BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10054_c0_seq2-m.23 complete 206-523(+) 106 (+)
         (105 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|391343675|ref|XP_003746132.1| PREDICTED: choline/ethanolamine...    75   5e-12   Metaseiulus occidentalis
gi|391329745|ref|XP_003739328.1| PREDICTED: choline/ethanolamine...    75   7e-12   Metaseiulus occidentalis
gi|460399299|ref|XP_004245179.1| PREDICTED: probable ethanolamin...    74   1e-11   Solanum lycopersicum
gi|348671557|gb|EGZ11378.1| hypothetical protein PHYSODRAFT_3524...    73   2e-11   Phytophthora sojae
gi|348671552|gb|EGZ11373.1| hypothetical protein PHYSODRAFT_3524...    73   2e-11   Phytophthora sojae
gi|505833967|ref|XP_004611409.1| PREDICTED: ethanolamine kinase ...    73   3e-11   
gi|356508317|ref|XP_003522904.1| PREDICTED: probable ethanolamin...    73   3e-11   
gi|242022623|ref|XP_002431739.1| Ethanolamine kinase, putative [...    72   3e-11   Pediculus humanus corporis [human body lice]
gi|356516955|ref|XP_003527156.1| PREDICTED: probable ethanolamin...    72   4e-11   
gi|66821497|ref|XP_644218.1| ethanolamine kinase A [Dictyosteliu...    72   5e-11   Dictyostelium discoideum AX4
gi|511003159|gb|EPB84571.1| hypothetical protein HMPREF1544_0866...    71   7e-11   Mucor circinelloides f. circinelloides 1006PhL
gi|499018328|ref|XP_004559958.1| PREDICTED: ethanolamine kinase ...    71   9e-11   Maylandia zebra


>gi|391343675|ref|XP_003746132.1| PREDICTED: choline/ethanolamine kinase-like [Metaseiulus
           occidentalis]
          Length = 429

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 2   NLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWG 61
           ++D YP E+Q+  FL  Y+      S H   +P     N ++ L  E   FTLASH+MW 
Sbjct: 330 SIDQYPTEEQRRAFLEEYLKTLKSSSIHGDIDPK---VNTIEHLLEETETFTLASHIMWS 386

Query: 62  LWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVYERLPL 101
           LW L  +  S+I+F Y  YG  RL R+ ELK  + ERL L
Sbjct: 387 LWSLNSAHSSKINFGYWEYGAARLRRYLELKERLMERLEL 426



>gi|391329745|ref|XP_003739328.1| PREDICTED: choline/ethanolamine kinase-like [Metaseiulus
           occidentalis]
          Length = 404

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 2   NLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWG 61
           ++D YP E+Q+  FL  Y+      S H   +P     N ++ L  E   FTLASH+MW 
Sbjct: 305 SIDQYPTEEQRRAFLEEYLKTLKSSSIHGDIDPK---VNTIEHLLEETETFTLASHIMWS 361

Query: 62  LWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEVYERLPL 101
           LW L  +  S+I+F Y  YG  RL R+ ELK  + ERL L
Sbjct: 362 LWSLNSAHSSKINFGYWEYGAARLRRYLELKERLMERLEL 401



>gi|460399299|ref|XP_004245179.1| PREDICTED: probable ethanolamine kinase A-like [Solanum
           lycopersicum]
          Length = 372

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 9/91 (9%)

Query: 5   LYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 64
           LYPN+DQQ  F R Y+D+         + P++  D  L+ L +E  ++ LASH+ W LW 
Sbjct: 273 LYPNKDQQFHFFRHYLDS---------DQPNKVSDKDLEALYVETSSYMLASHLYWALWA 323

Query: 65  LVQSGQSQIDFDYLSYGMERLHRFRELKNEV 95
           L+Q+  S IDFDY+SY   R + +++ K +V
Sbjct: 324 LIQAKMSPIDFDYISYFFLRYNEYKKQKEKV 354



>gi|348671557|gb|EGZ11378.1| hypothetical protein PHYSODRAFT_352482 [Phytophthora sojae]
          Length = 361

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 10/91 (10%)

Query: 6   YPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGL 65
           YP ++QQ +F RAY+            + S+  +N +++L+LE   ++LASH+ W +WG 
Sbjct: 278 YPTKEQQRNFCRAYLAGKD-------GDESDVSENEIEQLRLEANTYSLASHMFWSIWGY 330

Query: 66  VQSGQSQIDFDYLSYGMERLHRFRE---LKN 93
           +Q+ QS IDFD+L+YG  R   F+    LKN
Sbjct: 331 IQAAQSDIDFDFLAYGKCRYDAFKSRVTLKN 361



>gi|348671552|gb|EGZ11373.1| hypothetical protein PHYSODRAFT_352481 [Phytophthora sojae]
          Length = 359

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 10/91 (10%)

Query: 6   YPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWGL 65
           YP ++QQ +F RAY+            + S+  +N +++L+LE   ++LASH+ W +WG 
Sbjct: 274 YPTKEQQRNFCRAYLAGKD-------GDESDVSENEIEQLRLEANTYSLASHMFWSIWGY 326

Query: 66  VQSGQSQIDFDYLSYGMERLHRFRE---LKN 93
           +Q+ QS IDFD+L+YG  R   F+    LKN
Sbjct: 327 IQAAQSDIDFDFLAYGKCRYDAFKSQVALKN 357



>gi|505833967|ref|XP_004611409.1| PREDICTED: ethanolamine kinase 1 [Sorex araneus]
          Length = 338

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 4/91 (4%)

Query: 5   LYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 64
           LYP  + Q+ +LRAY++AY    +H      E  D  ++ L + V  F LASH  WGLW 
Sbjct: 245 LYPGRELQLQWLRAYLEAY----NHYKGYGPEVTDKEVEVLFIHVNRFALASHFFWGLWA 300

Query: 65  LVQSGQSQIDFDYLSYGMERLHRFRELKNEV 95
           L+Q+  S I+FD+L Y + R +++ ++K EV
Sbjct: 301 LIQAKYSTIEFDFLGYAIVRFNQYFKMKPEV 331



>gi|356508317|ref|XP_003522904.1| PREDICTED: probable ethanolamine kinase A-like [Glycine max]
          Length = 327

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 4   DLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLW 63
           DLYPN ++Q  FLR Y+             P E  +  L+ L +E   F+LASHV W LW
Sbjct: 231 DLYPNMNEQYHFLRHYLKP---------ERPQEVSEKDLETLYVEANTFSLASHVFWALW 281

Query: 64  GLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 96
           GL+Q+  S I+FDYL Y   R H ++  K + +
Sbjct: 282 GLIQAKMSPIEFDYLGYFFLRYHEYKRQKEKYF 314



>gi|242022623|ref|XP_002431739.1| Ethanolamine kinase, putative [Pediculus humanus corporis]
 gi|212517054|gb|EEB19001.1| Ethanolamine kinase, putative [Pediculus humanus corporis]
          Length = 376

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 2/94 (2%)

Query: 5   LYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 64
           L+PNE  Q +++R Y+  Y I +   I N  E +D  ++ + L+V  FTLASH +WGLW 
Sbjct: 255 LFPNEPFQKNWIRIYLLKY-IKNKKKIENV-EVNDEEIESMFLKVKKFTLASHFLWGLWS 312

Query: 65  LVQSGQSQIDFDYLSYGMERLHRFRELKNEVYER 98
           L+Q+  S I FDYL+Y   R   + + K E++ +
Sbjct: 313 LIQAEHSSIQFDYLNYAFIRFTEYYKKKKEIFNK 346



>gi|356516955|ref|XP_003527156.1| PREDICTED: probable ethanolamine kinase A-like [Glycine max]
          Length = 381

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 4   DLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLW 63
           DLYPN ++Q  FLR Y+             P E  +  L+ L +E   F+LASH+ W LW
Sbjct: 282 DLYPNMNEQYHFLRHYLKP---------ERPQEVSEKDLETLYVEANTFSLASHIFWALW 332

Query: 64  GLVQSGQSQIDFDYLSYGMERLHRFRELKNEVY 96
           GL+Q+  S I+FDYL Y   R H ++  K + +
Sbjct: 333 GLIQAKMSAIEFDYLGYFFLRYHEYKRHKEKYF 365



>gi|66821497|ref|XP_644218.1| ethanolamine kinase A [Dictyostelium discoideum AX4]
 gi|74860316|sp|Q869T9.1|EKIA_DICDI RecName: Full=Probable ethanolamine kinase A
 gi|60472417|gb|EAL70370.1| ethanolamine kinase A [Dictyostelium discoideum AX4]
          Length = 349

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (57%), Gaps = 9/90 (10%)

Query: 5   LYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWGLWG 64
           LYPN++ QI FL  Y         H     +E   + L+KL +E   F+LASH+ WG W 
Sbjct: 264 LYPNKESQIHFLTDY---------HRSLFKTEPTQDELEKLYIESNQFSLASHLYWGFWA 314

Query: 65  LVQSGQSQIDFDYLSYGMERLHRFRELKNE 94
           +VQ+  SQIDFDYL YG  R  R+ E +++
Sbjct: 315 IVQAMNSQIDFDYLEYGKARFDRYYETRDQ 344



>gi|511003159|gb|EPB84571.1| hypothetical protein HMPREF1544_08666 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 369

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 4/90 (4%)

Query: 1   MNLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMW 60
           M+   YP  ++QI FL AY++  S   +  I + + T +  LQK   E   + +ASH+ W
Sbjct: 278 MDTSQYPTYEEQIRFLNAYLETKSKNDNPDILDKAVTAE-CLQK---EAAMWLMASHLSW 333

Query: 61  GLWGLVQSGQSQIDFDYLSYGMERLHRFRE 90
           GLWGL+Q+ QS+IDFDY  +  +RL+ FRE
Sbjct: 334 GLWGLIQASQSEIDFDYFLFSTQRLNAFRE 363



>gi|499018328|ref|XP_004559958.1| PREDICTED: ethanolamine kinase 1-like [Maylandia zebra]
          Length = 360

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (58%), Gaps = 4/94 (4%)

Query: 2   NLDLYPNEDQQIDFLRAYIDAYSIPSDHTINNPSETHDNYLQKLKLEVYAFTLASHVMWG 61
           N  LYP+ + Q+++L+ Y+ AY + + +T     E     L+ L ++V  F LASH  WG
Sbjct: 264 NYGLYPSREMQMEWLKVYLQAYKLFTKNT----EEVSQRELETLYVQVNKFALASHFFWG 319

Query: 62  LWGLVQSGQSQIDFDYLSYGMERLHRFRELKNEV 95
            W L+Q+  S IDFD+L Y + R +++ + K  V
Sbjct: 320 FWALIQAKYSSIDFDFLGYAVLRFNQYFKTKPAV 353