVYFVSCPPVPKTRT-------VLLRIYGP 148

Query: 76  GVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
               L  R +EL  L  LS+   IGP++ G F+NGR E++ +S  L + D+RDP  S +I
Sbjct: 149 SSGTLISRPRELYTLHALSSRYHIGPRVYGTFENGRVEEYFDSTALTAADMRDPEVSSWI 208

Query: 135 AQRLSQLHNI----INICPP----PQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKG 186
             R+++LH +    +   PP    P   I+P    ++  W P A   +S      + R+ 
Sbjct: 209 GARMAELHGVDIDAVESEPPTPEGPDGEIQPTTKKSVKSWLPNAREVLSLPGAPADVREA 268

Query: 187 LEEFDFKMLKDEIEEL-----KYKLSHNIDSPIVFAHNDTQYGNILRL--------TDGS 233
           L   D    + E E+      + + S    SP+VF+HND QYGN+LRL            
Sbjct: 269 L---DLDRFQREWEQYVQWVSQKEKSERSSSPLVFSHNDAQYGNLLRLRTLKEGQPAHRQ 325

Query: 234 LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYS 293
           ++VVDFEYA  N  A+DIANHF EWT DY    PH ++    P  +++ +F RAY+    
Sbjct: 326 IIVVDFEYAAPNPAAYDIANHFHEWTADYHGPTPHLLDPARRPTREERRNFYRAYLTHTQ 385

Query: 294 IPSDHTINNPSETH-----DNYLQKLKLEVYAFTLASHVMWGLWGLVQS-----GQ-SQI 342
            P D      +        +  ++ L   V  ++ ASH +W +WG+VQ+     GQ  + 
Sbjct: 386 SPLDAPAPPAAPALSPDALEAEMRALDEHVRVWSPASHAVWAVWGVVQAREFVEGQDGEP 445

Query: 343 DFDYLSYGMERLHRFR 358
           +FDYL Y   R+  FR
Sbjct: 446 EFDYLGYAQCRMEGFR 461



>gi|195646466|gb|ACG42701.1| choline/ethanolamine kinase [Zea mays]
 gi|223949553|gb|ACN28860.1| unknown [Zea mays]
 gi|414880739|tpg|DAA57870.1| TPA: choline/ethanolamine kinase [Zea mays]
          Length = 362

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 191/347 (55%), Gaps = 31/347 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF----FITRTKKLHDQTKNKKPLR-VLLR 71
           L+ ++   W DV++   +++  + GA+TN V+             ++ + ++ +R VL+R
Sbjct: 31  LLHELAAAWADVADCRALEVVPLKGAMTNEVYQARWLTAGPAGQKEEPRAEREVRKVLVR 90

Query: 72  VYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTS 131
           +YG+GVD   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S
Sbjct: 91  IYGDGVDLFFDREDEVRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEIS 150

Query: 132 KYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFD 191
             +A +L + HN+    P P+  +   +W  +  W    L    SL C  E+ K   EF 
Sbjct: 151 ALVASKLREFHNL--DMPGPKSVL---IWDRLRNW----LRTAKSL-CPPEEAK---EFR 197

Query: 192 FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAFD 250
              L+++I  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N  A+D
Sbjct: 198 LDSLENQITALENECSGDYQW-IGFCHNDLQYGNIMIDEETNVLTIIDYEYASFNPVAYD 256

Query: 251 IANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           IANHFCE   DY SS PH ++   YP+ D+Q  F++ Y++      D      +E  +N 
Sbjct: 257 IANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTYLNISGEEPD------AEVVENL 310

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LQ ++      TLASH++WGLWG++    + IDFDY  Y  +R  ++
Sbjct: 311 LQSIE----KHTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQY 353



>gi|55295919|dbj|BAD67787.1| putative choline kinase [Oryza sativa Japonica Group]
          Length = 350

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 191/346 (55%), Gaps = 30/346 (8%)

Query: 23  LPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLC 81
           L G DV + + + + ++ GA+TN VF IT       + + +   R VL+R+YG GV+   
Sbjct: 25  LWGGDV-DPAALAVSQLKGAMTNEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFF 83

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR  E+   E +S    GP+LLG F NGR E+ + + TL + DLRD   S  IA++L + 
Sbjct: 84  DRADEVRTFECMSRHGQGPRLLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREF 143

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEE 201
           H++    P P+ N+   +W  + +W   A       +C+ E+ +   +F  + L DEI  
Sbjct: 144 HDL--DMPGPK-NVS--LWQRLRRWLEEARG-----RCSPEEAR---QFSLEKLGDEIAM 190

Query: 202 LKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTY 260
           L   LS  +D  + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE + 
Sbjct: 191 LDIALS-GVDQRVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMSA 249

Query: 261 DYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYA 320
           DY S+ PH ++   YP  D+Q  F++ Y+ +       +  NPS+    +L  L   +  
Sbjct: 250 DYHSATPHVLDFTKYPGIDEQRRFVQTYLSS-------SGENPSDAEVEHLLGL---IAK 299

Query: 321 FTLASHVMWGLWGLVQSGQ--SQIDFDYLSYGMERLHRFRELKNEV 364
           ++LASH+ WGLWG++ SG     IDF+Y  Y  +R  ++ + K++ 
Sbjct: 300 YSLASHIFWGLWGII-SGHVNKNIDFEYQEYARQRFDQYWKTKDQT 344



>gi|297724277|ref|NP_001174502.1| Os05g0535400 [Oryza sativa Japonica Group]
 gi|45680429|gb|AAS75230.1| putative choline kinase [Oryza sativa Japonica Group]
 gi|47900414|gb|AAT39208.1| putative choline kinase [Oryza sativa Japonica Group]
 gi|222632361|gb|EEE64493.1| hypothetical protein OsJ_19343 [Oryza sativa Japonica Group]
 gi|255676525|dbj|BAH93230.1| Os05g0535400 [Oryza sativa Japonica Group]
          Length = 352

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 187/342 (54%), Gaps = 29/342 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           L+ ++  GW DV++   +++  + GA+TN V+   + +            RVL+RVYG G
Sbjct: 24  LLHELAAGWGDVADCRALEVVPLRGAMTNEVY---QARWPPAAEAEAAGRRVLVRVYGEG 80

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA 
Sbjct: 81  VELFFDREAEVRTFESMSRHGHGPRLLGRFPNGRVEEFIHARTLSAVDLRDPEISAIIAS 140

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           +L + HN+    P P+  +   +W  +  W   A N      C  ++ K   EF    ++
Sbjct: 141 KLREFHNL--DMPGPKSVL---IWDRLRNWLKTAKNL-----CPSDEAK---EFCLDSME 187

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHF 255
           +EI  L+ +LS +    + F HND QYGNI+   +  L+ ++D+EYA +   A+DIANHF
Sbjct: 188 NEITALENELSEDYQC-VGFCHNDLQYGNIMIDEETKLLTIIDYEYASFGPVAYDIANHF 246

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           CE   DY S  PH ++   YP+ D+Q  F+++Y+ +     D      +E  +N ++ ++
Sbjct: 247 CEMAADYHSEKPHILDYTKYPDTDEQKQFVQSYLSSSGEEPD------AEKVNNLIKSIE 300

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
                +TLASH++W LWG++    + IDFDY+ Y  +R  ++
Sbjct: 301 ----KYTLASHLIWALWGIISEHVNDIDFDYMGYARQRFEQY 338



>gi|358396456|gb|EHK45837.1| choline kinase [Trichoderma atroviride IMI 206040]
          Length = 739

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 205/450 (45%), Gaps = 103/450 (22%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
            T +N ++ +  T  L GW    + +   + +ER+SGALTN V+ +T    L      K 
Sbjct: 264 TTFKNEILRIAHTLRLKGWRRIPLGSGEAMAVERLSGALTNAVYVVTPPAGLPQLDGRKP 323

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P +VLLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG FKNGRFEQ   + TL   +
Sbjct: 324 PTKVLLRVYGPQVEHLIDRENELQVLQRLARKKIGPRLLGTFKNGRFEQFFNAFTLTPLN 383

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISS-----LKC 179
           LR+P TS+ IA+R+ +LH  I +    +EN  P VW N D+W    +  I+S     L  
Sbjct: 384 LREPETSRQIAKRMRELHEGIEVLVHEREN-GPSVWKNWDQWLD-NVGRITSFLDKELDN 441

Query: 180 TEEQRKGLEE------------FDFKMLKDEIEELK------YKLSHNIDSPIVFAHNDT 221
           T E  + +                ++  KD +   +      YK    +   ++FAHNDT
Sbjct: 442 TPEGERRISAAQAWKANGYVCGVPWEQFKDVVMRYRAYLNGCYKDKRALKDRLIFAHNDT 501

Query: 222 QYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV- 266
           QYGNILR+                  LVV+DFEYAG N    + ANHF EW Y+Y   V 
Sbjct: 502 QYGNILRIRPDDEKSPLLQPANKHKQLVVIDFEYAGPNTAGHEFANHFTEWMYNYHDPVA 561

Query: 267 PHKMNLDLYPNEDQQIDFLRAYID-------AYSIPSDHTINN--PSETH---------- 307
           P   + D YP+ ++Q  F+RAY+D       A S P    +++  PS T           
Sbjct: 562 PFACHADRYPSLEEQKRFIRAYVDHRPQFPLASSTPRMTPVDSGAPSGTATPSLQPTASS 621

Query: 308 ----------------------------DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQ 339
                                       D  +++L  E   +  A+   W  WG+VQ+  
Sbjct: 622 SSIVDFMLDARYPGGDWSAVEKAREEQIDQQVRELIDEARLWQPANSAQWIAWGIVQAKV 681

Query: 340 SQID------------FDYLSYGMERLHRF 357
             +D            FDYLSY  ER   F
Sbjct: 682 PGLDGNPADEEPGADEFDYLSYAQERAMFF 711



>gi|297596235|ref|NP_001042223.2| Os01g0183000 [Oryza sativa Japonica Group]
 gi|255672946|dbj|BAF04137.2| Os01g0183000 [Oryza sativa Japonica Group]
          Length = 367

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 191/346 (55%), Gaps = 30/346 (8%)

Query: 23  LPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLC 81
           L G DV + + + + ++ GA+TN VF IT       + + +   R VL+R+YG GV+   
Sbjct: 42  LWGGDV-DPAALAVSQLKGAMTNEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFF 100

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR  E+   E +S    GP+LLG F NGR E+ + + TL + DLRD   S  IA++L + 
Sbjct: 101 DRADEVRTFECMSRHGQGPRLLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREF 160

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEE 201
           H++    P P+ N+   +W  + +W   A       +C+ E+ +   +F  + L DEI  
Sbjct: 161 HDL--DMPGPK-NVS--LWQRLRRWLEEARG-----RCSPEEAR---QFSLEKLGDEIAM 207

Query: 202 LKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTY 260
           L   LS  +D  + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE + 
Sbjct: 208 LDIALS-GVDQRVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMSA 266

Query: 261 DYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYA 320
           DY S+ PH ++   YP  D+Q  F++ Y+ +       +  NPS+    +L  L   +  
Sbjct: 267 DYHSATPHVLDFTKYPGIDEQRRFVQTYLSS-------SGENPSDAEVEHLLGL---IAK 316

Query: 321 FTLASHVMWGLWGLVQSGQ--SQIDFDYLSYGMERLHRFRELKNEV 364
           ++LASH+ WGLWG++ SG     IDF+Y  Y  +R  ++ + K++ 
Sbjct: 317 YSLASHIFWGLWGII-SGHVNKNIDFEYQEYARQRFDQYWKTKDQT 361



>gi|336267276|ref|XP_003348404.1| hypothetical protein SMAC_12598 [Sordaria macrospora k-hell]
 gi|380092057|emb|CCC10325.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 670

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 180/340 (52%), Gaps = 43/340 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +  +N +I L  T  L GW    ++    I +ER+SGALTN V+ ++   +  L  Q   
Sbjct: 181 LAFKNEIIKLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVYVVSPPPESVLPPQEGK 240

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           ++P ++LLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+  S TL  
Sbjct: 241 RQPEKLLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTP 300

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA------------ 170
            +LR+P TS+ IA+R+ +LH+ I +    +++  P VW N DKW   A            
Sbjct: 301 ENLREPETSRQIAKRMRELHDGIELLEHEKDD-GPGVWRNWDKWLDQAEKTAMYLDNQVA 359

Query: 171 --LNAISSLKCTEEQRKGLEEFDFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQ 222
             L   +  K T + R  +   ++ + +  +++ +      Y   + I   +VFAHNDTQ
Sbjct: 360 AELQKTTRQKETWKTRGFVCGVEWPVFRQMVQKYRKFLEDYYGSPNTIREKLVFAHNDTQ 419

Query: 223 YGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-P 267
           YGNILR+                  L+V+DFEYAG N    + ANHF EWTY+Y   V P
Sbjct: 420 YGNILRIRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTP 479

Query: 268 HKMNLDLYPNEDQQIDFLRAYID-AYSIPSDHTINNPSET 306
           H  +   YP  +QQ  F++AY+D     PS    + PS T
Sbjct: 480 HICDTTKYPTLEQQRRFIKAYVDHQPKFPSAPGASTPSVT 519



>gi|94420695|gb|ABF18675.1| choline kinase [Oryza sativa Indica Group]
          Length = 368

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 193/358 (53%), Gaps = 38/358 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF---FITRTKKLHDQTKNKKPL------- 66
           L+ +M   W DV++   +Q+  + GA+TN V+   ++       D  + +          
Sbjct: 29  LLHEMAASWADVADCRALQVIPLKGAMTNEVYQVRWLNGAPATADGGEVEAEAAARERGV 88

Query: 67  -RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDL 125
            +VL+R+YG+GV+   DR+ E+   E +S     P+LLG F NGR E+ + + TL + DL
Sbjct: 89  RKVLVRIYGDGVELFFDREDEVRTFECMSRHGQRPRLLGRFTNGRVEEFIHARTLSAADL 148

Query: 126 RDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK 185
           RDP  S  +A +L + HN+    P P+  +   +W  +  W   A N  SS    +E +K
Sbjct: 149 RDPEISALVASKLREFHNL--DMPGPKSVL---IWDRLKNWLKTARNLCSS----DESKK 199

Query: 186 GLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGY 244
               F    L++EI  L+ + S +    I F HND QYGNI+   D + L ++D+EYA +
Sbjct: 200 ----FRLGSLENEIAALEKEFSGDYHG-IGFCHNDLQYGNIMIDEDTNMLTIIDYEYASF 254

Query: 245 NYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNP- 303
           N  A+DIANHFCE   DY S  PH+++   YP+ D+Q  F++ Y+      S+     P 
Sbjct: 255 NPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYL------SNSVSEEPD 308

Query: 304 SETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           +E  +N LQ ++     +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K
Sbjct: 309 AEEVENLLQSIE----KYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQKK 362



>gi|242056163|ref|XP_002457227.1| hypothetical protein SORBIDRAFT_03g003630 [Sorghum bicolor]
 gi|241929202|gb|EES02347.1| hypothetical protein SORBIDRAFT_03g003630 [Sorghum bicolor]
          Length = 360

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 186/340 (54%), Gaps = 35/340 (10%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV + S + + ++ GA+TN VF IT      D      P +VL+R+YG GV+   DR 
Sbjct: 46  GSDV-DPSALTVSQLKGAMTNEVFRITWPGGEGD------PRKVLVRIYGRGVEVFFDRA 98

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 99  DEVRTFECMSRHGQGPRLLGRFANGRVEEFIYARTLSAADLRDPEISALIAKKLREFHDL 158

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A       +C+E++     +F    L DEI  L+ 
Sbjct: 159 --DMPGPRDV---SLWQRLRRWLEEARG-----RCSEQE---FNQFQLDKLGDEIAVLEK 205

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  ++  + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 206 TLS-GVEQSVGFCHNDLQYGNIMIDEETRQVTLIDYEYASFNPIAFDIANHFCEMAADYH 264

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYI-DAYSIPSDHTINNPSETHDNYLQKLKLEVYAFT 322
           ++ PH+++   YP  ++Q  F++ Y+  A   PSD  +           +KL   +  +T
Sbjct: 265 TATPHELDFTKYPGIEEQRRFVQTYLCSAGEKPSDGEV-----------EKLLGLIAKYT 313

Query: 323 LASHVMWGLWGLVQSG-QSQIDFDYLSYGMERLHRFRELK 361
            ASH+ WGLWG++ +   + IDF+Y  Y  +RL ++ + K
Sbjct: 314 PASHLFWGLWGIISAHVNNNIDFEYKEYARQRLDQYWQTK 353



>gi|348506106|ref|XP_003440601.1| PREDICTED: choline kinase alpha-like [Oreochromis niloticus]
          Length = 436

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 187/359 (52%), Gaps = 32/359 (8%)

Query: 12  RNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           R   I    D L G W    ++D QI  VSG L+N ++  +    +  Q    +P +VLL
Sbjct: 89  REKAINWCRDFLSGSWKTIEDADFQISIVSGGLSNLLYLCSLPDYV--QCVEDEPRQVLL 146

Query: 71  RVYG---NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRD 127
           RVYG    GVD L     E     +L+   +GPKL GVF  GR EQ+L +  +++N L D
Sbjct: 147 RVYGAILQGVDSLV---LESVMFAILAERALGPKLYGVFPLGRLEQYLPNTRMRTNQLSD 203

Query: 128 PSTSKYIAQRLSQLHNIINICPPPQENIKPE-VWVNIDKWYPLALNAISSLKCTEEQRKG 186
           P+ S  IA +L++ HN++        N KP+ ++  IDK+    +N         ++ K 
Sbjct: 204 PAISAEIATKLARFHNMVM-----PFNKKPKWLFGTIDKYMEQVMNISFVRDAHVKKYKK 258

Query: 187 LEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS------LVVVDFE 240
           L + D   L  E+  L+  L+    SP+VF HND Q GNIL L DG       L+++DFE
Sbjct: 259 LMKLD---LPAELRSLRALLAAT-PSPVVFCHNDVQEGNILMLEDGKHSSAERLMLIDFE 314

Query: 241 YAGYNYQAFDIANHFCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDH 298
           Y+ YNY+ FD  NHFCEW YDY  +  P +K   + YP  +QQ+ F+R+Y     +   H
Sbjct: 315 YSSYNYRGFDFGNHFCEWMYDYTYNEWPFYKATPENYPTREQQLLFIRSY-----LAEQH 369

Query: 299 TINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
              N +       + L +E   + LASH +WGLW ++Q+  S+I+F Y+ Y   R   +
Sbjct: 370 KDTNVAVDQTQIEEDLIIEANRYALASHFLWGLWSIIQAKISKIEFGYMDYAQCRFDAY 428



>gi|367042468|ref|XP_003651614.1| hypothetical protein THITE_2112126 [Thielavia terrestris NRRL 8126]
 gi|346998876|gb|AEO65278.1| hypothetical protein THITE_2112126 [Thielavia terrestris NRRL 8126]
          Length = 640

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 173/326 (53%), Gaps = 42/326 (12%)

Query: 6   DDNVTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQ 59
           D+ +T +N +I L  T  L GW    + +   I +ER+SGALTN V+ ++   +  L  +
Sbjct: 79  DNWLTFKNEIIRLAHTLRLKGWRRVPLDSGDSISVERLSGALTNAVYVVSPPSEALLPRE 138

Query: 60  TKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESET 119
              K+P +VLLR+YG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+L +  
Sbjct: 139 PGKKQPTKVLLRIYGPQVEHLIDRENELGVLKRLARKKIGPRLLGTFLNGRFEQYLNATA 198

Query: 120 LKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAI----- 174
           L    +R+P TS+ IA+R+ +LH+ I +    + +  P VW N D+W       +     
Sbjct: 199 LTPASMREPETSRQIAKRMRELHDGIELL-EEERDQGPGVWKNWDRWLSQVEKTVLYLDK 257

Query: 175 SSLKCTEEQR------------KGLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHN 219
             L   +  R             G++   FK L D+     E  Y  + NI   +VFAH+
Sbjct: 258 QILSGAQTHRLPGGVWKTRGFVCGVQWPVFKALVDKYRKHLEAYYGNAKNIRDKLVFAHS 317

Query: 220 DTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           DTQYGNILR+                  LVV+DFEYA  N    + ANHF EWTY+Y   
Sbjct: 318 DTQYGNILRMRPDDQKSPLLQPANEHKQLVVIDFEYAAANLPGLEFANHFSEWTYNYHDP 377

Query: 266 V-PHKMNLDLYPNEDQQIDFLRAYID 290
           V P+  +  LYP  DQQ  F++AY+D
Sbjct: 378 VRPYACDHALYPTPDQQRSFVKAYVD 403



>gi|302894513|ref|XP_003046137.1| hypothetical protein NECHADRAFT_76673 [Nectria haematococca mpVI
           77-13-4]
 gi|256727064|gb|EEU40424.1| hypothetical protein NECHADRAFT_76673 [Nectria haematococca mpVI
           77-13-4]
          Length = 782

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 147/473 (31%), Positives = 208/473 (43%), Gaps = 120/473 (25%)

Query: 4   GNDDNV--------TLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFIT 51
           G+DD V          +N +I +  T  L GW    +     I +ER+SGALTN V+ + 
Sbjct: 283 GSDDKVDKERENWLNFKNEIIRIAHTLRLKGWRRIPLGGGDKISVERLSGALTNAVYVVH 342

Query: 52  RTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRF 111
             + L +    + P ++LLR+YG  V+ L DR  EL  L+ L+  +IGP+LLG F+NGRF
Sbjct: 343 PPRNLEEVENKRMPSKLLLRIYGPQVEHLIDRDNELQVLQRLARKRIGPRLLGTFQNGRF 402

Query: 112 EQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLAL 171
           EQ  +S TL  +DLRDP  SK IA+R+ +LH  I + P  +EN  P  W + D+W     
Sbjct: 403 EQFFDSITLTPSDLRDPEMSKQIAKRMRELHEGIELLPHEREN-GPATWRSWDQWLDNVE 461

Query: 172 NAISSL--------KCTEEQRKGLEEF----------DFKMLKDEIEELKYKL-SH---- 208
              + L        K   E+R  +              +   KD I + +  L SH    
Sbjct: 462 RIATFLDQELEKEAKPPTERRNPIVHAWKSRGYVCGTPWPQFKDMIAKYRAHLYSHYKGG 521

Query: 209 --NIDSPIVFAHNDTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIA 252
              +   IVFAH+DTQYGNILR+                  L+V+DFEYAG N +  + A
Sbjct: 522 QREVKDKIVFAHSDTQYGNILRIRPDDEKSPLLQPANQHKQLIVIDFEYAGPNTRGLEFA 581

Query: 253 NHFCEWTYDYRSS-VPHKMNLDLYPNEDQQIDFLRAYIDAYS-----------IPSDHTI 300
           NHF EWTY+Y  + VP   N   YP  D+Q  F+RAY+D               PSD  +
Sbjct: 582 NHFNEWTYNYHDAVVPWACNERRYPTPDEQRRFVRAYVDHRPRFQGNGSTPRLAPSDGNL 641

Query: 301 NNPSET--------------------------------------------HDNYLQKLKL 316
           ++ + T                                             D  ++ L  
Sbjct: 642 SSGTSTPIATPLSTPSNPPASSSSSIVEFMLDARVPPGGWSAAERANEEERDQRVRALLE 701

Query: 317 EVYAFTLASHVMWGLWGLVQSGQSQID------------FDYLSYGMERLHRF 357
           E   +  A+H  W  WG+VQ+    +D            FDYL Y  +R+  F
Sbjct: 702 ETQWWRPANHAHWIAWGIVQAKIPALDDVVKEEDLGPDEFDYLRYAQDRVMFF 754



>gi|359487126|ref|XP_002265527.2| PREDICTED: choline/ethanolamine kinase [Vitis vinifera]
          Length = 363

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 188/342 (54%), Gaps = 31/342 (9%)

Query: 18  LITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  +   WD V++ + +Q+  + GA+TN V+ I       + ++     +VL+R+YG G
Sbjct: 22  ILLSLASSWDNVTDSNALQVIPLKGAMTNEVYQIKWPTSTGETSR-----KVLVRIYGEG 76

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+   DR  E+   E +S    GP+LLG F NGR E+ + + TL + DL DP  S  IA 
Sbjct: 77  VEVFFDRASEIQTFEFISKHGQGPRLLGRFPNGRIEEFIHARTLSAADLHDPDISDLIAI 136

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H++    P P++ +   +W  +  W    L+A  +L   EE       F    ++
Sbjct: 137 KMKEFHDL--NMPGPKDVV---LWDRMRDW----LSAAKNLSSPEEANT----FQLDAIE 183

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHF 255
           +EI  L+ KL  N    I F HND QYGNI+   + SL+ ++D+EYA YN   +DIANHF
Sbjct: 184 EEISLLEKKLPGN-HLHIGFCHNDLQYGNIMIDEETSLITIIDYEYASYNPVTYDIANHF 242

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           CE   DY +  PH ++   YP+ +++  FLR Y+        H  + P+   D  L+ L 
Sbjct: 243 CEMAADYHTETPHILDYSKYPSLEKRQRFLRIYL-------GHAGDQPN---DLELEVLV 292

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            +V  +TLASH++WGLWG++    ++IDF+Y+ Y  +R  ++
Sbjct: 293 QDVEKYTLASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQY 334



>gi|392597122|gb|EIW86444.1| choline kinase cytoplasm [Coniophora puteana RWD-64-598 SS2]
          Length = 432

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/357 (35%), Positives = 189/357 (52%), Gaps = 47/357 (13%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           ++I +VSG+LTN V+F++   +    T       +LLR+YG     L  R KEL+ L +L
Sbjct: 83  VKIFKVSGSLTNAVYFVSCPFEPAAPT-------LLLRIYGPSSGNLISRPKELHTLHVL 135

Query: 94  SN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPP 151
           S+   IGP++ G F NGR E++ +S  L   DLRD S S+ I  R+++LH++ ++    P
Sbjct: 136 SSRYNIGPRIYGTFDNGRIEEYFDSSPLTPADLRDQSVSRSIGARMAELHSVDVSAVEGP 195

Query: 152 QENIKPE-----VWVNIDKWYPLALNAISSLKCTEEQRKGL-------EEFDFKMLK-DE 198
                       V  N+ +W   A   +  L C     K         EE+   M + D 
Sbjct: 196 STGGSTTGRDIGVKRNVQEWL-FAAKDVLDLPCVSTHDKNALDLDRFQEEWTGYMSRLDR 254

Query: 199 IEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSL----------VVVDFEYAGYNYQA 248
           +E+ +        S  VFAHNDTQYGN+LR+ +G+L          +VVDFEY+  N  A
Sbjct: 255 VEQTEGM------STRVFAHNDTQYGNLLRV-NGTLEEGMPAHRQIIVVDFEYSAVNPLA 307

Query: 249 FDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYID-AYSIPSDHTINNPSETH 307
           FDIANHF EWT +Y S VPH ++   YP  +Q+ +F   Y+  A S  SD    +PS   
Sbjct: 308 FDIANHFHEWTANYHSDVPHILDPSRYPTLEQRRNFYVGYLQHAASSLSDVAGESPSPAS 367

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQS------GQSQIDFDYLSYGMERLHRFR 358
           +  L  L+ +V  ++ ASH MW +WG+VQ+      G++Q +FDY+ Y   R+  FR
Sbjct: 368 EKDLATLERQVRIWSAASHGMWAIWGIVQARDDLARGETQPEFDYIGYAQCRMQSFR 424



>gi|226497006|ref|NP_001152424.1| LOC100286064 [Zea mays]
 gi|195656143|gb|ACG47539.1| choline/ethanolamine kinase [Zea mays]
          Length = 366

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 191/347 (55%), Gaps = 31/347 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVF----FITRTKKLHDQTKNKKPLR-VLLR 71
           L+ ++   W DV++   +++  + GA+TN V+             ++ + ++ +R VL+R
Sbjct: 35  LLHELAAAWADVADCRALEVVPLKGAMTNEVYQARWLTAGPAGQKEEPRAEREVRKVLVR 94

Query: 72  VYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTS 131
           +YG+GVD   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S
Sbjct: 95  IYGDGVDLFFDREDEVRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEIS 154

Query: 132 KYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFD 191
             +A +L + HN+    P P+  +   +W  +  W    L    SL C  E+ K   EF 
Sbjct: 155 ALVASKLREFHNL--DMPGPKSVL---IWDRLRNW----LRTAKSL-CPPEEAK---EFR 201

Query: 192 FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAFD 250
              L+++I  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N  A+D
Sbjct: 202 LDSLENQITALENECSGDYQW-IGFCHNDLQYGNIMIDEETNVLTIIDYEYASFNPVAYD 260

Query: 251 IANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           IANHFCE   DY SS PH ++   YP+ D+Q  F++ Y++      D      +E  +N 
Sbjct: 261 IANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTYLNISGEEPD------AEVVENL 314

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LQ ++      TL+SH++WGLWG++    + IDFDY  Y  +R  ++
Sbjct: 315 LQSIE----KHTLSSHLVWGLWGIISDHVNDIDFDYKEYARQRFEQY 357



>gi|296087811|emb|CBI35067.3| unnamed protein product [Vitis vinifera]
          Length = 463

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 193/349 (55%), Gaps = 31/349 (8%)

Query: 18  LITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  +   WD V++ + +Q+  + GA+TN V+ I       + ++     +VL+R+YG G
Sbjct: 122 ILLSLASSWDNVTDSNALQVIPLKGAMTNEVYQIKWPTSTGETSR-----KVLVRIYGEG 176

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+   DR  E+   E +S    GP+LLG F NGR E+ + + TL + DL DP  S  IA 
Sbjct: 177 VEVFFDRASEIQTFEFISKHGQGPRLLGRFPNGRIEEFIHARTLSAADLHDPDISDLIAI 236

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H+ +N+ P P++ +   +W  +  W    L+A  +L   EE       F    ++
Sbjct: 237 KMKEFHD-LNM-PGPKDVV---LWDRMRDW----LSAAKNLSSPEEANT----FQLDAIE 283

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHF 255
           +EI  L+ KL  N    I F HND QYGNI+   + SL+ ++D+EYA YN   +DIANHF
Sbjct: 284 EEISLLEKKLPGN-HLHIGFCHNDLQYGNIMIDEETSLITIIDYEYASYNPVTYDIANHF 342

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           CE   DY +  PH ++   YP+ +++  FLR Y+        H  + P   +D  L+ L 
Sbjct: 343 CEMAADYHTETPHILDYSKYPSLEKRQRFLRIYL-------GHAGDQP---NDLELEVLV 392

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            +V  +TLASH++WGLWG++    ++IDF+Y+ Y  +R  ++   K E+
Sbjct: 393 QDVEKYTLASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQYWLRKPEL 441



>gi|500255389|gb|EON98770.1| putative choline kinase protein [Togninia minima UCRPA7]
          Length = 542

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 152/490 (31%), Positives = 218/490 (44%), Gaps = 130/490 (26%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTK--- 61
           V  +N +I L  T  L GW    + +   I +ER+SGALTN V+ ++    +  Q+    
Sbjct: 56  VVFKNEIIRLAHTLRLKGWRRVSLDSGEQISVERLSGALTNAVYVVSPPADVVKQSTADG 115

Query: 62  NKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLK 121
            K P ++LLRVYG  V+ L DR+ EL  L  L+  KIGP+LLG F NGRFEQ   S TL 
Sbjct: 116 KKAPPKLLLRVYGPQVEHLIDRETELGVLRRLARKKIGPRLLGTFTNGRFEQFFNSTTLT 175

Query: 122 SNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIK---PEVWVNIDKWYPLALNAISSL- 177
           ++D+R+P TSK IA+R+ +LH+ I +     EN K   P VW N DKW   A   I++L 
Sbjct: 176 ASDIREPETSKQIAKRMRELHDGIELL----ENEKDEGPAVWKNWDKWLKSAEERITALD 231

Query: 178 -----------KCTEEQRK------GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFA 217
                      +  ++  K      G+E   FK + ++     E +Y     I   +VFA
Sbjct: 232 ERMISGKLGPVRGPDDAWKTRGLICGVEWHVFKGMVEKYRKFVEEQYGGRKAIRERLVFA 291

Query: 218 HNDTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR 263
           HND QYGNILRL                  LVV+DFEYA  N    + ANHF EWTY+Y 
Sbjct: 292 HNDAQYGNILRLRPDDEKSPLMQPANEHKQLVVIDFEYASANCPGLEFANHFTEWTYNYH 351

Query: 264 SSV-PHKMNLDLYPNEDQQIDFLRAYID---------------AYSIPSDHTINNPS--- 304
           + V P   +   YP  +Q+  F++AY+D                 + P+ HT  + S   
Sbjct: 352 NPVAPWACDTTRYPTLEQRHRFIKAYVDHRPQFPHSNSTPNLTPLATPTLHTAASSSSIV 411

Query: 305 ---------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSG----- 338
                                +  +  +++L  E   + +A+   W  WG+VQ+      
Sbjct: 412 EFMLDARVPPGGWKEEEKRQQDQAEARVKELLDETLLWQIANSAQWVAWGIVQAKIPGFD 471

Query: 339 ------------------------QSQIDFDYLSYGMERLHRF------------RELKN 362
                                   + + +FDYL Y  ER   F             EL  
Sbjct: 472 GADESGFAEEVTAEEPGAAVNTTEEEEPEFDYLGYAQERAFFFWGDCVAMGLIKKEELPE 531

Query: 363 EVYERLPLLN 372
           E+  RL ++N
Sbjct: 532 ELQSRLKIVN 541



>gi|218187637|gb|EEC70064.1| hypothetical protein OsI_00666 [Oryza sativa Indica Group]
          Length = 368

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 189/347 (54%), Gaps = 31/347 (8%)

Query: 23  LPGWDVSNESDIQIERVSGALTNCVFFIT--RTKKLHDQTKNKKPLRVLLRVYGNGVDQL 80
           L G DV + + + + ++ GA+TN VF IT        +        +VL+R+YG GV+  
Sbjct: 42  LWGGDV-DPAALAVSQLKGAMTNEVFRITWPGGGGGGEGEGEGDHRKVLVRIYGQGVEVF 100

Query: 81  CDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQ 140
            DR  E+   E +S    GP+LLG F NGR E+ + + TL + DLRD   S  IA++L +
Sbjct: 101 FDRADEVRTFECMSRHGQGPRLLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLRE 160

Query: 141 LHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIE 200
            H++    P P+ N+   +W  + +W   A       +C+ E+ +   +F  + L DEI 
Sbjct: 161 FHDL--DMPGPK-NVS--LWQRLRRWLEEARG-----RCSPEEAR---QFSLEKLGDEIA 207

Query: 201 ELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWT 259
            L   LS  +D  + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE +
Sbjct: 208 MLDIALS-GVDQRVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMS 266

Query: 260 YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVY 319
            DY S+ PH ++   YP  D+Q  F++ Y+ +       +  NPS+    +L  L   + 
Sbjct: 267 ADYHSATPHVLDFTKYPGIDEQRRFVQTYLRS-------SGENPSDAEVEHLLGL---IA 316

Query: 320 AFTLASHVMWGLWGLVQSGQ--SQIDFDYLSYGMERLHRFRELKNEV 364
            ++LASH+ WGLWG++ SG     IDF+Y  Y  +R  ++ + K++ 
Sbjct: 317 KYSLASHIFWGLWGII-SGHVNKNIDFEYQEYARQRFDQYWKTKDQT 362



>gi|498995012|ref|XP_004553391.1| PREDICTED: choline kinase alpha-like [Maylandia zebra]
          Length = 487

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/359 (34%), Positives = 188/359 (52%), Gaps = 32/359 (8%)

Query: 12  RNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           R+  I    D L G W    ++D QI  VSG L+N ++  +     H Q    +P +VLL
Sbjct: 140 RDKAINWCRDFLSGSWKTIEDADFQISIVSGGLSNLLYLCSLPD--HVQCVEDEPRQVLL 197

Query: 71  RVYG---NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRD 127
           RVYG    GVD L     E     +L+   +GPKL G+F  GR EQ+L +  ++++ L D
Sbjct: 198 RVYGAILQGVDSLV---LESVMFAILAERALGPKLYGIFPQGRLEQYLPNTRMRTSQLSD 254

Query: 128 PSTSKYIAQRLSQLHNIINICPPPQENIKPE-VWVNIDKWYPLALNAISSLKCTEEQRKG 186
           P+ S  IA +L++ HN++        N KP+ ++  IDK+    +N     +   ++   
Sbjct: 255 PAISAEIATKLARFHNMVM-----PFNKKPKWLFGTIDKYMEQVMNISFVREAHVKKYNK 309

Query: 187 LEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS------LVVVDFE 240
           L + D   L  E+  L+  L+    SP+VF HND Q GNIL L DG       L+++DFE
Sbjct: 310 LMKLD---LPAELRSLRALLAAT-PSPVVFCHNDVQEGNILMLEDGKHSSAEKLMLIDFE 365

Query: 241 YAGYNYQAFDIANHFCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDH 298
           Y+ YNY+ FD  NHFCEW YDY  +  P +K   + YP  +QQ+ F+R+Y     +   H
Sbjct: 366 YSSYNYRGFDFGNHFCEWMYDYTYNEWPFYKATPENYPTREQQLLFIRSY-----LAEQH 420

Query: 299 TINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
              N +       + L +E   + LASH +WG+W ++Q+  S+I+F Y+ Y   R   +
Sbjct: 421 KDTNVAVDQTQIEEDLIIEANRYALASHFLWGVWSIIQAKISKIEFGYMDYAQCRFDAY 479



>gi|91085145|ref|XP_966691.1| PREDICTED: similar to choline/ethanolamine kinase isoform 1
           [Tribolium castaneum]
          Length = 379

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 203/388 (52%), Gaps = 39/388 (10%)

Query: 1   EKLGNDDNVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQ 59
           +K+  D N  +R     +  D L G W      +I  + +SG L+N ++ I+  + L ++
Sbjct: 3   KKVSGDSN-EMREFAARICRDYLYGPWKSVTAQNIGFKHISGGLSNLLYHISLPESLVEE 61

Query: 60  TKN-KKPLRVLLRVYG--NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLE 116
           +K+  +P  VL+RVYG  +G   L     E     +LS   +GPKL G+F  GR EQ++ 
Sbjct: 62  SKDLGEPQEVLIRVYGQTHGEHALEALITESVVFTLLSERGLGPKLHGIFPGGRIEQYIN 121

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISS 176
           +  L++ +L D   S  IAQ+++ +H +      P       +W  ID+W     + + S
Sbjct: 122 ARPLRTGELADEKLSVKIAQKMAAIHTM----EVPLHKEPGWLWDTIDRWLRTCESKLKS 177

Query: 177 LKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG---- 232
               E  R  ++  DF     E++ LK +L    + P+VF HND Q GNIL   DG    
Sbjct: 178 DDVPEFFRNSVD-CDFL---SEVDWLKKRLEME-NCPVVFCHNDMQEGNILIRQDGPENN 232

Query: 233 -----SLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFL 285
                 +VV+DFEY  YNY++FDIANHF EW YDY  +  P +K  L+ YP++ Q++ F+
Sbjct: 233 NNEDPQIVVIDFEYCSYNYRSFDIANHFVEWVYDYTEAEYPFYKEQLENYPSKKQRLLFI 292

Query: 286 RAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFD 345
           +AY++A  +       NP        +K+  EV  FTLASH  WG+WG++ +G SQI F 
Sbjct: 293 KAYLEARGLK-----ENP--------KKILREVEVFTLASHFFWGIWGIINAGTSQIPFG 339

Query: 346 YLSYGMERLHR-FRELKNEVYERLPLLN 372
           Y  Y   RL   F++ K    +  PL++
Sbjct: 340 YWEYAAARLRNYFQQKKKFTLDMKPLVS 367



>gi|351726586|ref|NP_001235340.1| GmCK2p [Glycine max]
 gi|1438881|gb|AAC49375.1| GmCK2p [Glycine max]
          Length = 362

 Score =  194 bits (493), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 120/326 (36%), Positives = 180/326 (55%), Gaps = 32/326 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFLEM 92
           +Q+  ++GA+TN VF      +++  TKN   +R VL+R+YG GV+   DR++E+   + 
Sbjct: 39  LQVIPLNGAMTNEVF------QINWPTKNGGEIRKVLVRLYGEGVEVFFDREEEIRNFDC 92

Query: 93  LSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQ 152
           +S    GP+LLG F +GR E+ + + TL + DLRDP  S  IA ++ + HN+    P  +
Sbjct: 93  ISKHGQGPRLLGRFTSGRVEEFIHARTLSAADLRDPEVSALIASKMREFHNL--HMPGAK 150

Query: 153 ENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDS 212
              K ++W  + KW    L    SL C+ +  K    F    L +EI  L+ KLS     
Sbjct: 151 ---KVQIWHRMRKW----LGQAKSL-CSPKDEKN---FGLDNLDEEINILEKKLSEGYQE 199

Query: 213 PIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMN 271
            I F HND QYGNI+   +  L+ ++D+EYA YN  A+D+ANHFCE   DY S  PH ++
Sbjct: 200 -IGFCHNDLQYGNIMMDEETRLITIIDYEYASYNPIAYDLANHFCEMVADYHSDTPHVLD 258

Query: 272 LDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGL 331
              YP  +++  F+R Y+ +         N PS    N L K       +TLA+H+ WGL
Sbjct: 259 YTKYPGLEERQRFIRNYLSSEG-------NKPSNAKVNQLAK---AAEKYTLANHLFWGL 308

Query: 332 WGLVQSGQSQIDFDYLSYGMERLHRF 357
           WGL+ S  ++IDFDY  Y  +R  ++
Sbjct: 309 WGLISSYVNKIDFDYKEYARQRFQQY 334



>gi|270009349|gb|EFA05797.1| hypothetical protein TcasGA2_TC030588 [Tribolium castaneum]
          Length = 371

 Score =  194 bits (493), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 198/378 (52%), Gaps = 38/378 (10%)

Query: 1   EKLGNDDNVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQ 59
           +K+  D N  +R     +  D L G W      +I  + +SG L+N ++ I+  + L ++
Sbjct: 3   KKVSGDSN-EMREFAARICRDYLYGPWKSVTAQNIGFKHISGGLSNLLYHISLPESLVEE 61

Query: 60  TKN-KKPLRVLLRVYG--NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLE 116
           +K+  +P  VL+RVYG  +G   L     E     +LS   +GPKL G+F  GR EQ++ 
Sbjct: 62  SKDLGEPQEVLIRVYGQTHGEHALEALITESVVFTLLSERGLGPKLHGIFPGGRIEQYIN 121

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISS 176
           +  L++ +L D   S  IAQ+++ +H +      P       +W  ID+W     + + S
Sbjct: 122 ARPLRTGELADEKLSVKIAQKMAAIHTM----EVPLHKEPGWLWDTIDRWLRTCESKLKS 177

Query: 177 LKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG---- 232
               E  R  ++  DF     E++ LK +L    + P+VF HND Q GNIL   DG    
Sbjct: 178 DDVPEFFRNSVD-CDFL---SEVDWLKKRLEME-NCPVVFCHNDMQEGNILIRQDGPENN 232

Query: 233 -----SLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFL 285
                 +VV+DFEY  YNY++FDIANHF EW YDY  +  P +K  L+ YP++ Q++ F+
Sbjct: 233 NNEDPQIVVIDFEYCSYNYRSFDIANHFVEWVYDYTEAEYPFYKEQLENYPSKKQRLLFI 292

Query: 286 RAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFD 345
           +AY++A  +       NP        +K+  EV  FTLASH  WG+WG++ +G SQI F 
Sbjct: 293 KAYLEARGLKE-----NP--------KKILREVEVFTLASHFFWGIWGIINAGTSQIPFG 339

Query: 346 YLSYGMERLHRFRELKNE 363
           Y  Y   RL  + + K +
Sbjct: 340 YWEYAAARLRNYFQQKKK 357



>gi|326528423|dbj|BAJ93400.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 358

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 187/355 (52%), Gaps = 31/355 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI------TRTKKLHDQTKNKKPLRVLL 70
           L+ D+   W +V++   +++  + GA+TN V+ +                K ++  +VL+
Sbjct: 24  LLHDLAAAWPNVADCRALEVVPLKGAMTNEVYQVRWLTAPAEAGAGAGPLKEREVRKVLV 83

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG+GVD   DR+ EL   E +S    GP+LLG F NGR E+ + + TL + DLRDP  
Sbjct: 84  RIYGDGVDLFFDREDELRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAPDLRDPEI 143

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEF 190
           S  +A +L + HN+    P P+  +   +W  +  W   A N      C  +Q     E 
Sbjct: 144 SALVATKLREFHNL--DMPGPKHVL---LWDRLKNWLKTAKNL-----CPTDQ---ANEL 190

Query: 191 DFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAF 249
               L++EI  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N  A+
Sbjct: 191 RLDCLENEIASLEKEFSGDYHHWIGFCHNDLQYGNIMMDEETNMLTIIDYEYASFNPVAY 250

Query: 250 DIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDN 309
           DIANHFCE   DY S  PH +N   YP+ D++  F++ Y+      +       +E  +N
Sbjct: 251 DIANHFCEMAADYHSEKPHILNYSKYPDIDERRRFVKTYL------TTSCEEPEAEEVEN 304

Query: 310 YLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            LQ     V  +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + K  V
Sbjct: 305 LLQS----VEKYTLASHLVWGLWGIISDRVNDIDFDYQEYARQRFEQYWQKKPAV 355



>gi|482572360|gb|EOA36547.1| hypothetical protein CARUB_v10011655mg [Capsella rubella]
          Length = 369

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 182/329 (55%), Gaps = 30/329 (9%)

Query: 32  SDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV-DQLCDRQKELNFL 90
           S++Q++ + GA+TN VF +T   K +D +  K    VL+RVYG GV D L +R  E+   
Sbjct: 55  SNLQVKPMKGAMTNEVFMVTWPTKDNDCSHRK----VLVRVYGQGVGDMLFNRTDEIRTF 110

Query: 91  EMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPP 150
           E++S    GPKLLG F  GR E+ + + TL + DLRD   S  +A +L + H I NI  P
Sbjct: 111 EVVSRYGHGPKLLGRFAGGRVEEFINARTLSATDLRDIEVSARVAAKLREFHGI-NI--P 167

Query: 151 PQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL-SHN 209
              N+   +W  +  W    L    SL CT E      EF    ++ EI  L+++L S  
Sbjct: 168 GDRNVL--IWDRMRNW----LRQAKSL-CTPEDSV---EFGLDNIETEINLLEHELHSEC 217

Query: 210 IDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPH 268
               I F HND QYGNI+   D  ++ ++D+EYA YN  A+DIANHFCE   +Y S  PH
Sbjct: 218 KQQKIGFCHNDLQYGNIMIDEDTNAITIIDYEYASYNPGAYDIANHFCEMAANYHSDTPH 277

Query: 269 KMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVM 328
            ++  LYP E+++  F+  Y+ +          +  E ++  +++L  +   +TLASH+ 
Sbjct: 278 ILDYTLYPGEEERRRFIHNYLSS----------SGKEPNEEDIKQLLEDAQKYTLASHLF 327

Query: 329 WGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           WGLWG++    ++IDFDY  Y  +R  ++
Sbjct: 328 WGLWGIISGYVNKIDFDYTEYSRQRFKQY 356



>gi|402221070|gb|EJU01140.1| kinase-like protein [Dacryopinax sp. DJM-731 SS1]
          Length = 469

 Score =  194 bits (492), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 190/385 (49%), Gaps = 64/385 (16%)

Query: 20  TDMLPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV 77
           T  +PGW       +++ ++++SGALTN VFF++  +         KP  ++LR+YG   
Sbjct: 97  TLRIPGWSSHRLTPANVHLQKISGALTNAVFFVSYPQA-------PKPPTLVLRIYGPSS 149

Query: 78  DQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
             L  R  EL  L +LS+   IGPK+ G F NGR EQ+  S TL + ++R+P  S++I  
Sbjct: 150 SVLISRPSELQTLHILSSQYSIGPKVYGTFANGRVEQYFPSRTLTAAEMREPQMSQWIGM 209

Query: 137 RLSQLHNIINICPPPQENIK-PEVWVNIDKWY-----PLALNAISSLKCTEEQRKGLEEF 190
           R+ +LH+ +++    Q++I  P VW NI  W       L L A   L    +      + 
Sbjct: 210 RMRELHS-VDLERVVQDDISLPGVWKNITSWLVPARDVLGLLAKVPLPLQHKWANISTDI 268

Query: 191 DFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG------------------ 232
           D      ++   +  +S     P+VFAHND QYGN+LRLT                    
Sbjct: 269 DLHRFAQDVSTYQALISSRT-PPVVFAHNDAQYGNLLRLTKPLRTPSSSPLAGATLPPQH 327

Query: 233 SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDL--YPNEDQQIDFLRAYID 290
            L+VVDFEYA  N  AFDIANHF EW +DY   V     L+   YP   ++ +F RAY+ 
Sbjct: 328 QLIVVDFEYASPNPAAFDIANHFHEWCFDYSRPVETSWYLERANYPTLGKRRNFYRAYL- 386

Query: 291 AYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI-------- 342
                  H+        +  L +L+ EV  ++ ASH MW +WGLVQ+    I        
Sbjct: 387 ------GHSAT------EEQLDQLEREVREWSPASHAMWAVWGLVQARDDVIGLVNEGVK 434

Query: 343 ----DFDYLSYGMERLHRF-RELKN 362
               DF+YL Y   R+  F REL++
Sbjct: 435 AEGGDFNYLRYARGRMEWFYRELQD 459



>gi|302419617|ref|XP_003007639.1| choline kinase [Verticillium albo-atrum VaMs.102]
 gi|261353290|gb|EEY15718.1| choline kinase [Verticillium albo-atrum VaMs.102]
          Length = 791

 Score =  194 bits (492), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 167/321 (52%), Gaps = 41/321 (12%)

Query: 10  TLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKP 65
           T RN +I L  T  + GW    +     I ++R+SGALTN V+ +T  + L      K+P
Sbjct: 291 TFRNEIIRLAHTLRIKGWRRIPLEAGDKISVQRLSGALTNAVYVVTPPEDLEPVPGKKQP 350

Query: 66  LRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDL 125
            +VLLR+YG  V+ L DR  EL+ L  L+  +IGP+LLG F NGRFE++  S TL   DL
Sbjct: 351 SKVLLRIYGPQVEHLIDRDNELSVLGRLARKRIGPRLLGTFTNGRFEEYFNSVTLTPKDL 410

Query: 126 RDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK 185
           RD  TSK IA+R+ +LH+ I +    +    P VW N DKW       + ++      R+
Sbjct: 411 RDAETSKQIAKRMRELHDGIELL-DAERKAGPSVWGNWDKWLDNVEKRVMAVDDETRARQ 469

Query: 186 GLEE---------------FDFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYG 224
             E                 ++   +  +E+ +      Y+   +I++ + FAHNDTQYG
Sbjct: 470 AGEPVKPTSTYQGQGFVCGVEWSQFRATVEKYRAFLTSFYRSEEDINARLTFAHNDTQYG 529

Query: 225 NILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHK 269
           NILR+                  L+V+DFEYAG N    + ANHF EW Y+Y     PH 
Sbjct: 530 NILRVRPDDKKSPLLKPANEHKQLIVIDFEYAGANVPGQEFANHFTEWAYNYHDEAKPHG 589

Query: 270 MNLDLYPNEDQQIDFLRAYID 290
            +++ YP  ++Q  F+R+Y++
Sbjct: 590 CSIERYPTVEEQRRFIRSYVE 610



>gi|440637053|gb|ELR06972.1| hypothetical protein GMDG_08206 [Geomyces destructans 20631-21]
          Length = 787

 Score =  193 bits (491), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 168/320 (52%), Gaps = 39/320 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           VT ++ ++ L  T  L GW    + + +D+++ER+SGALTN V+ ++      D T   K
Sbjct: 300 VTFKSEILRLAHTLRLKGWRRVPLDSGADLEVERLSGALTNAVYVVSPPALPSDPTSKSK 359

Query: 65  --PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
             P ++LLR+YG  V+ L DR  EL  L  L+  KIGP+LLG F+NGRFE++  S TL  
Sbjct: 360 ARPSKLLLRIYGPQVEHLIDRDAELGILSRLARKKIGPRLLGTFRNGRFEEYFISTTLTP 419

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEE 182
            DLRDP TSK IA+R+ +LH+ I +    + +  P VW N DKW       IS L    E
Sbjct: 420 RDLRDPETSKQIAKRMRELHDGIELL-ETERDEGPFVWRNWDKWVERCERVISFLDTYPE 478

Query: 183 QRKGLEE------------FDFKMLKDEIEEL------KYKLSHNIDSPIVFAHNDTQYG 224
              G ++             ++ + +  +E        KY     +   +VFAHNDTQYG
Sbjct: 479 TGDGGKKVPAWRERGLVCGVEWSVFRGMVERYRGWLNEKYGGVAGLREKLVFAHNDTQYG 538

Query: 225 NILRL-------------TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS-VPHKM 270
           NILRL             T   LVV+DFEYA  N    + ANHF EW Y+Y     P+  
Sbjct: 539 NILRLLPTTESPLLLPANTHKQLVVIDFEYASGNTPGLEFANHFTEWCYNYHEPFTPYLC 598

Query: 271 NLDLYPNEDQQIDFLRAYID 290
           N   +P   +Q  F+RAY++
Sbjct: 599 NTKSFPTPAEQRRFIRAYLN 618



>gi|452823806|gb|EME30813.1| choline/ethanolamine kinase isoform 1 [Galdieria sulphuraria]
          Length = 409

 Score =  193 bits (490), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 188/353 (53%), Gaps = 28/353 (7%)

Query: 22  MLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           ++P W    ++++++ERV G +TN +F ++  K   +   NK    VL+RV+G   + + 
Sbjct: 75  LVPDWRHLEDAELRVERVLGGITNRIFCVSVNKDAPNLFFNK----VLVRVFG--AEGII 128

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR+KE    E L+  +I P  +G F NGR E  L++  +   ++R P+ SK +AQ+L+ L
Sbjct: 129 DREKENEIFEQLAKNRIAPSFIGEFANGRIESWLQARCISIEEMRYPNISKAVAQKLAIL 188

Query: 142 HNIINICPPPQENIK----PEVWVNIDKWYPLALNAISSLKCTE---EQRKGLEEFDFKM 194
           H        PQ + K      VW +I  W   A  A+  L+ TE    +R  L++ D  +
Sbjct: 189 HRF-----QPQGHRKSLQDSPVWESIYAWLKEAKVALKQLENTELDDSRRLLLKQIDLLV 243

Query: 195 LKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILR-LTDGSLVVVDFEYAGYNYQAFDIAN 253
           L+ E+E L+  L     SPIVF+HND  +GNIL     G++  VDFEY+G+NY+ FDI N
Sbjct: 244 LEKELEFLRNTL-RKTPSPIVFSHNDLLFGNILYDEISGTVHFVDFEYSGWNYRGFDIGN 302

Query: 254 HFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           HFCE      + +P   +   YP E+QQ  F + Y+ +Y         N S  ++  ++ 
Sbjct: 303 HFCECMGGTDNGIP---DYTKYPTEEQQHLFCQHYLVSYG-----GFENVSSVNETDIKS 354

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVYE 366
           L +E   + L SH  WG+W L  S    +DFDYL +G+ R   +   +N+  E
Sbjct: 355 LMIEANRYALLSHFYWGMWALCLSVDQTVDFDYLLFGVNRFKEYYRFRNQFLE 407



>gi|296413944|ref|XP_002836666.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630499|emb|CAZ80857.1| unnamed protein product [Tuber melanosporum]
          Length = 673

 Score =  193 bits (490), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 176/364 (48%), Gaps = 60/364 (16%)

Query: 33  DIQIERVSGALTNCV---FFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELN 88
           DI IER+SGALTN V   F          +   +  LR +LLR+YG  V  L DR+ EL+
Sbjct: 223 DISIERISGALTNTVSLSFVDYPLVGFFPRQGTEASLRKLLLRIYGPQVSHLIDRETELS 282

Query: 89  FLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINIC 148
            L  L+   IGP LLG F+NGRFE+   + TL  +D++ P TS++IA RL +LH  I + 
Sbjct: 283 ILRRLARRTIGPPLLGTFENGRFEEFFNATTLTKDDIKVPGTSRHIAMRLKELHKGIEL- 341

Query: 149 PPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK-----GLEEFDFKMLKDEIEEL- 202
              +  + P  W N  KW P A   +  L   E   K     G     F+   ++ +E  
Sbjct: 342 EDRERKMGPASWCNWYKWAPRAKQIMIYLDTAENLGKRGYICGCPWEKFEAAVEKYKEWL 401

Query: 203 --KYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-------------LVVVDFEYAGYNYQ 247
             +Y    N+   +VFAHNDTQYGNILRL                 LVV+DFEYA  N  
Sbjct: 402 YDRYNGEENVKKQMVFAHNDTQYGNILRLQPSGESPPPTPSNEHRQLVVIDFEYASANTP 461

Query: 248 AFDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYID--------AYSIPSDH 298
            F+ ANHFCEW  +Y   V PH M+   +P   ++ +FL+AY++        A S+    
Sbjct: 462 GFEFANHFCEWMSNYHDPVSPHFMHHTRFPTFQERRNFLQAYVEHSLPSPFIAKSVSMPG 521

Query: 299 TINNPSE-------------------------THDNYLQKLKLEVYAFTLASHVMWGLWG 333
           T + PS                            D  + +L+ E  A+  ASH MW +WG
Sbjct: 522 TSSEPSTPPTLHPPAASSSSAPSSMLDTRIPGASDEEVDRLEGEAKAWRAASHAMWCVWG 581

Query: 334 LVQS 337
           +VQ+
Sbjct: 582 IVQA 585



>gi|449449250|ref|XP_004142378.1| PREDICTED: ethanolamine kinase 2-like [Cucumis sativus]
          Length = 350

 Score =  192 bits (488), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 183/332 (55%), Gaps = 30/332 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           D  + S +Q+  + GA+TN VF I    K  D ++     +VL+R+YG GVD   +R+ E
Sbjct: 32  DEIDSSALQMIPLKGAMTNEVFQIKWPTKTEDVSR-----KVLVRIYGEGVDVFFNREDE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F +GR E+ + + TL + DLRD   S  IA ++ + H+ +N
Sbjct: 87  IKTFEFMSKHGQGPRLLGRFSSGRIEEFIHARTLSAVDLRDSEISSLIAVKMKEFHD-LN 145

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
           I  P  +N+   +W  +  W    L A       EE +     F    +++EI  L+  L
Sbjct: 146 I--PGSKNVC--LWNRLRNW----LTAAKKCSLPEEAKA----FHLDSMEEEISILEKDL 193

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
             +  S I F HND QYGNI+   +  S+ ++D+EYA YN  AFDIANHFCE T DY + 
Sbjct: 194 LGDRQS-IGFCHNDLQYGNIMLDEETRSITIIDYEYASYNPIAFDIANHFCEMTADYHTD 252

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++   YP  +++  F++ Y+ A    S H  N      D  +++L  +V  +TLAS
Sbjct: 253 TPHVLDYIKYPGLEERKRFVQIYLSA----SGHQPN------DAEVEQLVQDVEKYTLAS 302

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H++WGLWG++    + IDFDY+ Y  +R  ++
Sbjct: 303 HLVWGLWGIISEHVNDIDFDYIEYARQRFEQY 334



>gi|322704538|gb|EFY96132.1| putative choline kinase [Metarhizium anisopliae ARSEF 23]
          Length = 739

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 203/459 (44%), Gaps = 107/459 (23%)

Query: 5   NDDNVTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQT 60
           ND  +  +N +I +  T  L GW    +++   I +ER+SGALTN V+ +T    L +  
Sbjct: 254 NDPWLIFKNDIIRIAHTLRLKGWRRIPLNSGDTITVERLSGALTNAVYVVTPPMDLPEIE 313

Query: 61  KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETL 120
             K P ++LLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F+NGRFEQ   S TL
Sbjct: 314 GKKNPPKLLLRVYGPQVEHLIDRENELKVLQRLARKKIGPRLLGTFQNGRFEQFFNSITL 373

Query: 121 KSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCT 180
               LR+P TSK IA+R+ +LH+ I +  P + +  P VW N D+W       ++ L   
Sbjct: 374 TPVHLREPDTSKQIAKRMRELHDGIELL-PLERDGGPGVWKNWDQWVENVAKIMAYLDKQ 432

Query: 181 EEQRK----------------------GLEEFDFKMLKDEIEELK-YKLSHNIDSPIVFA 217
            E                           E+F   ++K     +  YK    I   +VFA
Sbjct: 433 LETTSIPPAKSDSVVHAWKANGYVCGAPWEQFLAMVVKYRTHLVNCYKPKKIIKERLVFA 492

Query: 218 HNDTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR 263
           HNDTQYGNILR+                  LVV+DFEYAG N    + ANHF EWTY+Y 
Sbjct: 493 HNDTQYGNILRIKPDDEKSPLLQPANKHKQLVVIDFEYAGANLPGLEFANHFTEWTYNYH 552

Query: 264 SSV-PHKMNLDLYPNEDQQIDFLRAYID-------AYSIP---SDHTINNPS-------- 304
             V  H  N + YP  ++Q  F+++Y+D       A S P    D     PS        
Sbjct: 553 DPVTSHACNHERYPTPEEQRRFIKSYVDHRSQFAAAGSTPRVKPDSGPPTPSLNPTASSS 612

Query: 305 ------------------------ETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQS 340
                                   E  D ++++L  E   +  A  V W  WG+VQ+   
Sbjct: 613 SIVDFMLDARVPPGGWGAAERAREEQSDLHVRQLLEETRLWRPACSVFWIAWGIVQAKVP 672

Query: 341 QID----------------------FDYLSYGMERLHRF 357
            +D                      FDYLSY   R   F
Sbjct: 673 GLDANNEPVSEEEAAKAEQELGPDEFDYLSYAQNRAFFF 711



>gi|508724948|gb|EOY16845.1| Choline kinase 1 isoform 1 [Theobroma cacao]
          Length = 343

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 188/358 (52%), Gaps = 41/358 (11%)

Query: 12  RNALIP---------LITDMLPGWD--VSNESDIQIERVSGALTNCVFFITRTKKLHDQT 60
           +N  IP         ++T +   W   + +  +  +  + GA+TN VF I    K  D  
Sbjct: 5   KNGFIPSSAPEELKKVLTAVASEWGDMIEDMEEFHVIPLKGAMTNEVFQINWPTKHGDLH 64

Query: 61  KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETL 120
           +     +VL+RVYG GV+   DR  E+   E +S    GP+LLG F +GR E+ + + TL
Sbjct: 65  Q-----KVLVRVYGEGVEVFFDRDDEIRTFECMSKHGQGPRLLGRFADGRIEEFIHARTL 119

Query: 121 KSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCT 180
            + DLRDP  S  +A +L + HN+    P P++ +   +W  +  W   A        C+
Sbjct: 120 SAADLRDPEISALVAAKLREFHNL--HMPGPKDVL---LWERLRTWLSQAKKL-----CS 169

Query: 181 EEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDF 239
            E  K   EF   +L +EI  L+ +L+      I F HND QYGNI+   +  ++ ++D+
Sbjct: 170 PEDAK---EFGLDILGEEISMLEKELTQG-SQDIGFCHNDLQYGNIMMDEETRAITLIDY 225

Query: 240 EYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHT 299
           EYA YN  A+D+ANHFCE   +Y S  PH ++  +YP+ +++  F+ AY+ +       +
Sbjct: 226 EYASYNPVAYDLANHFCEMAANYHSETPHILDYSIYPDLEERQRFISAYLTS-------S 278

Query: 300 INNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            N P E     + +L  +   +TLA+H+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 279 GNEPGEAE---VAQLLNDAEKYTLANHLFWGLWGIISGHVNKIDFDYMEYARQRFQQY 333



>gi|508724950|gb|EOY16847.1| Choline kinase 1 isoform 3 [Theobroma cacao]
          Length = 344

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 187/358 (52%), Gaps = 40/358 (11%)

Query: 12  RNALIP---------LITDMLPGWD--VSNESDIQIERVSGALTNCVFFITRTKKLHDQT 60
           +N  IP         ++T +   W   + +  +  +  + GA+TN VF I    K  D  
Sbjct: 5   KNGFIPSSAPEELKKVLTAVASEWGDMIEDMEEFHVIPLKGAMTNEVFQINWPTKHGDLH 64

Query: 61  KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETL 120
           +     +VL+RVYG GV+   DR  E+   E +S    GP+LLG F +GR E+ + + TL
Sbjct: 65  Q-----KVLVRVYGEGVEVFFDRDDEIRTFECMSKHGQGPRLLGRFADGRIEEFIHARTL 119

Query: 121 KSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCT 180
            + DLRDP  S  +A +L + HN+    P P++ +   +W  +  W   A        C+
Sbjct: 120 SAADLRDPEISALVAAKLREFHNL--HMPGPKDVL---LWERLRTWLSQAKKL-----CS 169

Query: 181 EEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDF 239
            E  K   EF   +L +EI  L+ +L+      I F HND QYGNI+   +  ++ ++D+
Sbjct: 170 PEDAK---EFGLDILGEEISMLEKELTQG-SQDIGFCHNDLQYGNIMMDEETRAITLIDY 225

Query: 240 EYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHT 299
           EYA YN  A+D+ANHFCE   +Y S  PH ++  +YP+ +++  F+ AY+      +   
Sbjct: 226 EYASYNPVAYDLANHFCEMAANYHSETPHILDYSIYPDLEERQRFISAYL------TSSA 279

Query: 300 INNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            N P E     + +L  +   +TLA+H+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 280 GNEPGEAE---VAQLLNDAEKYTLANHLFWGLWGIISGHVNKIDFDYMEYARQRFQQY 334



>gi|322695505|gb|EFY87312.1| putative choline kinase [Metarhizium acridum CQMa 102]
          Length = 745

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 171/328 (52%), Gaps = 43/328 (13%)

Query: 5   NDDNVTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQT 60
           ND  +  +N +I +  T  L GW    +++   I +ER+SGALTN V+ +T    L +  
Sbjct: 254 NDPWLIFKNEIIRIAHTLKLKGWRRIPLNSGDTITVERLSGALTNAVYVVTPPMDLSEIE 313

Query: 61  KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETL 120
             K P ++LLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F+NGRFEQ   S TL
Sbjct: 314 GKKSPPKLLLRVYGPQVEHLIDRENELKVLQRLARKKIGPRLLGTFQNGRFEQFFNSITL 373

Query: 121 KSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCT 180
               LR+P TSK IA+R+ +LH+ I +  P + +  P VW N D+W       ++ L   
Sbjct: 374 TPAHLREPDTSKQIAKRMRELHDGIELL-PIERDSGPGVWKNWDQWVENVAKIMAYLDRQ 432

Query: 181 EEQRK----------------------GLEEFDFKMLKDEIEELK-YKLSHNIDSPIVFA 217
            E                           ++F   ++K     +K YK  + +   +VFA
Sbjct: 433 WETTSIPPAKSDSVVHAWKANGYVCGAPWDQFLAMVVKYRTHLVKCYKTKNMMKERLVFA 492

Query: 218 HNDTQYGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR 263
           HNDTQYGNILR+                  LVV+DFEYAG N    + ANHF EWTY+Y 
Sbjct: 493 HNDTQYGNILRIKPDDEKSPLLQPANKHKQLVVIDFEYAGANLPGLEFANHFTEWTYNYH 552

Query: 264 SSV-PHKMNLDLYPNEDQQIDFLRAYID 290
             V  H  N + YP  ++Q  F++AY+D
Sbjct: 553 DPVTSHACNHERYPTPEEQRRFIKAYVD 580



>gi|502087424|ref|XP_004488529.1| PREDICTED: probable ethanolamine kinase A-like isoform X1 [Cicer
           arietinum]
          Length = 370

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 182/352 (51%), Gaps = 34/352 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  DM   W   ++S   IE++SG +TN +       K+  +  N     + +R+YG
Sbjct: 45  VINLCKDMFKAWSKLDDSCFHIEKISGGITNLLL------KVSVKQGNSIDDIITIRLYG 98

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + DR +EL  ++ ++    G   LG+F NG  +  + + TL  +D+RDP  +  I
Sbjct: 99  PNTEFIIDRHRELQAIKYITAAGFGATWLGIFGNGMVQSFINAYTLTPSDMRDPKLAAKI 158

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H++    P  +E   P++W +I K++  A N    LK  + E++K  E   F 
Sbjct: 159 AKQLRRFHHVE--IPGSKE---PQLWNDIRKFFEKACN----LKFDDTEKQKTYEAISFT 209

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIA 252
            L DEI +L+  L   + SP++FAHND   GNI+    +  L  +D+EYA YNY+ FDI 
Sbjct: 210 ELHDEIYKLQL-LCDRLKSPVIFAHNDLLSGNIMINHEEDKLYFIDYEYASYNYRGFDIG 268

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            +  LYPN ++Q  F R Y+             P E     L+
Sbjct: 269 NHFAEYA-------GFDCDFSLYPNRNEQFHFFRHYLQP---------ERPQEVPQKDLE 312

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E   + LASH+ W LWGL+Q+  S IDFDYL Y  +R   ++  K++V
Sbjct: 313 ALYIEANTYALASHLFWALWGLIQAKMSPIDFDYLGYFFKRYKEYKRQKDQV 364



>gi|356516955|ref|XP_003527156.1| PREDICTED: probable ethanolamine kinase A-like [Glycine max]
          Length = 381

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 188/353 (53%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           ++ L  DM   W   ++S   +E++SG +TN +       K+  + +N     + +R+YG
Sbjct: 45  VLKLCKDMFKAWSNLDDSCFVVEKISGGITNLLL------KVSVKQENCIEETITVRLYG 98

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + DRQ+EL   + ++    G K LG+F NG  +  + + TL  +D+R+P  +  I
Sbjct: 99  PNTEYIIDRQRELQATKYITAAGFGAKWLGIFGNGMVQSFINAHTLSPSDMREPKLAAKI 158

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQ-RKGLEEFDFK 193
           A++L + H++    P  +E   P++W ++ K++  A    S L+  + + +K  E   FK
Sbjct: 159 AKQLQRFHHVE--IPGSKE---PQLWNDVWKFFEKA----SVLEFDDSKMQKTYETISFK 209

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIA 252
            + DEI ELK  L   + SP++FAHND   GNI+    +  L  +D+EYA YNY+ +DI 
Sbjct: 210 EVHDEIVELK-GLCDLLKSPVIFAHNDLLSGNIMMNCEEDKLYFIDYEYASYNYRGYDIG 268

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           +HF E+          + + DLYPN ++Q  FLR Y+             P E  +  L+
Sbjct: 269 DHFAEYA-------GFECDYDLYPNMNEQYHFLRHYLKP---------ERPQEVSEKDLE 312

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F+LASH+ W LWGL+Q+  S I+FDYL Y   R H ++  K + +
Sbjct: 313 TLYVEANTFSLASHIFWALWGLIQAKMSAIEFDYLGYFFLRYHEYKRHKEKYF 365



>gi|367021362|ref|XP_003659966.1| hypothetical protein MYCTH_2297591 [Myceliophthora thermophila ATCC
           42464]
 gi|347007233|gb|AEO54721.1| hypothetical protein MYCTH_2297591 [Myceliophthora thermophila ATCC
           42464]
          Length = 775

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 169/321 (52%), Gaps = 40/321 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +T +N +I L  T  L GW    + +   I +ER+SGALTN V+ ++   +  L  +   
Sbjct: 280 ITFKNEIIRLAHTLRLKGWRRVPLDSGETISVERLSGALTNAVYVVSPPPESLLPREPGK 339

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           K+P +VLLRVYG  VD L DR+ EL  L  L+  KIGP+LLG F NGRFEQ+L +  L  
Sbjct: 340 KQPGKVLLRVYGPQVDHLIDRENELGVLRRLARKKIGPRLLGTFLNGRFEQYLNATALTP 399

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAI-----SSL 177
             +R+  TS+ IA+R+ +LH+ I +    +++  P VW N DKW      A+      +L
Sbjct: 400 GSMREADTSRQIAKRMRELHDGIELL-EEEKDQGPAVWKNWDKWVGQVEKAVLFLDRRTL 458

Query: 178 KCTEEQRKGLEE-------FDFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYG 224
             ++    G  +         + + K  +E+ +      Y     I   +VFAHNDTQYG
Sbjct: 459 SHSQNPSNGASKSPGFVCGVQWPVFKALVEKYRRYVDAYYGDPKKIRDRLVFAHNDTQYG 518

Query: 225 NILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHK 269
           NILR+                  LVV+DFEYA  N    + ANHF EW Y+Y  +V P+ 
Sbjct: 519 NILRVRPDDQKSPLLQPANEHKQLVVIDFEYAAANVPGLEFANHFTEWAYNYHDAVRPYA 578

Query: 270 MNLDLYPNEDQQIDFLRAYID 290
            +   YP  +QQ  F+RAY+D
Sbjct: 579 CDTSRYPTPEQQRRFIRAYVD 599



>gi|329663412|ref|NP_001193023.1| choline/ethanolamine kinase [Bos taurus]
 gi|296486889|tpg|DAA29002.1| TPA: choline kinase beta [Bos taurus]
          Length = 395

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 183/351 (52%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   +++++ VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRQARPEELRVDPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+++LRDP  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTHELRDPVLSAAIATKMAKF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDE+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPTSLPQMNL--LEMYSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL     SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GNLR-KLLDTTPSPVVFCHNDIQEGNILLLSEPKNTDSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP E QQ+ FLR Y+    +  D TI+   E        
Sbjct: 282 CEWVYDYTHEEWPFYKAQPANYPTEGQQLHFLRHYLA--EVKKDETISQ--EEQRKLEAD 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGQM 388



>gi|297846390|ref|XP_002891076.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297336918|gb|EFH67335.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 352

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 180/327 (55%), Gaps = 30/327 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV-DQLCDRQKELNFLEM 92
           IQ++ + GA+TN VF +T   K +D    K    +L+RVYG GV D L +R+ E+   E+
Sbjct: 34  IQVKTMKGAMTNEVFMVTWPTKDNDFHHRK----LLVRVYGEGVGDLLFNRKDEIRTFEV 89

Query: 93  LSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQ 152
           +S    GPKLLG F  GR E+ + + TL + DLRD   S  +A +L + H I NI  P  
Sbjct: 90  VSRYGHGPKLLGRFAGGRIEEFINARTLSAADLRDMEASARVAAKLREFHGI-NI--PGD 146

Query: 153 ENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNI-D 211
           +N+   +W  +  W    L    SL CT E    L EF    ++ EI  L+++L      
Sbjct: 147 KNVL--IWDRMRNW----LRQAKSL-CTPED---LAEFGLDKIEAEINLLEHELQDKCKQ 196

Query: 212 SPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKM 270
             I F HND QYGNI+   D  ++ ++D+EYA YN  A+DIANHFCE   +Y S  PH +
Sbjct: 197 KEIGFCHNDLQYGNIMIDEDTNAITIIDYEYASYNPVAYDIANHFCEMAANYHSKTPHIL 256

Query: 271 NLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWG 330
           +  LYP E+++  F+  Y+ +          +  E  +  +++L  +   +TLASH+ WG
Sbjct: 257 DYTLYPGEEERSRFIHNYLSS----------SGEEPKEEDIKQLLDDAEKYTLASHLFWG 306

Query: 331 LWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LWG++    ++I+FDY  Y  +R  ++
Sbjct: 307 LWGIISGYVNKIEFDYAEYSRQRFKQY 333



>gi|356510434|ref|XP_003523943.1| PREDICTED: uncharacterized protein LOC547867 [Glycine max]
          Length = 669

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 188/345 (54%), Gaps = 37/345 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI---TRTKKLHDQTKNKKPLRVLLRVY 73
           ++  +   W DV + + +Q+  + GA+TN VF I   T T +L          +VL+R+Y
Sbjct: 301 ILKSLASKWEDVLDANALQVIPLKGAMTNEVFQIKWPTMTGELS--------RKVLVRMY 352

Query: 74  GNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKY 133
           G GVD   DR  E++  E +S    GP+LLG F NGR E+ + + TL ++DLRDPS S  
Sbjct: 353 GEGVDVFFDRDNEIHTFEFMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRDPSISAL 412

Query: 134 IAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFK 193
           IA ++ + H++      P E  K  +W  +  W    L+    L   +E    +E F   
Sbjct: 413 IAAKMKEFHDL----DMPGEK-KVHLWDRLRNW----LSEAKRLSSPKE----VEAFYLD 459

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            +  EI  L+ +LS +    I F HND QYGNI L     S+ ++D+EYA YN  AFDIA
Sbjct: 460 TIDKEISILEKELSGSHQQ-IKFCHNDLQYGNIMLDEETNSVTIIDYEYASYNPVAFDIA 518

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHFCE   +Y +  PH ++ + YP+ +++  F++AY+         +   PS   D+ ++
Sbjct: 519 NHFCEMAANYHTEEPHILDYNKYPDFEERQRFVQAYLST-------SGEQPS---DSEVE 568

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           +L  E+  +TLA+H+ WG+WG++ +  + IDFDY  Y  +R   +
Sbjct: 569 QLLQEIEKYTLANHLFWGVWGIISAQVNTIDFDYKEYAKQRFQEY 613



>gi|471562834|gb|EMR64251.1| putative choline kinase protein [Eutypa lata UCREL1]
          Length = 630

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 182/336 (54%), Gaps = 46/336 (13%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           ++ +N +I L  T  L GW    + +   I +ER+SGALTN V+ ++    L ++ ++ K
Sbjct: 138 ISFKNEIIRLAHTLRLKGWRRVALDSGESISVERLSGALTNAVYVVSPPDDLKEKMEHNK 197

Query: 65  --PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
             P ++LLR+YG  V+ + DR+ EL+ L  L+  KIGP+LLG F NGRFEQ+L + TL +
Sbjct: 198 KPPAKLLLRIYGPQVENIIDRENELSVLRRLARKKIGPRLLGTFTNGRFEQYLNAATLTA 257

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL----- 177
            ++R+P TS+ IA+R+ +LH  + +    +E   P VW N ++W P    AI+ L     
Sbjct: 258 ANIREPQTSRQIAKRMRELHEGMELLDEERE-AGPAVWKNWEQWLPNVEPAITFLDKKIL 316

Query: 178 ----------KCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP------IVFAHNDT 221
                       + ++R  +   ++ + K  +E+ +  L      P      +VFAHNDT
Sbjct: 317 AGNLGPVKGPADSWKERGLVLGVEWAIFKAMVEKYRKHLQDRYGGPKVIRDHLVFAHNDT 376

Query: 222 QYGNILRL-TDGS-------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSV 266
           QYGNILR+  D S             LVV+DFEYA  N +  + ANHF EW Y+Y   + 
Sbjct: 377 QYGNILRIRPDDSQSPLLQPNYEHKQLVVIDFEYAAANMRGLEFANHFTEWGYNYHDENA 436

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDA---YSIPSDHT 299
           P+     LYP  ++Q  F++AYI+    YS P   T
Sbjct: 437 PYAFKPSLYPTPEEQRRFIKAYIEHRPDYSHPGAST 472



>gi|356508317|ref|XP_003522904.1| PREDICTED: probable ethanolamine kinase A-like [Glycine max]
          Length = 327

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 185/346 (53%), Gaps = 34/346 (9%)

Query: 22  MLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           M   W   ++S   +E++SG +TN +       K+  + +N     + +R+YG   + + 
Sbjct: 1   MFKAWSNLDDSRFVVEKISGGITNLLL------KVSVKQENCIEETITVRLYGPNTEYII 54

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DRQ+EL   + ++    G K LG+F NG  +  + ++TL  +D+R+P  +  IA++L + 
Sbjct: 55  DRQRELQATKYITAAGFGAKWLGIFGNGMVQSFINAQTLSPSDMREPKLASKIAKQLQRF 114

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQ-RKGLEEFDFKMLKDEIE 200
           H++    P  +E   P++W ++ K++  A    S L+  + + +K  E   FK + DEI 
Sbjct: 115 HHVE--IPGSKE---PQLWNDVWKFFEKA----SVLEFDDSKMQKTYETISFKEVHDEIV 165

Query: 201 ELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIANHFCEWT 259
           ELK  L   + SP++FAHND   GNI+    +  L  +D+EYA YNY+ +DI NHF E+ 
Sbjct: 166 ELK-GLCDLLKSPVIFAHNDLLSGNIMINYEEDKLYFIDYEYASYNYRGYDIGNHFAEYA 224

Query: 260 YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVY 319
                    + + DLYPN ++Q  FLR Y+             P E  +  L+ L +E  
Sbjct: 225 -------GFECDYDLYPNMNEQYHFLRHYLKP---------ERPQEVSEKDLETLYVEAN 268

Query: 320 AFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            F+LASHV W LWGL+Q+  S I+FDYL Y   R H ++  K + +
Sbjct: 269 TFSLASHVFWALWGLIQAKMSPIEFDYLGYFFLRYHEYKRQKEKYF 314



>gi|413947638|gb|AFW80287.1| hypothetical protein ZEAMMB73_022982 [Zea mays]
          Length = 331

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 111/312 (35%), Positives = 171/312 (54%), Gaps = 29/312 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQ 84
           G DV +   + + ++ GA+TN VF IT       + +   P +VL+R+YG GV+   DR 
Sbjct: 42  GGDV-DPGALAVSQLRGAMTNEVFRITWPG---GEAEGNGPRKVLVRIYGRGVEVFFDRA 97

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA++L + H++
Sbjct: 98  DEVRTFECMSRHGQGPRLLGRFANGRVEEFINARTLSAADLRDPEMSALIARKLREFHDL 157

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKY 204
               P P++     +W  + +W   A +     +C+EE+     +F    L DEI  L+ 
Sbjct: 158 --DMPGPRDV---SLWQRLKRWLGEARD-----RCSEEESN---QFQLNKLGDEISVLEK 204

Query: 205 KLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYR 263
            LS  +   + F HND QYGNI+   +   V ++D+EYA +N  AFDIANHFCE   DY 
Sbjct: 205 TLS-GLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMAADYH 263

Query: 264 SSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTL 323
           +S PH ++   YP+  +Q  F+ AY+ +           P+   D  +++L   +  +TL
Sbjct: 264 TSTPHVLDFTKYPDTGEQRRFVEAYLSSAG-------KKPT---DGEVEELLGLIAKYTL 313

Query: 324 ASHVMWGLWGLV 335
           ASH+ WGLWG++
Sbjct: 314 ASHLFWGLWGII 325



>gi|224068861|ref|XP_002326218.1| predicted protein [Populus trichocarpa]
 gi|222833411|gb|EEE71888.1| predicted protein [Populus trichocarpa]
          Length = 386

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 190/352 (53%), Gaps = 34/352 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           LI L  D+   W   ++S   +E VSG +TN +  ++    + ++  N+ P+ V  R+YG
Sbjct: 53  LIELCKDLFKKWSRLDDSSFSVETVSGGITNLLLKVS----VKEEDGNEVPVTV--RLYG 106

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + +R++EL  ++ LS    G KLLGVF+NG  +  + + TL   D+R+P  +  I
Sbjct: 107 PNTDYVINRERELQAIKYLSAAGFGAKLLGVFQNGMVQSFINARTLIPQDMREPKLAAEI 166

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W +I K+Y  A    S+L   + E+RK  E   FK
Sbjct: 167 AKQLHKFHRV--DIPGSKE---PQLWNDIFKFYENA----STLHFDDIEKRKKYETILFK 217

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIA 252
            + +E+ E+K +L+  +++P+VFAHND   GN++   D   L ++DFEY  Y+Y+ +DI 
Sbjct: 218 EVYNEVVEIK-ELTDLLNAPVVFAHNDLLSGNLMLNDDEEKLYIIDFEYGSYSYRGYDIG 276

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+         +  +  LYP++D+Q  F R Y+           + P E  D  L+
Sbjct: 277 NHFNEYA-------GYDCDYSLYPSKDEQYHFFRHYLQP---------DKPHEVSDKDLE 320

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E   + L SH+ W LW L+Q+  S IDFDYL Y   R   F+  K + 
Sbjct: 321 ALYVESNTYMLVSHLFWALWALIQAKMSPIDFDYLGYFFLRYDEFKRRKEKA 372



>gi|401887856|gb|EJT51832.1| choline kinase [Trichosporon asahii var. asahii CBS 2479]
 gi|406699591|gb|EKD02793.1| choline kinase [Trichosporon asahii var. asahii CBS 8904]
          Length = 400

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 129/388 (33%), Positives = 193/388 (49%), Gaps = 66/388 (17%)

Query: 32  SDIQIERVSGALTNCVFFIT-----------------RTKKLHDQ------TKNKKPLRV 68
           S+I +++VSGALTN VFF+T                  T   HD       T+   P  +
Sbjct: 10  SNIHLQKVSGALTNAVFFVTFNPRHEPTSPSMSPMLTPTMPAHDPDHPPILTEEDYPQTL 69

Query: 69  LLRVYGNGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRD 127
           LLR+YG   DQL  R +EL  L  LS    +GPK+ G F NGR EQ   S  L + +LR 
Sbjct: 70  LLRIYGPSSDQLISRDEELRILHTLSTQYGLGPKIYGTFLNGRVEQFFPSRALHAEELRV 129

Query: 128 PSTSKYIAQRLSQLHNI--INICPPPQENIKPEVWVNIDKWYPLA---LNAISSLKCTEE 182
           P  S  IA+R+ +LH++  + +        +P +W +I +W P A   +N++++L  T E
Sbjct: 130 PRLSMGIARRMRELHSVDPVKLGFDHGREKQPMIWTSISQWMPAAEEMINSLTALGGTWE 189

Query: 183 QRKGLEEFDFKMLKDEIEELKYKLSHNI--DSPIVFAHNDTQYGNIL----RLTDG---- 232
                E+  F   ++E+E  +  ++     D  +VF+HNDTQYGN+L     L  G    
Sbjct: 190 MLG--EQIAFHRFREELEAYRRWVTSKTSNDKEVVFSHNDTQYGNLLLLDAELPKGVPDH 247

Query: 233 -SLVVVDFEYAGYNYQAFDIANHFCEWTYDY------RSSVPHKMNLDLYPNEDQQIDFL 285
             L+VVDFEYA  N + +DIANHF EW  +Y       S +PH      YP  +++  F 
Sbjct: 248 HRLIVVDFEYASPNCRGYDIANHFHEWRANYHHPTLSHSLMPHGN----YPTPEERERFY 303

Query: 286 RAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLV---------- 335
           RAY+       +  + + ++     + +L+ E   ++ AS   W LWG++          
Sbjct: 304 RAYLSVEMSQGEELLRDLADVDAAKVAQLEEETLRWSPASSAFWALWGIISAEEQVSGIA 363

Query: 336 ---QSGQSQI-DFDYLSYGMERLHRFRE 359
              Q+GQ    D+DYLSY +ER   FR+
Sbjct: 364 SELQTGQPYTPDWDYLSYAIERFQMFRD 391



>gi|170084833|ref|XP_001873640.1| choline kinase, cytoplasm [Laccaria bicolor S238N-H82]
 gi|164651192|gb|EDR15432.1| choline kinase, cytoplasm [Laccaria bicolor S238N-H82]
          Length = 474

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 130/394 (32%), Positives = 193/394 (48%), Gaps = 66/394 (16%)

Query: 18  LITDMLPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGN 75
           L T  +P W  S     DI + ++SGALTN VFF++    +   T       +LLR+YG 
Sbjct: 88  LRTLRIPSWSNSAIKSEDIVVRKISGALTNAVFFVSSIGLVKTNT-------LLLRIYGP 140

Query: 76  GVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
               L  R +EL+ L MLS+   IGP + G F+NGR E++ ES TL  ND+RDP  S++I
Sbjct: 141 SSGSLISRPRELHTLHMLSSQYHIGPIVYGTFENGRIEEYFESTTLTPNDIRDPLISRWI 200

Query: 135 AQRLSQLHNI-INIC---------PPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQR 184
             R+++LH++ I++          P  +E     V  N+  W   A   ++    ++  R
Sbjct: 201 GARMAELHSVDIDVVEGNSTQTGEPKGRET---GVERNVRSWLAPARQVLALPSISDIVR 257

Query: 185 KGLEEFDFKMLKDEIEELKYKLSHNIDSPI----VFAHNDTQYGNILRLTDGS------- 233
           + L   D    + E       LS   D       VFAHNDTQYGN+LRL   S       
Sbjct: 258 RDL---DLHRFEQEWHRYMLWLSKVDDLHTGRRRVFAHNDTQYGNLLRLKHPSEGLDEHR 314

Query: 234 ----------------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMN 271
                                 ++VVDFEYA  N  AFDIANHF EWT +Y SS PH ++
Sbjct: 315 QVCDINNYPNYPYRILKLAHLKIIVVDFEYASSNPAAFDIANHFHEWTANYHSSTPHLLD 374

Query: 272 LDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGL 331
              YP+  ++ +F  AY+   ++  +  +    +  +  +  L  +V  ++ ASH MW +
Sbjct: 375 FTRYPSFQERRNFYIAYVQHTTVLGEDPVMEAPDL-ERLVLDLDQQVRNWSPASHAMWAI 433

Query: 332 WGLVQSGQ------SQIDFDYLSYGMERLHRFRE 359
           WG+VQ+ +      +  +FDY+ Y   RL  FR+
Sbjct: 434 WGIVQAREDIEGNIADPEFDYIGYARGRLAAFRK 467



>gi|470108341|ref|XP_004290479.1| PREDICTED: choline/ethanolamine kinase-like [Fragaria vesca subsp.
           vesca]
          Length = 323

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 178/321 (55%), Gaps = 32/321 (9%)

Query: 39  VSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFLEMLSNLK 97
           + GA+TN V+      +L+  TKN   LR VL+RVYG GVD   +R  E+   E +S   
Sbjct: 23  LKGAMTNEVY------QLNWPTKNGDQLRKVLVRVYGEGVDLFFNRDDEIRTFECMSKHG 76

Query: 98  IGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKP 157
            GP+LLG F  GR E+ + + TL + DLRDP TS  IA +L + HN+     P   N+  
Sbjct: 77  QGPRLLGRFPEGRVEEFIHARTLSAADLRDPETSAIIAAKLREFHNLEM---PGSRNVV- 132

Query: 158 EVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFA 217
            +W  +  W    L+   +L C+ + +K   +F    L++EI  L+ KLS +    I F 
Sbjct: 133 -LWDRMRNW----LSEAKTL-CSVKDKK---DFGLDTLEEEINMLEKKLSEDCQD-IGFC 182

Query: 218 HNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYP 276
           HND QYGNI+   +  S+ ++D+EYA YN  A+D+ANHFCE   +Y S  PH ++   YP
Sbjct: 183 HNDLQYGNIMMDEETRSITIIDYEYASYNPVAYDLANHFCEMVANYHSEAPHFLDYRKYP 242

Query: 277 NEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQ 336
             D++  F+R Y+ +             E  D  + +L  +V  +TLA+H+ WGLWG++ 
Sbjct: 243 GLDERQRFVRLYLSSAEY----------EPSDAEVAQLVDKVEQYTLANHLFWGLWGIIS 292

Query: 337 SGQSQIDFDYLSYGMERLHRF 357
              ++I+FDY+ Y  +R  ++
Sbjct: 293 GYVNKIEFDYMEYARQRFQQY 313



>gi|156031082|ref|XP_001584866.1| hypothetical protein SS1G_14149 [Sclerotinia sclerotiorum 1980]
 gi|154700540|gb|EDO00279.1| hypothetical protein SS1G_14149 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 797

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 133/431 (30%), Positives = 207/431 (48%), Gaps = 97/431 (22%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQ----- 59
           +  +N ++ L  T  L GW    +   ++I++ER+SGALTN V+ ++    L        
Sbjct: 277 IQFKNEIVRLAHTLRLKGWRRVPLDRGAEIEVERLSGALTNAVYVVSPPANLPPSASSTN 336

Query: 60  --TKNKK-PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLE 116
             TK+++ P ++LLR+YG  V+ L DR+ EL+ L  L+  KIGP++LG F+NGRFE+   
Sbjct: 337 LSTKSQRYPSKLLLRIYGPQVEHLIDREAELSILRRLARKKIGPRMLGTFRNGRFEEFFN 396

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAIS- 175
           ++TL + DLR P TSK IA+R+ +LH+ + +    + +  P VW N DKW       I+ 
Sbjct: 397 AQTLTAQDLRIPDTSKKIAKRMRELHDGVALL-QEERDQGPFVWRNWDKWVDRCEKIITY 455

Query: 176 ------------SLKCTEEQRKGLE-EFDFKMLKDEIEELK------YKLSHNIDSPIVF 216
                       S++    + +GL    ++ + +  +E  +      Y  S  +   +VF
Sbjct: 456 LDRQILDGDSSRSIRGESWRDRGLVCGVEWPVFRAAVERYRQWLEKYYGGSEELSRSLVF 515

Query: 217 AHNDTQYGNILRL-----TDGS--------------LVVVDFEYAGYNYQAFDIANHFCE 257
           AHNDTQYGNILRL      DGS              LVV+DFEYA  N +  + ANHF E
Sbjct: 516 AHNDTQYGNILRLVPELPVDGSAPSPLLLPMNHHKQLVVIDFEYASANTRGLEFANHFTE 575

Query: 258 WTYDYRSSVPHKMNLDL--YPNEDQQIDFLRAYID--------AYSIPSDHTINNPSETH 307
           W Y+Y +  P     D   YP  ++Q  F+RAYI+        AYS P     + P+ + 
Sbjct: 576 WCYNYHAPPPMTWTCDTRNYPTIEEQKRFIRAYINHRPHFNLHAYSTPKFEGRDAPAGSI 635

Query: 308 DNYL-----------------------------------QKLKLEVYAFTLASHVMWGLW 332
             ++                                   +++  EV  + LA+   W  W
Sbjct: 636 KEFMLDSRTLASERDMPSSSTNLYAEEEARREEETEKQVEEMLREVRMWRLANSAQWVAW 695

Query: 333 GLVQSGQSQID 343
           G+VQ+   ++D
Sbjct: 696 GIVQAKVPELD 706



>gi|388514709|gb|AFK45416.1| unknown [Lotus japonicus]
          Length = 350

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 178/328 (54%), Gaps = 32/328 (9%)

Query: 32  SDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFL 90
           S +Q+  + GA+TN VF      +++  TKN   LR VL+R+YG+GV+   DR++E+   
Sbjct: 38  STLQVIPLKGAMTNEVF------QVNWPTKNGDDLRKVLVRLYGDGVEIFFDREEEIRTF 91

Query: 91  EMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPP 150
           E +S    GP+LLG F  GR E+ + + TL + DLRDP  S  IA ++ + H   N+  P
Sbjct: 92  ECVSEHGQGPRLLGRFTCGRVEEFIHARTLLAADLRDPDISALIASKMREFH---NLHMP 148

Query: 151 PQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNI 210
             E +  ++W  + KW   A +  S    T         F  + L +EI  L+ KLS   
Sbjct: 149 GAEKV--QIWERMRKWLGEAKSLCSPKDAT--------FFGLENLDEEINSLEKKLSEGY 198

Query: 211 DSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHK 269
              I F HND QYGNI+   +  SL ++D+EYA YN  A+D+ANHFCE   DY S  PH 
Sbjct: 199 QE-IGFCHNDLQYGNIMMDEETRSLTIIDYEYASYNPIAYDLANHFCEMVADYHSDTPHV 257

Query: 270 MNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMW 329
           ++   YP  +++  F+R Y+ +             + ++  + +L      +TLA+H+ W
Sbjct: 258 LDYSKYPGLEERQRFIRIYLSS----------QGKKPNNAKVIQLVNAAEKYTLANHLFW 307

Query: 330 GLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           GLWGL+ S  ++IDFDY  Y  +R  ++
Sbjct: 308 GLWGLISSYVNKIDFDYKEYARQRFQQY 335



>gi|475570304|gb|EMT15991.1| hypothetical protein F775_12153 [Aegilops tauschii]
          Length = 473

 Score =  190 bits (483), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 164/302 (54%), Gaps = 26/302 (8%)

Query: 67  RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLR 126
           RVL+R+YG GV+   DR  E+   E +S    GP+LLG F  GR E+ + + TL + DLR
Sbjct: 190 RVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPRLLGRFPQGRVEEFINARTLSAPDLR 249

Query: 127 DPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKG 186
           DP  S  IA++L + H +    P P++     +W  + +W    L    S   TEE R  
Sbjct: 250 DPEISGLIARKLREFHEL--DMPGPKD---ISLWQRLRRW----LEEARSRCSTEEAR-- 298

Query: 187 LEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYN 245
             E   + L DEI EL+  LS  +D  +VF HND QYGNI+   +   V ++D+EYA +N
Sbjct: 299 --ELRLETLGDEIAELENVLS-GVDQRVVFCHNDLQYGNIMIYEETRQVTLIDYEYASFN 355

Query: 246 YQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSE 305
             AFDIANHFCE   DY S  PH M+   YP+ D+Q  FL AY+ +          +   
Sbjct: 356 PVAFDIANHFCEMAADYHSDTPHVMDFTKYPDVDEQRRFLEAYLSS----------SGEN 405

Query: 306 THDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQ-IDFDYLSYGMERLHRFRELKNEV 364
           T D  ++ L   +  ++L SH+ WGLWG+V +  ++ IDF+Y  Y   R  ++ + K  +
Sbjct: 406 TSDVEVETLLGLIAKYSLTSHLFWGLWGIVSAHVNKNIDFEYKEYARHRFDQYWDTKPRI 465

Query: 365 YE 366
            +
Sbjct: 466 LQ 467



>gi|346323885|gb|EGX93483.1| choline kinase [Cordyceps militaris CM01]
          Length = 791

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 162/312 (51%), Gaps = 49/312 (15%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQ 79
           L GW    + +   I +ER+SGALTN V+ +T    + +    K P ++LLR+YG  V+ 
Sbjct: 307 LKGWRRVPLGDGHRIWVERLSGALTNAVYVVTPPADILEVEGKKMPPKILLRIYGPQVEH 366

Query: 80  LCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLS 139
           L DR+ EL  L+ L+  KIGP+LLG FKNGRFEQ+  + TL  +DLR+P T K IA+R+ 
Sbjct: 367 LIDRENELKVLQRLARKKIGPRLLGTFKNGRFEQYFNAITLCPSDLREPDTMKQIAKRMR 426

Query: 140 QLHNIINICPPPQENIKPEVWVNIDKWY--------------------PLALNAISSLK- 178
           +LH+ I +  P + +  P +W N D+W                     P A + + + K 
Sbjct: 427 ELHDGIELL-PSERDAGPGIWKNWDQWLDNVGRIVQFLDQDLHNVPEGPRAASVVHAWKA 485

Query: 179 ----CTEEQRKGLEE-FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD-- 231
               C     + L     F+   D      YK    +   +VFAH+DTQYGNILR+    
Sbjct: 486 NGYVCGAPWPQFLAAVIKFRAYLDSF----YKTPKALRESLVFAHSDTQYGNILRIRPDD 541

Query: 232 ------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLDLYPNE 278
                         L+V+DFEYA  N    + ANHF EWTY+Y   V  H  N++ YP  
Sbjct: 542 EKSPLLQAANKHKQLIVIDFEYAAANTPGLEFANHFTEWTYNYHDPVTSHACNVERYPTP 601

Query: 279 DQQIDFLRAYID 290
           ++Q  F++AYI+
Sbjct: 602 EEQHHFIKAYIN 613



>gi|255569147|ref|XP_002525542.1| choline/ethanolamine kinase, putative [Ricinus communis]
 gi|223535121|gb|EEF36801.1| choline/ethanolamine kinase, putative [Ricinus communis]
          Length = 332

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 116/332 (34%), Positives = 173/332 (52%), Gaps = 47/332 (14%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           DV + + +QI  + GA+TN VF I    K  + +      +VL+R+YG GV+   DR  E
Sbjct: 32  DVVDANALQIIPLKGAMTNEVFQIKWPTKTENGSH-----KVLVRIYGEGVEIFFDRDDE 86

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S  IA +L + H +  
Sbjct: 87  IKTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTLSACDLRDPDISALIAAKLKEFHGL-- 144

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
              P  +N+   +W+ +  W    LN   S+ C  E+ K    F    ++ EI  L+ +L
Sbjct: 145 -EMPGSKNVS--LWIRLRNW----LNTAKSM-CPPEEAKA---FHLDTIEVEISLLEKEL 193

Query: 207 SHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S   D  I F HND QYGNI+   +  ++ ++D+EY+ YN  AFDIANHFCE   DY S+
Sbjct: 194 SG--DQRIGFCHNDLQYGNIMIDEETKAITIIDYEYSSYNPIAFDIANHFCEMAADYHSN 251

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH M+   YP +                             D  +++L  +V  +TLAS
Sbjct: 252 TPHIMDYSKYPGD--------------------------RVSDIEVEQLLEDVEKYTLAS 285

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H+ WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 286 HLFWGLWGIISEHVNEIDFDYMEYARQRFEQY 317



>gi|225445456|ref|XP_002285099.1| PREDICTED: probable ethanolamine kinase A [Vitis vinifera]
          Length = 377

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 189/352 (53%), Gaps = 34/352 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W   ++S   +E +SG +TN +       K+  + +N     + +R+YG
Sbjct: 44  IIELCKDLFKKWSNLDDSQFSVETISGGITNLLL------KVSVKEENGNSTCMTVRLYG 97

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + +R++EL  +  LS    G KLLGVF NG  +  + + TL  +D++ P  +  I
Sbjct: 98  PNTEYVINRERELQAIGYLSAAGFGAKLLGVFGNGMVQSFINARTLTPSDMKMPKLAAEI 157

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W++I K++  A    S+LK  + E++K  +E  F+
Sbjct: 158 AKQLRKFHQVE--IPGSKE---PQLWIDIFKFFEKA----STLKFDDIEKQKKYKEISFE 208

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIA 252
            + +E+ ELK +L+  ++SP+VFAHND   GN++   D G L  +DFEY  Y+Y+ FDI 
Sbjct: 209 EVHNEVVELK-ELTDCLNSPVVFAHNDLLSGNLMLNDDEGKLYFIDFEYGSYSYRGFDIG 267

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+         +  +  LYP +++Q  F R Y+           + P+E  D  L+
Sbjct: 268 NHFNEY-------AGYDCDYSLYPTKNEQYHFFRHYL---------APDKPNEVSDKDLE 311

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   + + K + 
Sbjct: 312 TLYVEANTFMLASHLYWALWALIQAKMSPIDFDYLGYYFLRYEEYTKQKEKC 363



>gi|147821402|emb|CAN63497.1| hypothetical protein VITISV_011672 [Vitis vinifera]
          Length = 377

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 189/352 (53%), Gaps = 34/352 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W   ++S   +E +SG +TN +       K+  + +N     + +R+YG
Sbjct: 44  IIELCKDLFKKWSNLDDSQFSVETISGGITNLLL------KVSVKEENGNSTCMTVRLYG 97

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + +R++EL  +  LS    G KLLGVF NG  +  + + TL  +D++ P  +  I
Sbjct: 98  PNTEYVINRERELQAIGYLSAAGFGAKLLGVFGNGMVQSFINARTLTPSDMKMPKLAAEI 157

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W++I K++  A    S+LK  + E++K  +E  F+
Sbjct: 158 AKQLRKFHQVE--IPGSKE---PQLWIDIFKFFEKA----STLKFDDIEKQKKYKEISFE 208

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIA 252
            + +E+ ELK +L+  ++SP+VFAHND   GN++   D G L  +DFEY  Y+Y+ FDI 
Sbjct: 209 EVHNEVVELK-ELTDCLNSPVVFAHNDLLSGNLMLNDDEGKLYFIDFEYGSYSYRGFDIG 267

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+         +  +  LYP +++Q  F R Y+           + P+E  D  L+
Sbjct: 268 NHFNEY-------AGYDCDYSLYPTKNEQYHFFRHYL---------APDKPNEVSDKDLE 311

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   + + K + 
Sbjct: 312 TLYVEANTFMLASHLYWALWALIQAKMSPIDFDYLGYYFLRYEEYTKQKEKC 363



>gi|474069865|gb|EMS54304.1| Choline/ethanolamine kinase [Triticum urartu]
          Length = 374

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 188/364 (51%), Gaps = 35/364 (9%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           L+ D+   W +V++   +++  + GA+TN  +     +      K ++  +VL+R+YG+G
Sbjct: 26  LLHDLAAAWPNVADCRALEVVPLKGAMTNEGY-----QAGAGALKEREVRKVLVRIYGDG 80

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           VD   DR  EL   E +S    GP+LLG F NGR E+ + + TL + D+RDP  S  +A 
Sbjct: 81  VDLFFDRDDELRTFECMSRHGQGPRLLGRFPNGRIEEFIHARTLSAPDMRDPEISALVAT 140

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           +L + HN+    P P+  +   +W  +  W   A N      C  +Q     E     L+
Sbjct: 141 KLREFHNL--DMPGPKHVL---LWDRLKNWLKTAKNL-----CPTDQ---ANELRLDCLE 187

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS-LVVVDFEYAGYNYQAFDIANHF 255
           DEI  L+ + S +    I F HND QYGNI+   + + L ++D+EYA +N  A+DIANHF
Sbjct: 188 DEIASLEKEFSGDYHHWIGFCHNDLQYGNIMMDEETNMLTIIDYEYASFNPVAYDIANHF 247

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYI-------------DAYSIPSD--HTI 300
           CE T DY S  PH ++   YP+ D+Q  F++ Y+             D  +IP       
Sbjct: 248 CEMTADYHSEKPHILDYSKYPDIDEQRRFVKTYLSTSREYKTQLSWFDCPTIPFVLIQLC 307

Query: 301 NNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFREL 360
            +  E     ++ L   V  +TLASH++WGLWG++    + IDFDY  Y  +R  ++ + 
Sbjct: 308 WSGEEPEAEEVENLLRSVEKYTLASHLVWGLWGIISDRVNDIDFDYQEYARQRFEQYWQK 367

Query: 361 KNEV 364
           K  V
Sbjct: 368 KPAV 371



>gi|429855531|gb|ELA30481.1| choline kinase [Colletotrichum gloeosporioides Nara gc5]
          Length = 721

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 199/413 (48%), Gaps = 71/413 (17%)

Query: 11  LRNALIPLI-TDMLPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
            +N ++ L  T  + GW     D  N   + ++R+SGALTN V+ ++    L D    +K
Sbjct: 286 FKNEIVRLAHTLRIKGWRRVPLDCGNR--LSVQRLSGALTNAVYVVSPPTDLDDAASGRK 343

Query: 65  PL-RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSN 123
           P  ++LLR+YG  ++ L DR+ EL+ L  L+  KIGP+LLG F NGRFEQ+  S TL   
Sbjct: 344 PPPKLLLRIYG--LEHLIDRENELSVLRRLARKKIGPRLLGCFTNGRFEQYFNSITLTPK 401

Query: 124 DLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYP------LALNA---- 173
           DLR+P TS+ IA+R+ +LH+ I++    ++N    V+ N D W        LAL+     
Sbjct: 402 DLREPDTSRQIAKRMRELHDGIDVL-EKEKNEGAAVFKNWDTWLGNVEKKILALDEDVRR 460

Query: 174 ISSLKCTEEQRKGLEEFDFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYGNILRLT 230
            SS+   +    G+E   FK L +   EL    YK S  I   +VFAHNDTQYGNILR+ 
Sbjct: 461 GSSVFSGQGYVCGVEWAQFKALYERYRELVVKAYKGSQGIRERLVFAHNDTQYGNILRMR 520

Query: 231 D--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLY 275
                            L+V+DFEYA  N    + ANHF EW YDY   + P+  N   Y
Sbjct: 521 PDDEKSPLLQPANEHKQLIVIDFEYAAANVPGLEFANHFTEWAYDYHYEAAPYLCNTARY 580

Query: 276 PNEDQQIDFLRAYIDA---------------------------YSIPSDHTINNPSETHD 308
           P   +Q  FL+AY++                              +P  H         +
Sbjct: 581 PTIQEQRRFLKAYVEHRPQYPHGGXXXXPPPMALLSIVEFMLDARVPPGHWKEEERRADE 640

Query: 309 NYLQKLKLEVYAFTL---ASHVMWGLWGLVQS-GQSQIDFDYLSYGMERLHRF 357
              +++K       L    +   W  WG++Q+  ++  ++DYLSY  ER   F
Sbjct: 641 AIEEEVKELYEETRLWRGINSAQWVAWGIIQAKAEAGDEYDYLSYAQERAFFF 693



>gi|1438883|gb|AAC49376.1| GmCK3p, partial [Glycine max]
          Length = 497

 Score =  189 bits (481), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 119/345 (34%), Positives = 188/345 (54%), Gaps = 37/345 (10%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI---TRTKKLHDQTKNKKPLRVLLRVY 73
           ++  +   W DV + + +Q+  + GA+TN VF I   T T +L          +VL+R+Y
Sbjct: 129 ILKSLASKWEDVLDANALQVIPLKGAMTNEVFQIKWPTMTGELS--------RKVLVRMY 180

Query: 74  GNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKY 133
           G GVD   DR  E++  E +S    GP+LLG F NGR E+ + + TL ++DLR+PS S  
Sbjct: 181 GEGVDVFFDRDNEIHTFEFMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRNPSISAL 240

Query: 134 IAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFK 193
           IA ++ + H++      P E  K  +W  +  W    L+    L   +E    +E F   
Sbjct: 241 IAAKMKEFHDL----DMPGEK-KVHLWDRLRNW----LSEAKRLSSPKE----VEAFYLD 287

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            +  EI  L+ +LS +    I F HND QYGNI L     S+ ++D+EYA YN  AFDIA
Sbjct: 288 TIDKEISILEKELSGS-HQQIKFCHNDLQYGNIMLDEETNSVTIIDYEYASYNPVAFDIA 346

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHFCE   +Y +  PH ++ + YP+ +++  F++AY+         +   PS   D+ ++
Sbjct: 347 NHFCEMAANYHTEEPHILDYNKYPDFEERQRFVQAYLST-------SGEQPS---DSEVE 396

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           +L  E+  +TLA+H+ WG+WG++ +  + IDFDY  Y  +R   +
Sbjct: 397 QLLQEIEKYTLANHLFWGVWGIISAQVNTIDFDYKEYAKQRFQEY 441



>gi|475556926|gb|EMT12726.1| hypothetical protein F775_25923 [Aegilops tauschii]
          Length = 417

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 187/352 (53%), Gaps = 26/352 (7%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           L+ ++   W DV++   +++  + GA+TN V+ +       ++    +  +VL+RVYG G
Sbjct: 30  LLHELAAEWADVADCRALEVVPLKGAMTNEVYQVRWLTGGGEEKGEGEYRKVLMRVYGEG 89

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+   DR+ E+   E +S    GP+LLG F  GR E+ + + TL + DLRDP  +  IA 
Sbjct: 90  VEVFFDREDEVRTFECMSRHGPGPRLLGRFPTGRVEEFIHARTLSAVDLRDPEIAAIIAS 149

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           +L + H++    P P+  +   +W  +  W   A +      C  ++ K   EF    L+
Sbjct: 150 KLREFHHL--DMPGPKRVL---MWDRLRNWLKTAKSV-----CPSDEAK---EFRLDNLE 196

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHF 255
            EI  L+ + S   D  I F HND QYGNI+   +  +L ++D+EYA +N  AFDI+NHF
Sbjct: 197 KEINALESEFSGE-DQCIGFCHNDLQYGNIMIDEETKALTIIDYEYASFNPIAFDISNHF 255

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYS------IPSDHTINNPS----E 305
           CE   DY S  PH ++   YP+ D++  F++ Y+ +          S H +  PS    E
Sbjct: 256 CEMAADYHSEEPHILDYTKYPDLDERKRFVQTYLSSSDADFLELFVSHHCLIAPSVEGEE 315

Query: 306 THDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
                ++ L   +  +TLASH++WGLWG++    + IDFDY+ Y  +RL  +
Sbjct: 316 PDAEKIKDLMNNIEKYTLASHLVWGLWGIISEHVNDIDFDYMEYARQRLAAY 367



>gi|297261387|ref|XP_002808018.1| PREDICTED: LOW QUALITY PROTEIN: choline/ethanolamine kinase-like
           [Macaca mulatta]
          Length = 396

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/354 (35%), Positives = 183/354 (51%), Gaps = 38/354 (10%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N + FIT     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSN-LLFITTALPDHLPSVGEEPREVLLRLYGAILQGVDSLV 118

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 119 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 175

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 176 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 220

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 221 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 279

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP + QQ+ F+R Y+         T++   E     
Sbjct: 280 NHFCEWVYDYTHEEWPFYKARPTDYPTQGQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 335

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 336 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 389



>gi|478527781|ref|XP_004438072.1| PREDICTED: choline/ethanolamine kinase [Ceratotherium simum simum]
          Length = 395

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 181/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   +++++ VSG L+N +F        H  +   +P  VLLR+YG    GVD L 
Sbjct: 60  AWRRARPEELRVDPVSGGLSNLLFRCALPD--HLPSVGAEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTRELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDEI
Sbjct: 175 HGM------EMPFTKEPRWLFGTMERY----LKQIQDLPPTGLPQMNL--LEMYSLKDEI 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GNLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPKDADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP   QQ+ F+R Y+    +    TI+   E      + 
Sbjct: 282 CEWVYDYTHEEWPFYKAQAADYPTRGQQLHFIRHYLA--EVKKGETISR--EEQRKLEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEVNRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGQL 388



>gi|326524796|dbj|BAK04334.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 382

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 183/347 (52%), Gaps = 35/347 (10%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   I  VSG +TN +  ++  +    Q+       V +R+YG
Sbjct: 50  VIDLCKELVKGWSSLDSSCFSISTVSGGITNLLLKVSVKEGTDSQSS------VTVRLYG 103

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLGVF+NG     + + TL  +D+++P  +  I
Sbjct: 104 PNTDLVIDRERELQAIPYLSAAGFGARLLGVFENGVVSSFIHARTLTPSDMKEPRIAAEI 163

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W +I K+    L   S LK  + E++K  E   F+
Sbjct: 164 AKQLQKFHQV--DIPGSKE---PQLWNDIFKF----LKKASVLKFEDNEKQKRYETISFR 214

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  LS  + +P+VFAHND   GN+ L   +  L  +DFEY  Y+Y+ +DIA
Sbjct: 215 EIQDEVKELK-DLSDLLHAPVVFAHNDLLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIA 273

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+           + PSE  +  L 
Sbjct: 274 NHFNEY-------AGFDCDYNLYPDKDAQYHFFRNYLS----------DRPSEVQEQNLD 316

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE 359
            L  E   F LASHV W LW L+Q+  S IDFDYL Y   R   +++
Sbjct: 317 ALYTETNTFRLASHVYWALWALIQARVSPIDFDYLGYFFLRYGEYKK 363



>gi|357456273|ref|XP_003598417.1| Choline/ethanolamine kinase [Medicago truncatula]
 gi|355487465|gb|AES68668.1| Choline/ethanolamine kinase [Medicago truncatula]
          Length = 500

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 113/332 (34%), Positives = 177/332 (53%), Gaps = 30/332 (9%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           DV + + +Q+  + GA+TN VF I       + ++     +VL+R+YG GV+   DR  E
Sbjct: 142 DVLDANALQVIPLKGAMTNEVFEIKWPATTEETSR-----KVLVRIYGEGVEIFFDRDDE 196

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +   E +S    GP+LLG F NGR E+ + + TL ++DLRDPS S  IA ++ + H++  
Sbjct: 197 IRTFEYMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRDPSISALIAAKMKEFHDL-- 254

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
               P E  K  +W  +  W    L+    L   +E    +E F    +  EI  L+ +L
Sbjct: 255 --DMPGEK-KANLWPTLRNW----LSEAKRLSSPKE----VEAFYLDTVDKEISILEKEL 303

Query: 207 SHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S +    I F HND QYGNI L     S+ ++D+EYA +N  A+DIANHFCE   +Y + 
Sbjct: 304 SGS-HQRIGFCHNDLQYGNIMLDEETNSVTIIDYEYASHNPVAYDIANHFCEMAANYHTE 362

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++   YP+ +++  F++AY+               E  D+ ++ L  EV  +TLA+
Sbjct: 363 TPHILDYSKYPDVEERERFVKAYLRTSG----------EEPSDSEVEHLLQEVEKYTLAN 412

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H+ WGLWG++    + I+FDY  Y  +R   +
Sbjct: 413 HLFWGLWGIISGQVNTIEFDYKEYAKQRFQEY 444



>gi|502127679|ref|XP_004499796.1| PREDICTED: choline/ethanolamine kinase-like [Cicer arietinum]
          Length = 659

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 183/342 (53%), Gaps = 31/342 (9%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  M   W DV + S +Q+  + GA+TN VF I         T  +   +VL+R+YG G
Sbjct: 291 ILISMAGKWEDVLDASALQVIPLKGAMTNEVFQIKWPA-----TTGENSRKVLVRIYGEG 345

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           VD   DR  E+   E +S    GP+LLG F NGR E+ + + TL ++DLRDPS S  IA 
Sbjct: 346 VDIFFDRDDEIRTFEYMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRDPSISALIAA 405

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H   ++  P ++ +   +W  +  W    L+    L   +E    +E F    + 
Sbjct: 406 KMKEFH---DLAMPGEKKVN--LWRTLRTW----LSEAKRLSSPKE----VEAFYLDTVD 452

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
            EI  L+ +LS      I F HND QYGNI L     S+ ++D+EYA YN  A+DIANHF
Sbjct: 453 KEISILEKELS-GAHQRIGFCHNDLQYGNIMLDEETNSVTIIDYEYASYNPVAYDIANHF 511

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           CE   +Y + +PH ++ + YP+  ++  F+RAY+  +S     +++         ++ L 
Sbjct: 512 CEMAANYHTKMPHILDYNKYPDFQERELFIRAYL--WSSGEQPSVSE--------VEHLL 561

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            EV  +TLA+H+ WGLWG++    + I+FDY  Y  +R   +
Sbjct: 562 QEVEKYTLANHLFWGLWGIISGQVNTIEFDYKEYAKQRFQEY 603



>gi|224066603|ref|XP_002302158.1| predicted protein [Populus trichocarpa]
 gi|222843884|gb|EEE81431.1| predicted protein [Populus trichocarpa]
          Length = 360

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 30/338 (8%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   +Q+  + GA+TN VF I    K  +  +N     +L+R+YG GV+   +R  E+
Sbjct: 32  VDDMEALQVVPLKGAMTNEVFRIIWPTKCGNLNRN-----ILVRIYGEGVEAFFNRDNEI 86

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LLG F +GR E+ + + TL + DLRD   S  +A ++ + H++   
Sbjct: 87  RTFECMSKHGQGPRLLGRFADGRVEEFIHARTLSAADLRDHEISALVAAKMREFHDL--E 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P P+  +   +W  +  W   A +  S+        K ++EF    L++EI  L+ +LS
Sbjct: 145 MPGPRTIL---LWNRMRGWLVQAKSMCSA--------KDVKEFCLDSLENEINMLEKELS 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
           H+    I F HND QYGNI+   +  S+ ++D+EYA +N  A+DIANHFCE   +Y S+ 
Sbjct: 194 HDY-LDIGFCHNDLQYGNIMLDEETRSITLIDYEYASFNPVAYDIANHFCEMVANYHSAT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++   YP  +++  F++AY+ +           PSE     L +   EV  +TLASH
Sbjct: 253 PHILDYSKYPELEERHRFVQAYLCSAG-------KQPSEDEAELLLQ---EVEKYTLASH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           V WGLWG++    ++I+FDY+ Y  +R  ++   K E+
Sbjct: 303 VFWGLWGIISGYVNKIEFDYMEYARQRFQQYWMRKQEL 340



>gi|326507218|dbj|BAJ95686.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 382

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 183/347 (52%), Gaps = 35/347 (10%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   I  VSG +TN +  ++  +    Q+       V +R+YG
Sbjct: 50  VIDLCKELVKGWSSLDSSCFSISTVSGGITNLLLKVSVKEGTDSQSS------VTVRLYG 103

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLGVF+NG     + + TL  +D+++P  +  I
Sbjct: 104 PNTDLVIDRERELQAIPYLSAAGFGARLLGVFENGVVSSFIHARTLTPSDMKEPRIAAEI 163

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W +I K+    L   S LK  + E++K  E   F+
Sbjct: 164 AKQLQKFHQV--DIPGSKE---PQLWNDIFKF----LKKASVLKFEDNEKQKRYETISFR 214

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  LS  + +P+VFAHND   GN+ L   +  L  +DFEY  Y+Y+ +DIA
Sbjct: 215 EIQDEVKELK-DLSDLLHAPVVFAHNDLLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIA 273

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+           + PSE  +  L 
Sbjct: 274 NHFNEY-------AGFDCDYNLYPDKDAQYHFFRNYLS----------DRPSEVQEQNLD 316

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE 359
            L  E   F LASHV W LW L+Q+  S IDFDYL Y   R   +++
Sbjct: 317 ALYTETNTFRLASHVYWALWALIQARVSPIDFDYLGYFFLRYGEYKK 363



>gi|482556509|gb|EOA20701.1| hypothetical protein CARUB_v10001015mg, partial [Capsella rubella]
          Length = 429

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/331 (33%), Positives = 177/331 (53%), Gaps = 28/331 (8%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   ++++ + GA+TN VF ++  +K      N +  ++L+RVYG GVD   +R  E+
Sbjct: 112 VEDLESLEVKPMKGAMTNEVFMVSWPRK----ETNLRCRKLLVRVYGEGVDVFFNRDDEI 167

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E ++    GP LLG F  GR E+ + + TL   DLRDP+ S  +A +L + H   +I
Sbjct: 168 RTFEFVARHGHGPTLLGRFPGGRVEEFIHARTLSKTDLRDPNISALVASKLRRFH---SI 224

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
             P   N+   +W  +  W   A N      C++E    L EF    ++DEI  L+ ++ 
Sbjct: 225 HIPGDRNVL--IWDRMRTWVGQAKNL-----CSDEH---LTEFGLDNVEDEINLLEQEV- 273

Query: 208 HNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
            N +  I F HND QYGNI+   D  ++ ++D+EYA YN  A+DIANHFCE   DY S  
Sbjct: 274 -NNEQQIGFCHNDLQYGNIMIDEDTNAITIIDYEYASYNPIAYDIANHFCEMVADYHSDT 332

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++  LYP E+++  F+  Y+ +     +       +  D        +   +TLASH
Sbjct: 333 PHILDYTLYPGEEERRRFICNYLSSSGEEQEPKEEEIEQLLD--------DTEKYTLASH 384

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWG++    ++I+FDY+ Y  +R  ++
Sbjct: 385 LFWGLWGIISGYVNKIEFDYIEYSRQRFKQY 415



>gi|357132810|ref|XP_003568021.1| PREDICTED: choline/ethanolamine kinase-like [Brachypodium
           distachyon]
          Length = 369

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 182/346 (52%), Gaps = 30/346 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERVSGALTNCVFFI----TRTKKLHDQTKNKKPLRVLLRV 72
           L+ ++   W DV++   +++  + GA+TN V+ +              +  +  +VLLRV
Sbjct: 34  LLHELAAEWADVADCRALEVAPLKGAMTNEVYQVRWLAAGAGAGAAGEEGGEYRKVLLRV 93

Query: 73  YGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSK 132
           YG GV+   DR+ E+   E +S    GP+LLG F  GR E+ + + TL + DLRDP  S 
Sbjct: 94  YGEGVEVFFDREDEVRTFECMSRHGHGPRLLGRFPTGRVEEFIHARTLSAVDLRDPEISS 153

Query: 133 YIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDF 192
            IA +L + HN+    P P+  +   +W  +  W   A +      C  ++ K   EF  
Sbjct: 154 IIASKLREFHNL--DMPGPKSTL---LWDRLRNWLKTAKSV-----CPSDEAK---EFCL 200

Query: 193 KMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDI 251
             +++EI  L+   S   D  I F HND QYGNI+   +  +L ++D+EYA +N  A+DI
Sbjct: 201 DSMEEEITALENLFSGE-DHRIGFCHNDLQYGNIMIDEETKALTIIDYEYASFNPVAYDI 259

Query: 252 ANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYL 311
           ANHFCE   DY S  PH ++   YP+ D+Q  F++ Y+++       +   P     N L
Sbjct: 260 ANHFCEMAADYHSEKPHILDYTKYPDIDEQKRFVQTYLNS-------SGEEPDAEKVNDL 312

Query: 312 QKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            K    V   TLASH++WGLWG++    + IDFDY+ Y  +R  +F
Sbjct: 313 MKC---VEKHTLASHLIWGLWGIISEHVNDIDFDYMEYARQRFTQF 355



>gi|15234032|ref|NP_192714.1| choline synthase [Arabidopsis thaliana]
 gi|30681187|ref|NP_849350.1| choline synthase [Arabidopsis thaliana]
 gi|4538906|emb|CAB39643.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana]
 gi|7267671|emb|CAB78099.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana]
 gi|332657392|gb|AEE82792.1| protein kinase family protein [Arabidopsis thaliana]
 gi|332657393|gb|AEE82793.1| protein kinase family protein [Arabidopsis thaliana]
          Length = 346

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 182/331 (54%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   ++++ + GA+TN VF ++  +K      N +  ++L+RVYG GV+   +R  E+
Sbjct: 32  VEDFESLEVKPMKGAMTNEVFMVSWPRK----ETNLRCRKLLVRVYGEGVELFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E ++    GP LLG F  GR E+ + + TL + DLRDP+ S  +A +L + H+I   
Sbjct: 88  RTFEYVARHGHGPTLLGRFAGGRVEEFIHARTLSATDLRDPNISALVASKLRRFHSI--- 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
              P + I   +W  +  W   A N  S+   T        EF    ++DEI  L+ ++ 
Sbjct: 145 -HIPGDRIML-IWDRMRTWVGQAKNLCSNEHST--------EFGLDDIEDEINLLEQEV- 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
            N +  I F HND QYGNI+   +  ++ ++D+EYA YN  A+DIANHFCE   DY S+ 
Sbjct: 194 -NNEQEIGFCHNDLQYGNIMIDEETNAITIIDYEYASYNPIAYDIANHFCEMAADYHSNT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++  LYP E+++  F+  Y+ +          +  E  +  +++L  ++  +TLASH
Sbjct: 253 PHILDYTLYPGEEERRRFICNYLTS----------SGEEAREEDIEQLLDDIEKYTLASH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWG++    ++I+FDY+ Y  +R  ++
Sbjct: 303 LFWGLWGIISGYVNKIEFDYIEYSRQRFKQY 333



>gi|255566742|ref|XP_002524355.1| choline/ethanolamine kinase, putative [Ricinus communis]
 gi|223536446|gb|EEF38095.1| choline/ethanolamine kinase, putative [Ricinus communis]
          Length = 356

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 110/338 (32%), Positives = 181/338 (53%), Gaps = 30/338 (8%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   +Q+  + GA+TN VF I    +  D  +     ++L+R+YG GV+    R  E+
Sbjct: 32  VDDMEALQVMPLKGAMTNEVFQINWPTRSGDVIR-----KLLIRIYGKGVEVFFKRDDEI 86

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LLG F +GR E+ + + TL + DLRDP  S  +A ++ + H++   
Sbjct: 87  RTFECMSKHGQGPRLLGRFADGRVEEFIHARTLSAADLRDPEISALVAAKMREFHDL--D 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P P+  +   +W  +  W   A +  S+        K  ++F    L DEI  L+ +LS
Sbjct: 145 MPGPRNVL---LWSRMRNWLTKAKHLCSA--------KDAKKFHLDCLGDEINMLEKQLS 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
             +   I F HND QYGNI+   +  S+ ++D+EYA YN  A+DIANHFCE   +Y S  
Sbjct: 194 QEVQD-IGFCHNDLQYGNIMMDEETRSITIIDYEYASYNPIAYDIANHFCEMAANYHSET 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++   YP  +++  F+  Y+++           PSE   + +++L  +   +TLA+H
Sbjct: 253 PHVLDYSKYPGLEERRRFVHVYLNSGG-------KKPSE---DKVERLTDDAEKYTLANH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           + WGLWG++    +++DFDY+ Y  +R  ++   K EV
Sbjct: 303 LFWGLWGIISGYVNKLDFDYMEYARQRFEQYWVRKAEV 340



>gi|460399299|ref|XP_004245179.1| PREDICTED: probable ethanolamine kinase A-like [Solanum
           lycopersicum]
          Length = 372

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 193/357 (54%), Gaps = 36/357 (10%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           L+  ++ L  D+   W   + S   +E VSG +TN +       K+  +  + K   + +
Sbjct: 31  LKPKIVELCKDLFNQWSNLDGSHFSVETVSGGITNLLL------KVSVREDDGKHENMTV 84

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG   + + +R++E+  ++ LS    G KLL VF NG  +  +++ TL   D+ +P  
Sbjct: 85  RLYGPNTEYVINREREMQAIQHLSAAGFGAKLLAVFGNGMVQSFIDARTLTPPDMSNPKL 144

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK-GLEE 189
           +  IA++L + H +    P  +E   P+VW ++ K+Y  A    S+L+  + ++K   E 
Sbjct: 145 AAEIAKQLRKFHQVE--IPGSKE---PQVWNDVLKFYKNA----STLQFDDGEKKIKYET 195

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQA 248
             F  + +EI ELK +L+  +++P+VFAHND   GN+ L      L  +DFEY  YNY+ 
Sbjct: 196 ILFPEVHNEIIELK-ELTDRLNAPVVFAHNDLLSGNLMLNEEKEKLYFIDFEYGSYNYRG 254

Query: 249 FDIANHFCEWT-YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETH 307
           FDI NHF E+  YD         +  LYPN+DQQ  F R Y+D+         + P++  
Sbjct: 255 FDIGNHFNEYAGYD--------CDYSLYPNKDQQFHFFRHYLDS---------DQPNKVS 297

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           D  L+ L +E  ++ LASH+ W LW L+Q+  S IDFDY+SY   R + +++ K +V
Sbjct: 298 DKDLEALYVETSSYMLASHLYWALWALIQAKMSPIDFDYISYFFLRYNEYKKQKEKV 354



>gi|380494560|emb|CCF33061.1| choline/ethanolamine kinase [Colletotrichum higginsianum]
          Length = 775

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 173/315 (54%), Gaps = 36/315 (11%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
            T +N ++ L  T  + GW    + + + + ++R+SGALTN V+ ++  + L ++T  KK
Sbjct: 281 ATFKNEIVRLTHTLKIKGWRRVPLESGNSVIVKRLSGALTNAVYVVSPPENLDEKTTGKK 340

Query: 65  PL-RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSN 123
           P  ++LLR+YG  ++ L DR+ EL+ L  L+  +IGP+LLG F NGRFE++  S TL  +
Sbjct: 341 PPPKLLLRIYG--LEHLIDRENELSVLRRLARKRIGPRLLGCFTNGRFEEYFNSITLTPS 398

Query: 124 DLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQ 183
           DLR+P TSK IA+R+ +LH  I++    +++  P V  N D W       I++L     +
Sbjct: 399 DLREPETSKQIAKRMRELHVGIDVL-EREKDEGPAVLKNWDSWLRNVEKKIAALDDGVRR 457

Query: 184 RK----------GLEEFDFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYGNILRLT 230
                       GLE   FK L D+  EL    YK    I   ++FAHNDTQYGNILR+ 
Sbjct: 458 GNSVFRGHGYVCGLEWHRFKELYDKHRELVLSAYKGHQGIRERLIFAHNDTQYGNILRMR 517

Query: 231 --------------DGSLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSVPHKMNLDLY 275
                            LVV+DFEYA  N    + ANHF EW YDY   ++P + N   Y
Sbjct: 518 PDDEKSPLLQPANEHKQLVVIDFEYAAANVPGHEFANHFTEWAYDYHHETLPFRCNTACY 577

Query: 276 PNEDQQIDFLRAYID 290
           P   +Q  FL+AY++
Sbjct: 578 PTIQEQRRFLKAYVE 592



>gi|482570262|gb|EOA34450.1| hypothetical protein CARUB_v10021986mg [Capsella rubella]
          Length = 348

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/343 (32%), Positives = 191/343 (55%), Gaps = 30/343 (8%)

Query: 18  LITDMLPGWD--VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGN 75
           ++T +   W   V +   +++  + GA+TN V+ I        +  ++K   VL+R+YG+
Sbjct: 22  VLTTLGSSWGDVVEDLERLEVVPLKGAMTNEVYQINWPTLNGAEDVHRK---VLVRIYGD 78

Query: 76  GVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIA 135
           GVD   +R  E+   E +S+   GPKLLG F +GR E+ + + TL ++DLR   TS +IA
Sbjct: 79  GVDLFFNRDDEIKTFECMSHHGYGPKLLGRFSDGRLEEFIHARTLSADDLRIAETSDFIA 138

Query: 136 QRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKML 195
            +L + H +    P P+  I   +W  +  W   A N  S ++        ++EF  + L
Sbjct: 139 AKLREFHML--DMPGPKNII---LWERLRTWLKEAKNLASPIE--------MDEFRLEAL 185

Query: 196 KDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANH 254
           + EI  L+ +L+ + D  I F HND QYGNI+   +  ++ ++D+EY+ +N  A+DIANH
Sbjct: 186 EGEISLLEERLTMD-DQEIGFCHNDLQYGNIMIDEETTAITIIDYEYSSFNPIAYDIANH 244

Query: 255 FCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKL 314
           FCE   +Y S  PH ++  LYP E+++  F+  Y+ +       T N  SE     +++L
Sbjct: 245 FCEMAANYHSDTPHVLDYTLYPGEEERRRFISTYLGS-------TGNVISEEQ---VERL 294

Query: 315 KLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
             +  ++TLA+H+ WGLWG++    ++I+FDY+ Y  +R  ++
Sbjct: 295 LNDAESYTLANHIFWGLWGIISGHVNKIEFDYMEYARQRFEQY 337



>gi|297813407|ref|XP_002874587.1| hypothetical protein ARALYDRAFT_911244 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297320424|gb|EFH50846.1| hypothetical protein ARALYDRAFT_911244 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 342

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 184/343 (53%), Gaps = 34/343 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   ++++ + GA+TN VF ++  +K      N +  ++L+RVYG GV+   +R  E+
Sbjct: 32  VEDFESLEVKPMKGAMTNEVFMVSWPRK----ETNLRCRKLLVRVYGEGVELFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E ++    GP LLG F  GR E+ + + TL + DLRDP+ S  +A +L + H   +I
Sbjct: 88  RTFEYVARHGHGPTLLGRFAGGRVEEFIHARTLSATDLRDPNVSALVASKLKRFH---SI 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
             P   N+   +W  +  W   A N      C+ E      EF    ++DEI  L+ ++ 
Sbjct: 145 HIPGDRNVL--IWDRMRTWIGQAKNL-----CSNEHSA---EFGLDDIEDEINMLEQEV- 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
            N +  I F HND QYGNI+   D  ++ ++D+EYA YN  A+DIANHFCE   DY S+ 
Sbjct: 194 -NNEQEIGFCHNDLQYGNIMIDEDTNAITIIDYEYASYNPIAYDIANHFCEMAADYHSNT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++  LYP E+++  F+  Y+              + + +  +++   ++  +TLASH
Sbjct: 253 PHILDYTLYPGEEERRRFICNYL--------------TSSGEEDIEQFLDDIEKYTLASH 298

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVYERLP 369
           + WGLWG++    ++I+FDY+ Y  +R  ++   K +V    P
Sbjct: 299 LFWGLWGIISGYVNKIEFDYIEYSRQRFKQYWIRKPQVLSFYP 341



>gi|15217543|ref|NP_177315.1| choline kinase 1 [Arabidopsis thaliana]
 gi|7239497|gb|AAF43223.1|AC012654_7 Strong similarity to the putative choline kinase F26A9.3 gi|6682607
           from Arabidopsis thaliana on BAC gb|AC016163. EST
           gb|F19946 comes from this gene [Arabidopsis thaliana]
 gi|30725296|gb|AAP37670.1| At1g71697 [Arabidopsis thaliana]
 gi|110739418|dbj|BAF01619.1| choline kinase like protein [Arabidopsis thaliana]
 gi|110741310|dbj|BAF02205.1| choline kinase like protein [Arabidopsis thaliana]
 gi|332197099|gb|AEE35220.1| choline kinase 1 [Arabidopsis thaliana]
          Length = 346

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/326 (32%), Positives = 186/326 (57%), Gaps = 31/326 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           +++  + GA+TN V+ I     L+ +  ++K   VL+R+YG+GVD   +R  E+   E +
Sbjct: 40  LEVVPLKGAMTNEVYQIN-WPTLNGEDVHRK---VLVRIYGDGVDLFFNRGDEIKTFECM 95

Query: 94  SNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQE 153
           S+   GPKLLG F +GR E+ + + TL ++DLR   TS +IA +L + H +    P P+ 
Sbjct: 96  SHHGYGPKLLGRFSDGRLEEFIHARTLSADDLRVAETSDFIAAKLREFHKL--DMPGPKN 153

Query: 154 NIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
            +   +W  +  W   A N  S ++  + + +GLE        +EI  L+ +L+ + D  
Sbjct: 154 VL---LWERLRTWLKEAKNLASPIEMDKYRLEGLE--------NEINLLEERLTRD-DQE 201

Query: 214 IVFAHNDTQYGNIL--RLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMN 271
           I F HND QYGN++   +T+ ++ ++D+EY+ +N  A+DIANHFCE   +Y S  PH ++
Sbjct: 202 IGFCHNDLQYGNVMIDEVTN-AITIIDYEYSSFNPIAYDIANHFCEMAANYHSDTPHVLD 260

Query: 272 LDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGL 331
             LYP E ++  F+  Y+ +            + T D  +++L  +  ++TLA+H+ WGL
Sbjct: 261 YTLYPGEGERRRFISTYLGS----------TGNATSDKEVERLLKDAESYTLANHIFWGL 310

Query: 332 WGLVQSGQSQIDFDYLSYGMERLHRF 357
           WG++    ++I+FDY+ Y  +R  ++
Sbjct: 311 WGIISGHVNKIEFDYMEYARQRFEQY 336



>gi|512197570|gb|EPE26405.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868]
          Length = 880

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 173/322 (53%), Gaps = 55/322 (17%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFF------ITRTKKLHDQTK---NKKPLRVLL 70
           L GW    +    +I++ER+SGALTN V+       I++ + + + +K   +K P ++LL
Sbjct: 320 LKGWRKVALERGGEIEVERLSGALTNAVYVVSPPPGISQPQNIENGSKAHSSKPPPKLLL 379

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG  V+ L DR+ EL  L+ LS  +IGP++LG F+NGRFE++  + TLK  DLR   T
Sbjct: 380 RIYGPQVEHLIDRENELEILKRLSRKRIGPRMLGTFRNGRFEEYFNATTLKFEDLRVKDT 439

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKC-TEEQRKGLEE 189
           SK IA+R+ +LH  I++    +E   P VW N DKW       I+ L      QRKG E 
Sbjct: 440 SKQIAKRMRELHEGIDLLEREREE-GPFVWRNWDKWVDRCEEVITYLDSEILSQRKGKEA 498

Query: 190 F---------DFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYGNILRL----- 229
           +          +K+ K  +++ +      YK    +++ +VFAHNDTQYGNILRL     
Sbjct: 499 WRERGLICGVGWKVFKAAVDKYRKWLDEYYKKKGGVENRLVFAHNDTQYGNILRLIPPPA 558

Query: 230 ----TDGS----------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPH 268
               +DGS                L+V+DFEYA  N    + ANHF EW Y+Y     P 
Sbjct: 559 PTPTSDGSYPPPSPLLLPANHHKQLIVIDFEYASANTPGLEFANHFTEWCYNYHDPKRPW 618

Query: 269 KMNLDLYPNEDQQIDFLRAYID 290
                 YP  +QQ DF+R+Y++
Sbjct: 619 ACETSRYPTLEQQRDFIRSYVN 640



>gi|488561028|ref|XP_004470401.1| PREDICTED: choline/ethanolamine kinase isoform 4 [Dasypus
           novemcinctus]
          Length = 395

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 184/352 (52%), Gaps = 35/352 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W +    ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRLVRPEELRVNPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S TLK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRTLKTRELREPVFSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  +   +  L   +   LK+E+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPSGLPQVNL--LEMYSLKEEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GNLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPGSADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  DQQ+ F+R Y+             PS+     L++
Sbjct: 282 CEWVYDYTHEEWPFYKAQPADYPTRDQQLHFIRHYLAEVK-----KGETPSQEEQRKLEE 336

Query: 314 -LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E+  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 337 DLMVEISRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGQL 388



>gi|504155672|ref|XP_004589749.1| PREDICTED: choline/ethanolamine kinase [Ochotona princeps]
          Length = 397

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 182/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   +++++ VSG L+N +F  +     H  +   +P  VLLRVYG    GVD L 
Sbjct: 62  AWRRALPGELRVQPVSGGLSNLLFRCSLPD--HLPSVGDEPREVLLRVYGAILQGVDSLV 119

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LRDP  S  IA +++Q 
Sbjct: 120 ---LESVMFAILAERALGPQLYGVFPEGRLEQYIPSRPLKTQELRDPVLSAAIATKMAQF 176

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDE+
Sbjct: 177 HGM------EMPFTKEPHWLFGTMERY----LKQIQELPNTGLPQPHL--LETYRLKDEM 224

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
            +L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 225 SQLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPRSVDSLMLVDFEYSSYNYRGFDIGNHF 283

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P ++     YP   QQ+ F+R Y+    +    T+  P        + 
Sbjct: 284 CEWVYDYTHEEWPFYRAQPADYPTRGQQLHFIRHYLA--EVQKGETL--PKAEQSKLEED 339

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +EV  + LASH  WGLW  +Q+  S I+F YL Y   R   + + K+++
Sbjct: 340 LLIEVNRYALASHFFWGLWSTLQASMSTIEFGYLEYAQSRFQFYFQQKSQL 390



>gi|361129117|gb|EHL01035.1| putative Choline kinase [Glarea lozoyensis 74030]
          Length = 742

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 173/322 (53%), Gaps = 55/322 (17%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFF------ITRTKKLHDQTK---NKKPLRVLL 70
           L GW    +    +I++ER+SGALTN V+       I++ + + + +K   +K P ++LL
Sbjct: 220 LKGWRKVALERGGEIEVERLSGALTNAVYVVSPPPGISQPQNIENGSKAHSSKPPPKLLL 279

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG  V+ L DR+ EL  L+ LS  +IGP++LG F+NGRFE++  + TLK  DLR   T
Sbjct: 280 RIYGPQVEHLIDRENELEILKRLSRKRIGPRMLGTFRNGRFEEYFNATTLKFEDLRVKDT 339

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKC-TEEQRKGLEE 189
           SK IA+R+ +LH  I++    +E   P VW N DKW       I+ L      QRKG E 
Sbjct: 340 SKQIAKRMRELHEGIDLLEREREE-GPFVWRNWDKWVDRCEEVITYLDSEILSQRKGKEA 398

Query: 190 F---------DFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYGNILRL----- 229
           +          +K+ K  +++ +      YK    +++ +VFAHNDTQYGNILRL     
Sbjct: 399 WRERGLICGVGWKVFKAAVDKYRKWLDEYYKKKGGVENRLVFAHNDTQYGNILRLIPPPA 458

Query: 230 ----TDGS----------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPH 268
               +DGS                L+V+DFEYA  N    + ANHF EW Y+Y     P 
Sbjct: 459 PTPTSDGSYPPPSPLLLPANHHKQLIVIDFEYASANTPGLEFANHFTEWCYNYHDPKRPW 518

Query: 269 KMNLDLYPNEDQQIDFLRAYID 290
                 YP  +QQ DF+R+Y++
Sbjct: 519 ACETSRYPTLEQQRDFIRSYVN 540



>gi|125569295|gb|EAZ10810.1| hypothetical protein OsJ_00644 [Oryza sativa Japonica Group]
          Length = 307

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 179/326 (54%), Gaps = 29/326 (8%)

Query: 43  LTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPK 101
           +TN VF IT       + + +   R VL+R+YG GV+   DR  E+   E +S    GP+
Sbjct: 1   MTNEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPR 60

Query: 102 LLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWV 161
           LLG F NGR E+ + + TL + DLRD   S  IA++L + H++    P P+ N+   +W 
Sbjct: 61  LLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREFHDL--DMPGPK-NVS--LWQ 115

Query: 162 NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDT 221
            + +W   A       +C+ E+ +   +F  + L DEI  L   LS  +D  + F HND 
Sbjct: 116 RLRRWLEEARG-----RCSPEEAR---QFSLEKLGDEIAMLDIALS-GVDQRVGFCHNDL 166

Query: 222 QYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQ 280
           QYGNI+   +   V ++D+EYA +N  AFDIANHFCE + DY S+ PH ++   YP  D+
Sbjct: 167 QYGNIMIYEETRQVTLIDYEYASFNPVAFDIANHFCEMSADYHSATPHVLDFTKYPGIDE 226

Query: 281 QIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQ- 339
           Q  F++ Y+ +       +  NPS+    +L  L   +  ++LASH+ WGLWG++ SG  
Sbjct: 227 QRRFVQTYLSS-------SGENPSDAEVEHLLGL---IAKYSLASHIFWGLWGII-SGHV 275

Query: 340 -SQIDFDYLSYGMERLHRFRELKNEV 364
              IDF+Y  Y  +R  ++ + K++ 
Sbjct: 276 NKNIDFEYQEYARQRFDQYWKTKDQT 301



>gi|242044794|ref|XP_002460268.1| hypothetical protein SORBIDRAFT_02g025680 [Sorghum bicolor]
 gi|241923645|gb|EER96789.1| hypothetical protein SORBIDRAFT_02g025680 [Sorghum bicolor]
          Length = 391

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 188/353 (53%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L   ++ GW   + S   IE VSG +TN +  ++  +   +++       V +R+YG
Sbjct: 58  IIYLCKQLVIGWCKIDSSRFSIETVSGGITNLLLKVSVKEDDGNESA------VTVRLYG 111

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F NG  +  + + TL   D+RDP  +  I
Sbjct: 112 PNTDLVIDRKRELKAIPYLSAAGFGAQLLGIFGNGVVQSFIYARTLSPADMRDPKIAAEI 171

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H  ++I    Q    P++W +I K+    L   ++LK  + EQ+K  E+  F+
Sbjct: 172 AKELHKFHQ-VDIPGSKQ----PQLWNDIFKF----LKKAAALKFEDNEQQKRYEKISFR 222

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 223 EIQDEVQELK-DLLDTMHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 281

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q +F R Y+           + PSE     ++
Sbjct: 282 NHFNEYA-------GLDCDYNLYPDKDAQYNFFRNYLRP---------DRPSEAQAQDME 325

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ +   +
Sbjct: 326 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQREPCF 378



>gi|195620822|gb|ACG32241.1| choline/ethanolamine kinase [Zea mays]
          Length = 393

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 188/353 (53%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG
Sbjct: 60  IIALCKELVEGWSSIDSSLFSIETVSGGITNLLL------KVSVKEDNGNESSVTVRLYG 113

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  I
Sbjct: 114 PNTDLVIDRKRELQAIPYLSAAGFGARLLGIFENGVVQSFIYARTLSPADMKEPKIAAEI 173

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEE-QRKGLEEFDFK 193
           A+ L + H +    P  +E   P++W +I K+    L   ++LK  +  ++K  E+  F+
Sbjct: 174 AKELRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNMKQKRYEKISFR 224

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 225 EIQDEVQELK-DLLDILRAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 283

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+        HT + PSE     ++
Sbjct: 284 NHFNEYA-------GFDCDYNLYPDKDAQYHFFRNYL--------HT-DRPSEVDAQDME 327

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ +   +
Sbjct: 328 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRESCF 380



>gi|462396019|gb|EMJ01818.1| hypothetical protein PRUPE_ppa008037mg [Prunus persica]
          Length = 348

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 178/326 (54%), Gaps = 32/326 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           +Q+  + GA+TN V+ I+   +  D ++N     VL+RVYG GV+   +R  E+   E +
Sbjct: 38  LQVIPLKGAMTNEVYQISWPTRDGDFSRN-----VLVRVYGEGVEVFFNRDDEIQTFECM 92

Query: 94  SNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQE 153
           S    GP+LLG F +GR E+ + + TL + DLRDP  S  IA +L + HN+    P P+ 
Sbjct: 93  SKHGQGPRLLGRFADGRVEEFIHARTLSAADLRDPEISAIIAAKLREFHNL--DMPGPKN 150

Query: 154 NIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
            +   +W  +  W   A   + S+K T       +EF    L++EI  L+ +LS +    
Sbjct: 151 VV---LWDRMRNWISEA-KTLCSIKDT-------KEFGLDTLEEEISMLEKELSRDYQE- 198

Query: 214 IVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNL 272
           I F HND QYGNI+   +  S+ ++D+EYA YN  A+D+ANHFCE   +Y    PH ++ 
Sbjct: 199 IGFCHNDLQYGNIMMDEETRSITLIDYEYASYNPVAYDLANHFCEMVANYHCETPHILDY 258

Query: 273 DLYPNEDQQIDFLRAYIDAYSI-PSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGL 331
             YP  +++  F+R Y+ +    PSD  ++   +  + Y           TLA+H+ WGL
Sbjct: 259 SNYPGLEERQRFVRIYLSSAGYQPSDADVDELVDKSEKY-----------TLANHLFWGL 307

Query: 332 WGLVQSGQSQIDFDYLSYGMERLHRF 357
           WG++    ++IDFDY+ Y  +R  ++
Sbjct: 308 WGIISGYVNKIDFDYVEYARQRFQQY 333



>gi|226507172|ref|NP_001146697.1| uncharacterized protein LOC100280298 [Zea mays]
 gi|219884381|gb|ACL52565.1| unknown [Zea mays]
 gi|219888389|gb|ACL54569.1| unknown [Zea mays]
 gi|224029521|gb|ACN33836.1| unknown [Zea mays]
 gi|414589571|tpg|DAA40142.1| TPA: choline/ethanolamine kinase [Zea mays]
          Length = 393

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 188/353 (53%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG
Sbjct: 60  IIALCKELVEGWSSIDSSLFSIETVSGGITNLLL------KVSVKEDNGNESSVTVRLYG 113

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  I
Sbjct: 114 PNTDLVIDRKRELQAIPYLSAAGFGARLLGIFENGVVQSFIYARTLSPADMKEPKIAAEI 173

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEE-QRKGLEEFDFK 193
           A+ L + H +    P  +E   P++W +I K+    L   ++LK  +  ++K  E+  F+
Sbjct: 174 AKELRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNMKQKRYEKISFR 224

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 225 EIQDEVQELK-DLLDILRAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 283

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+        HT + PSE     ++
Sbjct: 284 NHFNEYA-------GFDCDYNLYPDKDAQYHFFRNYL--------HT-DRPSEVDAQDME 327

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ +   +
Sbjct: 328 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRESCF 380



>gi|195636804|gb|ACG37870.1| choline/ethanolamine kinase [Zea mays]
          Length = 388

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 187/353 (52%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG
Sbjct: 55  IIGLCKELVKGWSSIDSSRFSIETVSGGITNLLL------KVSVKGNNGNESSVTVRLYG 108

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  I
Sbjct: 109 PNTDLVIDRKRELQAIPYLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEI 168

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H +    P  +E   P++W +I K+    L   ++LK  + EQ+K   +  F+
Sbjct: 169 AKELRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNEQQKRYVKISFR 219

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 220 EIQDEVKELK-DLLDILHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 278

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+           + PSE     ++
Sbjct: 279 NHFNEYA-------GFDCDYNLYPDKDAQYHFFRNYLHP---------DRPSEVQAQDME 322

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ ++  +
Sbjct: 323 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRDSCF 375



>gi|353234831|emb|CCA66852.1| hypothetical protein PIIN_00614 [Piriformospora indica DSM 11827]
          Length = 562

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 141/438 (32%), Positives = 207/438 (47%), Gaps = 109/438 (24%)

Query: 31  ESDIQIERVSGALTNCVFFITRTKKLHDQT---KNKKPLR-VLLRVYGNGVDQLCDRQKE 86
           + DI I +VSG+LTN  FF+       +Q    ++K P + +LLRVYG     L +R  E
Sbjct: 127 KGDIWIHKVSGSLTNAAFFVLVPSTSREQITSFQSKAPYKTLLLRVYGPSSSSLINRSAE 186

Query: 87  LNFLEMLSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLH--N 143
           L  L +LS+  +IGP++ G F NGR E++ ES+ L S+D+RDP  S+ IA R+S+LH  +
Sbjct: 187 LRILHVLSSRYRIGPRVWGTFANGRIEEYFESDPLTSSDIRDPHISRCIAVRMSELHRVD 246

Query: 144 IINICPP-----PQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           +  +  P     P +  + E+ V  N+  W P A   +S ++  EE +K   E DF++L 
Sbjct: 247 VRKVVDPKQWADPGDGTRGELGVKRNVRTWIPPAREVLSLIR-NEEYKK---EIDFELLV 302

Query: 197 DEIEELKYKLSHNID--------SPIVFAHNDTQYGNILRLTDGS--------LVVVDFE 240
            + +   YK   + +        SP VF HNDTQYGN+LRL            ++VVDFE
Sbjct: 303 KQWDTY-YKWVRDWEKEDDCLKESPRVFCHNDTQYGNLLRLRTTQPGMLPHQQIIVVDFE 361

Query: 241 YAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSI------ 294
           YA  N  AFDIANHFCEWT DY  S P  +    +P   ++ +F  AY+ +  +      
Sbjct: 362 YASPNCAAFDIANHFCEWTTDYLGSNPALLKPSRFPTRAERDNFYLAYLQSGLVLDNRSS 421

Query: 295 ---------PSDHTINNPSET--------------HDNYLQK------------------ 313
                     S   +++PS T              H +  Q                   
Sbjct: 422 RADPETPTGSSGQLVDSPSSTPALSRHNSQAQISRHGSLTQMQSKTPPLAQFARRGSAVL 481

Query: 314 ------LKLEVYAFTLASHVMWGLWGLVQS------------GQSQ---------IDFDY 346
                 L+ +V  +  ASH MW +W LVQ+            G+ Q         ++FDY
Sbjct: 482 PDAMDLLEEQVRRWMPASHGMWAIWALVQARDDVERINRRMEGKRQDGEEEEEDVMEFDY 541

Query: 347 LSYGMERLHRFRELKNEV 364
           L Y  +R+  FRE   E+
Sbjct: 542 LLYASDRIRIFREACQEL 559



>gi|164427253|ref|XP_964582.2| hypothetical protein NCU03176 [Neurospora crassa OR74A]
 gi|157071670|gb|EAA35346.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 682

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 175/338 (51%), Gaps = 57/338 (16%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           +T +N +I L  T  L GW    ++    I +ER+SGALTN V                +
Sbjct: 181 LTFKNEIIRLAHTLRLKGWRRIPLNGGETISVERLSGALTNAV----------------Q 224

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P +VLLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+  S TL   +
Sbjct: 225 PEKVLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTPEN 284

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA-------------- 170
           LR+P TSK IA+R+ +LH+ + +    +++  P VW N D+W   A              
Sbjct: 285 LREPETSKQIAKRMRELHDGVELL-EHEKDEGPGVWRNWDRWLDQAEKTAMYLDSQVAAQ 343

Query: 171 LNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP------IVFAHNDTQYG 224
           L   +  K T + R  +   ++ + +  +++ +  L     SP      +VFAHNDTQYG
Sbjct: 344 LQESTRHKETWKTRGFVCGVEWPVFRKMVQKYRKFLEDYYGSPTKIREKLVFAHNDTQYG 403

Query: 225 NILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHK 269
           NILR+                  L+V+DFEYAG N    + ANHF EWTY+Y   V PH 
Sbjct: 404 NILRIRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTPHV 463

Query: 270 MNLDLYPNEDQQIDFLRAYIDAY-SIPSDHTINNPSET 306
            +   YP  +QQ  F++AY+D     PS   ++ PS T
Sbjct: 464 CDAAKYPTLEQQRRFIKAYVDHQPKFPSVPGVSTPSVT 501



>gi|297839003|ref|XP_002887383.1| hypothetical protein ARALYDRAFT_895010 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333224|gb|EFH63642.1| hypothetical protein ARALYDRAFT_895010 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 347

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 184/325 (56%), Gaps = 29/325 (8%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           +++  + GA+TN V+ I     L+ +  ++K   VL+R+YG+GVD   +R  E+   E +
Sbjct: 40  LEVVPLKGAMTNEVYQIN-WPTLNGEDVHRK---VLVRIYGDGVDLFFNRDDEIKTFECM 95

Query: 94  SNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQE 153
           S+   GPKLLG F +GR E+ + + TL ++DLR   TS +IA +L + H +    P P+ 
Sbjct: 96  SHHGYGPKLLGRFSDGRLEEFIHARTLSADDLRIVETSDFIAAKLREFHKL--DMPGPKN 153

Query: 154 NIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
            +   +W  +  W   A N  S ++        ++E+   +++DEI  L+ +L+   D  
Sbjct: 154 VL---LWERLRTWLKEAKNLASPIE--------MDEYRLDVMEDEINLLEERLTRG-DQE 201

Query: 214 IVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNL 272
           I F HND QYGN++   +  ++ ++D+EY+ +N  A+DIANHFCE   +Y S  PH ++ 
Sbjct: 202 IGFCHNDLQYGNVMIDEETNAITIIDYEYSSFNPIAYDIANHFCEMAANYHSDSPHILDY 261

Query: 273 DLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLW 332
            LYP E+++  F+  Y+ +              T +  +++L  +  ++TLA+H+ WGLW
Sbjct: 262 TLYPGEEERRRFISTYLGS----------TGKATSEEEIERLLNDAESYTLANHIFWGLW 311

Query: 333 GLVQSGQSQIDFDYLSYGMERLHRF 357
           G++    ++I+FDY+ Y  +R  ++
Sbjct: 312 GIISGHVNKIEFDYMEYARQRFEQY 336



>gi|402078159|gb|EJT73508.1| choline kinase [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 857

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 161/321 (50%), Gaps = 48/321 (14%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFIT---RTKKLHDQTKNKKPLRVLLRVYGNG 76
           L GW    + +   + +ER+SGALTN V+ ++              K P ++LLR+YG  
Sbjct: 336 LKGWRRVPLESGDQVGVERLSGALTNAVYVVSPPADVVAAAAVEGRKVPPKLLLRIYGPN 395

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+QL DR+KEL+ L+ L+  KIGP+LLG F NGRFEQ+L +  L   +LR+P TS+ IA+
Sbjct: 396 VEQLIDREKELSVLQRLARKKIGPRLLGTFTNGRFEQYLNATALTPPNLREPETSRMIAK 455

Query: 137 RLSQLHNIINICPPPQE-NIKPEVWVNIDKWYPLALNAI---------------SSLKCT 180
           R+ +LH+ I++    QE    P VWVN D W       +               +   C 
Sbjct: 456 RMRELHDGIDLL--EQELGDGPNVWVNWDNWLDTVERTVMFLDHKVIAGGDAAQTGFVC- 512

Query: 181 EEQRKGLEEFDFKMLKDEIEE---LKYKLSHNIDSPIVFAHNDTQYGNILRLTD------ 231
                G+E   F+ L D   +     Y     I   +VFAHNDTQYGNILR+        
Sbjct: 513 -----GVEWSVFRGLVDRYRKHLNEYYGQPKKIREKLVFAHNDTQYGNILRVRPDDEKSP 567

Query: 232 --------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPH-KMNLDLYPNEDQQI 282
                     LVV+DFEYA  N    + ANHF EW Y+Y  +V     N  +YP  +QQ 
Sbjct: 568 LLQPANEHKQLVVIDFEYAAANLPGLEFANHFTEWAYNYHDAVASFACNTAMYPTLEQQR 627

Query: 283 DFLRAYIDAYSIPSDHTINNP 303
            F+RAY+D     S   +  P
Sbjct: 628 RFVRAYVDHKGGASSSRVTTP 648



>gi|226503203|ref|NP_001146264.1| uncharacterized protein LOC100279839 [Zea mays]
 gi|219886453|gb|ACL53601.1| unknown [Zea mays]
 gi|413946223|gb|AFW78872.1| hypothetical protein ZEAMMB73_384185 [Zea mays]
          Length = 365

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 180/346 (52%), Gaps = 30/346 (8%)

Query: 18  LITDMLPGW-DVSNESDIQIERV--SGALTNCVFFITRTKKLHDQTK--NKKPLRVLLRV 72
           L+ ++   W DV+     + E V   GA+TN V+         D +         VL+RV
Sbjct: 30  LLHELAAAWEDVAGCGSREPEVVPLKGAMTNEVYRARWATGSGDSSAPGQSDARTVLVRV 89

Query: 73  YGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSK 132
           YG GVD   DR+ E+   E +S    GP+LLG F NGR E+ + + TL + DLRDP  S 
Sbjct: 90  YGEGVDLFFDREDEVRTFEFMSRHGHGPRLLGRFPNGRVEEFIHARTLSAPDLRDPGISA 149

Query: 133 YIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDF 192
            IA +L + H++     P  +++   +W  +  W   A +  SS   T       EEF  
Sbjct: 150 IIASKLREFHSLDM---PGSKSVL--IWERLRNWLRTAKSLYSSSDET-------EEFCL 197

Query: 193 KMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDI 251
             +++EI  L+ + S   +  + F HND QYGNI+   +  L+ ++D+EYAG+N  A+DI
Sbjct: 198 DSMEEEIAALENEFSGECER-VGFCHNDLQYGNIMIDEETRLLTIIDYEYAGFNPVAYDI 256

Query: 252 ANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYL 311
           ANHFCE   DY S  PH ++   YP+ D++  F+R Y+ +    S+  + N         
Sbjct: 257 ANHFCEMAADYHSEKPHILDYSKYPDTDERKQFVRTYLSSSGEESEEEVEN--------- 307

Query: 312 QKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
             L   +  +TLASH++WGLWG++    + IDFDY  Y  +R  ++
Sbjct: 308 --LIKSIEKYTLASHLVWGLWGIISDHVNDIDFDYKDYARQRFEQY 351



>gi|482808438|gb|EOA85371.1| hypothetical protein SETTUDRAFT_172258 [Setosphaeria turcica Et28A]
          Length = 1370

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 180/335 (53%), Gaps = 54/335 (16%)

Query: 23   LPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKL------HDQTKNKK--PLRVL 69
            L GW     ++SNE  I ++R+SGALTN V+ ++  K L       D T   +  P ++L
Sbjct: 844  LKGWRKVPSELSNE--ISVQRLSGALTNAVYVVSPPKNLPPPEPSEDGTPKPRNPPPKLL 901

Query: 70   LRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPS 129
            LR+YG  VD L DR  EL  L  L+  +IGP+LLG F NGRFE+ L ++ L S +LR+P 
Sbjct: 902  LRIYGPQVDYLIDRDSELQILTRLARKRIGPRLLGTFSNGRFEEFLHAQPLTSKELRNPE 961

Query: 130  TSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL------------ 177
            TS  IA+R+ +LH  I++    +E   P VW N DKW     + ++ L            
Sbjct: 962  TSVQIAKRMRELHEGIDLLKKERE-AGPFVWQNWDKWVDRCEHVVNWLDQRVRESNQDPS 1020

Query: 178  KCTEEQRK-----GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILRL 229
            K +E+ +K     G+E   FK + D+     E +Y     I+  +VFAHNDTQYGNILR+
Sbjct: 1021 KASEKMKKRGYVCGVEWPVFKQMIDKYRKWLEDQYGGIEKINERMVFAHNDTQYGNILRM 1080

Query: 230  T-DG------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLY 275
              +G             LVV+DFEYA  N    + ANHF EW Y+Y  +  P + N   Y
Sbjct: 1081 MPEGESPLMLPANQHKQLVVIDFEYANANLPGLEFANHFTEWAYNYHDAEAPWRCNTKHY 1140

Query: 276  PNEDQQIDFLRAYI---DAYSIPSDHTINNPSETH 307
            P  ++Q  F+RAY+    +Y  P  +T +NP+  H
Sbjct: 1141 PTIEEQHRFIRAYLMHNPSYKAPGGYT-SNPATPH 1174



>gi|440482680|gb|ELQ63148.1| choline kinase [Magnaporthe oryzae P131]
          Length = 811

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 40/296 (13%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHD--------QTKNKKPLRVLLRVYGNGVDQLCDRQK 85
           + +ER+SGALTN V+ ++   ++          +   K P ++LLR+YG  V+QL DR+K
Sbjct: 345 LAVERLSGALTNAVYVVSPPTEIVSNMSIDDVSKKPKKPPPKLLLRIYGPQVEQLIDREK 404

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           EL  L+ L+  KIGP++LG F NGRFEQ+L + TL + +LR+P TSK IA+R+ +LH  +
Sbjct: 405 ELGVLKRLARKKIGPRMLGTFTNGRFEQYLNATTLTAANLREPETSKMIAKRMKELHVGV 464

Query: 146 NICPPPQENIKPEVWVNIDKWYP------LALN--AISSLKCTEEQRKG--LEEFDFKML 195
            +    +    P VWVN D W        LAL+   + S    ++ RKG  +   ++ + 
Sbjct: 465 ELL-ESELAAGPNVWVNWDSWLDAVERTVLALDKKVLESPADAKDWRKGGFVCGVEWHVF 523

Query: 196 KDEIEELKYKLSHN------IDSPIVFAHNDTQYGNILRLTD--------------GSLV 235
           K  +E  +  L+ +      I   +VFAHNDTQYGNILR+                  LV
Sbjct: 524 KGLVERYRVHLTEHHGGQKKIREKLVFAHNDTQYGNILRIRPDDEKSPLLQPANEHKQLV 583

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYID 290
           V+DFEYA  N    + ANHF EWTY+Y  +V PH  N   YP  +QQ  F+RAY+D
Sbjct: 584 VIDFEYAAANTPGLEFANHFTEWTYNYHDAVAPHACNASRYPTPEQQRRFVRAYVD 639



>gi|312282637|dbj|BAJ34184.1| unnamed protein product [Thellungiella halophila]
          Length = 348

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 110/325 (33%), Positives = 177/325 (54%), Gaps = 30/325 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           ++++ + GA+TN VF ++  +K      N    ++L+RVYG GVD   +R  E+   E +
Sbjct: 38  LEVKPMKGAMTNEVFMVSWPRK----ETNLCCRKLLVRVYGEGVDLFFNRDDEIRTFEFV 93

Query: 94  SNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQE 153
           +    GP+LLG F  GR E+ + + TL + DLRDP+ S  +A +L + H+I     P  +
Sbjct: 94  ARHGHGPRLLGRFSGGRVEEFIHARTLSATDLRDPNISALVASKLRRFHSIY---IPGDK 150

Query: 154 NIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
            +   +W  +  W   A N  S+   T        EF    ++DEI  L+  +  N +  
Sbjct: 151 TVL--IWDRMRTWVGQAKNLCSTEDST--------EFGLDNIEDEINLLEQDM--NNEQE 198

Query: 214 IVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNL 272
           I F HND QYGNI+   +  ++ ++D+EYA YN  A+DIANHFCE   +Y S  PH ++ 
Sbjct: 199 IGFCHNDLQYGNIMIDEETNAITIIDYEYASYNPIAYDIANHFCEMVANYHSDTPHILDY 258

Query: 273 DLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLW 332
            LYP E+ +    R +I  Y   SD       E  +  +++L  ++  +TLASH+ WGLW
Sbjct: 259 TLYPGEEDR----RRFICNYFSSSDE------EAREEDIKQLLDDIEKYTLASHLFWGLW 308

Query: 333 GLVQSGQSQIDFDYLSYGMERLHRF 357
           G++    ++I+FDY+ Y  +R  ++
Sbjct: 309 GIISGYVNKIEFDYIEYSRQRFKQY 333



>gi|414885624|tpg|DAA61638.1| TPA: choline/ethanolamine kinase [Zea mays]
          Length = 388

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 186/353 (52%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG
Sbjct: 55  IIGLCKELVKGWSSIDSSRFSIETVSGGITNLLL------KVSVKGNNGNDSSVTVRLYG 108

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  I
Sbjct: 109 PNTDLVIDRKRELQAIPYLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEI 168

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H +    P  +E   P++W +I K+    L   ++LK  + EQ+K   +  F 
Sbjct: 169 AKELRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNEQQKRYVKISFT 219

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 220 EIQDEVKELK-DLLDILHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 278

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+           + PSE     ++
Sbjct: 279 NHFNEYA-------GFDCDFNLYPDKDAQYHFFRNYLHP---------DRPSEVQAQDME 322

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ ++  +
Sbjct: 323 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRDSCF 375



>gi|21594823|gb|AAM66047.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana]
          Length = 346

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 181/331 (54%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   ++++ + GA+TN VF ++  +K      N +   +L+RVYG GV+   +R  E+
Sbjct: 32  VEDFESLEVKPMKGAMTNEVFMVSWPRK----ETNLQCRNLLVRVYGEGVELFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E ++    GP LLG F  GR E+ + + TL + DLRDP+ S  +A +L + H+I   
Sbjct: 88  RTFEYVARHGHGPTLLGRFAGGRVEEFIHARTLSATDLRDPNISALVASKLRRFHSI--- 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
              P + I   +W  +  W   A N  S+   TE        F    ++DEI  L+ ++ 
Sbjct: 145 -HIPGDRIML-IWDRMRTWVGQAKNLCSNEHSTE--------FGLDDIEDEINLLEQEV- 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
            N +  I F HND QYGNI+   +  ++ ++D+EYA YN  A+DIANHFCE   DY S+ 
Sbjct: 194 -NNEQEIGFCHNDLQYGNIMIDEETNTITIIDYEYASYNPIAYDIANHFCEMAADYHSNT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++  LYP E+++  F+  Y+ +          +  E  +  +++L  ++  +TLASH
Sbjct: 253 PHILDYTLYPGEEERRRFICNYLTS----------SGEEAREEDIEQLLDDIEKYTLASH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWG++    ++I+FDY+ Y  +R  ++
Sbjct: 303 LFWGLWGIISGYVNKIEFDYIEYSRQRFKQY 333



>gi|389646107|ref|XP_003720685.1| choline kinase [Magnaporthe oryzae 70-15]
 gi|351638077|gb|EHA45942.1| choline kinase [Magnaporthe oryzae 70-15]
          Length = 831

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 40/296 (13%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHD--------QTKNKKPLRVLLRVYGNGVDQLCDRQK 85
           + +ER+SGALTN V+ ++   ++          +   K P ++LLR+YG  V+QL DR+K
Sbjct: 345 LAVERLSGALTNAVYVVSPPTEIVSNMSIDDVSKKPKKPPPKLLLRIYGPQVEQLIDREK 404

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           EL  L+ L+  KIGP++LG F NGRFEQ+L + TL + +LR+P TSK IA+R+ +LH  +
Sbjct: 405 ELGVLKRLARKKIGPRMLGTFTNGRFEQYLNATTLTAANLREPETSKMIAKRMKELHVGV 464

Query: 146 NICPPPQENIKPEVWVNIDKWYP------LALN--AISSLKCTEEQRKG--LEEFDFKML 195
            +    +    P VWVN D W        LAL+   + S    ++ RKG  +   ++ + 
Sbjct: 465 ELL-ESELAAGPNVWVNWDSWLDAVERTVLALDKKVLESPADAKDWRKGGFVCGVEWHVF 523

Query: 196 KDEIEELKYKLSHN------IDSPIVFAHNDTQYGNILRLTD--------------GSLV 235
           K  +E  +  L+ +      I   +VFAHNDTQYGNILR+                  LV
Sbjct: 524 KGLVERYRVHLTEHHGGQKKIREKLVFAHNDTQYGNILRIRPDDEKSPLLQPANEHKQLV 583

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYID 290
           V+DFEYA  N    + ANHF EWTY+Y  +V PH  N   YP  +QQ  F+RAY+D
Sbjct: 584 VIDFEYAAANTPGLEFANHFTEWTYNYHDAVAPHACNASRYPTPEQQRRFVRAYVD 639



>gi|440472681|gb|ELQ41531.1| choline kinase [Magnaporthe oryzae Y34]
          Length = 831

 Score =  186 bits (473), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 40/296 (13%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHD--------QTKNKKPLRVLLRVYGNGVDQLCDRQK 85
           + +ER+SGALTN V+ ++   ++          +   K P ++LLR+YG  V+QL DR+K
Sbjct: 345 LAVERLSGALTNAVYVVSPPTEIVSNMSIDDVSKKPKKPPPKLLLRIYGPQVEQLIDREK 404

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           EL  L+ L+  KIGP++LG F NGRFEQ+L + TL + +LR+P TSK IA+R+ +LH  +
Sbjct: 405 ELGVLKRLARKKIGPRMLGTFTNGRFEQYLNATTLTAANLREPETSKMIAKRMKELHVGV 464

Query: 146 NICPPPQENIKPEVWVNIDKWYP------LALN--AISSLKCTEEQRKG--LEEFDFKML 195
            +    +    P VWVN D W        LAL+   + S    ++ RKG  +   ++ + 
Sbjct: 465 ELL-ESELAAGPNVWVNWDSWLDAVERTVLALDKKVLESPADAKDWRKGGFVCGVEWHVF 523

Query: 196 KDEIEELKYKLSHN------IDSPIVFAHNDTQYGNILRLTD--------------GSLV 235
           K  +E  +  L+ +      I   +VFAHNDTQYGNILR+                  LV
Sbjct: 524 KGLVERYRVHLTEHHGGQKKIREKLVFAHNDTQYGNILRIRPDDEKSPLLQPANEHKQLV 583

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYID 290
           V+DFEYA  N    + ANHF EWTY+Y  +V PH  N   YP  +QQ  F+RAY+D
Sbjct: 584 VIDFEYAAANTPGLEFANHFTEWTYNYHDAVAPHACNASRYPTPEQQRRFVRAYVD 639



>gi|356517680|ref|XP_003527514.1| PREDICTED: choline/ethanolamine kinase-like [Glycine max]
          Length = 636

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 117/335 (34%), Positives = 180/335 (53%), Gaps = 36/335 (10%)

Query: 27  DVSNESDIQIERVSGALTNCVFFI---TRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDR 83
           DV + + +Q+  + GA+TN VF I   T T +L          +VL+R+YG GVD   +R
Sbjct: 278 DVFDANALQVIPLKGAMTNEVFQIKWPTTTGELS--------RKVLVRMYGEGVDVFFNR 329

Query: 84  QKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHN 143
             E+   E +S    GP+LLG F NGR E+ + + TL ++DLRDPS S  IA ++ + H+
Sbjct: 330 DNEIQTFEFMSKNGQGPRLLGRFMNGRVEEFIHARTLSASDLRDPSISALIATKMKEFHD 389

Query: 144 IINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELK 203
           +      P E  K  +W  +  W+  A    S         K  E F    +  EI  L+
Sbjct: 390 LDM----PGEK-KVHLWDRLRNWFSEAKRLSSP--------KEFEAFYLDTIDKEISILE 436

Query: 204 YKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDY 262
            +LS      I F HND QYGNI L     S+ ++D+EYA YN  AFDIANHFCE   +Y
Sbjct: 437 KELS-GPHQRIGFCHNDLQYGNIMLDEETNSVTIIDYEYASYNPVAFDIANHFCEMAANY 495

Query: 263 RSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFT 322
            +  PH ++ + YP+ +++  F++AY+      S   ++N      + +++L  E+  +T
Sbjct: 496 HTEEPHILDYNKYPDFEERQRFVQAYLST----SGEQLSN------SEVEQLLQEIEKYT 545

Query: 323 LASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LA+H+ WG+WG++ +  + IDFDY  Y  +R   +
Sbjct: 546 LANHLFWGVWGIISAQVNTIDFDYKEYAKQRFQEY 580



>gi|357515433|ref|XP_003628005.1| Choline/ethanolamine kinase [Medicago truncatula]
 gi|355522027|gb|AET02481.1| Choline/ethanolamine kinase [Medicago truncatula]
          Length = 411

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 180/339 (53%), Gaps = 30/339 (8%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKE 86
           +V + +++++  + GA+TN VF I         T+ +   +VL+R+YG G D   DR+ E
Sbjct: 51  NVLDANELEVIPLKGAMTNEVFQIK-----WQTTEGEMSRKVLVRIYGEGTDIFFDRENE 105

Query: 87  LNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIIN 146
           +     +S    GP+LLG F  GR E+ + + TL + D+RDPS S  IA ++ + H   +
Sbjct: 106 IRTFAFISKNGQGPRLLGRFAQGRLEEFIRARTLSAPDMRDPSISALIASKMKEFH---D 162

Query: 147 ICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKL 206
           +  P  +N+   +W  +  W   A   +S         + +E F    +  EI  L+ +L
Sbjct: 163 LDMPGSKNVY--LWERLRDWLIEARRLLSP--------EEVEMFHLNTMDKEISLLEKEL 212

Query: 207 SHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS 265
           S      I F HND QYGNI L     S+ ++D+EYA YN  A+DIANHF E   +Y + 
Sbjct: 213 SIT-PQRIGFCHNDLQYGNIMLDEVTNSVTIIDYEYASYNPVAYDIANHFSEMAANYHTE 271

Query: 266 VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
            PH ++   YP+ +++  F+  Y+ +       +   PS   DN +QKL  E+  +TLAS
Sbjct: 272 TPHILDYSKYPDLEERQRFVHTYLSS-------SGEQPS---DNEVQKLLDEIEKYTLAS 321

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           H++WGLWG+V    ++IDFDY  Y  +R   +   KN +
Sbjct: 322 HLLWGLWGIVSEHVNKIDFDYKEYAKQRFQEYWSRKNHL 360



>gi|194696992|gb|ACF82580.1| unknown [Zea mays]
          Length = 338

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 186/353 (52%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG
Sbjct: 5   IIGLCKELVKGWSSIDSSRFSIETVSGGITNLLL------KVSVKGNNGNDSSVTVRLYG 58

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  I
Sbjct: 59  PNTDLVIDRKRELQAIPYLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEI 118

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H +    P  +E   P++W +I K+    L   ++LK  + EQ+K   +  F 
Sbjct: 119 AKELRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNEQQKRYVKISFT 169

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIA
Sbjct: 170 EIQDEVKELK-DLLDILHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIA 228

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            + +LYP++D Q  F R Y+           + PSE     ++
Sbjct: 229 NHFNEYA-------GLDCDFNLYPDKDAQYHFFRNYLHP---------DRPSEVQAQDME 272

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ ++  +
Sbjct: 273 VLYVETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRDSCF 325



>gi|502158268|ref|XP_004511086.1| PREDICTED: choline/ethanolamine kinase-like isoform X1 [Cicer
           arietinum]
          Length = 406

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 188/350 (53%), Gaps = 31/350 (8%)

Query: 18  LITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  +   W+ V + + +++  + GA+TN VF I + + +  +   K    VL+R+YG G
Sbjct: 38  ILKSLASKWENVLDPNALEVIPLKGAMTNEVFQI-KWQTIEGEMSRK----VLVRIYGEG 92

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
            D   DR  E+     +S    GP+LLG F +GR E+ + + TL + D+RDPS S  IA 
Sbjct: 93  TDIFFDRANEIRTFAFISKNGQGPRLLGRFPHGRLEEFIRARTLSAPDMRDPSISALIAS 152

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H   ++  P  +N+   +W  +  W    LN    L   +E    +E F  + + 
Sbjct: 153 KMKEFH---DLDMPGSKNVN--LWDRLRNW----LNEARRLSSPDE----VETFHLETMD 199

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
            EI  L+ +LS      I F HND QYGNI L     S+ ++D+EYA YN  A+DIANHF
Sbjct: 200 KEISLLEKELSET-RQRIGFCHNDLQYGNIMLDEVTNSVTIIDYEYASYNPVAYDIANHF 258

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E   +Y +  PH ++   YP+ +++  F++ Y+ +          +  +  D+ +Q+L 
Sbjct: 259 SEMAANYHTETPHVLDFSKYPDLEERQRFVQTYLSS----------SGEQASDSEVQQLL 308

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            EV  +TLASH++WGLWG++    ++IDFDY  Y  +R   +   K++++
Sbjct: 309 DEVEKYTLASHLLWGLWGIISEHVNKIDFDYEEYAKQRFQEYWSRKSDLF 358



>gi|38567241|emb|CAE76532.1| related to choline kinase [Neurospora crassa]
          Length = 664

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 120/334 (35%), Positives = 175/334 (52%), Gaps = 37/334 (11%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKK--LHDQTKN 62
           +T +N +I L  T  L GW    ++    I +ER+SGALTN V+ ++   +  L  Q   
Sbjct: 181 LTFKNEIIRLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVYVVSPPPESILPPQEGK 240

Query: 63  KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKS 122
           ++P +VLLRVYG  V+ L DR+ EL  L+ L+  KIGP+LLG F NGRFEQ+  S TL  
Sbjct: 241 RQPEKVLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTP 300

Query: 123 NDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA------------ 170
            +LR+P TSK IA+R+ +LH+ + +    +++  P VW N D+W   A            
Sbjct: 301 ENLREPETSKQIAKRMRELHDGVELL-EHEKDEGPGVWRNWDRWLDQAEKTAMYLDSQVA 359

Query: 171 --LNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILR 228
             L   +  K T + R  +   ++ + +  +++ +  L     SP       TQYGNILR
Sbjct: 360 AQLQESTRHKETWKTRGFVCGVEWPVFRKMVQKYRKFLEDYYGSPTKIREKLTQYGNILR 419

Query: 229 LTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLD 273
           +                  L+V+DFEYAG N    + ANHF EWTY+Y   V PH  +  
Sbjct: 420 IRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTPHVCDAA 479

Query: 274 LYPNEDQQIDFLRAYID-AYSIPSDHTINNPSET 306
            YP  +QQ  F++AY+D     PS   ++ PS T
Sbjct: 480 KYPTLEQQRRFIKAYVDHQPKFPSVPGVSTPSVT 513



>gi|21537276|gb|AAM61617.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana]
          Length = 346

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 108/331 (32%), Positives = 180/331 (54%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   ++++ + GA+TN VF ++  +K      N +  ++L+RVYG GV+   +R  E+
Sbjct: 32  VEDFESLEVKPMKGAMTNEVFMVSWPRK----ETNLRCRKLLVRVYGEGVELFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E ++    GP LLG F  GR E+ + + TL + DLRDP+ S  +A +L + H+I   
Sbjct: 88  RTFEYVARHGHGPTLLGRFAGGRVEEFIHARTLSATDLRDPNISALVASKLRRFHSI--H 145

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P  +  +   +W  +  W   A N      C+ E      EF    + DEI  L+ ++ 
Sbjct: 146 IPGDRTML---IWDRMRTWVGQAKNL-----CSNEHSS---EFGLDCIDDEINLLEQEV- 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTD-GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
            N +  I F HND QYGNI+   +  ++ ++D+EYA YN  A+DIANHFCE   DY S+ 
Sbjct: 194 -NNEQEIGFCHNDLQYGNIMIDEETNAITIIDYEYASYNPIAYDIANHFCEMAADYHSNT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++  LYP E+++  F+  Y+ +          +  E  +  + +L  ++  +TLASH
Sbjct: 253 PHILDYTLYPGEEERRRFICNYLTS----------SGEEAREEDIDQLLDDIEKYTLASH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWG++    ++I+FDY+ Y  +R  ++
Sbjct: 303 LFWGLWGIISGYVNKIEFDYIEYSRQRFKQY 333



>gi|398407731|ref|XP_003855331.1| hypothetical protein MYCGRDRAFT_37582, partial [Zymoseptoria
           tritici IPO323]
 gi|339475215|gb|EGP90307.1| hypothetical protein MYCGRDRAFT_37582 [Zymoseptoria tritici IPO323]
          Length = 664

 Score =  186 bits (472), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 124/390 (31%), Positives = 185/390 (47%), Gaps = 87/390 (22%)

Query: 34  IQIERVSGALTNCVFFITRTKKL----HDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNF 89
           ++++R+SGALTN V+ ++  + L     D T  K P ++LLR+YG  V+ L DRQ EL  
Sbjct: 187 VEVQRLSGALTNAVYVVSPPEDLPLQKEDGTTAKPPPKLLLRIYGPQVEHLIDRQAELAI 246

Query: 90  LEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICP 149
           L+ L+  +IGP++LG F NGRFE+   +ETL   DL+D STS+ IA+R+ +LH+ I +  
Sbjct: 247 LQRLARKRIGPRMLGTFANGRFEEFFHAETLTPEDLKDASTSRQIAKRMRELHDGIELLD 306

Query: 150 PPQENIKPEVWVNIDKWYPLALNAISSL-----------KCTEEQ---RKG-LEEFDFKM 194
             +++  P VW N DKW       ++ +           K T  +   R+G +    ++ 
Sbjct: 307 QERDD-GPFVWRNWDKWLQRVEQIVTWMDSQIAAQDPNTKPTGSKAWMRRGYICGVPWQQ 365

Query: 195 LKDEIEELK------YKLSHNIDSPIVFAHNDTQYGNILRLTDGS-------------LV 235
            K  +E+ +      Y  S ++   +VFAHNDTQYGNILRL                 LV
Sbjct: 366 FKAVVEKYRAWLKAQYGGSKHLREQLVFAHNDTQYGNILRLVPAGKSPLLLPANSHKQLV 425

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQIDFLRAYI----- 289
           V+DFEYA  N    + ANHF EW Y+Y     P+  N + YP  ++Q  F+RAY+     
Sbjct: 426 VIDFEYASANTPGLEFANHFTEWCYNYHDKRKPYACNTNTYPTPEEQDRFIRAYVRHRPQ 485

Query: 290 -------------------------------------DAYSIPSDHTINNPSE-----TH 307
                                                DA   P   + N  +E       
Sbjct: 486 FNAATDTPHMTPVGTPDSARPADLARRSTTSISDFMLDARVPPGSSSTNLAAEAATKSAE 545

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQS 337
           D  ++ L  E   + LA+   W  WG+VQ+
Sbjct: 546 DAEVKHLMHETRMWRLANTAQWVAWGIVQA 575



>gi|471916269|emb|CCO26245.1| hypothetical protein BN14_00265 [Rhizoctonia solani AG-1 IB]
          Length = 447

 Score =  186 bits (472), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 196/430 (45%), Gaps = 100/430 (23%)

Query: 23  LPGWDVS--NESDIQIERVSGALTNCVFFITRTKKL---HDQTKNKKPL----------- 66
           +P W  S  + + ++I RVSGALTN VFF++        H  T +  P            
Sbjct: 12  VPTWTSSTLDPTLVKIARVSGALTNAVFFVSYAGTAPASHSSTTHLAPTPHSSSSSLPLV 71

Query: 67  ---RVLLRVYGNGVDQLCDRQKELNFLEMLS-NLKIGPKLLGVFKNGRFEQHLESETLKS 122
               VLLR+YG     L  R  EL+ L +LS N +IGP++ G F+NGR E+  +S TLK 
Sbjct: 72  VPRTVLLRIYGPSSSILISRADELHTLHLLSSNYRIGPRVYGTFQNGRVEEWFDSNTLKK 131

Query: 123 NDLRDPSTSKYIAQRLSQLHN-----IINICPPPQENIKPEVWVNIDKWYPLALNAISSL 177
            D+RDP  S++IA R+ +LH      I+ +    QE++    + N+  W   A   +  L
Sbjct: 132 EDIRDPVQSQWIAMRMRELHGVDVLGIVGVSWNGQESL----YKNVVSWQGAAQETLGML 187

Query: 178 KCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNI-------------DSPIVFAHNDTQYG 224
           K  E + +   E  +   ++E++  K+  +                 S +VFAHND QYG
Sbjct: 188 KAKEARGEIPSEHVWHGRREELDLGKFMRAWEAYWGWLQKWESEFGRSEMVFAHNDAQYG 247

Query: 225 NIL---RLTDGS-----LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYP 276
           N+L   +L  G      ++VVDFEYAG N  A+DIANHF EWT DY S  P+ +    YP
Sbjct: 248 NLLYANKLAPGKPEHHRIIVVDFEYAGPNPAAYDIANHFHEWTADYHSDTPYVLTSSRYP 307

Query: 277 NEDQQIDFLRAY---------IDAYSIPSDH----------------------------- 298
             +++ +F   Y         I A   PS H                             
Sbjct: 308 TREERWNFYLGYLGSSILGGPISASPAPSRHPSFQRSGSSSSINSLGAPSHHHHSSSGSL 367

Query: 299 ------TINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI-----DFDYL 347
                 T    +E  +  +  L  +VYA++ ASH  W +WG++Q+          DFDYL
Sbjct: 368 FPIDLSTTRGQAELEET-ISVLDSQVYAWSPASHAHWIIWGIIQASDDVTNGEVSDFDYL 426

Query: 348 SYGMERLHRF 357
            Y  +R  +F
Sbjct: 427 GYAADRAGKF 436



>gi|452846045|gb|EME47978.1| hypothetical protein DOTSEDRAFT_42271 [Dothistroma septosporum
           NZE10]
          Length = 487

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 133/404 (32%), Positives = 190/404 (47%), Gaps = 92/404 (22%)

Query: 32  SDIQIERVSGALTNCVFFITRTKKL----HDQTKN-----KKPLRVLLRVYGNGVDQLCD 82
           S I +ER+SGALTN V+ ++    L     D++ N     K P ++LLRVYG  V+ L D
Sbjct: 3   SAITVERLSGALTNAVYVVSPPADLPLEKFDESGNVVGFSKAPSKLLLRVYGPQVEHLID 62

Query: 83  RQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLH 142
           R+ EL  L+ L+  +IGP+LLG F NGRFE++L ++ L   +LRDP+TS+ IA+R+ +LH
Sbjct: 63  REAELAILQRLARKQIGPRLLGTFVNGRFEEYLHAQPLTPEELRDPATSRQIAKRMRELH 122

Query: 143 NIINICPPPQENIKPE-VWVNIDKWYPLALNAIS----SLKCTEEQRK------------ 185
             I +    QE  +   VW N DKW+  A   ++     +K   E  K            
Sbjct: 123 EGIELL--DQERSEGAFVWRNWDKWFQRAERIVTWMDDQVKALPEHAKPTGQQAWMRRGF 180

Query: 186 --GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS------- 233
             G+    FK +  +     + +Y  S  +   +VFAHNDTQYGNILR+T          
Sbjct: 181 ICGVPWAQFKEVVAKYRMWLKAQYGGSKEVREQLVFAHNDTQYGNILRMTPSGESPLLLP 240

Query: 234 ------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQIDFLR 286
                 LVV+DFEYA  N +  + ANHF EW Y+Y     P+  N   YP  ++Q  FLR
Sbjct: 241 ANTHKQLVVIDFEYANANTRGLEFANHFTEWCYNYHDERKPYAFNSAWYPTPEEQDRFLR 300

Query: 287 AYI--------------------DAYSIPSDHTINN-----------PSETH-------- 307
           AY+                    DA + P     ++           P   H        
Sbjct: 301 AYVSHRPQDGLSTPKMGPSTPSSDASTPPVKRATSSISDFMLDARQPPGHRHNAAKEEES 360

Query: 308 -----DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI-DFD 345
                D  + +L  E   + LA+   W  WG+VQ+    + DFD
Sbjct: 361 TKAAEDLEIARLADETRIWRLANTAQWVAWGIVQAKVPGMPDFD 404



>gi|86196743|gb|EAQ71381.1| hypothetical protein MGCH7_ch7g788 [Magnaporthe oryzae 70-15]
          Length = 682

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 165/296 (55%), Gaps = 40/296 (13%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTK--------NKKPLRVLLRVYGNGVDQLCDRQK 85
           + +ER+SGALTN V+ ++   ++              K P ++LLR+YG  V+QL DR+K
Sbjct: 196 LAVERLSGALTNAVYVVSPPTEIVSNMSIDDVSKKPKKPPPKLLLRIYGPQVEQLIDREK 255

Query: 86  ELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNII 145
           EL  L+ L+  KIGP++LG F NGRFEQ+L + TL + +LR+P TSK IA+R+ +LH  +
Sbjct: 256 ELGVLKRLARKKIGPRMLGTFTNGRFEQYLNATTLTAANLREPETSKMIAKRMKELHVGV 315

Query: 146 NICPPPQENIKPEVWVNIDKWYP------LALN--AISSLKCTEEQRKG--LEEFDFKML 195
            +    +    P VWVN D W        LAL+   + S    ++ RKG  +   ++ + 
Sbjct: 316 ELL-ESELAAGPNVWVNWDSWLDAVERTVLALDKKVLESPADAKDWRKGGFVCGVEWHVF 374

Query: 196 KDEIEELKYKLSHN------IDSPIVFAHNDTQYGNILRLTD--------------GSLV 235
           K  +E  +  L+ +      I   +VFAHNDTQYGNILR+                  LV
Sbjct: 375 KGLVERYRVHLTEHHGGQKKIREKLVFAHNDTQYGNILRIRPDDEKSPLLQPANEHKQLV 434

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMNLDLYPNEDQQIDFLRAYID 290
           V+DFEYA  N    + ANHF EWTY+Y  +V PH  N   YP  +QQ  F+RAY+D
Sbjct: 435 VIDFEYAAANTPGLEFANHFTEWTYNYHDAVAPHACNASRYPTPEQQRRFVRAYVD 490



>gi|6978649|ref|NP_005189.2| choline/ethanolamine kinase [Homo sapiens]
 gi|6685604|sp|Q9Y259.3|CHKB_HUMAN RecName: Full=Choline/ethanolamine kinase; AltName: Full=Choline
           kinase beta; Short=CK; Short=CKB; AltName: Full=Choline
           kinase-like protein; AltName: Full=Ethanolamine kinase;
           Short=EK; AltName: Full=Ethanolamine kinase beta;
           Short=EKB; AltName: Full=choline/ethanolamine kinase
           beta; Short=CKEKB
 gi|5420185|emb|CAB46629.1| Choline/Ethanolamine Kinase [Homo sapiens]
 gi|5420187|emb|CAB46630.1| hypothetical protein [Homo sapiens]
 gi|5509940|dbj|BAA82511.1| choline/ethanolamine kinase [Homo sapiens]
 gi|5509942|dbj|BAA82512.1| choline/ethanolamine kinase [Homo sapiens]
 gi|6862559|gb|AAB03342.2| choline kinase isolog 384D8_3 [Homo sapiens]
 gi|47678369|emb|CAG30305.1| CHKL [Homo sapiens]
 gi|51895977|gb|AAH82263.1| Choline kinase beta [Homo sapiens]
 gi|109451100|emb|CAK54411.1| CHKB [synthetic construct]
 gi|109451678|emb|CAK54710.1| CHKB [synthetic construct]
 gi|119593979|gb|EAW73573.1| hCG16873, isoform CRA_a [Homo sapiens]
 gi|119593980|gb|EAW73574.1| hCG16873, isoform CRA_a [Homo sapiens]
 gi|119593981|gb|EAW73575.1| hCG16873, isoform CRA_a [Homo sapiens]
 gi|127802021|gb|AAI13522.2| Choline kinase beta [Homo sapiens]
 gi|133777770|gb|AAI01489.1| Choline kinase beta [Homo sapiens]
 gi|189067262|dbj|BAG36972.1| unnamed protein product [Homo sapiens]
 gi|261859492|dbj|BAI46268.1| choline kinase beta [synthetic construct]
 gi|313882988|gb|ADR82980.1| choline kinase beta [synthetic construct]
          Length = 395

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|502158274|ref|XP_004511087.1| PREDICTED: choline/ethanolamine kinase-like isoform X2 [Cicer
           arietinum]
          Length = 372

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 188/350 (53%), Gaps = 31/350 (8%)

Query: 18  LITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  +   W+ V + + +++  + GA+TN VF I + + +  +   K    VL+R+YG G
Sbjct: 38  ILKSLASKWENVLDPNALEVIPLKGAMTNEVFQI-KWQTIEGEMSRK----VLVRIYGEG 92

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
            D   DR  E+     +S    GP+LLG F +GR E+ + + TL + D+RDPS S  IA 
Sbjct: 93  TDIFFDRANEIRTFAFISKNGQGPRLLGRFPHGRLEEFIRARTLSAPDMRDPSISALIAS 152

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H   ++  P  +N+   +W  +  W    LN    L   +E    +E F  + + 
Sbjct: 153 KMKEFH---DLDMPGSKNVN--LWDRLRNW----LNEARRLSSPDE----VETFHLETMD 199

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
            EI  L+ +LS      I F HND QYGNI L     S+ ++D+EYA YN  A+DIANHF
Sbjct: 200 KEISLLEKELSET-RQRIGFCHNDLQYGNIMLDEVTNSVTIIDYEYASYNPVAYDIANHF 258

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E   +Y +  PH ++   YP+ +++  F++ Y+ +          +  +  D+ +Q+L 
Sbjct: 259 SEMAANYHTETPHVLDFSKYPDLEERQRFVQTYLSS----------SGEQASDSEVQQLL 308

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            EV  +TLASH++WGLWG++    ++IDFDY  Y  +R   +   K++++
Sbjct: 309 DEVEKYTLASHLLWGLWGIISEHVNKIDFDYEEYAKQRFQEYWSRKSDLF 358



>gi|114687093|ref|XP_001144556.1| PREDICTED: choline/ethanolamine kinase isoform 3 [Pan troglodytes]
 gi|397465729|ref|XP_003804638.1| PREDICTED: choline/ethanolamine kinase [Pan paniscus]
          Length = 395

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|477534512|gb|ENH86050.1| choline kinase [Colletotrichum orbiculare MAFF 240422]
          Length = 767

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 167/317 (52%), Gaps = 40/317 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQ-TKNK 63
            T +N ++ L  T  + GW    + + + + ++R+SGALTN V+ ++    L D+ T  K
Sbjct: 276 ATFKNEIVRLAHTLKIKGWRRVPLDSGNALSVQRLSGALTNAVYVVSPPADLEDKATGRK 335

Query: 64  KPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSN 123
            P ++LLR+YG  ++ L DR+ EL+ L  L+  KIGP+LLG F NGRFE++  S TL + 
Sbjct: 336 PPPKLLLRIYG--LEHLIDRENELSVLRRLARKKIGPRLLGCFTNGRFEEYFNSITLTAR 393

Query: 124 DLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQ 183
           D+RDP TS+ IA+R+ +LH+ I++    ++     V+ N D W       I  L   E  
Sbjct: 394 DIRDPDTSRQIAKRMRELHDGIDVL-QKEKYEGAAVFKNWDTWLGNVEKKI--LAIDEGV 450

Query: 184 RKGLEEF------------DFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYGNILR 228
           R+G   F             FK L D   EL    YK    I   +VFAHNDTQYGNILR
Sbjct: 451 RQGTSVFRGQGYVCGVEWGQFKALYDRYRELVVKAYKGHQGIRERLVFAHNDTQYGNILR 510

Query: 229 LTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLD 273
           +                  LVV+DFEYA  N    + ANHF EW YDY     P+  N  
Sbjct: 511 MRPDDEKSPLLQPANEHKQLVVIDFEYAAANVPGLEFANHFTEWAYDYHYEPAPYLCNTA 570

Query: 274 LYPNEDQQIDFLRAYID 290
            YP   +Q  FL+AY++
Sbjct: 571 KYPTVKEQRRFLKAYVE 587



>gi|295789466|pdb|3LQ3|A Chain A, Crystal Structure Of Human Choline Kinase Beta In Complex
           With Phosphorylated Hemicholinium-3 And Adenosine
           Nucleotide
          Length = 401

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 66  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 123

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 124 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 180

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 181 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 225

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 226 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 284

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 285 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 340

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 341 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 394



>gi|33304029|gb|AAQ02522.1| choline kinase-like, partial [synthetic construct]
          Length = 396

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|218766919|pdb|3FEG|A Chain A, Crystal Structure Of Human Choline Kinase Beta In Complex
           With Phosphorylated Hemicholinium-3 And Adenosine
           Nucleotide
          Length = 379

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 44  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 101

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 102 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 158

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 159 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 203

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 204 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 262

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 263 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 318

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 319 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 372



>gi|402884714|ref|XP_003905820.1| PREDICTED: choline/ethanolamine kinase [Papio anubis]
          Length = 395

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 182/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP + QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQGQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|462397678|gb|EMJ03346.1| hypothetical protein PRUPE_ppa007064mg [Prunus persica]
          Length = 384

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 190/353 (53%), Gaps = 34/353 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W     S   +  VSG +TN +  +T       + +N   + V +R+YG
Sbjct: 45  IIELCKDLFKKWSNLENSRFSVGTVSGGITNLLLKVTV------KEENGNDVSVTVRLYG 98

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + +R++EL  ++ LS    G  LLGVF NG  +  + + TL  +D+R+P  +  I
Sbjct: 99  PNTEYVINRERELQSIKYLSAAGFGANLLGVFGNGMVQSFINARTLIPSDMRNPKLAAEI 158

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGL-EEFDFK 193
           A++L + H +    P  +E   P++W ++ K++  A    S+L+  + +++ L +   F 
Sbjct: 159 AKQLCRFHQVE--IPGSKE---PQLWNDLLKFFEKA----SALEFDDNEKQKLYKTISFS 209

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIA 252
            + +EI ELK +L+  ++SP+VFAHND   GNI+    +  L ++DFEY  YNY+ FDI 
Sbjct: 210 EVHNEIIELK-ELTGLLNSPVVFAHNDLLSGNIMVNDEEDKLYLIDFEYGSYNYRGFDIG 268

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+         ++ +  L PN+D+Q  FLR Y+            NP E  +  L+
Sbjct: 269 NHFNEY-------AGYECDFTLCPNKDEQYHFLRHYLQP---------ENPHEVSEKDLE 312

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
            L +E   +TLASH+ W LWGL+Q+  S I+FDYL Y   R + F+  K + +
Sbjct: 313 ALYVEENTYTLASHLYWALWGLIQAKFSPINFDYLGYFFLRYNEFKRQKEKCF 365



>gi|400597974|gb|EJP65698.1| choline kinase [Beauveria bassiana ARSEF 2860]
          Length = 792

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/323 (34%), Positives = 168/323 (52%), Gaps = 42/323 (13%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
           +  +N +I +  T  L GW    + +   I +ER+SGALTN V+ +T    + +    K 
Sbjct: 290 LVFKNEIIRIAHTLRLKGWRRVPLGDGHRIWVERLSGALTNAVYVVTPPTDIPEIEGKKM 349

Query: 65  PLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSND 124
           P ++LLR+YG  V+ L DR  EL  L+ L+  KIGP+LLG FKNGRFEQ+  + TL+ +D
Sbjct: 350 PPKLLLRIYGPQVEHLIDRDNELKVLQRLARKKIGPRLLGTFKNGRFEQYFNAITLRPSD 409

Query: 125 LRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-----KC 179
           LR+P TS+ IA+R+ +LH+ I +  P + +  P +W N D+W       +  L       
Sbjct: 410 LREPDTSRQIAKRMRELHDGIELL-PSERDGGPGIWKNWDQWLDNVARIVQFLDKDLHNV 468

Query: 180 TEEQRKGLEEFDFKM-----------LKDEIEELK------YKLSHNIDSPIVFAHNDTQ 222
            E  R       +K              D + + +      YK +  I   +VFAH+DTQ
Sbjct: 469 PEGSRANSVVHAWKANGYVCGAPWPQFLDAVVKFRAYLDSFYKSAKAIRESLVFAHSDTQ 528

Query: 223 YGNILRLTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-P 267
           YGNILR+                  L+V+DFEYA  N    + ANHF EW Y+Y   V  
Sbjct: 529 YGNILRIRPDDEKSPLLQAANKHKQLIVIDFEYAAANTPGLEFANHFTEWAYNYHDPVTS 588

Query: 268 HKMNLDLYPNEDQQIDFLRAYID 290
           +  N++ YP  ++Q  F++AY+D
Sbjct: 589 YACNVERYPTPEEQHRFIKAYVD 611



>gi|414885625|tpg|DAA61639.1| TPA: hypothetical protein ZEAMMB73_138989 [Zea mays]
          Length = 441

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 184/350 (52%), Gaps = 34/350 (9%)

Query: 18  LITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV 77
           L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG   
Sbjct: 111 LCKELVKGWSSIDSSRFSIETVSGGITNLLL------KVSVKGNNGNDSSVTVRLYGPNT 164

Query: 78  DQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQR 137
           D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  IA+ 
Sbjct: 165 DLVIDRKRELQAIPYLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKE 224

Query: 138 LSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFKMLK 196
           L + H +    P  +E   P++W +I K+    L   ++LK  + EQ+K   +  F  ++
Sbjct: 225 LRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNEQQKRYVKISFTEIQ 275

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
           DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIANHF
Sbjct: 276 DEVKELK-DLLDILHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHF 334

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E+            + +LYP++D Q  F R Y+           + PSE     ++ L 
Sbjct: 335 NEYA-------GFDCDFNLYPDKDAQYHFFRNYLHP---------DRPSEVQAQDMEVLY 378

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
           +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ ++  +
Sbjct: 379 VETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRDSCF 428



>gi|212720894|ref|NP_001132180.1| uncharacterized protein LOC100193605 [Zea mays]
 gi|194693676|gb|ACF80922.1| unknown [Zea mays]
          Length = 351

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 184/350 (52%), Gaps = 34/350 (9%)

Query: 18  LITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV 77
           L  +++ GW   + S   IE VSG +TN +       K+  +  N     V +R+YG   
Sbjct: 21  LCKELVKGWSSIDSSRFSIETVSGGITNLLL------KVSVKGNNGNDSSVTVRLYGPNT 74

Query: 78  DQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQR 137
           D + DR++EL  +  LS    G +LLG+F+NG  +  + + TL   D+++P  +  IA+ 
Sbjct: 75  DLVIDRKRELQAIPYLSAAGFGARLLGMFENGVVQSFIYARTLSPADMKEPKIAAEIAKE 134

Query: 138 LSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFKMLK 196
           L + H +    P  +E   P++W +I K+    L   ++LK  + EQ+K   +  F  ++
Sbjct: 135 LRKFHQV--DIPGSKE---PQLWNDIFKF----LKKAAALKFEDNEQQKRYVKISFTEIQ 185

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
           DE++ELK  L   + +P+V+AHND   GN+ L   +G L  +DFEY  Y+Y+ +DIANHF
Sbjct: 186 DEVKELK-DLLDILHAPVVYAHNDLLSGNLMLNDLEGKLYFIDFEYGSYSYRGYDIANHF 244

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E+            + +LYP++D Q  F R Y+           + PSE     ++ L 
Sbjct: 245 NEYA-------GFDCDFNLYPDKDAQYHFFRNYLHP---------DRPSEVQAQDMEVLY 288

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
           +E   F LASH+ W LW L+Q+  S IDFDYL Y   R   +++ ++  +
Sbjct: 289 VETNTFRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKKQRDSCF 338



>gi|344309119|ref|XP_003423224.1| PREDICTED: choline/ethanolamine kinase-like [Loxodonta africana]
          Length = 347

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
           GW    +++  +   SG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 12  GWAEPTQAEHPLWVYSGGLSNLLFRCSLPD--HLPSHGEEPREVLLRLYGAILQGVDSLV 69

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA ++++ 
Sbjct: 70  ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMARF 126

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDE+
Sbjct: 127 HGM------EMPFTKEPHWLFRTMERY----LKQIQDLPPTGLPQMNL--LEVYSLKDEM 174

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L+      SL++VDFEY+ YNY+ FDI NHF
Sbjct: 175 GNLR-KLLASTPSPVVFCHNDIQEGNILLLSAPENADSLMLVDFEYSSYNYRGFDIGNHF 233

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  +QQ+ F+R Y+    +  D T++   E      + 
Sbjct: 234 CEWVYDYTHEEWPFYKARPADYPTREQQLHFIRHYLA--EVKKDETLSQ--EEQRKLEED 289

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +EV  + LASH  WGLW ++Q+  S I+F YL Y   RL  + + K ++
Sbjct: 290 LLVEVDRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRLQFYFQQKRQL 340



>gi|426394972|ref|XP_004063756.1| PREDICTED: choline/ethanolamine kinase [Gorilla gorilla gorilla]
          Length = 395

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEVNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLVEVSWYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|471390854|ref|XP_004380089.1| PREDICTED: choline/ethanolamine kinase [Trichechus manatus
           latirostris]
          Length = 395

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 184/352 (52%), Gaps = 35/352 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +  +  H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVRPEELRVNPVSGGLSNLLFRCSLPE--HLPSHGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDE+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPTGLPQLNL--LEVYSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
           + L+ KL  +  SP+VF HND Q GNIL L++     +L++VDFEY+ YNY+ FDI NHF
Sbjct: 223 DNLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPENADNLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +      YP   QQ+ F+R Y+    I  D T   PS      L++
Sbjct: 282 CEWVYDYTHEEWPFYTARPADYPTRGQQLHFIRHYLA--EIRKDKT---PSPEEQRKLEE 336

Query: 314 -LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +EV  + LASH  WGLW ++QS  S I+F YL Y   R   + + K ++
Sbjct: 337 DLLVEVNRYALASHFFWGLWSILQSSMSTIEFGYLEYAQSRFQFYFQQKRQL 388



>gi|407919190|gb|EKG12444.1| Choline/ethanolamine kinase [Macrophomina phaseolina MS6]
          Length = 821

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 186/415 (44%), Gaps = 100/415 (24%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQ-------TKNKKPLRVLLRV 72
           L GW    +   SDI++ER+SGALTN V+ ++  K L  +            P ++LLRV
Sbjct: 302 LKGWRRVPMDCSSDIEVERLSGALTNAVYVVSPPKDLPPKEGEGGMIRPRNPPPKLLLRV 361

Query: 73  YGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSK 132
           YG  V+ L DR+ EL  L  L+  KIGP+LLG F NGRFE+   + TL   DLR+  TS 
Sbjct: 362 YGPQVEHLIDRESELQILRRLARKKIGPRLLGTFSNGRFEEFFHARTLTPKDLRNAETSV 421

Query: 133 YIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWY--------------------PLALN 172
            IA+R+ +LH  I++ P  +E+  P +W N DKW                     P  L 
Sbjct: 422 QIAKRMRELHEGIDLLPQERED-GPFIWRNWDKWVERCGYITKWLDEQVLEAQDNPEKLA 480

Query: 173 AISSLK-----CTEEQRKGLEEFDFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYG 224
            + +L      C      G+    F+   D+  +    +Y  +  ++  +VFAHNDTQYG
Sbjct: 481 HLPALMDRGFVC------GVPWETFRQTVDKYRQWLNEQYGGAKQLNQRLVFAHNDTQYG 534

Query: 225 NILRLTDGS-------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKM 270
           NILRL                 LVV+DFEYA  N    + ANHF EW Y+Y     PH +
Sbjct: 535 NILRLVPPGDSPLLLPANEHKQLVVIDFEYANANTPGLEFANHFTEWCYNYHDEKAPHAV 594

Query: 271 NLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY-------------------- 310
           N   YP   +Q  F+R+Y+        +  NNPS T ++                     
Sbjct: 595 NTAAYPTPTEQQRFIRSYVSHRPF-QPYQNNNPSATPNSARPTTLAHSSSISTFMLDSRA 653

Query: 311 -------------------LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQI-DFD 345
                              +Q+L  E   + L +   W  WG+VQ+    + DFD
Sbjct: 654 PPQQLCEQEEREEAEVEKEVQRLMEETRLWRLGNSAQWVAWGIVQAKVPGLPDFD 708



>gi|6671748|ref|NP_031718.1| choline/ethanolamine kinase [Mus musculus]
 gi|6685597|sp|O55229.3|CHKB_MOUSE RecName: Full=Choline/ethanolamine kinase; AltName: Full=Choline
           kinase beta; Short=CK; Short=CKB; AltName:
           Full=Ethanolamine kinase; Short=EK; AltName:
           Full=choline/ethanolamine kinase beta; Short=CKEKB
 gi|2897729|dbj|BAA24896.1| choline/ethanolamine kinase [Mus musculus]
 gi|2897731|dbj|BAA24897.1| choline/ethanolamine kinase [Mus musculus]
 gi|6539488|dbj|BAA88151.1| choline/ethanolamine kinase-beta [Mus musculus]
 gi|148672392|gb|EDL04339.1| choline kinase beta, isoform CRA_b [Mus musculus]
          Length = 394

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 181/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   ++ +  VSG L+N +F  +     H  +   +P  VLLR+YG    GVD L 
Sbjct: 60  AWRRARPEELSVCPVSGGLSNLLFRCSLPN--HVPSVGGEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LRDP  S  IA R+++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATRMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L E     LKDE+
Sbjct: 175 HGM------EMPFTKEPRWLFGTMERY----LKQIQDLPSTSLPQMNLVEM--YSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLT----DGSLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L+    D +L++VDFEY+ YNY+ FDI NHF
Sbjct: 223 NSLR-KLLDDTPSPVVFCHNDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  +QQ+ F+R Y+    +     ++   E      ++
Sbjct: 282 CEWVYDYTYEEWPFYKARPTDYPTREQQLHFIRHYLA--EVQKGEILSE--EEQKKREEE 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L LE+  ++LASH  WGLW  +Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLLEISRYSLASHFFWGLWSTLQASMSTIEFGYLEYAQSRFQFYFQQKGQL 388



>gi|303318056|ref|XP_003069030.1| Choline/ethanolamine kinase family protein [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240108711|gb|EER26885.1| Choline/ethanolamine kinase family protein [Coccidioides posadasii
           C735 delta SOWgp]
          Length = 787

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 198/407 (48%), Gaps = 95/407 (23%)

Query: 23  LPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN---------KKPLRV 68
           L GW     +VS E  +++ R+SGALTN V+ ++  KKL    ++         K P ++
Sbjct: 280 LKGWRRVPLEVSGE--VEVVRLSGALTNAVYVVSPPKKLPMAQRSETSLPSVPRKPPPKL 337

Query: 69  LLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           LLRVYG  V+ L DR++EL  L  L    IGP++LG F NGRFEQ+  ++ L + +LR P
Sbjct: 338 LLRVYGPQVEHLIDRERELQILRRLGKRNIGPRVLGTFNNGRFEQYFHAKPLTTKELRVP 397

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA-----------LNAISSL 177
            TSK I++R+ +LH+ I++ P  +E+  P +W N DKW               LN  +S 
Sbjct: 398 ETSKQISKRMRELHDGIDLLPEERES-GPSLWKNWDKWVGRCEKVTTWLDQEILNGNNSS 456

Query: 178 KCTEE--QRKG----LEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILR 228
           K + E  + +G    +    F+ + D      E  +  +  I   +VFAHNDTQYGN+LR
Sbjct: 457 KASNEPWRSRGFVCCVPWQSFRAVVDRYRKWLEEHFGGAGEISKRLVFAHNDTQYGNLLR 516

Query: 229 LTDG-------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDL 274
           L                 L+V+DFEYA  N +  + ANHF EW Y+Y  +  P   + + 
Sbjct: 517 LQPSEESPLLLPANEHKQLIVIDFEYASANMRGVEFANHFTEWCYNYHDAERPWACHTNW 576

Query: 275 YPNEDQQIDFLRAYI-----------DAYSIPSDH---TINNPSETH---------DNY- 310
           YP +++Q  F+RAY+           D  + P+ H   ++  P+ T          D Y 
Sbjct: 577 YPTQEEQERFIRAYLRHQSRLTAQPADISTPPATHPSVSVTRPTYTSSPRVPPFLLDTYV 636

Query: 311 --------------------LQKLKLEVYAFTLASHVMWGLWGLVQS 337
                               +Q+L  E   + +A+ V W  WG+VQ+
Sbjct: 637 PGVNPPLTDYENRDPAEEAEVQQLLHETRLWRVANSVQWIAWGIVQA 683



>gi|320036804|gb|EFW18742.1| ethanolamine kinase [Coccidioides posadasii str. Silveira]
          Length = 787

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 198/407 (48%), Gaps = 95/407 (23%)

Query: 23  LPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN---------KKPLRV 68
           L GW     +VS E  +++ R+SGALTN V+ ++  KKL    ++         K P ++
Sbjct: 280 LKGWRRVPLEVSGE--VEVVRLSGALTNAVYVVSPPKKLPMAQRSETSLPSVPRKPPPKL 337

Query: 69  LLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           LLRVYG  V+ L DR++EL  L  L    IGP++LG F NGRFEQ+  ++ L + +LR P
Sbjct: 338 LLRVYGPQVEHLIDRERELQILRRLGKRNIGPRVLGTFNNGRFEQYFHAKPLNTKELRVP 397

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA-----------LNAISSL 177
            TSK I++R+ +LH+ I++ P  +E+  P +W N DKW               LN  +S 
Sbjct: 398 ETSKQISKRMRELHDGIDLLPEERES-GPSLWKNWDKWVGRCEKVTTWLDQEILNGNNSS 456

Query: 178 KCTEE--QRKG----LEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILR 228
           K + E  + +G    +    F+ + D      E  +  +  I   +VFAHNDTQYGN+LR
Sbjct: 457 KASNEPWRSRGFVCCVPWQSFRAVVDRYRKWLEEHFGGAGEISKRLVFAHNDTQYGNLLR 516

Query: 229 LTDG-------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDL 274
           L                 L+V+DFEYA  N +  + ANHF EW Y+Y  +  P   + + 
Sbjct: 517 LQPSEESPLLLPANEHKQLIVIDFEYASANMRGVEFANHFTEWCYNYHDAERPWACHTNW 576

Query: 275 YPNEDQQIDFLRAYI-----------DAYSIPSDH---TINNPSETH---------DNY- 310
           YP +++Q  F+RAY+           D  + P+ H   ++  P+ T          D Y 
Sbjct: 577 YPTQEEQERFIRAYLRHQSRLTAQPADISTPPATHPSVSVTRPTYTSSPRVPPFLLDTYV 636

Query: 311 --------------------LQKLKLEVYAFTLASHVMWGLWGLVQS 337
                               +Q+L  E   + +A+ V W  WG+VQ+
Sbjct: 637 PGVSPPLTDYENRDPAEEAEVQQLLHETRLWRVANSVQWIAWGIVQA 683



>gi|449441185|ref|XP_004138364.1| PREDICTED: probable ethanolamine kinase A-like isoform 2 [Cucumis
           sativus]
 gi|449526908|ref|XP_004170455.1| PREDICTED: probable ethanolamine kinase A-like isoform 2 [Cucumis
           sativus]
          Length = 384

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 185/349 (53%), Gaps = 34/349 (9%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W   + S   +E VSG +TN +  +T       + ++   + V +R+YG
Sbjct: 47  IIELCKDLFKEWSELDASRFSVETVSGGITNQLLKVTV------KEESGTSVSVTVRLYG 100

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + +R +EL  ++ LS    G KLLGVFKNG  +  + + TL+ +DLR P  +  I
Sbjct: 101 PNTDYVINRDRELQAIKYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEI 160

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGL-EEFDFK 193
           A++L++ H +      P  N +P++W  I  +Y  A    S+L+  +  ++ + +   F+
Sbjct: 161 AKQLNKFHKVY----IPGSN-EPQLWNEILNFYDKA----STLQFDDTGKQSIYDTISFQ 211

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            + +EI E+K +L+  +++PIVFAHND   GN+ L   +G L  +DFEY  Y+Y+ FDI 
Sbjct: 212 EIHNEILEIK-ELTSLLNAPIVFAHNDLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIG 270

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+         +  +   YP++++Q  F R Y+             P E     L+
Sbjct: 271 NHFNEYA-------GYDCDYSCYPSKEEQYHFFRHYLQP---------EKPDEVSQKDLE 314

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
            L +E   F LASH+ W LW L+Q+  S IDFDYLSY   R   +++ K
Sbjct: 315 ALYVESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRYGEYKKQK 363



>gi|310797778|gb|EFQ32671.1| choline/ethanolamine kinase [Glomerella graminicola M1.001]
          Length = 728

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 170/317 (53%), Gaps = 40/317 (12%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKK 64
            T +N ++ L  T  + GW    + + + + ++R+SGALTN V+ ++  + L ++   KK
Sbjct: 235 ATFKNEIVRLTHTLKIKGWRRVPLDSGNSVIVQRLSGALTNAVYVLSPPEDLDEKVTGKK 294

Query: 65  PL-RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSN 123
           P  ++LLR+YG  ++ L DR+ EL  L  L+  KIGP+LLG F NGRFE++  S TL  +
Sbjct: 295 PPPKLLLRIYG--LEHLIDRENELTVLRRLARKKIGPRLLGCFTNGRFEEYFNSITLTPS 352

Query: 124 DLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQ 183
           DLR+P TSK IA+R+ +LH  I++    +++  P V  N D W       I  L   E  
Sbjct: 353 DLREPETSKQIAKRMRELHVGIDVL-DREKDEGPAVLKNWDTWLRNVEKKI--LALDESV 409

Query: 184 RKGLEEF------------DFKMLKDEIEEL---KYKLSHNIDSPIVFAHNDTQYGNILR 228
           R+G   F             FK L D+  EL    YK    +   +VFAHNDTQYGNILR
Sbjct: 410 RRGNSVFRGSGYVCGVEWQQFKELYDKYRELVINAYKGPQEVRERLVFAHNDTQYGNILR 469

Query: 229 LTD--------------GSLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSVPHKMNLD 273
           +                  LVV+DFEYA  N    + ANHF EW YDY   ++P + N  
Sbjct: 470 MRPDDEKSPLLQPANEHKQLVVIDFEYAAANVPGLEFANHFTEWAYDYHHETLPFRCNTV 529

Query: 274 LYPNEDQQIDFLRAYID 290
            YP   +Q  FL+AY++
Sbjct: 530 RYPTIQEQRRFLKAYVE 546



>gi|388498224|gb|AFK37178.1| unknown [Lotus japonicus]
          Length = 432

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 183/342 (53%), Gaps = 31/342 (9%)

Query: 18  LITDMLPGWD-VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNG 76
           ++  +   W+ V + + +Q+  + GA+TN VF I         T  +   +VL R+YG G
Sbjct: 65  ILKSLASEWENVLDANALQVIPLKGAMTNEVFQIK-----WQTTAGETSRKVLARIYGEG 119

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
            D   DR  E+   E +S    GP+LLG F +GR E+ + + TL ++DLRDPS S  IA 
Sbjct: 120 TDIFFDRDDEIRTFEFISKNGQGPRLLGRFAHGRIEEFIRARTLSASDLRDPSISALIAT 179

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLK 196
           ++ + H++    P P++ +   +W  +  W   A        C+ E+   +E F    + 
Sbjct: 180 KMKEFHDL--DMPGPKKVL---LWERLRNWLSEARRL-----CSPEE---VETFHLDTMD 226

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGN-ILRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
            EI  L+ +LS      I F HND QYGN +L   + S+ ++D+EY+ YN  A+DIANHF
Sbjct: 227 KEISSLENELS-GTHQRIGFCHNDLQYGNFMLDEENNSVTIIDYEYSSYNPVAYDIANHF 285

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E   +Y +  PH ++   YP+ +++  F+  Y+ +       +   PS   D+ +Q+L 
Sbjct: 286 SEMVANYHTETPHVLDYSKYPDLEERKRFVYTYLSS-------SGQQPS---DSEVQQLV 335

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            EV  +TLA+H++WG+WG++    ++IDFDY  Y  +R   +
Sbjct: 336 DEVEKYTLANHLLWGVWGIISEHVNKIDFDYKEYAKQRFQEY 377



>gi|354506926|ref|XP_003515510.1| PREDICTED: choline/ethanolamine kinase-like [Cricetulus griseus]
          Length = 395

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 184/352 (52%), Gaps = 35/352 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   ++ +  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRARPEELSVCPVSGGLSNLLFRCSLPN--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LRDP  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERALGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTE-EQRKGLEEFDFKMLKDE 198
           H +           K   W+   ++++    L  I  L  T+  Q   LE ++   LKDE
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPSTDLPQMNLLEMYN---LKDE 221

Query: 199 IEELKYKLSHNIDSPIVFAHNDTQYGNILRLT----DGSLVVVDFEYAGYNYQAFDIANH 254
           +  L+ KL     SP+VF HND Q GNIL L+    D SL++VDFEY+ YNY+ FDI NH
Sbjct: 222 MGNLR-KLLDATPSPVVFCHNDIQEGNILLLSEPKSDDSLMLVDFEYSSYNYRGFDIGNH 280

Query: 255 FCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           FCEW YDY     P +K +   YP   QQ+ F+R Y+    +     +  P E      +
Sbjct: 281 FCEWVYDYTFEEWPFYKASPTDYPTRGQQLHFIRHYLA--EVQKGQIL--PEEEQKKLEE 336

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           +L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 337 ELLMEVSWYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFKQKGQL 388



>gi|395753620|ref|XP_003779632.1| PREDICTED: choline/ethanolamine kinase [Pongo abelii]
          Length = 395

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 182/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 219

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 220 DEMGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 278

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E     
Sbjct: 279 NHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 334

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L  EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 335 EEDLLAEVSWYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 388



>gi|501756460|emb|CCG80513.1| Ethanolamine kinase [Taphrina deformans PYCC 5710]
          Length = 536

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 175/337 (51%), Gaps = 44/337 (13%)

Query: 10  TLRNALIPLITDM-LPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRV 68
           T + A++ ++  + L  W +S    + ++ ++ ALTN V+ I    +           ++
Sbjct: 65  TFKIAIVKILIKLRLTNWKLSEAESLVVKNIASALTNSVYLIILDSQ-----------KL 113

Query: 69  LLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           LLR+YG  V  L DR  E + L  L++ +IGP+LLG FKNGR EQ LES  + SN++RDP
Sbjct: 114 LLRIYGPNVLHLIDRDYETSVLARLAHHRIGPRLLGQFKNGRIEQWLESVEVGSNEIRDP 173

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLE 188
             S YIA+RL + H+ + + PP  + +      N++ W P    A+   +          
Sbjct: 174 IVSTYIARRLREFHDYVTLLPPEMDKVS--AITNLEGWIP----ALPKTRLN-------- 219

Query: 189 EFDFKMLKDEIEELKYKLS--HNIDSPIVFAHNDTQYGNILRLTDGS----LVVVDFEYA 242
                M++  I  +K   S     +  IVF HND QYGN+LR T G     L V+DFEYA
Sbjct: 220 ----SMVQTFIRHIKLYRSFVRGKEGEIVFCHNDLQYGNLLR-TKGEEHNCLAVIDFEYA 274

Query: 243 GYNYQAFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPS--DHTI 300
           G N ++FDIANHF EW  +Y  S  H+++   YP   Q  +FL  YI    + +  +  +
Sbjct: 275 GPNPRSFDIANHFIEWMANYHESPSHELDTAAYPTYGQSRNFLGEYIQFGKLIARREDPV 334

Query: 301 NNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQS 337
            +P E     ++KL   V  +   SH  W +WGL+Q+
Sbjct: 335 VSPDE-----IEKLSESVDLWRAMSHAQWAIWGLIQA 366



>gi|255566975|ref|XP_002524470.1| choline/ethanolamine kinase, putative [Ricinus communis]
 gi|223536258|gb|EEF37910.1| choline/ethanolamine kinase, putative [Ricinus communis]
          Length = 326

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 177/345 (51%), Gaps = 37/345 (10%)

Query: 20  TDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQ 79
            D+   W   +ES   +E VSG L   V           + +N   + + +R+YG   D 
Sbjct: 3   ADLFKNWSKLDESRFSVETVSGVLKVSV-----------KEENGNEVAITVRLYGPNTDY 51

Query: 80  LCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLS 139
           + +R++EL  ++ LS    G KLLGVF NG  +  +++ TL   D+R P  +  IA++L 
Sbjct: 52  VINRERELQAIKYLSAAGFGAKLLGVFGNGMVQSFIDARTLTPADMRKPKLAAEIAKQLH 111

Query: 140 QLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           + H +    P  +E   P++W  I K+Y  A  +I      E+Q+K  +   FK + DE+
Sbjct: 112 KFHEV--EIPGSKE---PQLWNEIFKFYENA--SILQFDDIEKQKK-YKTISFKEVYDEV 163

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEW 258
            E+K  L+  + +P+VFAHND   GN++   D   L  +DFEY  Y+Y+ FDI NHF E+
Sbjct: 164 VEIK-DLTDPLKAPVVFAHNDLLSGNLMLNEDKDKLYFIDFEYGSYSYRGFDIGNHFNEY 222

Query: 259 TYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEV 318
                    +  +  LYP++D+Q  F R Y+           + P E  D  L+ L +E 
Sbjct: 223 A-------GYDCDYSLYPSKDEQYHFFRHYLQP---------DKPYEVSDKDLEALYIET 266

Query: 319 YAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNE 363
             F LASH+ W LW L+Q+  S I+FDYL Y   R + ++  K +
Sbjct: 267 NTFMLASHLFWALWALIQAKMSPIEFDYLGYFFLRYNEYKRQKEK 311



>gi|12311795|emb|CAC24490.1| choline kinase [Pisum sativum]
          Length = 343

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 176/331 (53%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           + + S +++  + GA+TN VF +    K     +     RVL+R+YG GV+   DR  E+
Sbjct: 33  IDDVSVVEVNPLKGAMTNEVFEVNWPTKSDGHLR-----RVLVRLYGEGVEVFFDRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LL  F  GR E+ + + TL + DLRDP  S  IA ++ + HN+   
Sbjct: 88  QTFECMSKNGQGPRLLSRFTTGRVEEFIHARTLSAADLRDPEISSLIASKMKEFHNL--H 145

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P  +   K ++W  + KW    LN   SL C++   K ++ F    L  EI  L+  LS
Sbjct: 146 MPGAK---KAQIWQRMRKW----LNHAKSL-CSQ---KDIKIFGLDNLDAEINSLRELLS 194

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
                 I F HND QYGNI+   +  S+ ++D+EY+ YN  A+D+ANHFCE   DY S  
Sbjct: 195 DGYQE-IGFCHNDLQYGNIMMDEETRSITLIDYEYSSYNPVAYDLANHFCEMAADYHSDT 253

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++   YP+ +++  F+  Y+ +           PSE     +++L   V  +TLA+H
Sbjct: 254 PHVLDYTKYPDLEERRRFIHTYLSSEG-------EKPSEGE---VEQLVNVVEKYTLANH 303

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWGL+ +  + IDFDY  Y  +R  ++
Sbjct: 304 LFWGLWGLISNYVNTIDFDYKEYSRQRFQQY 334



>gi|507693039|ref|XP_004642493.1| PREDICTED: choline/ethanolamine kinase [Octodon degus]
          Length = 395

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 181/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GV+ L 
Sbjct: 60  AWRRVRPDELRVCPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVESLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP L GVF  GR EQ+L S  LK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPHLYGVFPEGRLEQYLPSRPLKTQELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L      +  L   +   LKDE+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPSATLLQMNL--LEMCSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
           + L+ K   +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 DNLR-KFLDSTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY +   P +K     YP ++QQ+ F+R Y+    +    T+  P E      + 
Sbjct: 282 CEWVYDYTQEEWPFYKAQPTDYPTQEQQLHFIRHYLA--EVKKGETL--PQEEQKKLEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQARFQFYFQQKRQL 388



>gi|406859236|gb|EKD12305.1| choline kinase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 813

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 134/406 (33%), Positives = 189/406 (46%), Gaps = 86/406 (21%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKL---HDQTKNKKPLRVLLRVYGNG 76
           L GW    +    DI+++R+SGALTN V+ ++  + L     +   K P ++LLR+YG  
Sbjct: 302 LKGWRRVPLERGGDIEVKRLSGALTNAVYVVSPPQDLPTPEGKAGLKPPAKLLLRIYGPQ 361

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+ L DR+ EL+ L  L+  +IGP+LLG FKNGRFE+   +ETL  +DLR  STSK IA+
Sbjct: 362 VEHLIDRENELSILRRLARKRIGPRLLGTFKNGRFEEFFNAETLTFDDLRIESTSKQIAK 421

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK----------- 185
           R+ +LH+ I++    +E+  P VW+N DKW       IS L       K           
Sbjct: 422 RMRELHDGIDLLEKERED-GPFVWLNWDKWVNTCEKIISYLDKEIGGGKEVKGELWRSRG 480

Query: 186 ---GLEEFDFKMLKDEIEEL--KYKLSHNIDSPIVFAHNDTQYGNILRL-----TDGS-- 233
              G+E   FK   D   +    Y     +   +VFAHNDTQYGNILRL     T GS  
Sbjct: 481 LICGVEWPQFKAAIDRYRKWLDSYYGKGGVYRRLVFAHNDTQYGNILRLVPESPTVGSAP 540

Query: 234 ------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPH-KMNLDLYPNEDQ 280
                       L+V+DFEYA  N    + ANHF EW Y+Y  +      N   YP  +Q
Sbjct: 541 SPLLLPENRHKQLIVIDFEYASANTPGLEFANHFTEWCYNYHDATRSWACNTQSYPTLEQ 600

Query: 281 QIDFLRAYIDA-----------------------------------------YSIPSDHT 299
           Q  F+R+Y++                                          +  PS++ 
Sbjct: 601 QKTFIRSYLNHRPQFNPRASTTPKLNPLEASSRNSISDFYLDSRTPGGSTSDFPSPSNYF 660

Query: 300 INNPSETHDNYLQKLKL--EVYAFTLASHVMWGLWGLVQSGQSQID 343
               S  H+  LQ   L  EV  + +A+   W  WG+VQ+    +D
Sbjct: 661 EEEASREHETELQVQDLIKEVRIWRIANSAQWVAWGIVQAQVPGLD 706



>gi|452823805|gb|EME30812.1| choline/ethanolamine kinase isoform 2 [Galdieria sulphuraria]
          Length = 389

 Score =  183 bits (465), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 116/334 (34%), Positives = 179/334 (53%), Gaps = 28/334 (8%)

Query: 22  MLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           ++P W    ++++++ERV G +TN +F ++  K   +   NK    VL+RV+G   + + 
Sbjct: 75  LVPDWRHLEDAELRVERVLGGITNRIFCVSVNKDAPNLFFNK----VLVRVFG--AEGII 128

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR+KE    E L+  +I P  +G F NGR E  L++  +   ++R P+ SK +AQ+L+ L
Sbjct: 129 DREKENEIFEQLAKNRIAPSFIGEFANGRIESWLQARCISIEEMRYPNISKAVAQKLAIL 188

Query: 142 HNIINICPPPQENIK----PEVWVNIDKWYPLALNAISSLKCTE---EQRKGLEEFDFKM 194
           H        PQ + K      VW +I  W   A  A+  L+ TE    +R  L++ D  +
Sbjct: 189 HRF-----QPQGHRKSLQDSPVWESIYAWLKEAKVALKQLENTELDDSRRLLLKQIDLLV 243

Query: 195 LKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILR-LTDGSLVVVDFEYAGYNYQAFDIAN 253
           L+ E+E L+  L     SPIVF+HND  +GNIL     G++  VDFEY+G+NY+ FDI N
Sbjct: 244 LEKELEFLRNTL-RKTPSPIVFSHNDLLFGNILYDEISGTVHFVDFEYSGWNYRGFDIGN 302

Query: 254 HFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           HFCE      + +P   +   YP E+QQ  F + Y+ +Y         N S  ++  ++ 
Sbjct: 303 HFCECMGGTDNGIP---DYTKYPTEEQQHLFCQHYLVSYG-----GFENVSSVNETDIKS 354

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYL 347
           L +E   + L SH  WG+W L  S    +DFDYL
Sbjct: 355 LMIEANRYALLSHFYWGMWALCLSVDQTVDFDYL 388



>gi|50553266|ref|XP_504043.1| YALI0E16907p [Yarrowia lipolytica]
 gi|49649912|emb|CAG79636.1| YALI0E16907p [Yarrowia lipolytica CLIB122]
          Length = 566

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 130/372 (34%), Positives = 192/372 (51%), Gaps = 59/372 (15%)

Query: 12  RNALIPLITDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQ--------- 59
           ++ L+ + T  +P W   + +  +D+ + R+SGALTN V+ +     L ++         
Sbjct: 110 QDILMLIHTLKIPKWKYVESTMAADMVVTRLSGALTNAVYHVAPPTYLKERLREANEGFV 169

Query: 60  TKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESET 119
            K++ PL +LLRVYG  V+ L DR  EL  L+ L    IGPK++G F NGRFEQ   ++T
Sbjct: 170 AKHRLPLPLLLRVYGPQVEHLIDRDSELRILQRLGRKNIGPKMMGTFTNGRFEQFFHAKT 229

Query: 120 LKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIK-PEVWVNIDKWYPLA-------- 170
           L   DLRDP TS  IA+R+ +LH+ + +   P+E +  P VWVN +KW   A        
Sbjct: 230 LSKEDLRDPDTSVQIAKRMRELHDHVRLL--PEERMSGPGVWVNFEKWGVRAKEVLEILD 287

Query: 171 ----LNAISSLKCTEEQRKGLEEFDFKMLK-DEIEELKYKLSHNIDSPIVFAHNDTQYGN 225
                N  +   C    +   +EF   + K     E K+  + +I+  +VFAHNDTQYGN
Sbjct: 288 NRAKTNPAAEWTCQTVVQSSWDEFLTMVAKYRSWLEHKHGGAESINKKLVFAHNDTQYGN 347

Query: 226 ILRL--TDGS-----------LVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV-PHKMN 271
           +LRL    GS           L+V+DFEYA  N + FDI NHFCEW  DY  +  P  ++
Sbjct: 348 LLRLEPPPGSPLLQPQLEHRQLIVIDFEYASPNARGFDICNHFCEWMSDYHDAQHPETIH 407

Query: 272 LDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ------KLKLEVYAFTLAS 325
              YP   +Q++ L  Y+       +H +    E+ D+  Q       L  EV  +  A 
Sbjct: 408 EKAYPTVKEQLNLLNGYV-------EHGL----ESFDDEDQIQVEVDGLMEEVRDWRPAV 456

Query: 326 HVMWGLWGLVQS 337
           H+ W +WG+VQ+
Sbjct: 457 HLYWLVWGIVQA 468



>gi|502093357|ref|XP_004489916.1| PREDICTED: choline/ethanolamine kinase-like [Cicer arietinum]
          Length = 343

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 114/332 (34%), Positives = 173/332 (52%), Gaps = 32/332 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           + + S +++  + GA+TN VF +    K     +     RVL+R+YG GV+   +R  E+
Sbjct: 33  IDDVSVVEVNPLKGAMTNEVFEVNWPTKSDSHLR-----RVLVRLYGEGVEVFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LLG F  GR E+ + + TL + DLRD   S  IA ++ + HN+   
Sbjct: 88  KTFECMSKNGQGPRLLGRFTTGRVEEFIHARTLSAADLRDREISSLIASKMKEFHNL--H 145

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P P+   K ++W  + KW    LN   SL C++   K +  F    L  EI  L   LS
Sbjct: 146 MPGPK---KAQIWPRMRKW----LNHAKSL-CSQ---KDINNFGLDNLDAEINMLGELLS 194

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
                 I F HND QYGNI+   +  S+ ++D+EYA YN  A+D+ANHFCE   +Y S  
Sbjct: 195 EGYQD-IGFCHNDLQYGNIMIDEETRSVTLIDYEYASYNPVAYDLANHFCEMAANYHSDT 253

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYS-IPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
           PH ++   YP+ D++  F+  Y+ +   +PSD  +       + Y           TLA+
Sbjct: 254 PHVLDYSKYPDLDERRRFIYTYLSSEGKMPSDAEVEQLVNAAEKY-----------TLAN 302

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           H+ WGLWGL+ S  + I+FDY  Y  +R  ++
Sbjct: 303 HLFWGLWGLISSYVNTIEFDYKEYSRQRFQQY 334



>gi|410907399|ref|XP_003967179.1| PREDICTED: choline kinase alpha-like [Takifugu rubripes]
          Length = 433

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 195/372 (52%), Gaps = 35/372 (9%)

Query: 2   KLGNDDNVTL--RNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHD 58
           K G  + V L  R+       D L G W    E D QI  VSG L+N ++  +   ++  
Sbjct: 73  KGGRSEEVDLDTRSRAFAWCRDFLSGSWKTLGEDDFQISIVSGGLSNLLYLCSLPARV-- 130

Query: 59  QTKNKKPLRVLLRVYG---NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHL 115
               ++P  VLLR+YG    GVD L     E     +L+   +GPKL G+F  GR EQ++
Sbjct: 131 PCVGEEPREVLLRIYGAILQGVDSLV---LESVMFAILAERTLGPKLYGIFPEGRLEQYI 187

Query: 116 ESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPE-VWVNIDKWYPLALNAI 174
            +  +++  L DPS S  IA +L++ H  + + P    N +P+ ++  IDK+    +  +
Sbjct: 188 PNTRMRTEQLSDPSISSEIAVKLARFH--LMVMP---FNKEPKWLFGTIDKYLAQVMK-L 241

Query: 175 SSLKCTEEQR-KGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRL---- 229
           S ++ T  ++ K L + D   L  E+E L+  L+    SP+VF HND Q GNIL L    
Sbjct: 242 SFVRDTHVKKYKKLMKLD---LPAELESLRALLAAT-PSPVVFCHNDVQEGNILALENRV 297

Query: 230 --TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFL 285
             +   L+++DFEY+ YNY+ FD  NHFCEW YDY     P +K + + YP   QQ+ F+
Sbjct: 298 HTSADRLMLIDFEYSSYNYRGFDFGNHFCEWMYDYTYDQWPFYKASPEKYPTRQQQLRFI 357

Query: 286 RAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFD 345
           RAY+      S     + ++  ++ +    +E   + LASH +WGLW ++Q+  S+I+F 
Sbjct: 358 RAYLTEQRRQSSGGDVDQAQMEEDMI----IEANRYALASHFLWGLWSIIQAKISKIEFG 413

Query: 346 YLSYGMERLHRF 357
           Y+ Y   R   +
Sbjct: 414 YMDYAQCRFDAY 425



>gi|508783766|gb|EOY31022.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gi|508783767|gb|EOY31023.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gi|508783768|gb|EOY31024.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
          Length = 384

 Score =  182 bits (463), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 191/358 (53%), Gaps = 36/358 (10%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           + + +I L  D+   W   ++S   +E VSG +TN +       K+  + +N   + V +
Sbjct: 47  MVSCVIELCKDLFGKWAKLDDSCFSVETVSGGITNLLL------KVSVKEENGDDVYVTV 100

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG   + + +R++EL  ++ LS    G KLLGVF+NG  +  + + TL S+D+R P  
Sbjct: 101 RLYGPNTEYVINRERELQAIKYLSAAGFGAKLLGVFENGMVQSFINARTLTSSDMRKPKL 160

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGL-EE 189
              IA++L + H +    P  +E   P++WV+I K++  A    S+L+  +  ++ + E 
Sbjct: 161 VAEIAKQLRRFHQV--EIPGSKE---PQLWVDILKFFEKA----SALQFEDIDKQMIYET 211

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTD--GSLVVVDFEYAGYNYQ 247
             F+ +  E+ +LK +L+  +++P+VFAHND   GN++ L D    L  +DFEY  YNY+
Sbjct: 212 ILFEEVHKEVTQLK-ELTGLLNAPVVFAHNDLLSGNLM-LNDEHDKLYFIDFEYGSYNYR 269

Query: 248 AFDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETH 307
            FDI NHF E+         +  +  LYP++D+Q  F R Y+             P E  
Sbjct: 270 GFDIGNHFNEYA-------GYDCDYSLYPSKDEQYLFFRHYLQP---------EKPYEVS 313

Query: 308 DNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 365
           +  L+ L +E   F LASH+ W LW ++Q+  S IDFDYL Y   R + ++  K   +
Sbjct: 314 EKDLEALYVETNTFMLASHLYWALWAIIQARMSPIDFDYLGYFFLRYNEYKRQKEMCF 371



>gi|507532817|ref|XP_004650480.1| PREDICTED: choline/ethanolamine kinase [Jaculus jaculus]
          Length = 396

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 179/351 (50%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +  +  H  +  ++P  VLLR+YG    GVD L 
Sbjct: 61  AWRRVRPEELRVCPVSGGLSNLLFRCSLPE--HLPSVGEEPREVLLRLYGAILQGVDSLV 118

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LR+P  S  IA +++  
Sbjct: 119 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTRELREPVLSAAIATKMAHF 175

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L E     LKDE+
Sbjct: 176 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPSTGLPQMNLVEM--YSLKDEM 223

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL     SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 224 NNLR-KLLDATPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF 282

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP   QQ+ F+R Y+    I    T++   E      + 
Sbjct: 283 CEWVYDYTHEEWPFYKARPTDYPTRGQQLHFIRHYLA--EIKKSETLS--PEEQKKLEED 338

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L  EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 339 LLTEVNRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKMQL 389



>gi|58271652|ref|XP_572982.1| choline kinase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134114756|ref|XP_773676.1| hypothetical protein CNBH1310 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256304|gb|EAL19029.1| hypothetical protein CNBH1310 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229241|gb|AAW45675.1| choline kinase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 519

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 194/398 (48%), Gaps = 67/398 (16%)

Query: 23  LPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPL-------------- 66
           +P W  +    ++I +++VSGALTN VFF++     +  + ++ PL              
Sbjct: 119 VPRWSSTLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPP 178

Query: 67  ---------RVLLRVYGNGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLE 116
                     +L RVYG   + L  R +EL  L +LS    IGP++ G F NGR E+   
Sbjct: 179 PLTPDQYPHTLLFRVYGPSSEALISRSEELRILHVLSTQYGIGPRVFGTFTNGRVEEFFP 238

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNI--INICPPPQENIKPEVWVNIDKWYPLALNAI 174
           S  L + +LRDPS S+ IA+R+ +LH++    +        +P +W+ + +W   A + I
Sbjct: 239 SRALTAQELRDPSISRGIARRMRELHSVDLRRLGYEQGRATEPALWICLKEWSEAAEDVI 298

Query: 175 SSLKCTEEQRKG-LEEFDFKMLKDEIEELK--YKLSHNIDSPIVFAHNDTQYGNILRLTD 231
           +SL       +  +E F    +++E+   +   +      S +VFAHNDTQYGN+LRL D
Sbjct: 299 TSLTALGGTLEAWVERFSLHRIREEVTIYRNFVESQSGKGSGVVFAHNDTQYGNLLRL-D 357

Query: 232 GSL----------VVVDFEYAGYNYQAFDIANHFCEWTYDY------RSSVPHKMNLDLY 275
             L          +V+DFEYA  N + +DIANHF EW  +Y       S +PH      Y
Sbjct: 358 VELPPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRANYHHPTHSHSLIPHFP----Y 413

Query: 276 PNEDQQIDFLRAY--IDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 333
           P   Q+ DF R+Y  ++      +  +    +   + +  L+ EV  ++    + W LWG
Sbjct: 414 PTPIQREDFYRSYLSVEVDGRNGEEVVGKRKDVPADKVAALEREVRIWSPGCSINWALWG 473

Query: 334 LVQSGQSQI------------DFDYLSYGMERLHRFRE 359
           LVQ+ + Q+            +FDYLSY  ERL  FR+
Sbjct: 474 LVQA-EEQVCALATKKEGYVPEFDYLSYAAERLEMFRD 510



>gi|153792296|ref|NP_001093482.1| choline/ethanolamine kinase [Danio rerio]
 gi|190337575|gb|AAI63504.1| Choline kinase beta [Danio rerio]
 gi|190338436|gb|AAI63518.1| Choline kinase beta [Danio rerio]
          Length = 451

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 187/351 (53%), Gaps = 43/351 (12%)

Query: 21  DMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTK--NKKPLRVLLRVYG--- 74
           D L G W V  E D QI+ VSG L+N ++  +    L D  K    +P RVLLR+YG   
Sbjct: 116 DFLSGSWKVITEHDFQIKIVSGGLSNLLYMCS----LPDDVKPAGVEPRRVLLRIYGAIL 171

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
            GVD L     E     +L+  ++GP+L G+F  GR EQ+L S  L++  L     S  I
Sbjct: 172 QGVDSLV---LESVMFAILAERELGPRLYGIFPEGRLEQYLPSNRLRTEQLSYSQISAEI 228

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKM 194
           A ++++ H +      P       ++  ID++    ++ + +LK   E    +++F+  M
Sbjct: 229 ASKMARFHGM----EMPFNKEPKWLFGTIDRY----MDQVKTLKFVREAH--IKKFNKLM 278

Query: 195 ---LKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG------SLVVVDFEYAGYN 245
              L  E+E L+  L+    SP+VF HND Q GNIL L DG       L+++DFEY+ YN
Sbjct: 279 KYDLPAELESLRSLLAAT-PSPVVFCHNDVQEGNILML-DGRENSADKLMLIDFEYSSYN 336

Query: 246 YQAFDIANHFCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNP 303
           Y+ FD  NHFCEW YDY     P +K  ++ YPN +QQ+ F+R Y+      S+    +P
Sbjct: 337 YRGFDFGNHFCEWIYDYTYDQWPFYKAKVENYPNREQQLHFIRHYL------SEKGGVSP 390

Query: 304 SETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERL 354
           ++      + + +E   F LASH +WGLW ++Q+  S+I+F Y+ Y   R 
Sbjct: 391 AD-QARIEEDMIIEANRFALASHFLWGLWSIIQAKLSKIEFGYMDYAQHRF 440



>gi|494825067|gb|EON62285.1| hypothetical protein W97_01506 [Coniosporium apollinis CBS 100218]
          Length = 782

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 162/316 (51%), Gaps = 50/316 (15%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQT-KNKKPLRVLL-------- 70
           L GW    +    +I++ER+SGALTN V+ ++  K L  Q   N    R L         
Sbjct: 259 LKGWRRVPMDKSGEIEVERLSGALTNAVYVVSPPKDLPTQKPANGDGSRSLTPKKPPPKL 318

Query: 71  --RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
             R+YG  V+ L DR+ EL  L  L+  +IGP+LLG FKNGRFE+   + TL   DLR+P
Sbjct: 319 LLRIYGPQVEHLIDREAELQILRRLARKRIGPRLLGTFKNGRFEEFFHARTLTPKDLRNP 378

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL---------KC 179
            TSK IA+R+ +LH  I++ P  +E+  P VW N DKW       ++ L         K 
Sbjct: 379 ETSKQIAKRMRELHEGIDLLPQERED-GPFVWRNWDKWVDRCEQLVTWLDEQVRAYDGKS 437

Query: 180 TE------EQRKGLEEFDFKMLKDEIE------ELKYKLSHNIDSPIVFAHNDTQYGNIL 227
            E      +QR  +   ++   +  +E      + K+  +  +   +VFAHNDTQYGNIL
Sbjct: 438 GEGRADVWKQRGFVCGTEWAFFRQTLELYRKWLDEKHGGADKVKEDLVFAHNDTQYGNIL 497

Query: 228 RLTDGS-------------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLD 273
           RL                 LVV+DFEYA  N    + ANHF EW Y+Y     P+ ++ +
Sbjct: 498 RLEPAGESPLLLPTNEHKQLVVIDFEYANANTPGLEFANHFTEWCYNYHDEKAPYALHTE 557

Query: 274 LYPNEDQQIDFLRAYI 289
            YP  ++Q  F+RAY+
Sbjct: 558 RYPTPEEQHRFIRAYV 573



>gi|217072234|gb|ACJ84477.1| unknown [Medicago truncatula]
 gi|388509770|gb|AFK42951.1| unknown [Medicago truncatula]
          Length = 343

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 175/331 (52%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           + + S +++  + GA+TN VF +    K     +     RVL+R+YG GV+   +R  E+
Sbjct: 33  IDDVSTVEVNPLKGAMTNQVFEVNWPTKSDGHLR-----RVLVRLYGEGVEVFFNRDDEI 87

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LLG F  GR E+ + + TL ++DLRDP  S  IA ++ + HN+   
Sbjct: 88  QTFECMSKNGQGPRLLGRFTTGRVEEFIHARTLSASDLRDPEISSLIASKMKEFHNL--H 145

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P  +   K ++W  + KW    LN   SL C++   K +  F    L  E+  L+  LS
Sbjct: 146 MPGAK---KAQIWQRMRKW----LNHAKSL-CSQ---KDIINFGLDNLDAELSMLRALLS 194

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
                 I F HND QYGNI+   +  S+ ++D+EY+ YN  A+D+ANHFCE   +Y +  
Sbjct: 195 EEYQE-IGFCHNDLQYGNIMMDEETRSITLIDYEYSSYNPVAYDLANHFCEMAANYHTDT 253

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++   YP+ +++  F+  Y+ +           PS    + L  L   V  +TLA+H
Sbjct: 254 PHVLDYSKYPDLEERRRFIYTYLSSEG-------EKPSGAQVDQLANL---VEKYTLANH 303

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWGL+ S  + IDFDY  Y  +R  ++
Sbjct: 304 LFWGLWGLISSYVNTIDFDYKEYSRQRFKQY 334



>gi|329744645|ref|NP_001193289.1| choline/ethanolamine kinase [Sus scrofa]
 gi|222090418|gb|ACM42417.1| choline/ethanolamine kinase [Sus scrofa]
          Length = 395

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 180/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      +++++ VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVRPEELRVDPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+++LR+P  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERALGPQLYGVFPEGRLEQYIPSRPLKTHELREPVLSAAIATKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LK+E+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPTGLPQMNL--LEMYSLKEEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL     SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GSLR-KLLDTTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP   QQ+ F+R Y+    +    TI+   E        
Sbjct: 282 CEWVYDYTHEEWPFYKAQPADYPTRGQQLHFIRHYLA--EVKKGETISQ--EEQRKLEAD 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQSYFQQKAQL 388



>gi|488561022|ref|XP_004470399.1| PREDICTED: choline/ethanolamine kinase isoform 2 [Dasypus
           novemcinctus]
          Length = 435

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/335 (35%), Positives = 177/335 (52%), Gaps = 35/335 (10%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W +    ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRLVRPEELRVNPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S TLK+ +LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRTLKTRELREPVFSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  +   +  L   +   LK+E+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPSGLPQVNL--LEMYSLKEEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GNLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPGSADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  DQQ+ F+R Y+             PS+     L++
Sbjct: 282 CEWVYDYTHEEWPFYKAQPADYPTRDQQLHFIRHYLAEVK-----KGETPSQEEQRKLEE 336

Query: 314 -LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYL 347
            L +E+  + LASH  WGLW ++Q+  S I+F YL
Sbjct: 337 DLMVEISRYALASHFFWGLWSILQASMSTIEFGYL 371



>gi|73968807|ref|XP_848257.1| PREDICTED: choline/ethanolamine kinase isoform 1 [Canis lupus
           familiaris]
          Length = 395

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   +++++ VSG L+N +F  +     H  +  K+P  VLLR+YG    GVD L 
Sbjct: 60  AWRRARPEELRVDPVSGGLSNLLFRCSLPD--HLPSVGKEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTCELREPVLSAEIATKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T+  +  L   +   LKDE+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPTDLPQMNL--LEMYSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS----LVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++      L++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GNLR-KLLDSTPSPVVFCHNDVQEGNILLLSEPENTDRLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP   QQ+ F+R Y+ A     D TI+   E      + 
Sbjct: 282 CEWVYDYTHEEWPFYKAQPADYPTRGQQLHFIRHYL-AEGKKGD-TISQ--EEQRKLEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGQL 388



>gi|449441183|ref|XP_004138363.1| PREDICTED: probable ethanolamine kinase A-like isoform 1 [Cucumis
           sativus]
 gi|449526906|ref|XP_004170454.1| PREDICTED: probable ethanolamine kinase A-like isoform 1 [Cucumis
           sativus]
          Length = 386

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 183/346 (52%), Gaps = 34/346 (9%)

Query: 18  LITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGV 77
           L  D+   W   + S   +E VSG +TN +  +T       + ++   + V +R+YG   
Sbjct: 52  LCKDLFKEWSELDASRFSVETVSGGITNQLLKVTV------KEESGTSVSVTVRLYGPNT 105

Query: 78  DQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQR 137
           D + +R +EL  ++ LS    G KLLGVFKNG  +  + + TL+ +DLR P  +  IA++
Sbjct: 106 DYVINRDRELQAIKYLSAAGFGAKLLGVFKNGMVQSFIHARTLEPSDLRKPELAAEIAKQ 165

Query: 138 LSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGL-EEFDFKMLK 196
           L++ H +      P  N +P++W  I  +Y  A    S+L+  +  ++ + +   F+ + 
Sbjct: 166 LNKFHKVY----IPGSN-EPQLWNEILNFYDKA----STLQFDDTGKQSIYDTISFQEIH 216

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHF 255
           +EI E+K +L+  +++PIVFAHND   GN+ L   +G L  +DFEY  Y+Y+ FDI NHF
Sbjct: 217 NEILEIK-ELTSLLNAPIVFAHNDLLSGNLMLNEEEGRLYFIDFEYGSYSYRGFDIGNHF 275

Query: 256 CEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
            E+         +  +   YP++++Q  F R Y+             P E     L+ L 
Sbjct: 276 NEYA-------GYDCDYSCYPSKEEQYHFFRHYLQP---------EKPDEVSQKDLEALY 319

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           +E   F LASH+ W LW L+Q+  S IDFDYLSY   R   +++ K
Sbjct: 320 VESNTFMLASHLYWALWALIQARMSPIDFDYLSYFFLRYGEYKKQK 365



>gi|466057553|ref|XP_004279673.1| PREDICTED: choline/ethanolamine kinase [Orcinus orca]
 gi|470607320|ref|XP_004314559.1| PREDICTED: choline/ethanolamine kinase [Tursiops truncatus]
          Length = 395

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 178/351 (50%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      +++++ VSG L+N +F  +     H     ++P  VLLR+YG    GVD L 
Sbjct: 60  AWRRVRPEELRVDPVSGGLSNLLFRCSLPD--HLPRVGEEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+++LR+P  S  IA +++Q 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTHELREPVLSAAIATKMAQF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   L+DE+
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPTTGLPQMNL--LEMYSLQDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++      L++VDFEY+ YNY+ FDI NHF
Sbjct: 223 GSLR-KLLDSTPSPVVFCHNDIQEGNILLLSEPENVDGLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP   QQ+ F+R Y+    +    TI+   E        
Sbjct: 282 CEWVYDYTHEEWPFYKAQPANYPTRGQQLHFIRHYLA--EVKKGETISQ--EEQRKLEAD 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L  E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K E+
Sbjct: 338 LLAEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGEL 388



>gi|242088613|ref|XP_002440139.1| hypothetical protein SORBIDRAFT_09g026700 [Sorghum bicolor]
 gi|241945424|gb|EES18569.1| hypothetical protein SORBIDRAFT_09g026700 [Sorghum bicolor]
          Length = 374

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 174/324 (53%), Gaps = 30/324 (9%)

Query: 39  VSGALTNCVF----FITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLS 94
           + GA+TN V+     IT T         +    VL+RVYG GVD   DR+ E+   E +S
Sbjct: 64  LKGAMTNEVYQARWAITTTTGGGGAEAGRDARTVLVRVYGEGVDLFFDREDEVRTFEFMS 123

Query: 95  NLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQEN 154
              +GP+LLG F NGR E+ + + TL + DLRDP  S  IA +L + H++     P  + 
Sbjct: 124 RHGLGPRLLGRFPNGRVEEFIHARTLSAPDLRDPEISAIIASKLREFHSLDM---PGSKY 180

Query: 155 IKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSPI 214
           +   +W  +  W    L    SL  ++E +    EF    +++EI  L+ + S   +  +
Sbjct: 181 VL--IWERLRNW----LKTAKSLYSSDEAK----EFCLDSMEEEITALENEFSEECER-V 229

Query: 215 VFAHNDTQYGNILRLTDGSLV-VVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNLD 273
            F HND QYGNI+   +  L+ ++D+EYA +N  A+DIANHFCE   DY S  PH ++  
Sbjct: 230 GFCHNDLQYGNIMIDEETKLLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHILDYS 289

Query: 274 LYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 333
            YP+ +++  F++ Y+ +    S+  + N  ++ +NY           TLASH++WGLWG
Sbjct: 290 KYPDTNERKKFVQTYLSSSGEESEVEVENLIKSIENY-----------TLASHLVWGLWG 338

Query: 334 LVQSGQSQIDFDYLSYGMERLHRF 357
           ++    + IDFDY  Y  +R  ++
Sbjct: 339 IISDHVNDIDFDYKEYARQRFEQY 362



>gi|315043496|ref|XP_003171124.1| choline kinase [Arthroderma gypseum CBS 118893]
 gi|311344913|gb|EFR04116.1| choline kinase [Arthroderma gypseum CBS 118893]
          Length = 868

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/400 (31%), Positives = 186/400 (46%), Gaps = 96/400 (24%)

Query: 33  DIQIERVSGALTNCVFFITRTKKLHDQTKN--------KKPLRVLLRVYGNGVDQLCDRQ 84
           ++++ R+SGALTN V+ ++  K +   +++        K P ++LLR+YG  V+ L DR+
Sbjct: 359 EVEVIRLSGALTNAVYQVSPPKDMSKYSQSTSSQGLIRKPPPKLLLRIYGPQVEHLIDRE 418

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            EL  L  L    IGP++LG FKNGRFEQ+L + TL + DLR P TS  IA+R+ +LH  
Sbjct: 419 HELQVLRRLGKRNIGPRVLGTFKNGRFEQYLHARTLTTRDLRIPETSIQIAKRMRELHEG 478

Query: 145 INICPPPQENIKPEVWVNIDKWYPLALNAISSL------------KCTEEQRK-----GL 187
           I++  P + +  P +W N DKW       I+ L               E  RK     G+
Sbjct: 479 IDLL-PEERDAGPGLWKNWDKWVNRCEKVITWLDSEILADHNEGKSAKEPWRKRGFVCGV 537

Query: 188 EEFDFKMLKDEIEE---LKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS----------- 233
               F+ + D   +   + +     I   ++FAHNDTQYGN+LRL               
Sbjct: 538 PWQTFQSMVDRYRQWLVVSFGGIEEITRRLIFAHNDTQYGNLLRLEPSGESPLLLPANEH 597

Query: 234 --LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQIDFLRAY-- 288
             L+V+DFEYA  N +  + ANHF EW Y+Y     P + N   YP  ++Q  F+RAY  
Sbjct: 598 KQLIVIDFEYAAANMRGAEFANHFTEWCYNYHDEDRPWRCNTAWYPTLEEQKRFIRAYLT 657

Query: 289 ------------------------------------------------IDAY--SIP-SD 297
                                                           +DAY  S+P S 
Sbjct: 658 HRPRLISETYNNAYPSGQNISTSSVSSTMTTPGLRPTYSSSPRVTPFNLDAYTPSVPFSI 717

Query: 298 HTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQS 337
             ++   E  +  +QKL  EV A+ +A+  MW  WG+VQ+
Sbjct: 718 SEVDQIDEELEVEVQKLLQEVRAWRIANSAMWVAWGIVQA 757



>gi|224082510|ref|XP_002306722.1| predicted protein [Populus trichocarpa]
 gi|222856171|gb|EEE93718.1| predicted protein [Populus trichocarpa]
          Length = 359

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 178/331 (53%), Gaps = 30/331 (9%)

Query: 28  VSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKEL 87
           V +   +Q+  + GA+TN VF I    K  +  +     ++++R+YG GV+   +R  E+
Sbjct: 32  VDDMESLQVIPLKGAMTNEVFQINWPTKCGNLDR-----KLVVRIYGEGVEAFFNRDDEI 86

Query: 88  NFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINI 147
              E +S    GP+LLG F +GR E+ + + TL + DLRD   S  +A ++ + HN+   
Sbjct: 87  RTFECMSKHGQGPRLLGRFADGRVEEFIHARTLSAADLRDHEISALVAAKMREFHNL--E 144

Query: 148 CPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLS 207
            P P+  +   +W  +  W   A  ++ S KC       ++EF    L+DEI  L+ +LS
Sbjct: 145 MPGPRTVL---LWNRMRDWLVEA-KSMCSAKC-------VKEFRLDSLEDEISMLEKELS 193

Query: 208 HNIDSPIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSV 266
           H+    I F HND QYGNI+   +  S+ ++D+EYA +N  A+D+ANHFCE   +Y S  
Sbjct: 194 HDY-LDIGFCHNDLQYGNIMLDEETRSITLIDYEYASFNPVAYDLANHFCEMVANYHSGT 252

Query: 267 PHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASH 326
           PH ++ + YP  +++  F+  Y+ +           P E     L     EV  +TLASH
Sbjct: 253 PHILDYNKYPGLEERRRFVDTYLSSEG-------KQPIEDEAVLLLH---EVERYTLASH 302

Query: 327 VMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
           + WGLWG++    ++IDFDY+ Y  +R  ++
Sbjct: 303 LFWGLWGIISGYVNKIDFDYMEYARQRFRQY 333



>gi|502087427|ref|XP_004488530.1| PREDICTED: probable ethanolamine kinase A-like isoform X2 [Cicer
           arietinum]
          Length = 314

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 175/345 (50%), Gaps = 39/345 (11%)

Query: 22  MLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           M   W   ++S   IE++SG L           K+  +  N     + +R+YG   + + 
Sbjct: 1   MFKAWSKLDDSCFHIEKISGVL-----------KVSVKQGNSIDDIITIRLYGPNTEFII 49

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR +EL  ++ ++    G   LG+F NG  +  + + TL  +D+RDP  +  IA++L + 
Sbjct: 50  DRHRELQAIKYITAAGFGATWLGIFGNGMVQSFINAYTLTPSDMRDPKLAAKIAKQLRRF 109

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFKMLKDEIE 200
           H++    P  +E   P++W +I K++  A N    LK  + E++K  E   F  L DEI 
Sbjct: 110 HHVE--IPGSKE---PQLWNDIRKFFEKACN----LKFDDTEKQKTYEAISFTELHDEIY 160

Query: 201 ELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAFDIANHFCEWT 259
           +L+  L   + SP++FAHND   GNI+    +  L  +D+EYA YNY+ FDI NHF E+ 
Sbjct: 161 KLQL-LCDRLKSPVIFAHNDLLSGNIMINHEEDKLYFIDYEYASYNYRGFDIGNHFAEYA 219

Query: 260 YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVY 319
                      +  LYPN ++Q  F R Y+             P E     L+ L +E  
Sbjct: 220 -------GFDCDFSLYPNRNEQFHFFRHYLQP---------ERPQEVPQKDLEALYIEAN 263

Query: 320 AFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + LASH+ W LWGL+Q+  S IDFDYL Y  +R   ++  K++V
Sbjct: 264 TYALASHLFWALWGLIQAKMSPIDFDYLGYFFKRYKEYKRQKDQV 308



>gi|302760153|ref|XP_002963499.1| hypothetical protein SELMODRAFT_438648 [Selaginella moellendorffii]
 gi|300168767|gb|EFJ35370.1| hypothetical protein SELMODRAFT_438648 [Selaginella moellendorffii]
          Length = 350

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 185/344 (53%), Gaps = 35/344 (10%)

Query: 22  MLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLC 81
           ++ GW    + D+ I  +SG +TN +       K+ D+ +N+    V +R++G   D + 
Sbjct: 30  LVSGWSDLGDDDLAISEISGGITNLLL------KVLDKKQNEA---VTVRIFGPNTDAVI 80

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
           DR++EL  L  LS    G KL+G+F+NG  +  +E+ TL   DL  P+ +  IA+ L +L
Sbjct: 81  DRKRELQVLPHLSESDFGAKLVGLFENGMIQSFIEARTLVPVDLSKPNVASLIAKELRRL 140

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEE 201
           H++    P  +E   P++W +I K+Y  A   +S     +++R G  E  F  L D+I+ 
Sbjct: 141 HSL--QIPGSKE---PQLWEDILKFYDKA-RLVSFEDNAKQERLG--EVSFSRLMDDIKM 192

Query: 202 LKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIANHFCEWTY 260
           LK  +S ++ +PIVF+HND   GNI L    G L ++DFEY  Y+Y+ +DI NHF E+  
Sbjct: 193 LK-GISDSLKAPIVFSHNDLLSGNIMLNEASGRLHLIDFEYGSYSYRGYDIGNHFNEYA- 250

Query: 261 DYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYA 320
                   + +  LYPN++ Q  F R Y+     P D     PS+  D+ L+ L +E   
Sbjct: 251 ------GFECDYSLYPNKEAQYHFFRHYLS----PID-----PSKVSDDELEVLFVETNF 295

Query: 321 FTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           + L SH+ W +W +VQ+  S I+FDYL Y   R   +   K E+
Sbjct: 296 YALVSHLYWAIWAIVQAKFSPINFDYLGYHCLRYKEYERRKKEL 339



>gi|392870339|gb|EAS32131.2| choline kinase [Coccidioides immitis RS]
          Length = 787

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 194/407 (47%), Gaps = 95/407 (23%)

Query: 23  LPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN---------KKPLRV 68
           L GW     +VS E  +++ R+SGALTN V+ ++  K L    ++         K P ++
Sbjct: 280 LKGWRRVPLEVSGE--VEVVRLSGALTNAVYVVSPPKNLPMAQRSESSLPSVPRKPPPKL 337

Query: 69  LLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDP 128
           LLRVYG  V+ L DR++EL  L  L    IGP++LG F NGRFEQ+  ++ L + +LR P
Sbjct: 338 LLRVYGPQVEHLIDRERELQILRRLGKRNIGPRVLGTFNNGRFEQYFHAKPLTTKELRVP 397

Query: 129 STSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLA-----------LNAISSL 177
            TSK I++R+ +LH+ I++ P  +E+  P +W N DKW               LN  +S 
Sbjct: 398 ETSKQISKRMRELHDGIDLLPEERES-GPSLWKNWDKWVGRCEKVTTWLDQEILNGNNSS 456

Query: 178 KCTEEQRK------GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILR 228
           K + E  +       +    F+ + D      E  +  +  I   +VFAHNDTQYGN+LR
Sbjct: 457 KASNEPWRWRGFVCCVPWQSFRAVVDRYRKWLEEHFGGAGEISKRLVFAHNDTQYGNLLR 516

Query: 229 LTDG-------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDL 274
           L                 L+V+DFEYA  N +  + ANHF EW Y+Y  +  P   + + 
Sbjct: 517 LQPSEESPLLLPANEHKQLIVIDFEYASANMRGVEFANHFTEWCYNYHDAERPWACHTNW 576

Query: 275 YPNEDQQIDFLRAYI-----------DAYSIPSDH---TINNPSETH---------DNY- 310
           YP +++Q  F+RAY+           D  + P+ H   ++  P+ T          D Y 
Sbjct: 577 YPTQEEQERFIRAYLRHQSGLTAQPADISTPPATHPSVSVTRPTHTSSPRVPPFLLDTYV 636

Query: 311 --------------------LQKLKLEVYAFTLASHVMWGLWGLVQS 337
                               +Q L  E   + +A+ V W  WG+VQ+
Sbjct: 637 PGVSPPLTDYENRDPAEEAEVQHLLHETRLWRVANSVQWIAWGIVQA 683



>gi|403282836|ref|XP_003932844.1| PREDICTED: choline/ethanolamine kinase [Saimiri boliviensis
           boliviensis]
          Length = 435

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 181/354 (51%), Gaps = 39/354 (11%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 100 AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 157

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA ++++ 
Sbjct: 158 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMARF 214

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLK 196
           H +           K   W+   ++++    L  I  L  T     GL E    +   LK
Sbjct: 215 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLK 259

Query: 197 DEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIA 252
           DE+  L+ K   +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI 
Sbjct: 260 DEMGNLR-KFLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIG 318

Query: 253 NHFCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNY 310
           NHFCEW YDY     P +K     YP + QQ+ F+R Y+         T++   E     
Sbjct: 319 NHFCEWVYDYTHEEWPFYKARPTDYPTQGQQLHFIRHYLA--EAKKGETLSQ--EEQRKL 374

Query: 311 LQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            + L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 375 EEDLLVEVNRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKRQL 428



>gi|225470840|ref|XP_002265759.1| PREDICTED: choline/ethanolamine kinase [Vitis vinifera]
 gi|296083138|emb|CBI22774.3| unnamed protein product [Vitis vinifera]
          Length = 358

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 183/348 (52%), Gaps = 34/348 (9%)

Query: 11  LRNALIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           LR  LI L +    G  V +   +++  + GA+TN ++ I    +   ++       VL+
Sbjct: 17  LRKLLISLASSW--GDVVDDPKKLRVIPLKGAMTNEIYQINWPIEAGTRS-------VLV 67

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           RVYG GV+   DR  E+   E +S    GP+LLG F +GR E+ + ++TL + DLRDP  
Sbjct: 68  RVYGEGVEVFFDRDDEIRTFECMSEHGHGPRLLGRFADGRVEEFIHAKTLSAADLRDPEI 127

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEF 190
           S  +A +L + H +    P P+      +W  +  W   A    S         K  +EF
Sbjct: 128 SALVAAKLREFHRL--EMPGPKNVF---LWDRMRNWVGEAKRLSSP--------KDAKEF 174

Query: 191 DFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQAF 249
               L++EI  L+ + S +    I F HND QYGNI+      ++ ++D+EYA YN  A+
Sbjct: 175 CLDTLEEEISMLQKEFSQD-HQDIGFCHNDLQYGNIMIDEKTRAITIIDYEYASYNPVAY 233

Query: 250 DIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDN 309
           D+ANHFCE   +Y +  PH ++   YP+++++  F+R Y+ +         N PS   D+
Sbjct: 234 DLANHFCEMVANYHTDTPHILDYSKYPDQEERHRFIRTYLSSAG-------NQPS---DS 283

Query: 310 YLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRF 357
            ++KL  +   +TLA+H+ WG+WG++    + I+F+Y+ Y  +R  ++
Sbjct: 284 EVEKLACDAEKYTLANHLFWGIWGIISGHVNTIEFNYMEYARQRFQQY 331



>gi|426227258|ref|XP_004007736.1| PREDICTED: choline/ethanolamine kinase [Ovis aries]
          Length = 341

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 174/337 (51%), Gaps = 33/337 (9%)

Query: 39  VSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLCDRQKELNFLEMLSN 95
           +SG L+N +F  +     H  +  ++P  VLLR+YG    GVD L     E     +L+ 
Sbjct: 20  ISGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV---LESVMFAILAE 74

Query: 96  LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENI 155
             +GP+L GVF  GR EQ++ S  LK+++LRDP  S  IA ++++ H +           
Sbjct: 75  RSLGPQLYGVFPEGRLEQYIPSRPLKTHELRDPVLSAAIATKMAKFHGM------EMPFT 128

Query: 156 KPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
           K   W+   ++++    L  I  L  T   +  L   +   LKDE+  L+ KL     SP
Sbjct: 129 KEPHWLFGTMERY----LKQIQDLPPTGLPQMNL--LEMYSLKDEMGNLR-KLLDTTPSP 181

Query: 214 IVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSVP- 267
           +VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHFCEW YDY     P 
Sbjct: 182 VVFCHNDIQEGNILLLSEPKNTDSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPF 241

Query: 268 HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHV 327
           +K     YP E QQ+ F+R Y+    +     I+   E   N    L +E   + LASH 
Sbjct: 242 YKAQPANYPTEGQQLHFIRHYLA--EVKKGEAISQ--EEQRNLEADLLVEANRYALASHF 297

Query: 328 MWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            WGLW ++Q+  S I+F YL Y   R   + + K  +
Sbjct: 298 FWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKGRL 334



>gi|189208991|ref|XP_001940828.1| ethanolamine kinase [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187976921|gb|EDU43547.1| ethanolamine kinase [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 494

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 172/327 (52%), Gaps = 50/327 (15%)

Query: 27  DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNK--------KPLRVLLRVYGNGVD 78
           ++SNE D+Q  R+SGALTN V+ ++  K L  Q +N+         P ++LLR+YG  V+
Sbjct: 2   ELSNEIDVQ--RLSGALTNAVYVVSPPKNLPAQEQNEDGPPKPRNPPPKLLLRIYGPQVE 59

Query: 79  QLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRL 138
            L DR+ EL  L  L+  +IGP+LLG F NGRFE+ L ++ L S +LR+  TSK IA+R+
Sbjct: 60  HLIDRESELQILTRLARKRIGPRLLGTFTNGRFEEFLHAKPLTSKELRNADTSKQIAKRM 119

Query: 139 SQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRK------------- 185
            +LH  I++    +E   P VW N DKW       ++ L     + K             
Sbjct: 120 RELHEGIDLLKEERE-AGPFVWQNWDKWVERCEYIVTWLDQQIREAKQNATPSSSDKWKK 178

Query: 186 -----GLEEFDFKMLKDEIE---ELKYKLSHNIDSPIVFAHNDTQYGNILRLTDGS---- 233
                G E   F+ + ++     E +Y     I+  +VFAHNDTQYGNILR+        
Sbjct: 179 LGYVCGTEWPVFRQMIEKYRRWLEEQYGGIDKINERMVFAHNDTQYGNILRMVPQGESPL 238

Query: 234 ---------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQID 283
                    LVV+DFEYA  N    + ANHF EWTY+Y  + VP + N   YP  ++Q  
Sbjct: 239 LLPANQHKQLVVIDFEYANANLPGLEFANHFTEWTYNYHDAEVPWRCNTKYYPTIEEQHR 298

Query: 284 FLRAYI---DAYSIPSDHTINNPSETH 307
           F+RAY+    +Y     +T +NP+  H
Sbjct: 299 FIRAYLMHNPSYKASGGYT-SNPATPH 324



>gi|348551576|ref|XP_003461606.1| PREDICTED: choline/ethanolamine kinase-like [Cavia porcellus]
          Length = 395

 Score =  181 bits (458), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 180/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GV+ L 
Sbjct: 60  AWRRVRPEELRVCPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVESLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LR+P  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELREPVLSAAIATKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LKDE+
Sbjct: 175 HGM------EMPFTKEPRWLFGTMERY----LKQIQDLPSTTLLQMNL--LEMYSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
           + L+ K   +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 223 DNLR-KFLDSTPSPVVFCHNDIQEGNILLLSEPEHADSLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  +QQ+ F+R Y+    +    T+    E      + 
Sbjct: 282 CEWVYDYTHEEWPFYKAQPTDYPTREQQLHFIRHYLA--EVKKGKTVAQ--EEQKKLEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQARFQFYFQQKRQL 388



>gi|470101773|ref|XP_004287343.1| PREDICTED: probable ethanolamine kinase A-like [Fragaria vesca
           subsp. vesca]
          Length = 377

 Score =  180 bits (457), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 186/353 (52%), Gaps = 38/353 (10%)

Query: 15  LIPLIT----DMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLL 70
           + PL+T    D+   W   ++S   +E VSG +TN +  +  T K  D  +    + V +
Sbjct: 40  ITPLVTKLCKDLFKEWSDLDDSRFSVETVSGGITNLL--LKATVKEDDGNE----VSVTV 93

Query: 71  RVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPST 130
           R+YG   D + +R++EL  ++ LS    G  LL VF NG  +  + + TL   D+RDP  
Sbjct: 94  RLYGPNTDYVINRERELQAIKYLSAAGFGASLLAVFGNGMVQSFINARTLVPLDMRDPKL 153

Query: 131 SKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEE 189
           +  IA+ L + H +    P  +E   P++W +I K+Y  A    S+L+  + E++K  E 
Sbjct: 154 AADIAKELRRFHQVE--IPGSKE---PQLWTDIFKFYEKA----SALEFDDNEKQKIYET 204

Query: 190 FDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL-RLTDGSLVVVDFEYAGYNYQA 248
             F  + +E+ E+K +L+ + ++P+VF HND   GNI+    +  L  +DFEY  YNY+ 
Sbjct: 205 ISFSEVHNELVEVK-ELTSHFNAPVVFCHNDLLSGNIMVNDEEEKLYFIDFEYGSYNYRG 263

Query: 249 FDIANHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHD 308
           FDI NHF E+         ++ +  LYP +++Q  F R Y+             P    D
Sbjct: 264 FDIGNHFNEYA-------GYECDYSLYPTKEEQYHFFRHYLGP---------EKPQAVSD 307

Query: 309 NYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
             L+ L +E   + LASH+ W LWGL+Q+  S I+FDYLSY   R + +++ K
Sbjct: 308 KDLEALYIEANTYMLASHLYWALWGLIQAKFSPIEFDYLSYFFLRYNEYKKQK 360



>gi|505831106|ref|XP_004610841.1| PREDICTED: choline/ethanolamine kinase [Sorex araneus]
          Length = 393

 Score =  180 bits (457), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 180/351 (51%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W     S+  +   SG L+N +F  +     H  +  ++P  VLLRVYG    GVD L 
Sbjct: 58  AWRRXATSEYPLWIPSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRVYGAILQGVDSLV 115

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +L++P  S  IA +++Q 
Sbjct: 116 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTRELQEPVLSATIATKMAQF 172

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  +   +  L   +   LKDE+
Sbjct: 173 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPPSGLPQMNL--LEMYSLKDEM 220

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL  +  SP+VF HND Q GNIL L++     +L++VDFEY+ YNY+ FDI NHF
Sbjct: 221 GHLR-KLLSSTPSPVVFCHNDIQEGNILLLSEPKNADNLMLVDFEYSSYNYRGFDIGNHF 279

Query: 256 CEWTYDY-RSSVPH-KMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     PH K     YPN +QQ+ F+R Y+    +     ++   E      + 
Sbjct: 280 CEWVYDYTHEEWPHYKAQPADYPNREQQLHFIRHYLA--EVKKGEILSQ--EEQRKLEED 335

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 336 LLVEVNRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFKQKGQL 386



>gi|330936666|ref|XP_003305482.1| hypothetical protein PTT_18336 [Pyrenophora teres f. teres 0-1]
 gi|311317464|gb|EFQ86410.1| hypothetical protein PTT_18336 [Pyrenophora teres f. teres 0-1]
          Length = 827

 Score =  180 bits (457), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 179/336 (53%), Gaps = 55/336 (16%)

Query: 23  LPGW-----DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNK--------KPLRVL 69
           L GW     ++SNE D+Q  R+SGALTN V+ ++  K L  Q +N+         P ++L
Sbjct: 301 LKGWRKVPMELSNEIDVQ--RLSGALTNAVYVVSPPKNLPAQEQNEDGPPKPRNPPPKLL 358

Query: 70  LRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPS 129
           LR+YG  V+ L DR+ EL  L  L+  +IGP+LLG F NGRFE+ L ++ L S +LR+  
Sbjct: 359 LRIYGPQVEHLIDRESELQILTRLARKRIGPRLLGTFTNGRFEEFLHAKPLTSKELRNAD 418

Query: 130 TSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSL-KCTEEQRKGLE 188
           TSK IA+R+ +LH  I++    +E   P VW N DKW       ++ L +   E ++   
Sbjct: 419 TSKQIAKRMRELHEGIDLLKEERE-AGPFVWQNWDKWVERCEYIVTWLDQQIREAKQNAT 477

Query: 189 EF--------------DFKMLKDEIE------ELKYKLSHNIDSPIVFAHNDTQYGNILR 228
           +               ++ + +  IE      E +Y     I+  ++FAHNDTQYGNILR
Sbjct: 478 QLSSDKWKKLGYVCGTEWPVFRQMIEKYRRWLEEQYGGIDKINERMIFAHNDTQYGNILR 537

Query: 229 LT-DG------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDL 274
           +  +G             LVV+DFEYA  N    + ANHF EWTY+Y  + VP + N   
Sbjct: 538 MVPEGESPLLLPANQHKQLVVIDFEYANANLPGLEFANHFTEWTYNYHDADVPWRCNTKY 597

Query: 275 YPNEDQQIDFLRAYI---DAYSIPSDHTINNPSETH 307
           YP  ++Q  F+RAY+    +Y     +T +NP+  H
Sbjct: 598 YPTIEEQHRFIRAYLMHNPSYKASGGYT-SNPATPH 632



>gi|355563803|gb|EHH20365.1| hypothetical protein EGK_03208, partial [Macaca mulatta]
 gi|355785120|gb|EHH65971.1| hypothetical protein EGM_02850, partial [Macaca fascicularis]
          Length = 321

 Score =  180 bits (456), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 122/339 (35%), Positives = 176/339 (51%), Gaps = 39/339 (11%)

Query: 40  SGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLCDRQKELNFLEMLSNL 96
           SG L+N +F  +     H  +  ++P  VLLR+YG    GVD L     E     +L+  
Sbjct: 1   SGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV---LESVMFAILAER 55

Query: 97  KIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIK 156
            +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q H +           K
Sbjct: 56  SLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGM------EMPFTK 109

Query: 157 PEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLKDEIEELKYKLSHNID 211
              W+   ++++    L  I  L  T     GL E    +   LKDE+  L+ KL  +  
Sbjct: 110 EPHWLFGTMERY----LKQIQDLPPT-----GLPEMNLLEMYSLKDEMGNLR-KLLESTP 159

Query: 212 SPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHFCEWTYDY-RSSV 266
           SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHFCEW YDY     
Sbjct: 160 SPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEW 219

Query: 267 P-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLAS 325
           P +K     YP + QQ+ F+R Y+         T++   E      + L +EV  + LAS
Sbjct: 220 PFYKARPTDYPTQGQQLHFIRHYLA--EAKKGETLSQ--EEQRKLEEDLLVEVSRYALAS 275

Query: 326 HVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           H  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 276 HFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL 314



>gi|118138368|pdb|2IG7|A Chain A, Crystal Structure Of Human Choline Kinase B
 gi|118138369|pdb|2IG7|B Chain B, Crystal Structure Of Human Choline Kinase B
          Length = 401

 Score =  180 bits (456), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 178/352 (50%), Gaps = 35/352 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 66  AWRRVQPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 123

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA + +Q 
Sbjct: 124 ---LESVXFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKXAQF 180

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEE---FDFKMLKDE 198
           H      P  +E   P       + Y   L  I  L  T     GL E    +   LKDE
Sbjct: 181 HGXEX--PFTKE---PHWLFGTXERY---LKQIQDLPPT-----GLPEXNLLEXYSLKDE 227

Query: 199 IEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANH 254
              L+ KL  +  SP+VF HND Q GNIL L++     SL +VDFEY+ YNY+ FDI NH
Sbjct: 228 XGNLR-KLLESTPSPVVFCHNDIQEGNILLLSEPENADSLXLVDFEYSSYNYRGFDIGNH 286

Query: 255 FCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           FCEW YDY     P +K     YP ++QQ+ F+R Y+         T++   E      +
Sbjct: 287 FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLA--EAKKGETLSQ--EEQRKLEE 342

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +EV  + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 343 DLLVEVSRYALASHFFWGLWSILQASXSTIEFGYLDYAQSRFQFYFQQKGQL 394



>gi|357158571|ref|XP_003578170.1| PREDICTED: probable ethanolamine kinase A-like [Brachypodium
           distachyon]
          Length = 386

 Score =  180 bits (456), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 111/347 (31%), Positives = 184/347 (53%), Gaps = 35/347 (10%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  +++ GW   + S   +E VSG +TN +  ++  +    ++       V +R+YG
Sbjct: 54  IIGLCKELVKGWSSVDSSCFSVETVSGGITNLLLKVSVKEGTCSESS------VTVRLYG 107

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              D + DR++EL  +  LS    G  LLG+F+NG  +  + + TL  +D+++P  +  I
Sbjct: 108 PNTDLVIDRERELLAIPYLSAAGFGALLLGIFENGVIQSFINARTLSPSDMKEPRIAAEI 167

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A++L + H +    P  +E   P++W +I K+    L   S+LK  + ++ K  +   F+
Sbjct: 168 AKQLQKFHQV--DIPGSKE---PQLWNDIFKF----LKKASTLKFEDNDKHKRYDTISFR 218

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            ++DE++ELK  LS  + +P+VF+HND   GN+ L   +  L  +DFEY  Y+Y+ +DIA
Sbjct: 219 EIQDEVKELK-DLSDLLHAPVVFSHNDLLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIA 277

Query: 253 NHFCEWTYDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           NHF E+            +  LYP++D Q  F R Y+           + PSE     L+
Sbjct: 278 NHFNEYA-------GFDCDYSLYPDKDVQYHFFRNYL----------ADRPSEVQMQDLE 320

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRE 359
            L +E   + LASH+ W LW L+Q+  S IDFDYL Y   R   +++
Sbjct: 321 ALYIETNTYRLASHIYWALWALIQAKVSPIDFDYLGYFFLRYGEYKK 367



>gi|395819506|ref|XP_003783124.1| PREDICTED: choline/ethanolamine kinase [Otolemur garnettii]
          Length = 395

 Score =  179 bits (455), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 181/351 (51%), Gaps = 32/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W   +  ++++  VSG L+N +F  +     H  +  ++P  VLLR+YG    GVD L 
Sbjct: 59  AWRRVHPEELRVYPVSGGLSNLLFRCSLPD--HLPSVGEEPREVLLRLYGAILQGVDSLV 116

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ++ S  LK+ +LR+P  S  IA +++Q 
Sbjct: 117 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPMLSAAIATKMAQF 173

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L   +   LK+E+
Sbjct: 174 HGM------EMPFTKEPHWLFGTMERY----LQQIQDLPPTGPPQMNL--LEVYSLKEEM 221

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANHF 255
             L+ KL     SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NHF
Sbjct: 222 GNLR-KLLDATPSPVVFCHNDIQEGNILLLSEPESADSLMLVDFEYSSYNYRGFDIGNHF 280

Query: 256 CEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K   + YP + QQ+ F+R Y+    +     + +  E      + 
Sbjct: 281 CEWVYDYTHEEWPFYKARPEDYPTQGQQLHFIRHYLA--EVKKGEALLSRDEQR-RLEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L  EV  + LASH  WGLW ++Q+  S I+F Y+ Y   R   + + K ++
Sbjct: 338 LLAEVNRYALASHFFWGLWSILQASMSTIEFGYMEYAQSRFQFYFQQKGQL 388



>gi|504178583|ref|XP_004598314.1| PREDICTED: choline kinase alpha [Ochotona princeps]
          Length = 419

 Score =  179 bits (455), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 194/377 (51%), Gaps = 51/377 (13%)

Query: 21  DMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN--KKPLRVLLRVYGNGV 77
           + LPG W    E    I  + G L+N +F  +    L D T +   +P +VLLR+YG  +
Sbjct: 59  EFLPGAWRGLREDQFHISVIRGGLSNMLFQCS----LPDTTASVSDEPRKVLLRLYG-AI 113

Query: 78  DQL--CDR------QKELNF------------LEMLSNLKIGPKLLGVFKNGRFEQHLES 117
            Q+  C++      QKE  F              +L+   +GPKL G+F  GR EQ + S
Sbjct: 114 LQMRSCNKEGSEQTQKESEFQGAEAMVLESVMFAILAERALGPKLYGIFPQGRLEQFIPS 173

Query: 118 ETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPE-VWVNIDKWYPLALNAISS 176
             L + +L  P  S  IA++++  H +         N +P+ ++  ++K+    L+ +  
Sbjct: 174 RRLDTEELSLPDISAEIAEKMATFHGMKMPF-----NKEPKWLFGTMEKY----LSQVLR 224

Query: 177 LKCTEEQR-KGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNIL------RL 229
           +K TEE + + L++F    L  E+++L+  L  +  SP+VF HND Q GNIL       L
Sbjct: 225 VKFTEEPKARQLQKFLAYNLPLELQKLR-SLLESTPSPVVFCHNDCQEGNILLLEGREHL 283

Query: 230 TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDYRS-SVP-HKMNLDLYPNEDQQIDFLRA 287
               L+++DFEY+ YNY+ FDI NHFCEW YDY S   P  + NL  YP   QQ+ F+ +
Sbjct: 284 EKEKLMLIDFEYSSYNYRGFDIGNHFCEWVYDYSSEKYPFFRANLHKYPTRKQQLHFISS 343

Query: 288 YIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYL 347
           Y+ A+     +  N  SE      + + +E+  F LASH  WGLW +VQ+  S I+F Y+
Sbjct: 344 YLAAF---QSNVANLSSEERAAVEEAMLVEINRFALASHFFWGLWSIVQAKISSIEFGYM 400

Query: 348 SYGMERLHRFRELKNEV 364
            Y   R   + + K ++
Sbjct: 401 EYAQARFDAYFDQKRKL 417



>gi|405122372|gb|AFR97139.1| choline kinase [Cryptococcus neoformans var. grubii H99]
          Length = 519

 Score =  179 bits (455), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 190/397 (47%), Gaps = 65/397 (16%)

Query: 23  LPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPL-------------- 66
           +P W       ++I +++VSGALTN VFF++     +  + ++ PL              
Sbjct: 119 VPRWSSPLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPP 178

Query: 67  ---------RVLLRVYGNGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLE 116
                     +L RVYG   D L  R +EL  L +LS    IGP++ G F NGR E+   
Sbjct: 179 PLTPEQYPHTLLFRVYGPSSDALISRSEELRILHVLSTQYGIGPRVFGTFTNGRVEEFFP 238

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNI--INICPPPQENIKPEVWVNIDKWYPLALNAI 174
           S  L + +LRDP  S+ IA+R+ +LH++    +        +P +W+ + +W   A + I
Sbjct: 239 SRALTAQELRDPIISRGIARRMRELHSVDLRRLGYEQGRATEPALWICLKEWSEAAEDVI 298

Query: 175 SSLKCTEEQRKG-LEEFDFKMLKDEIEELK--YKLSHNIDSPIVFAHNDTQYGNILRL-- 229
           SSL       +  +E F    +++E+   +   +      + +VFAHNDTQYGN+LRL  
Sbjct: 299 SSLTALGGTLEAWVERFSLHRIREEVTIYRNFVESQSGKGNGVVFAHNDTQYGNLLRLDV 358

Query: 230 -------TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDY------RSSVPHKMNLDLYP 276
                       +V+DFEYA  N + +DIANHF EW  +Y       S +PH      YP
Sbjct: 359 ELPPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRANYHHPTHSHSLIPHFP----YP 414

Query: 277 NEDQQIDFLRAY--IDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGL 334
              Q+ DF R+Y  ++      +  +    +   + +  L+ EV  ++    + W LWGL
Sbjct: 415 TPIQREDFYRSYLSVEVDGRNGEEVVGKRKDVPADKVAALEHEVRIWSPGCSINWALWGL 474

Query: 335 VQSGQSQI------------DFDYLSYGMERLHRFRE 359
           VQ+ + Q+            +FDYLSY  ERL  FR+
Sbjct: 475 VQA-EEQVCALATKKEGYVPEFDYLSYAAERLEMFRD 510



>gi|321261890|ref|XP_003195664.1| choline kinase [Cryptococcus gattii WM276]
 gi|317462138|gb|ADV23877.1| choline kinase, putative [Cryptococcus gattii WM276]
          Length = 519

 Score =  179 bits (455), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/397 (30%), Positives = 191/397 (48%), Gaps = 65/397 (16%)

Query: 23  LPGWDVS--NESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPL-------------- 66
           +P W       ++I +++VSGA+TN VFF++     +  + ++ PL              
Sbjct: 119 VPRWSSPLLTPTNIHLQKVSGAMTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPP 178

Query: 67  ---------RVLLRVYGNGVDQLCDRQKELNFLEMLSN-LKIGPKLLGVFKNGRFEQHLE 116
                     +L RVYG   D L  R +EL  L +LS    IGP++ G F NGR E+   
Sbjct: 179 PLTPDQYPHTLLFRVYGPSSDALISRSEELRILHVLSTQYGIGPRIFGTFTNGRVEEFFP 238

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPPQ-ENIKPEVWVNIDKWYPLALNAI 174
           S  L + +LRDP  S+ IA+R+ +LH++ + +    Q    +P +W+ + +W   A + I
Sbjct: 239 SRALTAQELRDPIISRGIARRMRELHSVDLRLLGYEQGRATEPALWICLKEWSEAAEDVI 298

Query: 175 SSLKCTEEQRKG-LEEFDFKMLKDEIEELK--YKLSHNIDSPIVFAHNDTQYGNILRL-- 229
           SSL       +  +E      +++EI   +   +      + +VFAHNDT YGN+LRL  
Sbjct: 299 SSLTSLGGTLEAWVERLSLHRIQEEIAIYRNFVESQSGKGNGVVFAHNDTHYGNLLRLDV 358

Query: 230 -------TDGSLVVVDFEYAGYNYQAFDIANHFCEWTYDY------RSSVPHKMNLDLYP 276
                       +V+DFEYA  N + +DIANHF EW  DY       S +PH      YP
Sbjct: 359 ELPPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRADYHHPTLSHSLIPHFP----YP 414

Query: 277 NEDQQIDFLRAY--IDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGL 334
             +Q+ DF RAY  ++      +  +    +   + +  L+ EV  ++    + W LWGL
Sbjct: 415 TPNQREDFYRAYLSVEVDGRNGEEVVGKRKDVPADKVAALEREVRIWSPGCSINWALWGL 474

Query: 335 VQSGQSQI------------DFDYLSYGMERLHRFRE 359
           VQ+ + QI            +FDYL+Y  ERL  FR+
Sbjct: 475 VQA-EEQICALVTKKEGYVPEFDYLAYATERLEMFRD 510



>gi|395537764|ref|XP_003770861.1| PREDICTED: choline/ethanolamine kinase [Sarcophilus harrisii]
          Length = 375

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 171/340 (50%), Gaps = 31/340 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W       +Q+  VSG L+N +F     + +       +P  VLLR+YG    GVD L 
Sbjct: 36  AWRQIQVEQLQVSPVSGGLSNLLFRCALPENI--PLVGDEPREVLLRLYGAILQGVDSLV 93

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+  ++GP+L GVF  GR EQ++ S  L +++LR+P  S  IA ++++ 
Sbjct: 94  ---LESVMFAILAERRLGPRLYGVFPEGRLEQYIPSRPLGTSELREPRRSAEIAVKMARF 150

Query: 142 HNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTEE--QRKGLEEFDFKMLKDEI 199
           H    +   P       ++  ++++     + I   K  E   QR  LEE +  ML+   
Sbjct: 151 H----LMEMPFNKEPRWLFGTMERYLKQIQDLIPPTKTNENLIQRYHLEE-EMSMLR--- 202

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG--SLVVVDFEYAGYNYQAFDIANHFCE 257
                KL  +  SP+VF HND Q GNIL L+D    L+++DFEY+ YNY+ FDI NHFCE
Sbjct: 203 -----KLLDSTSSPVVFCHNDIQEGNILLLSDKEPGLMLIDFEYSSYNYRGFDIGNHFCE 257

Query: 258 WTYD--YRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           W YD  Y  S    M    YPN +QQ+ F+R Y+         +    +E  +N L    
Sbjct: 258 WIYDYSYEESPYFLMEPKNYPNREQQLHFIRNYLSVIQGDDRPSPEEQTELEENML---- 313

Query: 316 LEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLH 355
           +E   F LASH  WGLW ++Q+  S I+F YL Y   R  
Sbjct: 314 VEANRFALASHFFWGLWSILQNIMSTIEFGYLEYAESRFQ 353



>gi|8393104|ref|NP_058873.1| choline/ethanolamine kinase [Rattus norvegicus]
 gi|6685577|sp|O54783.3|CHKB_RAT RecName: Full=Choline/ethanolamine kinase; AltName: Full=Choline
           kinase beta; Short=CK; Short=CKB; AltName:
           Full=Ethanolamine kinase; Short=EK; AltName:
           Full=choline/ethanolamine kinase beta; Short=CKEKB
 gi|2780752|dbj|BAA24366.1| choline/ethanolamine kinase [Rattus norvegicus]
 gi|38014816|gb|AAH60515.1| Choline kinase beta [Rattus norvegicus]
 gi|149017567|gb|EDL76571.1| choline kinase beta, isoform CRA_a [Rattus norvegicus]
          Length = 394

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 177/351 (50%), Gaps = 33/351 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W  +   ++ +  VSG L+N +F  +     H  +   +P  VLLR+YG    GVD L 
Sbjct: 60  AWRRARPEELSVCPVSGGLSNLLFRCSLPN--HVPSMGGEPREVLLRLYGAILQGVDSLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LRDP  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEI 199
           H +           K   W+   ++++    L  I  L  T   +  L E     LKDE+
Sbjct: 175 HGM------EMPFTKEPRWLFGTMERY----LKQIQDLPSTSLPQMNLVEM--YSLKDEM 222

Query: 200 EELKYKLSHNIDSPIVFAHNDTQYGNILRLT----DGSLVVVDFEYAGYNYQAFDIANHF 255
             L+  L     SP+VF HND Q GNIL L+    D +L++VDFEY+ YNY+ FDI NHF
Sbjct: 223 NHLR-TLLDATPSPVVFCHNDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRGFDIGNHF 281

Query: 256 CEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQK 313
           CEW YDY     P +K     YP  +QQ+ F+R Y+    +     ++   E      + 
Sbjct: 282 CEWVYDYTYEEWPFYKARPADYPTREQQLLFIRHYLA--EVQKGEVLS--EEEQKKQEED 337

Query: 314 LKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
           L +E+  + LASH  WGLW  +Q+  S I+F YL Y   R   + + K ++
Sbjct: 338 LLIEISRYALASHFFWGLWSTLQASMSTIEFGYLEYAQSRFQFYFQQKGQL 388



>gi|502118880|ref|XP_004496428.1| PREDICTED: choline/ethanolamine kinase-like [Cicer arietinum]
          Length = 364

 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 176/327 (53%), Gaps = 34/327 (10%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLR-VLLRVYGNGVDQLCDRQKELNFLEM 92
           +Q+  + GA+TN VF      +++  T+N   LR VL+R+YG GV+   +R +E+   E 
Sbjct: 39  LQVIPLKGAMTNEVF------QINWPTENGADLRKVLVRLYGEGVEVFFNRDEEIRTFEC 92

Query: 93  LSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQ 152
           +S    GP+LL  F  GR E+ + + TL ++DLRD   S  IA ++ + H +    P  +
Sbjct: 93  ISKHGQGPRLLARFTTGRVEEFIHARTLSASDLRDLEISALIAFKMREFHKLH--MPGTK 150

Query: 153 ENIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDS 212
              K  +W  + KW    L    SL   +E +K    F    L +EI  L+ K S     
Sbjct: 151 ---KAHIWQRMRKW----LGEAKSLCSPKETKK----FGLDNLDEEINILE-KESCEGYQ 198

Query: 213 PIVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMN 271
            I F HND QYGNI+   +  S+ ++D+EYA YN  A+D+ANHFCE   DY +  PH ++
Sbjct: 199 EIGFCHNDLQYGNIMMDEEARSITLIDYEYASYNPIAYDLANHFCEMAADYHTDTPHVLD 258

Query: 272 LDLYPNEDQQIDFLRAYIDAYS-IPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWG 330
              YP  +++  F+RAY+ +    PS+  +N           +L   V  +TLA+H+ WG
Sbjct: 259 YSKYPELEERQRFIRAYLSSEGKKPSNAKVN-----------QLVNAVEKYTLANHLFWG 307

Query: 331 LWGLVQSGQSQIDFDYLSYGMERLHRF 357
           LWGL+ S  ++IDFDY  Y  +R  ++
Sbjct: 308 LWGLISSYVNKIDFDYKEYARQRFQQY 334



>gi|15225800|ref|NP_180251.1| protein embryo defective 1187  [Arabidopsis thaliana]
 gi|3426043|gb|AAC32242.1| putative choline kinase [Arabidopsis thaliana]
 gi|110738719|dbj|BAF01284.1| choline kinase like protein [Arabidopsis thaliana]
 gi|330252801|gb|AEC07895.1| protein kinase-like protein [Arabidopsis thaliana]
          Length = 374

 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 190/350 (54%), Gaps = 36/350 (10%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W   ++S   +ERVSG +TN +       K+  +    K + V +R+YG
Sbjct: 43  IIELCKDLFKNWGELDDSLFSVERVSGGITNLLL------KVSVKEDTNKEVSVTVRLYG 96

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + +R++E+  ++ LS    G KLLG F NG  +  + + TL+ +D+R+P  +  I
Sbjct: 97  PNTEYVINREREILAIKYLSAAGFGAKLLGGFGNGMVQSFINARTLEPSDMREPKIAAQI 156

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H +    P  +E   P++WV+I K+Y  A    S+L   E +++K  E   F+
Sbjct: 157 ARELGKFHKV--DIPGSKE---PQLWVDILKFYEKA----STLTFEEPDKQKLFETISFE 207

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGN-ILRLTDGSLVVVDFEYAGYNYQAFDIA 252
            L  EI EL+ + +  +++P+VFAHND   GN +L   +  L ++DFEY  YNY+ FDI 
Sbjct: 208 ELHKEIIELR-EFTGLLNAPVVFAHNDLLSGNFMLNDEEEKLYLIDFEYGSYNYRGFDIG 266

Query: 253 NHFCEWT-YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYL 311
           NHF E+  YD         +  LYP++++Q  F++ Y+           + P E     +
Sbjct: 267 NHFNEYAGYD--------CDYSLYPSKEEQYHFIKHYLQP---------DKPDEVSIAEV 309

Query: 312 QKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           + + +E  A+ LASH+ W +W ++Q+  S I+F+YL Y   R + +++ K
Sbjct: 310 ESVFVETDAYKLASHLYWAIWAIIQARMSPIEFEYLGYFFLRYNEYKKQK 359



>gi|512966314|ref|XP_004845343.1| PREDICTED: choline/ethanolamine kinase [Heterocephalus glaber]
          Length = 395

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 181/352 (51%), Gaps = 35/352 (9%)

Query: 25  GWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG---NGVDQLC 81
            W      ++++  VSG L+N +F  +     H     ++P  VLLR+YG    GV+ L 
Sbjct: 60  AWRRVRPEELRVCPVSGGLSNLLFRCSLPN--HLPNVGEEPREVLLRLYGAILQGVESLV 117

Query: 82  DRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQL 141
               E     +L+   +GP+L GVF  GR EQ+L S  LK+ +LR P  S  IA ++++ 
Sbjct: 118 ---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRKPVLSAAIAAKMARF 174

Query: 142 HNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSL-KCTEEQRKGLEEFDFKMLKDE 198
           H +           K   W+   ++++    L  I  L   T  Q   LE +    L+DE
Sbjct: 175 HGM------EMPFTKEPHWLFGTMERY----LKQIQDLPSATLLQMDLLEMYS---LQDE 221

Query: 199 IEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG----SLVVVDFEYAGYNYQAFDIANH 254
           ++ L+ KL  +  SP+VF HND Q GNIL L++     SL++VDFEY+ YNY+ FDI NH
Sbjct: 222 MDNLR-KLLESTPSPVVFCHNDVQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH 280

Query: 255 FCEWTYDY-RSSVP-HKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQ 312
           FCEW Y+Y     P +K     YP  +QQ+ F+R Y+    +     +  P E  +   +
Sbjct: 281 FCEWVYNYTHEEWPFYKAQPTDYPTREQQLHFIRHYLA--EVKKGEIL--PQEEQNKLEE 336

Query: 313 KLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 364
            L +E   + LASH  WGLW ++Q+  S I+F YL Y   R   + + K ++
Sbjct: 337 DLLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYFQQKRQL 388



>gi|383849571|ref|XP_003700418.1| PREDICTED: choline/ethanolamine kinase-like [Megachile rotundata]
          Length = 379

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 199/378 (52%), Gaps = 38/378 (10%)

Query: 3   LGN---DDNVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHD 58
           LGN   ++N  +R     +  D L G W      +I+++R+SG L+N ++ +    +L D
Sbjct: 3   LGNKMSEENPEMREMAARICRDYLHGVWKHVTAENIRLKRISGGLSNWLYNV----QLPD 58

Query: 59  QTK--NKKPLRVLLRVYG--NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQH 114
            T     +P +VLLR+YG  +G   L     E     +LS  ++GPKL G+F  GR E++
Sbjct: 59  GTVPIRGEPRQVLLRLYGQVHGERALEGLITESVIFTLLSERRLGPKLHGIFPGGRIEEY 118

Query: 115 LESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNA 173
           + +  L + +L DP+ S  IA++++Q+H + + I   P       +W  + KW   A + 
Sbjct: 119 IPARPLLTKELADPTLSSMIAEKMAQIHTMQVPISKEPTW-----LWDTMAKWLDTATDI 173

Query: 174 ISSLKCTEEQR-KGLEEFDFKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNILRLTDG 232
           + + +  + +  K +       L  EI   ++ ++     P+VF HND Q GNIL   + 
Sbjct: 174 LENAEDVDARHSKNVNAIRAIDLSHEIAWFRFLVTRQ-KYPVVFCHNDMQEGNILLRQNT 232

Query: 233 ---SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS---VPHKMNLDLYPNEDQQIDFLR 286
               LV++DFEY  YNY+ FDIANHF EW YDY ++     H+      P E+Q+++F+R
Sbjct: 233 RKPELVLIDFEYCSYNYRGFDIANHFVEWQYDYTAAEYPFFHERT-GSGPTEEQKLNFVR 291

Query: 287 AYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDY 346
           +Y+         TI     + ++   ++  E+  F+LASH+ WGLW +V +  S+I F Y
Sbjct: 292 SYL--------RTIGKEGPSEED---RVMTEIKIFSLASHLFWGLWSIVNAKLSEIPFGY 340

Query: 347 LSYGMERLHRFRELKNEV 364
             Y + RL  ++ LK ++
Sbjct: 341 WDYAVSRLKNYQYLKEKI 358



>gi|347835591|emb|CCD50163.1| similar to choline kinase [Botryotinia fuckeliana T4]
          Length = 798

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 127/431 (29%), Positives = 201/431 (46%), Gaps = 97/431 (22%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN-- 62
           +  +N ++ L  T  L GW    +    +I++ER+SGALTN V+ +T    L     +  
Sbjct: 277 IQFKNEIVRLAHTLRLKGWRRVPLDRGHEIEVERLSGALTNAVYVVTPPADLPPSASSTN 336

Query: 63  ------KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLE 116
                 K P ++LLR+YG  V+ L DR+ EL+ L  L+  KIGP++LG F+NGRFE+   
Sbjct: 337 LSTKSQKSPPKLLLRIYGPQVEHLIDREAELSILRRLARKKIGPRMLGTFRNGRFEEFFN 396

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYP-------- 168
           ++TL + DLR P TS+ IA+R+ +LH+ + +    +++  P V+ N DKW          
Sbjct: 397 AQTLTAQDLRIPETSRKIAKRMRELHDGVELLQEERDD-GPFVFKNWDKWVDRCEKITTY 455

Query: 169 -----LALNAISSLKCTEEQRKGLE-EFDFKMLKDEIE------ELKYKLSHNIDSPIVF 216
                L  ++  S++    + +GL    ++ + +  +E      E  Y     +   +VF
Sbjct: 456 LDKQILEGDSSKSVRGESWRDRGLVCGVEWPVFRTAVEKYRQWLEESYGGKEGLSRRLVF 515

Query: 217 AHNDTQYGNILRL-----TDGS--------------LVVVDFEYAGYNYQAFDIANHFCE 257
           AHNDTQYGNILRL      +GS              LVV+DFEYA  N    + ANHF E
Sbjct: 516 AHNDTQYGNILRLVPEPPVNGSAPSPLLLPMNHHKQLVVIDFEYASANTPGLEFANHFTE 575

Query: 258 WTYDYRSSVPHKMNLDL--YPNEDQQIDFLRAYID--------AYSIPSDHTINNPSETH 307
           W Y+Y +  P     D   YP  ++Q  F+RAY++        A S P     + P  + 
Sbjct: 576 WCYNYHAPAPMTWTCDTRNYPTVEEQKRFVRAYLNHRPHFNPHANSTPKLEGKDAPPGSI 635

Query: 308 DNYL-----------------------------------QKLKLEVYAFTLASHVMWGLW 332
             ++                                   +++  E+  + LA+   W  W
Sbjct: 636 KEFMLDSRTPGGEKDTPTSSVNLYAEEEARREQETEKQVEEILQEIRIWRLANSAQWVAW 695

Query: 333 GLVQSGQSQID 343
           G+VQ+   ++D
Sbjct: 696 GIVQAKVPELD 706



>gi|472242603|gb|EMR87290.1| putative choline kinase protein [Botryotinia fuckeliana BcDW1]
          Length = 1667

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 127/431 (29%), Positives = 201/431 (46%), Gaps = 97/431 (22%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKN-- 62
           +  +N ++ L  T  L GW    +    +I++ER+SGALTN V+ +T    L     +  
Sbjct: 277 IQFKNEIVRLAHTLRLKGWRRVPLDRGHEIEVERLSGALTNAVYVVTPPADLPPSASSTN 336

Query: 63  ------KKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLE 116
                 K P ++LLR+YG  V+ L DR+ EL+ L  L+  KIGP++LG F+NGRFE+   
Sbjct: 337 LSTKSQKSPPKLLLRIYGPQVEHLIDREAELSILRRLARKKIGPRMLGTFRNGRFEEFFN 396

Query: 117 SETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYP-------- 168
           ++TL + DLR P TS+ IA+R+ +LH+ + +    +++  P V+ N DKW          
Sbjct: 397 AQTLTAQDLRIPETSRKIAKRMRELHDGVELLQEERDD-GPFVFKNWDKWVDRCEKITTY 455

Query: 169 -----LALNAISSLKCTEEQRKGLE-EFDFKMLKDEIE------ELKYKLSHNIDSPIVF 216
                L  ++  S++    + +GL    ++ + +  +E      E  Y     +   +VF
Sbjct: 456 LDKQILEGDSSKSVRGESWRDRGLVCGVEWPVFRTAVEKYRQWLEESYGGKEGLSRRLVF 515

Query: 217 AHNDTQYGNILRL-----TDGS--------------LVVVDFEYAGYNYQAFDIANHFCE 257
           AHNDTQYGNILRL      +GS              LVV+DFEYA  N    + ANHF E
Sbjct: 516 AHNDTQYGNILRLVPEPPVNGSAPSPLLLPMNHHKQLVVIDFEYASANTPGLEFANHFTE 575

Query: 258 WTYDYRSSVPHKMNLDL--YPNEDQQIDFLRAYID--------AYSIPSDHTINNPSETH 307
           W Y+Y +  P     D   YP  ++Q  F+RAY++        A S P     + P  + 
Sbjct: 576 WCYNYHAPAPMTWTCDTRNYPTVEEQKRFVRAYLNHRPHFNPHANSTPKLEGKDAPPGSI 635

Query: 308 DNYL-----------------------------------QKLKLEVYAFTLASHVMWGLW 332
             ++                                   +++  E+  + LA+   W  W
Sbjct: 636 KEFMLDSRTPGGEKDTPTSSVNLYAEEEARREQETEKQVEEILQEIRIWRLANSAQWVAW 695

Query: 333 GLVQSGQSQID 343
           G+VQ+   ++D
Sbjct: 696 GIVQAKVPELD 706



>gi|380014375|ref|XP_003691209.1| PREDICTED: choline/ethanolamine kinase-like [Apis florea]
          Length = 396

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 203/387 (52%), Gaps = 56/387 (14%)

Query: 3   LGN---DDNVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHD 58
           LGN   ++N  +R     +  D L G W      +I ++R+SG L+N ++ +    +L D
Sbjct: 20  LGNKMSEENPEMREMAARICRDYLHGVWKHVTAENIILKRISGGLSNWLYNV----QLPD 75

Query: 59  QTK--NKKPLRVLLRVYG--NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQH 114
           +T     +P +VLLR+YG  +G   L     E     +LS  ++GPKL G+F  GR E++
Sbjct: 76  ETVPIRGEPRQVLLRLYGQIHGERALEGLITESVIFTLLSERRLGPKLHGIFPGGRIEEY 135

Query: 115 LESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNA 173
           + +  L + +L DP+ S  IA++++Q+H + + I   P       +W  + KW       
Sbjct: 136 IPARPLLTKELADPTLSCMIAEKMAQIHCMQVPISKEPTW-----LWDTMAKW------- 183

Query: 174 ISSLKCTEEQRKGLEEFDFKMLK--------DEIEELKY--KLSHNIDSPIVFAHNDTQY 223
              L  T++  + +E+ D + LK        D   E+K+   L+     P+VF HND Q 
Sbjct: 184 ---LDTTKDILENIEDIDVRHLKSVNMIRIIDLDHEIKWFRSLATRHKYPVVFCHNDMQE 240

Query: 224 GNILRLTDG---SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS---VPHKMNLDLYPN 277
           GNIL   +     LV++DFEY  YNY+AFDIANHF EW YDY ++     H+      P 
Sbjct: 241 GNILLRQNTRKPELVLIDFEYCSYNYRAFDIANHFVEWQYDYTAAEYPFFHERT-GSGPT 299

Query: 278 EDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQS 337
           ++Q+++F+R+Y+         TI     T +   +++ +E+  F LASH+ WGLW +V +
Sbjct: 300 KEQKLNFVRSYLK--------TIGKEGPTEE---ERVMMEIKIFFLASHLFWGLWSIVNA 348

Query: 338 GQSQIDFDYLSYGMERLHRFRELKNEV 364
             S+I F Y  Y + RL  ++ LK ++
Sbjct: 349 KLSEIPFGYWDYAVSRLKNYQYLKEKI 375



>gi|328775933|ref|XP_624492.2| PREDICTED: choline/ethanolamine kinase-like [Apis mellifera]
          Length = 395

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 202/387 (52%), Gaps = 56/387 (14%)

Query: 3   LGN---DDNVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHD 58
           LGN   ++N  +R     +  D L G W      +I ++R+SG L+N ++ +    +L D
Sbjct: 19  LGNKMSEENPEMREMAARICRDYLHGVWKHVTAENIILKRISGGLSNWLYNV----QLPD 74

Query: 59  QTK--NKKPLRVLLRVYG--NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQH 114
           +T     +P +VLLR+YG  +G   L     E     +LS  ++GPKL G+F  GR E++
Sbjct: 75  ETVPIRGEPRQVLLRLYGQIHGERALEGLITESVIFTLLSERRLGPKLHGIFPGGRIEEY 134

Query: 115 LESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPPPQENIKPEVWVNIDKWYPLALNA 173
           + +  L + +L DP+ S  IA++++Q+H + + I   P       +W  + KW       
Sbjct: 135 IPARPLLTKELADPTLSCMIAEKMAQIHCMQVPISKEPTW-----LWDTMAKW------- 182

Query: 174 ISSLKCTEEQRKGLEEFDFKMLK--------DEIEELKY--KLSHNIDSPIVFAHNDTQY 223
              L  T +  + +E+ D + LK        D   E+K+   L+     P+VF HND Q 
Sbjct: 183 ---LDTTRDILENIEDIDVRHLKNVNMIRIIDLDHEIKWFRSLATRHKYPVVFCHNDMQE 239

Query: 224 GNILRLTDG---SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSS---VPHKMNLDLYPN 277
           GNIL   +     LV++DFEY  YNY+AFDIANHF EW YDY ++     H+      P 
Sbjct: 240 GNILLRQNTRKPELVLIDFEYCSYNYRAFDIANHFVEWQYDYTAAEYPFFHERT-GSGPT 298

Query: 278 EDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQS 337
           ++Q+++F+R+Y+         TI     T +   +++ +E+  F LASH+ WGLW +V +
Sbjct: 299 KEQKLNFVRSYLK--------TIGKEGPTEE---ERIMMEIKIFFLASHLFWGLWSIVNA 347

Query: 338 GQSQIDFDYLSYGMERLHRFRELKNEV 364
             S+I F Y  Y + RL  ++ LK ++
Sbjct: 348 KLSEIPFGYWDYAVSRLKNYQYLKEKI 374



>gi|297822263|ref|XP_002879014.1| EMB1187 [Arabidopsis lyrata subsp. lyrata]
 gi|297324853|gb|EFH55273.1| EMB1187 [Arabidopsis lyrata subsp. lyrata]
          Length = 374

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 190/350 (54%), Gaps = 36/350 (10%)

Query: 15  LIPLITDMLPGWDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYG 74
           +I L  D+   W   ++S   +ERVSG +TN +       K+  +    K + V +R+YG
Sbjct: 43  IIELCKDLFKNWRDLDDSLFSVERVSGGITNLLL------KVSVKEDTDKQVSVTVRLYG 96

Query: 75  NGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYI 134
              + + +R++E+  ++ LS    G KLLG F NG  +  + + TL+ +D+R+P  +  I
Sbjct: 97  PNTEYVINREREILAIKYLSAAGFGAKLLGGFGNGMVQSFIYARTLEPSDMREPKIAAEI 156

Query: 135 AQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAISSLKCTE-EQRKGLEEFDFK 193
           A+ L + H +    P  +E   P++WV+I K+Y  A    S+L+  E +++K  E   F+
Sbjct: 157 AKELGKFHKV--DIPGSKE---PQLWVDIFKFYEKA----STLRFEEPDKQKLFETISFE 207

Query: 194 MLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI-LRLTDGSLVVVDFEYAGYNYQAFDIA 252
            L  EI EL+ + +  +++P+VFAHND   GN+ L   +  L ++DFEY  YNY+ FDI 
Sbjct: 208 ELHKEIIELR-EFTGLLNAPVVFAHNDLLSGNLMLNDEEEKLYLIDFEYGSYNYRGFDIG 266

Query: 253 NHFCEWT-YDYRSSVPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYL 311
           NHF E+  YD         +  +YP +++Q  F++ Y+           + P E     +
Sbjct: 267 NHFNEYAGYD--------CDYSMYPTKEEQYHFIKHYLQP---------DKPDEVSIAEV 309

Query: 312 QKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMERLHRFRELK 361
           + + +E  A+ LASH+ W +W ++Q+  S I+F+YL Y   R + +++ K
Sbjct: 310 ESVFVETDAYKLASHLYWAIWAIIQARMSPIEFEYLGYFFLRYNEYKKQK 359



>gi|327293163|ref|XP_003231278.1| choline kinase [Trichophyton rubrum CBS 118892]
 gi|326466394|gb|EGD91847.1| choline kinase [Trichophyton rubrum CBS 118892]
          Length = 884

 Score =  177 bits (450), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 185/400 (46%), Gaps = 96/400 (24%)

Query: 33  DIQIERVSGALTNCVFFITRTKKLHDQTKN--------KKPLRVLLRVYGNGVDQLCDRQ 84
           ++++ R+SGALTN V+ ++  K +   +++        K P ++LLR+YG  V+ L DR+
Sbjct: 365 EVEVVRLSGALTNAVYQVSPPKDMSKYSQSTSSQSLPRKPPPKLLLRIYGPQVEHLIDRE 424

Query: 85  KELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI 144
            EL  L  L    IGP++LG FKNGRFEQ+L + TL + DLR P TS  IA+R+ +LH  
Sbjct: 425 HELQVLRRLGKRNIGPRVLGTFKNGRFEQYLHARTLTTRDLRIPETSIQIAKRMRELHEG 484

Query: 145 INICPPPQENIKPEVWVNIDKWYPLAL--------------NAISSLKCTEEQRKGLEEF 190
           I++ P  +E   P +W N DKW                   N   S+K    +R  +   
Sbjct: 485 IDLLPEEREG-GPGLWKNWDKWVNRCEKVTTWLDSEILADHNGGRSVKEPWRKRGFVCGV 543

Query: 191 DFKMLKDEIEELKYKLSHN------IDSPIVFAHNDTQYGNILRLTDGS----------- 233
            ++  +  +E  +  L+ +      I   ++FAHNDTQYGN+LRL               
Sbjct: 544 PWETFRGMVERYRQWLAASFGGMEEITRRLIFAHNDTQYGNLLRLEPSGESPLLLPANEH 603

Query: 234 --LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQIDFLRAYI- 289
             L+V+DFEYA  N +  + ANHF EW Y+Y     P + N   YP  ++Q  F+RAY+ 
Sbjct: 604 KQLIVIDFEYAAANMRGAEFANHFTEWCYNYHDEDRPWRCNTAWYPTLEEQKRFIRAYLT 663

Query: 290 ---------DAYSIPSDHT-------------------INNPSETH---DNYL------- 311
                    +  + PS H                    I++P       D Y+       
Sbjct: 664 HRPRLISETNNSTYPSGHNLSTSSVSSTMTTPGLRPTYISSPRVAPLSLDTYIPSVPFSI 723

Query: 312 --------------QKLKLEVYAFTLASHVMWGLWGLVQS 337
                         QKL  E   + +A+  MW  WG+VQ+
Sbjct: 724 SEDDQIDEELEVEVQKLLHEARVWRVANSAMWVAWGIVQA 763



>gi|225677693|gb|EEH15977.1| choline kinase [Paracoccidioides brasiliensis Pb03]
          Length = 804

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 155/308 (50%), Gaps = 41/308 (13%)

Query: 23  LPGW---DVSNESDIQIERVSGALTNCVFFIT---RTKKLHDQTKNKKPLRVLLRVYGNG 76
           L GW    + +  +I++ R+SGALTN V+ +T    +         + P ++LLR+YG  
Sbjct: 293 LRGWRRVPIEDSRNIEVVRLSGALTNAVYVVTPPQNSPSTSSLAPKRPPPQLLLRIYGPQ 352

Query: 77  VDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQ 136
           V+ L DR+ EL  L  L+   IGP++LG F NGRFEQ+  ++TL   D+R+P TSK IA+
Sbjct: 353 VEHLIDRKNELQILRRLAKRNIGPRVLGSFNNGRFEQYFHAKTLTPKDIRNPETSKQIAK 412

Query: 137 RLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAIS----SLKCTEEQRKGLEEF-- 190
           R+ +LH+ I + P   E   P +W N DKW        S     +  +  Q K   E   
Sbjct: 413 RMRELHDGIELLPEETEG-GPSIWKNWDKWVERCKQVASWLDREIMSSHNQSKSETECWR 471

Query: 191 --------DFKMLKDEIEELK------YKLSHNIDSPIVFAHNDTQYGNILRLTDGS--- 233
                    +   +  ++  +      Y  +  I+  ++FAHNDTQYGN+LRL       
Sbjct: 472 RQGFVCGSPWPKFRKAVDAYRKWLVNFYGGTAAINQQLIFAHNDTQYGNLLRLEPSGESP 531

Query: 234 ----------LVVVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVPHKMNLDLYPNEDQQI 282
                     LVV+DFEYA  N +  +  NHF EW Y+Y     P   N   YP  ++Q 
Sbjct: 532 LLLPPNEHKQLVVIDFEYASANTRGLEFCNHFTEWCYNYHDPDRPWACNTKWYPTPEEQE 591

Query: 283 DFLRAYID 290
            F+RAY++
Sbjct: 592 RFVRAYLN 599



>gi|259488783|tpe|CBF88506.1| TPA: choline kinase, putative (AFU_orthologue; AFUA_1G15930)
           [Aspergillus nidulans FGSC A4]
          Length = 730

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 165/328 (50%), Gaps = 48/328 (14%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTK-----KLHDQ 59
           V  ++ L+ L  T  L GW    +   S+I + R+SGALTN V+ IT  +     K  D 
Sbjct: 247 VVFKSELLRLTHTLQLKGWRKIPMELASEIDVVRLSGALTNAVYKITPPQNIPPPKAEDG 306

Query: 60  T----KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHL 115
           +      + P ++LLR+YG  VD L DR+KEL  L  L    IGPK+LG F NGRFE++ 
Sbjct: 307 SYTLVPRRPPPKLLLRIYGPQVDHLIDREKELQILRRLGRKNIGPKVLGTFNNGRFEEYF 366

Query: 116 ESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAIS 175
           E+  L   +LRDPST K IA+R+ +LH+ I++    +EN  P V+ N DKW       IS
Sbjct: 367 EARPLTPKELRDPSTMKQIAKRMRELHDGIDLLDEEREN-GPMVFHNWDKWVDRCEQVIS 425

Query: 176 ----SLKCTEEQRKGLEE----------FDFKMLKDEIEELKYKL------SHNIDSPIV 215
                +K    + K   E            +   +  +E+ +  L       H I   +V
Sbjct: 426 WVDAEIKSPLNEGKAASEPWRRRGYVCGVPWPKFRKAVEDYRKWLIVDSGGVHEIKRQLV 485

Query: 216 FAHNDTQYGNILRLTDG-------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDY 262
           F HNDTQYGN+LR+                 LVV+DFEYA  N    + ANHF EW Y+Y
Sbjct: 486 FGHNDTQYGNLLRMEPSQQSPLLLPQNEHKQLVVIDFEYASANTPGLEFANHFTEWCYNY 545

Query: 263 R-SSVPHKMNLDLYPNEDQQIDFLRAYI 289
             +  P   N  LYP  +QQ  F+ AY+
Sbjct: 546 HDAEKPWACNNQLYPTPEQQHQFVTAYL 573



>gi|67517310|ref|XP_658533.1| hypothetical protein AN0929.2 [Aspergillus nidulans FGSC A4]
 gi|40746802|gb|EAA65958.1| hypothetical protein AN0929.2 [Aspergillus nidulans FGSC A4]
          Length = 728

 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 165/328 (50%), Gaps = 48/328 (14%)

Query: 9   VTLRNALIPLI-TDMLPGW---DVSNESDIQIERVSGALTNCVFFITRTK-----KLHDQ 59
           V  ++ L+ L  T  L GW    +   S+I + R+SGALTN V+ IT  +     K  D 
Sbjct: 245 VVFKSELLRLTHTLQLKGWRKIPMELASEIDVVRLSGALTNAVYKITPPQNIPPPKAEDG 304

Query: 60  T----KNKKPLRVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHL 115
           +      + P ++LLR+YG  VD L DR+KEL  L  L    IGPK+LG F NGRFE++ 
Sbjct: 305 SYTLVPRRPPPKLLLRIYGPQVDHLIDREKELQILRRLGRKNIGPKVLGTFNNGRFEEYF 364

Query: 116 ESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWVNIDKWYPLALNAIS 175
           E+  L   +LRDPST K IA+R+ +LH+ I++    +EN  P V+ N DKW       IS
Sbjct: 365 EARPLTPKELRDPSTMKQIAKRMRELHDGIDLLDEEREN-GPMVFHNWDKWVDRCEQVIS 423

Query: 176 ----SLKCTEEQRKGLEE----------FDFKMLKDEIEELKYKL------SHNIDSPIV 215
                +K    + K   E            +   +  +E+ +  L       H I   +V
Sbjct: 424 WVDAEIKSPLNEGKAASEPWRRRGYVCGVPWPKFRKAVEDYRKWLIVDSGGVHEIKRQLV 483

Query: 216 FAHNDTQYGNILRLTDG-------------SLVVVDFEYAGYNYQAFDIANHFCEWTYDY 262
           F HNDTQYGN+LR+                 LVV+DFEYA  N    + ANHF EW Y+Y
Sbjct: 484 FGHNDTQYGNLLRMEPSQQSPLLLPQNEHKQLVVIDFEYASANTPGLEFANHFTEWCYNY 543

Query: 263 R-SSVPHKMNLDLYPNEDQQIDFLRAYI 289
             +  P   N  LYP  +QQ  F+ AY+
Sbjct: 544 HDAEKPWACNNQLYPTPEQQHQFVTAYL 571



>gi|187607543|ref|NP_001120148.1| choline kinase beta [Xenopus (Silurana) tropicalis]
 gi|166796753|gb|AAI59142.1| LOC100145186 protein [Xenopus (Silurana) tropicalis]
          Length = 436

 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 198/368 (53%), Gaps = 35/368 (9%)

Query: 8   NVTLRNALIPLITDMLPG-WDVSNESDIQIERVSGALTNCVFFITRTKKLHDQTKNKKPL 66
           N  L+     L  + L G W        ++  VSG L+N ++  + T  +  +T++ +P 
Sbjct: 86  NTELQTRAFTLCREYLRGVWREIQPHQFRVSVVSGGLSNLLYKCSLTDSV--KTQSTEPR 143

Query: 67  RVLLRVYGNGVDQLCDRQKELNFLEMLSNLKIGPKLLGVFKNGRFEQHLESETLKSNDLR 126
           +VLLR+YG  +  +    +E     +L+   +GP+L GVF  GR E+++ S  L +++L 
Sbjct: 144 QVLLRLYGAILQGVNSLVQESVMFAILAERSLGPRLYGVFPQGRLEEYIPSRRLLTSELS 203

Query: 127 DPSTSKYIAQRLSQLHNIINICPPPQENIKPEVWV--NIDKWYPLALNAISSLKCTEEQR 184
            P  S  IA++L++ H +         N KP VW+   ++++    ++ ISSL  T  Q+
Sbjct: 204 CPDVSSEIAEKLARFHKM-----EMPFNKKP-VWLFRTMEEY----MSQISSLSFT--QK 251

Query: 185 KGLEEFD---FKMLKDEIEELKYKLSHNIDSPIVFAHNDTQYGNI------LRLTDGSLV 235
           + +E+F+      L++E+++LK  L  +  SP+VF HND Q GNI             L+
Sbjct: 252 EDVEKFNQLKSLSLEEEMQKLKLLL-LSTASPVVFCHNDVQEGNILLLSSRSSSPSDRLM 310

Query: 236 VVDFEYAGYNYQAFDIANHFCEWTYDYR-SSVP-HKMNLDLYPNEDQQIDFLRAYIDAYS 293
           ++DFEY+ YNY+ FDI NHFCEW Y+Y+ +  P +K  L+ YP+  QQ+ F R+Y+   S
Sbjct: 311 LIDFEYSSYNYRGFDIGNHFCEWAYNYQHNEWPFYKAQLNDYPSRVQQLRFFRSYLLEMS 370

Query: 294 IPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGLVQSGQSQIDFDYLSYGMER 353
                   +  E      + + LEV  F LASH  WGLW ++Q+  S I+F YL Y + R
Sbjct: 371 PGLSEGERHAQE------EAMLLEVNRFALASHFFWGLWSILQAKMSTIEFGYLDYALSR 424

Query: 354 LHRFRELK 361
            + + E K
Sbjct: 425 FNAYFEQK 432



>gi|426201843|gb|EKV51766.1| hypothetical protein AGABI2DRAFT_198280 [Agaricus bisporus var.
           bisporus H97]
          Length = 400

 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 180/349 (51%), Gaps = 42/349 (12%)

Query: 33  DIQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEM 92
           D+ I +VSGALTN VFF++           K+   VL RVYG     L  R +EL+ L +
Sbjct: 61  DLHIHKVSGALTNAVFFVSFPS-------GKRTRTVLTRVYGPSSSSLISRPRELHTLHI 113

Query: 93  LSN-LKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNI-INICPP 150
           LS    +GP++ G F+NGR E++ ES TL + DLRDP  S +I   +++LH++ IN+   
Sbjct: 114 LSTRYHLGPRVYGTFENGRVEEYFESTTLTAPDLRDPKISGWIGACMAELHSVDINV--- 170

Query: 151 PQENIKPEVWV-----NIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYK 205
               ++ + W+     N+  W   A   ++    +E+ R+ L+   F+   D       K
Sbjct: 171 ----VEGKNWIIGVEQNVRAWLTPAGKVLALPSVSEDIRRELDLDKFRHDWDRYSHWLAK 226

Query: 206 LSH-NIDSPIVFAHNDTQYGNILRLTDG--------SLVVVDFEYAGYNYQAFDIANHFC 256
           +   +  S  VFAHNDTQYGN+LRL            ++VVDFEYA  N  +FDIANHF 
Sbjct: 227 VDDVHSGSKRVFAHNDTQYGNLLRLNHPKEDADDHRQIIVVDFEYAAPNPASFDIANHFH 286

Query: 257 EWTYDYRSS-VPHKMNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLK 315
           EWT DY S    H ++   YP   ++ +F  +Y+   S    H   +  E  ++ + KL 
Sbjct: 287 EWTADYHSPDKSHLLDPSKYPTLAERRNFYLSYLRHAS----HITGSDVEL-ESTIAKLD 341

Query: 316 LEVYAFTLASHVMWGLWGLVQS------GQSQIDFDYLSYGMERLHRFR 358
            +V  ++ ASH  W +W +VQ+        +  +FDY+ Y   R   FR
Sbjct: 342 RQVQVWSPASHAHWMIWAIVQARDDLENNNTTPEFDYIGYARCRSALFR 390



>gi|351724363|ref|NP_001236799.1| GmCK1p [Glycine max]
 gi|1438879|gb|AAC49374.1| GmCK1p [Glycine max]
          Length = 359

 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 170/325 (52%), Gaps = 30/325 (9%)

Query: 34  IQIERVSGALTNCVFFITRTKKLHDQTKNKKPLRVLLRVYGNGVDQLCDRQKELNFLEML 93
           +Q+  + GA+TN VF +    K     +     RVL+R+YG GV+   +R  E+   E +
Sbjct: 39  LQVTPLKGAMTNEVFEVNWPTKSDGHQR-----RVLVRLYGEGVEVFFNRVDEIQTFECM 93

Query: 94  SNLKIGPKLLGVFKNGRFEQHLESETLKSNDLRDPSTSKYIAQRLSQLHNIINICPPPQE 153
           S    GP+LLG F  GR E+ + ++TL + DLRDP  S  IA ++ + HN+    P  + 
Sbjct: 94  SKHGQGPRLLGRFTTGRVEEFIHAKTLSAADLRDPEISALIASKMREFHNL--HMPGAK- 150

Query: 154 NIKPEVWVNIDKWYPLALNAISSLKCTEEQRKGLEEFDFKMLKDEIEELKYKLSHNIDSP 213
             K ++W  + KW    L+   SL C+ ++ K    F    L  EI  L   LS   +  
Sbjct: 151 --KAQLWQRMRKW----LSHAKSL-CSPKETK---NFGLDNLDAEINMLVELLSQG-NQQ 199

Query: 214 IVFAHNDTQYGNILRLTDG-SLVVVDFEYAGYNYQAFDIANHFCEWTYDYRSSVPHKMNL 272
           I F HND QYGNI+   D  ++ ++D+EYA YN   +D+ANHFCE   +Y S  PH ++ 
Sbjct: 200 IGFCHNDLQYGNIMMDEDTRAITLIDYEYASYNPIGYDLANHFCEMVANYHSDEPHVLDY 259

Query: 273 DLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLW 332
             YP  +++  F+  Y+ +           PS +  + L  L      +TLA+H+ WGLW
Sbjct: 260 SKYPGLEERQRFVYNYLSSEG-------KKPSNSEVDQLVNL---AEKYTLANHLFWGLW 309

Query: 333 GLVQSGQSQIDFDYLSYGMERLHRF 357
           GL+ S  + IDFDY  Y  +R  ++
Sbjct: 310 GLISSHVNTIDFDYKEYARQRFQQY 334