BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10055_c0_seq1-m.24 5prime_partial 173-1048(-) 292 (-)
         (291 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384499478|gb|EIE89969.1| hypothetical protein RO3G_14680 [Rhi...   145   9e-33   Rhizopus delemar RA 99-880
gi|511006550|gb|EPB87860.1| hypothetical protein HMPREF1544_0538...   144   2e-32   Mucor circinelloides f. circinelloides 1006PhL
gi|511004042|gb|EPB85423.1| hypothetical protein HMPREF1544_0779...   144   3e-32   Mucor circinelloides f. circinelloides 1006PhL
gi|511006549|gb|EPB87859.1| hypothetical protein HMPREF1544_0538...   143   6e-32   Mucor circinelloides f. circinelloides 1006PhL
gi|511005353|gb|EPB86696.1| hypothetical protein HMPREF1544_0648...   143   6e-32   Mucor circinelloides f. circinelloides 1006PhL
gi|511004033|gb|EPB85414.1| hypothetical protein HMPREF1544_0778...   135   1e-29   Mucor circinelloides f. circinelloides 1006PhL
gi|384498726|gb|EIE89217.1| hypothetical protein RO3G_13928 [Rhi...   131   2e-28   Rhizopus delemar RA 99-880
gi|511004453|gb|EPB85823.1| hypothetical protein HMPREF1544_0740...   129   7e-28   Mucor circinelloides f. circinelloides 1006PhL
gi|511010408|gb|EPB91632.1| hypothetical protein HMPREF1544_0155...   129   9e-28   Mucor circinelloides f. circinelloides 1006PhL
gi|511004034|gb|EPB85415.1| hypothetical protein HMPREF1544_0778...   128   1e-27   Mucor circinelloides f. circinelloides 1006PhL
gi|511006275|gb|EPB87591.1| hypothetical protein HMPREF1544_0557...   124   3e-26   Mucor circinelloides f. circinelloides 1006PhL
gi|511006590|gb|EPB87899.1| hypothetical protein HMPREF1544_0530...   123   5e-26   Mucor circinelloides f. circinelloides 1006PhL
gi|384490271|gb|EIE81493.1| hypothetical protein RO3G_06198 [Rhi...   122   8e-26   Rhizopus delemar RA 99-880
gi|511003178|gb|EPB84590.1| hypothetical protein HMPREF1544_0868...   122   1e-25   Mucor circinelloides f. circinelloides 1006PhL
gi|384498349|gb|EIE88840.1| hypothetical protein RO3G_13551 [Rhi...   121   2e-25   Rhizopus delemar RA 99-880
gi|511004214|gb|EPB85591.1| hypothetical protein HMPREF1544_0768...   119   9e-25   Mucor circinelloides f. circinelloides 1006PhL
gi|511006015|gb|EPB87336.1| hypothetical protein HMPREF1544_0586...   116   9e-24   Mucor circinelloides f. circinelloides 1006PhL
gi|511009362|gb|EPB90606.1| hypothetical protein HMPREF1544_0251...   115   2e-23   Mucor circinelloides f. circinelloides 1006PhL
gi|384502053|gb|EIE92544.1| hypothetical protein RO3G_17142 [Rhi...   114   4e-23   Rhizopus delemar RA 99-880
gi|384494573|gb|EIE85064.1| hypothetical protein RO3G_09774 [Rhi...   110   6e-22   Rhizopus delemar RA 99-880
gi|384489746|gb|EIE80968.1| hypothetical protein RO3G_05673 [Rhi...   109   1e-21   Rhizopus delemar RA 99-880
gi|511001640|gb|EPB83106.1| hypothetical protein HMPREF1544_1014...   107   4e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|384499227|gb|EIE89718.1| hypothetical protein RO3G_14429 [Rhi...   106   8e-21   Rhizopus delemar RA 99-880
gi|511010507|gb|EPB91728.1| hypothetical protein HMPREF1544_0143...   105   1e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|384500229|gb|EIE90720.1| hypothetical protein RO3G_15431 [Rhi...   105   1e-20   Rhizopus delemar RA 99-880
gi|384487154|gb|EIE79334.1| hypothetical protein RO3G_04039 [Rhi...   105   1e-20   Rhizopus delemar RA 99-880
gi|511002906|gb|EPB84327.1| hypothetical protein HMPREF1544_0892...   104   3e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|495197908|ref|WP_007922697.1| type 11 methyltransferase [Kted...   104   3e-20   Ktedonobacter racemifer
gi|511011209|gb|EPB92421.1| hypothetical protein HMPREF1544_0071...   103   5e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|495198165|ref|WP_007922954.1| Methyltransferase type 11 [Kted...   102   1e-19   Ktedonobacter racemifer
gi|384484246|gb|EIE76426.1| hypothetical protein RO3G_01130 [Rhi...   101   2e-19   Rhizopus delemar RA 99-880
gi|384486559|gb|EIE78739.1| hypothetical protein RO3G_03444 [Rhi...   101   3e-19   Rhizopus delemar RA 99-880
gi|495192558|ref|WP_007917348.1| Methyltransferase type 11 [Kted...   101   3e-19   Ktedonobacter racemifer
gi|511007540|gb|EPB88826.1| hypothetical protein HMPREF1544_0433...   100   3e-19   Mucor circinelloides f. circinelloides 1006PhL
gi|384491034|gb|EIE82230.1| hypothetical protein RO3G_06935 [Rhi...   100   3e-19   Rhizopus delemar RA 99-880
gi|401883649|gb|EJT47847.1| Methyltransferase type 11 [Trichospo...   100   6e-19   Trichosporon asahii var. asahii CBS 2479
gi|406702527|gb|EKD05542.1| Methyltransferase type 11 [Trichospo...    99   1e-18   Trichosporon asahii var. asahii CBS 8904
gi|384486101|gb|EIE78281.1| hypothetical protein RO3G_02985 [Rhi...    99   2e-18   Rhizopus delemar RA 99-880
gi|384496141|gb|EIE86632.1| hypothetical protein RO3G_11343 [Rhi...    99   2e-18   Rhizopus delemar RA 99-880
gi|384488579|gb|EIE80759.1| hypothetical protein RO3G_05464 [Rhi...    98   2e-18   Rhizopus delemar RA 99-880
gi|495189579|ref|WP_007914369.1| type 11 methyltransferase [Kted...    98   3e-18   Ktedonobacter racemifer
gi|495198348|ref|WP_007923137.1| type 11 methyltransferase [Kted...    98   3e-18   Ktedonobacter racemifer
gi|302919169|ref|XP_003052805.1| hypothetical protein NECHADRAFT...    97   4e-18   Nectria haematococca mpVI 77-13-4
gi|511009368|gb|EPB90612.1| hypothetical protein HMPREF1544_0252...    97   4e-18   Mucor circinelloides f. circinelloides 1006PhL
gi|510999582|gb|EPB81197.1| hypothetical protein HMPREF1544_1210...    96   9e-18   Mucor circinelloides f. circinelloides 1006PhL
gi|384500386|gb|EIE90877.1| hypothetical protein RO3G_15588 [Rhi...    96   1e-17   Rhizopus delemar RA 99-880
gi|384496105|gb|EIE86596.1| hypothetical protein RO3G_11307 [Rhi...    95   3e-17   Rhizopus delemar RA 99-880
gi|380479314|emb|CCF43091.1| TAM domain methyltransferase [Colle...    94   3e-17   Colletotrichum higginsianum
gi|384491468|gb|EIE82664.1| hypothetical protein RO3G_07369 [Rhi...    94   3e-17   Rhizopus delemar RA 99-880
gi|121706360|ref|XP_001271443.1| conserved hypothetical protein ...    94   4e-17   Aspergillus clavatus NRRL 1
gi|302886149|ref|XP_003041965.1| hypothetical protein NECHADRAFT...    94   6e-17   Nectria haematococca mpVI 77-13-4
gi|384500413|gb|EIE90904.1| hypothetical protein RO3G_15615 [Rhi...    94   6e-17   Rhizopus delemar RA 99-880
gi|475672319|gb|EMT69483.1| mRNA 3'-end-processing protein YTH1 ...    93   7e-17   Fusarium oxysporum f. sp. cubense race 4
gi|384496097|gb|EIE86588.1| hypothetical protein RO3G_11299 [Rhi...    93   8e-17   Rhizopus delemar RA 99-880
gi|510999402|gb|EPB81043.1| hypothetical protein HMPREF1544_1225...    93   9e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|384491877|gb|EIE83073.1| hypothetical protein RO3G_07778 [Rhi...    93   1e-16   Rhizopus delemar RA 99-880
gi|384484898|gb|EIE77078.1| hypothetical protein RO3G_01782 [Rhi...    93   1e-16   Rhizopus delemar RA 99-880
gi|302885854|ref|XP_003041818.1| hypothetical protein NECHADRAFT...    93   1e-16   Nectria haematococca mpVI 77-13-4
gi|495194496|ref|WP_007919286.1| type 11 methyltransferase [Kted...    92   1e-16   
gi|477519783|gb|ENH71949.1| mRNA 3'-end-processing protein YTH1 ...    92   1e-16   Fusarium oxysporum f. sp. cubense race 1
gi|402074124|gb|EJT69653.1| hypothetical protein GGTG_12537 [Gae...    92   2e-16   Gaeumannomyces graminis var. tritici R3-111a-1
gi|511002580|gb|EPB84010.1| hypothetical protein HMPREF1544_0920...    91   3e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|477522885|gb|ENH74927.1| hypothetical protein FOC1_g10002472 ...    91   3e-16   Fusarium oxysporum f. sp. cubense race 1
gi|384483693|gb|EIE75873.1| hypothetical protein RO3G_00577 [Rhi...    91   5e-16   Rhizopus delemar RA 99-880
gi|384497298|gb|EIE87789.1| hypothetical protein RO3G_12500 [Rhi...    90   9e-16   Rhizopus delemar RA 99-880
gi|302887855|ref|XP_003042815.1| hypothetical protein NECHADRAFT...    89   1e-15   Nectria haematococca mpVI 77-13-4
gi|384493293|gb|EIE83784.1| hypothetical protein RO3G_08489 [Rhi...    89   1e-15   Rhizopus delemar RA 99-880
gi|85081713|ref|XP_956770.1| hypothetical protein NCU00451 [Neur...    89   1e-15   Neurospora crassa OR74A
gi|475667102|gb|EMT64892.1| Demethylmenaquinone methyltransferas...    89   1e-15   Fusarium oxysporum f. sp. cubense race 4
gi|367028873|ref|XP_003663720.1| hypothetical protein MYCTH_2315...    89   2e-15   Myceliophthora thermophila ATCC 42464
gi|477508784|gb|ENH62077.1| Phosphoethanolamine N-methyltransfer...    89   2e-15   Fusarium oxysporum f. sp. cubense race 1
gi|342871460|gb|EGU74057.1| hypothetical protein FOXB_15447 [Fus...    88   2e-15   Fusarium oxysporum Fo5176
gi|477527332|gb|ENH79155.1| methyltransferase domain-containing ...    88   2e-15   Colletotrichum orbiculare MAFF 240422
gi|392574793|gb|EIW67928.1| hypothetical protein TREMEDRAFT_5739...    88   2e-15   Tremella mesenterica DSM 1558
gi|336261277|ref|XP_003345429.1| hypothetical protein SMAC_08783...    88   2e-15   Sordaria macrospora k-hell
gi|511000432|gb|EPB81971.1| hypothetical protein HMPREF1544_1128...    88   2e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|495196549|ref|WP_007921339.1| Methyltransferase type 11 [Kted...    88   2e-15   Ktedonobacter racemifer
gi|336266230|ref|XP_003347884.1| hypothetical protein SMAC_06716...    88   3e-15   Sordaria macrospora k-hell
gi|477535144|gb|ENH86671.1| methyltransferase domain-containing ...    87   4e-15   Colletotrichum orbiculare MAFF 240422
gi|336260240|ref|XP_003344916.1| hypothetical protein SMAC_08396...    87   4e-15   Sordaria macrospora k-hell
gi|399170491|emb|CCE28868.1| uncharacterized protein CPUR_02558 ...    87   4e-15   Claviceps purpurea 20.1
gi|342888666|gb|EGU87903.1| hypothetical protein FOXB_01589 [Fus...    87   4e-15   Fusarium oxysporum Fo5176
gi|302902186|ref|XP_003048600.1| hypothetical protein NECHADRAFT...    87   4e-15   Nectria haematococca mpVI 77-13-4
gi|408393967|gb|EKJ73224.1| hypothetical protein FPSE_06648 [Fus...    87   5e-15   Fusarium pseudograminearum CS3096
gi|477520092|gb|ENH72228.1| Demethylmenaquinone methyltransferas...    87   5e-15   Fusarium oxysporum f. sp. cubense race 1
gi|302884009|ref|XP_003040902.1| hypothetical protein NECHADRAFT...    87   5e-15   Nectria haematococca mpVI 77-13-4
gi|429850977|gb|ELA26202.1| methyltransferase domain-containing ...    87   6e-15   Colletotrichum gloeosporioides Nara gc5
gi|336260232|ref|XP_003344912.1| hypothetical protein SMAC_08392...    87   6e-15   Sordaria macrospora k-hell
gi|477520492|gb|ENH72618.1| hypothetical protein FOC1_g10013276 ...    87   6e-15   Fusarium oxysporum f. sp. cubense race 1
gi|399170957|emb|CCE28051.1| uncharacterized protein CPUR_01525 ...    87   6e-15   Claviceps purpurea 20.1
gi|399170467|emb|CCE28844.1| uncharacterized protein CPUR_02533 ...    87   7e-15   Claviceps purpurea 20.1
gi|399170466|emb|CCE28843.1| uncharacterized protein CPUR_02532 ...    87   7e-15   Claviceps purpurea 20.1
gi|336470542|gb|EGO58703.1| hypothetical protein NEUTE1DRAFT_144...    87   7e-15   Neurospora tetrasperma FGSC 2508
gi|380088936|emb|CCC13216.1| unnamed protein product [Sordaria m...    87   7e-15   Sordaria macrospora k-hell
gi|336470002|gb|EGO58164.1| hypothetical protein NEUTE1DRAFT_101...    86   9e-15   Neurospora tetrasperma FGSC 2508
gi|302908161|ref|XP_003049805.1| hypothetical protein NECHADRAFT...    86   9e-15   Nectria haematococca mpVI 77-13-4
gi|340897429|gb|EGS17019.1| hypothetical protein CTHT_0073450 [C...    86   9e-15   Chaetomium thermophilum var. thermophilum DSM 1495
gi|495195997|ref|WP_007920787.1| Methyltransferase type 11 [Kted...    86   9e-15   Ktedonobacter racemifer
gi|296423088|ref|XP_002841088.1| hypothetical protein [Tuber mel...    86   1e-14   Tuber melanosporum Mel28
gi|46115986|ref|XP_384011.1| hypothetical protein FG03835.1 [Fus...    86   1e-14   
gi|475666883|gb|EMT64673.1| hypothetical protein FOC4_g10007354 ...    86   1e-14   Fusarium oxysporum f. sp. cubense race 4
gi|320592688|gb|EFX05118.1| methyltransferase type 12 [Grosmanni...    86   1e-14   Grosmannia clavigera kw1407
gi|342873344|gb|EGU75532.1| hypothetical protein FOXB_13950 [Fus...    86   1e-14   Fusarium oxysporum Fo5176
gi|336470531|gb|EGO58692.1| hypothetical protein NEUTE1DRAFT_780...    86   2e-14   Neurospora tetrasperma FGSC 2508
gi|475671568|gb|EMT68847.1| Phosphoethanolamine N-methyltransfer...    86   2e-14   Fusarium oxysporum f. sp. cubense race 4
gi|477519248|gb|ENH71426.1| Phosphoethanolamine N-methyltransfer...    85   2e-14   Fusarium oxysporum f. sp. cubense race 1
gi|159123462|gb|EDP48581.1| methyltransferase, putative [Aspergi...    85   2e-14   Aspergillus fumigatus A1163
gi|302917172|ref|XP_003052390.1| hypothetical protein NECHADRAFT...    85   2e-14   Nectria haematococca mpVI 77-13-4
gi|399170970|emb|CCE28064.1| uncharacterized protein CPUR_01538 ...    85   2e-14   Claviceps purpurea 20.1
gi|485918769|gb|EOD45328.1| putative tam domain methyltransferas...    85   2e-14   Neofusicoccum parvum UCRNP2
gi|392574791|gb|EIW67926.1| hypothetical protein TREMEDRAFT_6381...    85   2e-14   Tremella mesenterica DSM 1558
gi|85095489|ref|XP_960101.1| hypothetical protein NCU05841 [Neur...    85   2e-14   Neurospora crassa OR74A
gi|116197022|ref|XP_001224323.1| hypothetical protein CHGG_05109...    85   2e-14   Chaetomium globosum CBS 148.51
gi|477528628|gb|ENH80409.1| methyltransferase domain-containing ...    85   2e-14   Colletotrichum orbiculare MAFF 240422
gi|384483931|gb|EIE76111.1| hypothetical protein RO3G_00815 [Rhi...    85   2e-14   Rhizopus delemar RA 99-880
gi|409082773|gb|EKM83131.1| hypothetical protein AGABI1DRAFT_125...    85   2e-14   Agaricus bisporus var. burnettii JB137-S8
gi|399170478|emb|CCE28855.1| uncharacterized protein CPUR_02544 ...    85   2e-14   Claviceps purpurea 20.1
gi|296424464|ref|XP_002841768.1| hypothetical protein [Tuber mel...    85   2e-14   Tuber melanosporum Mel28
gi|429857110|gb|ELA31992.1| methyltransferase domain-containing ...    85   2e-14   Colletotrichum gloeosporioides Nara gc5
gi|399166203|emb|CCE32995.1| uncharacterized protein CPUR_06918 ...    85   3e-14   Claviceps purpurea 20.1
gi|399170468|emb|CCE28845.1| uncharacterized protein CPUR_02534 ...    85   3e-14   Claviceps purpurea 20.1
gi|429859604|gb|ELA34381.1| SAM dependent methyltransferase, put...    85   3e-14   Colletotrichum gloeosporioides Nara gc5
gi|495196550|ref|WP_007921340.1| Methyltransferase type 11 [Kted...    84   3e-14   Ktedonobacter racemifer
gi|336467795|gb|EGO55959.1| hypothetical protein NEUTE1DRAFT_117...    84   3e-14   Neurospora tetrasperma FGSC 2508
gi|495193431|ref|WP_007918221.1| Methyltransferase type 11 [Kted...    84   3e-14   Ktedonobacter racemifer
gi|500253011|gb|EON96769.1| putative s-adenosyl-l-methionine-dep...    84   3e-14   Phaeoacremonium minimum UCRPA7
gi|399164450|emb|CCE34654.1| uncharacterized protein CPUR_08588 ...    84   3e-14   Claviceps purpurea 20.1
gi|302916913|ref|XP_003052267.1| hypothetical protein NECHADRAFT...    84   3e-14   Nectria haematococca mpVI 77-13-4
gi|399166187|emb|CCE32979.1| uncharacterized protein CPUR_06901 ...    84   3e-14   Claviceps purpurea 20.1
gi|302881379|ref|XP_003039604.1| hypothetical protein NECHADRAFT...    84   4e-14   Nectria haematococca mpVI 77-13-4
gi|380489752|emb|CCF36491.1| UMTA [Colletotrichum higginsianum]        84   4e-14   Colletotrichum higginsianum
gi|85092357|ref|XP_959354.1| hypothetical protein NCU04906 [Neur...    84   4e-14   
gi|475669176|gb|EMT66938.1| Phosphoethanolamine N-methyltransfer...    84   4e-14   Fusarium oxysporum f. sp. cubense race 4
gi|399170469|emb|CCE28846.1| uncharacterized protein CPUR_02535 ...    84   5e-14   Claviceps purpurea 20.1
gi|399170486|emb|CCE28863.1| uncharacterized protein CPUR_02553 ...    84   5e-14   Claviceps purpurea 20.1
gi|429851659|gb|ELA26840.1| methyltransferase domain-containing ...    84   5e-14   Colletotrichum gloeosporioides Nara gc5
gi|392587262|gb|EIW76596.1| S-adenosyl-L-methionine-dependent me...    84   5e-14   Coniophora puteana RWD-64-598 SS2
gi|342881065|gb|EGU82047.1| hypothetical protein FOXB_07450 [Fus...    84   5e-14   Fusarium oxysporum Fo5176
gi|511001982|gb|EPB83433.1| hypothetical protein HMPREF1544_0981...    84   5e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|429856986|gb|ELA31874.1| methyltransferase domain-containing ...    84   5e-14   Colletotrichum gloeosporioides Nara gc5
gi|392574788|gb|EIW67923.1| hypothetical protein TREMEDRAFT_6381...    84   5e-14   Tremella mesenterica DSM 1558
gi|302890947|ref|XP_003044356.1| hypothetical protein NECHADRAFT...    84   6e-14   Nectria haematococca mpVI 77-13-4
gi|85087907|ref|XP_957841.1| hypothetical protein NCU04904 [Neur...    84   6e-14   Neurospora crassa OR74A
gi|384493124|gb|EIE83615.1| hypothetical protein RO3G_08320 [Rhi...    84   6e-14   Rhizopus delemar RA 99-880
gi|429856167|gb|ELA31092.1| SAM dependent methyltransferase, put...    84   6e-14   Colletotrichum gloeosporioides Nara gc5
gi|336268312|ref|XP_003348921.1| hypothetical protein SMAC_01942...    84   6e-14   Sordaria macrospora k-hell
gi|296425053|ref|XP_002842058.1| hypothetical protein [Tuber mel...    83   7e-14   Tuber melanosporum Mel28
gi|336470530|gb|EGO58691.1| hypothetical protein NEUTE1DRAFT_593...    83   7e-14   Neurospora tetrasperma FGSC 2508
gi|477531650|gb|ENH83357.1| methyltransferase domain-containing ...    83   7e-14   Colletotrichum orbiculare MAFF 240422
gi|399170476|emb|CCE28853.1| uncharacterized protein CPUR_02542 ...    83   7e-14   Claviceps purpurea 20.1
gi|399170949|emb|CCE28043.1| uncharacterized protein CPUR_01517 ...    83   8e-14   Claviceps purpurea 20.1
gi|336273335|ref|XP_003351422.1| hypothetical protein SMAC_07621...    83   8e-14   Sordaria macrospora k-hell
gi|171676722|ref|XP_001903313.1| hypothetical protein [Podospora...    83   8e-14   Podospora anserina S mat+
gi|85092365|ref|XP_959358.1| hypothetical protein NCU04910 [Neur...    83   8e-14   Neurospora crassa OR74A
gi|399164030|emb|CCE35189.1| uncharacterized protein CPUR_02120 ...    83   9e-14   Claviceps purpurea 20.1
gi|296423617|ref|XP_002841350.1| hypothetical protein [Tuber mel...    83   9e-14   Tuber melanosporum Mel28
gi|399170951|emb|CCE28045.1| uncharacterized protein CPUR_01519 ...    83   1e-13   Claviceps purpurea 20.1
gi|46109724|ref|XP_381920.1| hypothetical protein FG01744.1 [Fus...    83   1e-13   
gi|452841085|gb|EME43022.1| hypothetical protein DOTSEDRAFT_7242...    83   1e-13   Dothistroma septosporum NZE10
gi|388851535|emb|CCF54725.1| uncharacterized protein [Ustilago h...    83   1e-13   Ustilago hordei
gi|340514160|gb|EGR44427.1| predicted protein [Trichoderma reese...    83   1e-13   Trichoderma reesei QM6a
gi|384494154|gb|EIE84645.1| hypothetical protein RO3G_09355 [Rhi...    83   1e-13   Rhizopus delemar RA 99-880
gi|399170485|emb|CCE28862.1| uncharacterized protein CPUR_02552 ...    83   1e-13   Claviceps purpurea 20.1
gi|429859026|gb|ELA33824.1| methyltransferase domain-containing ...    83   1e-13   Colletotrichum gloeosporioides Nara gc5
gi|393238105|gb|EJD45643.1| hypothetical protein AURDEDRAFT_1139...    82   1e-13   Auricularia subglabra TFB-10046 SS5
gi|429856166|gb|ELA31091.1| methyltransferase domain-containing ...    82   1e-13   Colletotrichum gloeosporioides Nara gc5
gi|367048749|ref|XP_003654754.1| hypothetical protein THITE_2079...    82   1e-13   Thielavia terrestris NRRL 8126
gi|399167618|emb|CCE31633.1| uncharacterized protein CPUR_05486 ...    82   1e-13   Claviceps purpurea 20.1
gi|302917997|ref|XP_003052562.1| hypothetical protein NECHADRAFT...    82   1e-13   Nectria haematococca mpVI 77-13-4
gi|399166568|emb|CCE32551.1| uncharacterized protein CPUR_06411 ...    82   1e-13   Claviceps purpurea 20.1
gi|342884112|gb|EGU84441.1| hypothetical protein FOXB_05034 [Fus...    82   1e-13   Fusarium oxysporum Fo5176
gi|475669983|gb|EMT67352.1| hypothetical protein FOC4_g10005441 ...    82   1e-13   Fusarium oxysporum f. sp. cubense race 4
gi|320592897|gb|EFX05306.1| methyltransferase type 12 [Grosmanni...    82   1e-13   Grosmannia clavigera kw1407
gi|399170954|emb|CCE28048.1| uncharacterized protein CPUR_01522 ...    82   1e-13   Claviceps purpurea 20.1
gi|85095447|ref|XP_960091.1| hypothetical protein NCU05831 [Neur...    82   2e-13   Neurospora crassa OR74A
gi|384488140|gb|EIE80320.1| hypothetical protein RO3G_05025 [Rhi...    82   2e-13   Rhizopus delemar RA 99-880
gi|494830161|gb|EON66727.1| hypothetical protein W97_05973 [Coni...    82   2e-13   Coniosporium apollinis CBS 100218
gi|475674986|gb|EMT72066.1| Phosphoethanolamine N-methyltransfer...    82   2e-13   Fusarium oxysporum f. sp. cubense race 4
gi|336470543|gb|EGO58704.1| hypothetical protein NEUTE1DRAFT_116...    82   2e-13   Neurospora tetrasperma FGSC 2508
gi|408390893|gb|EKJ70278.1| hypothetical protein FPSE_09495 [Fus...    82   2e-13   Fusarium pseudograminearum CS3096
gi|302888902|ref|XP_003043337.1| hypothetical protein NECHADRAFT...    82   2e-13   Nectria haematococca mpVI 77-13-4
gi|426200640|gb|EKV50564.1| hypothetical protein AGABI2DRAFT_176...    82   2e-13   Agaricus bisporus var. bisporus H97
gi|399170960|emb|CCE28054.1| uncharacterized protein CPUR_01528 ...    82   2e-13   Claviceps purpurea 20.1
gi|384501454|gb|EIE91945.1| hypothetical protein RO3G_16656 [Rhi...    82   2e-13   Rhizopus delemar RA 99-880
gi|495194818|ref|WP_007919608.1| type 11 methyltransferase [Kted...    82   2e-13   
gi|399170489|emb|CCE28866.1| uncharacterized protein CPUR_02556 ...    82   2e-13   Claviceps purpurea 20.1
gi|302885914|ref|XP_003041848.1| hypothetical protein NECHADRAFT...    82   2e-13   Nectria haematococca mpVI 77-13-4
gi|400597642|gb|EJP65372.1| methyltransferase domain-containing ...    82   2e-13   Beauveria bassiana ARSEF 2860
gi|399170948|emb|CCE28042.1| uncharacterized protein CPUR_01516 ...    82   2e-13   Claviceps purpurea 20.1
gi|384500734|gb|EIE91225.1| hypothetical protein RO3G_15936 [Rhi...    82   2e-13   Rhizopus delemar RA 99-880
gi|399170487|emb|CCE28864.1| uncharacterized protein CPUR_02554 ...    82   2e-13   Claviceps purpurea 20.1
gi|46127867|ref|XP_388487.1| hypothetical protein FG08311.1 [Fus...    82   2e-13   
gi|336470533|gb|EGO58694.1| hypothetical protein NEUTE1DRAFT_116...    82   2e-13   Neurospora tetrasperma FGSC 2508
gi|342869589|gb|EGU73214.1| hypothetical protein FOXB_16275 [Fus...    81   3e-13   Fusarium oxysporum Fo5176
gi|449549146|gb|EMD40112.1| hypothetical protein CERSUDRAFT_8139...    81   3e-13   Gelatoporia subvermispora B
gi|336260230|ref|XP_003344911.1| hypothetical protein SMAC_08391...    81   3e-13   Sordaria macrospora k-hell
gi|511008085|gb|EPB89357.1| hypothetical protein HMPREF1544_0386...    81   3e-13   Mucor circinelloides f. circinelloides 1006PhL
gi|399170475|emb|CCE28852.1| uncharacterized protein CPUR_02541 ...    81   3e-13   Claviceps purpurea 20.1
gi|426200638|gb|EKV50562.1| hypothetical protein AGABI2DRAFT_176...    81   3e-13   Agaricus bisporus var. bisporus H97
gi|164425784|ref|XP_959355.2| hypothetical protein NCU04907 [Neu...    81   3e-13   Neurospora crassa OR74A
gi|399170480|emb|CCE28857.1| uncharacterized protein CPUR_02546 ...    81   3e-13   Claviceps purpurea 20.1
gi|429858695|gb|ELA33506.1| methyltransferase domain-containing ...    81   3e-13   Colletotrichum gloeosporioides Nara gc5
gi|402075003|gb|EJT70474.1| hypothetical protein GGTG_11497 [Gae...    81   3e-13   Gaeumannomyces graminis var. tritici R3-111a-1
gi|336467783|gb|EGO55947.1| hypothetical protein NEUTE1DRAFT_117...    81   3e-13   Neurospora tetrasperma FGSC 2508
gi|345563140|gb|EGX46144.1| hypothetical protein AOL_s00110g308 ...    81   3e-13   Arthrobotrys oligospora ATCC 24927
gi|320589662|gb|EFX02118.1| methyltransferase type 11 [Grosmanni...    81   3e-13   Grosmannia clavigera kw1407
gi|302917505|ref|XP_003052453.1| hypothetical protein NECHADRAFT...    81   3e-13   Nectria haematococca mpVI 77-13-4
gi|399170481|emb|CCE28858.1| uncharacterized protein CPUR_02547 ...    81   4e-13   Claviceps purpurea 20.1
gi|477529620|gb|ENH81371.1| sam dependent [Colletotrichum orbicu...    81   4e-13   Colletotrichum orbiculare MAFF 240422
gi|399166733|emb|CCE32406.1| uncharacterized protein CPUR_06266 ...    81   4e-13   Claviceps purpurea 20.1
gi|358378574|gb|EHK16256.1| hypothetical protein TRIVIDRAFT_8744...    81   4e-13   Trichoderma virens Gv29-8
gi|471569225|gb|EMR68660.1| putative methyltransferase domain-co...    81   4e-13   Eutypa lata UCREL1
gi|341038745|gb|EGS23737.1| hypothetical protein CTHT_0004390 [C...    81   4e-13   Chaetomium thermophilum var. thermophilum DSM 1495
gi|409082776|gb|EKM83134.1| hypothetical protein AGABI1DRAFT_118...    80   4e-13   Agaricus bisporus var. burnettii JB137-S8
gi|302887024|ref|XP_003042401.1| hypothetical protein NECHADRAFT...    80   4e-13   Nectria haematococca mpVI 77-13-4
gi|85086879|ref|XP_957775.1| hypothetical protein NCU00304 [Neur...    80   4e-13   Neurospora crassa OR74A
gi|399170953|emb|CCE28047.1| uncharacterized protein CPUR_01521 ...    80   4e-13   Claviceps purpurea 20.1
gi|302414084|ref|XP_003004874.1| UMTA [Verticillium albo-atrum V...    80   5e-13   Verticillium alfalfae VaMs.102
gi|85095451|ref|XP_960092.1| hypothetical protein NCU05832 [Neur...    80   5e-13   
gi|310799789|gb|EFQ34682.1| methyltransferase domain-containing ...    80   5e-13   Colletotrichum graminicola M1.001
gi|399166184|emb|CCE32976.1| uncharacterized protein CPUR_06898 ...    80   5e-13   Claviceps purpurea 20.1
gi|342868648|gb|EGU72816.1| hypothetical protein FOXB_16675 [Fus...    80   5e-13   Fusarium oxysporum Fo5176
gi|409083668|gb|EKM84025.1| hypothetical protein AGABI1DRAFT_124...    80   5e-13   Agaricus bisporus var. burnettii JB137-S8
gi|336256943|ref|XP_003343500.1| hypothetical protein SMAC_09744...    80   5e-13   Sordaria macrospora k-hell
gi|341038521|gb|EGS23513.1| hypothetical protein CTHT_0002070 [C...    80   6e-13   Chaetomium thermophilum var. thermophilum DSM 1495
gi|212539277|ref|XP_002149794.1| conserved hypothetical protein ...    80   6e-13   Talaromyces marneffei ATCC 18224
gi|238482447|ref|XP_002372462.1| UMTA methyltransferase family p...    80   6e-13   Aspergillus flavus NRRL3357
gi|429858114|gb|ELA32945.1| methyltransferase domain-containing ...    80   6e-13   Colletotrichum gloeosporioides Nara gc5
gi|452000440|gb|EMD92901.1| hypothetical protein COCHEDRAFT_1212...    80   6e-13   Bipolaris maydis C5
gi|358388005|gb|EHK25599.1| hypothetical protein TRIVIDRAFT_2120...    80   6e-13   Trichoderma virens Gv29-8
gi|358390205|gb|EHK39611.1| hypothetical protein TRIATDRAFT_2316...    80   6e-13   Trichoderma atroviride IMI 206040
gi|46114338|ref|XP_383187.1| hypothetical protein FG03011.1 [Fus...    80   6e-13   
gi|429857245|gb|ELA32119.1| methyltransferase domain-containing ...    80   6e-13   Colletotrichum gloeosporioides Nara gc5
gi|302881127|ref|XP_003039483.1| hypothetical protein NECHADRAFT...    80   6e-13   Nectria haematococca mpVI 77-13-4
gi|391868351|gb|EIT77569.1| hypothetical protein Ao3042_06361 [A...    80   7e-13   Aspergillus oryzae 3.042
gi|336244256|ref|XP_003343257.1| hypothetical protein SMAC_09737...    80   7e-13   Sordaria macrospora k-hell
gi|409077309|gb|EKM77675.1| hypothetical protein AGABI1DRAFT_114...    80   7e-13   Agaricus bisporus var. burnettii JB137-S8
gi|296416541|ref|XP_002837935.1| hypothetical protein [Tuber mel...    80   7e-13   Tuber melanosporum Mel28
gi|399170470|emb|CCE28847.1| uncharacterized protein CPUR_02536 ...    80   7e-13   Claviceps purpurea 20.1
gi|399170952|emb|CCE28046.1| uncharacterized protein CPUR_01520 ...    80   7e-13   Claviceps purpurea 20.1
gi|399170488|emb|CCE28865.1| uncharacterized protein CPUR_02555 ...    80   7e-13   Claviceps purpurea 20.1
gi|336467782|gb|EGO55946.1| hypothetical protein NEUTE1DRAFT_124...    80   7e-13   Neurospora tetrasperma FGSC 2508
gi|336469845|gb|EGO58007.1| hypothetical protein NEUTE1DRAFT_146...    80   8e-13   Neurospora tetrasperma FGSC 2508
gi|399171424|emb|CCE27614.1| uncharacterized protein CPUR_01088 ...    80   8e-13   Claviceps purpurea 20.1
gi|322697875|gb|EFY89650.1| TAM domain methyltransferase [Metarh...    80   8e-13   Metarhizium acridum CQMa 102
gi|512206220|gb|EPE35040.1| S-adenosyl-L-methionine-dependent me...    80   8e-13   Glarea lozoyensis ATCC 20868
gi|242795021|ref|XP_002482494.1| phosphoethanolamine N-methyltra...    80   8e-13   Talaromyces stipitatus ATCC 10500
gi|399170449|emb|CCE28826.1| uncharacterized protein CPUR_02515 ...    80   8e-13   Claviceps purpurea 20.1
gi|320594082|gb|EFX06485.1| methyltransferase type 11 [Grosmanni...    80   8e-13   Grosmannia clavigera kw1407
gi|399170356|emb|CCE28733.1| uncharacterized protein CPUR_02421 ...    80   8e-13   Claviceps purpurea 20.1
gi|154302830|ref|XP_001551824.1| hypothetical protein BC1G_09530...    80   8e-13   Botrytis cinerea B05.10
gi|500253840|gb|EON97487.1| hypothetical protein UCRPA7_7099 [To...    80   8e-13   Phaeoacremonium minimum UCRPA7
gi|477524047|gb|ENH75999.1| methyltransferase domain-containing ...    80   8e-13   Colletotrichum orbiculare MAFF 240422
gi|477517923|gb|ENH70162.1| mRNA 3'-end-processing protein YTH1 ...    80   8e-13   Fusarium oxysporum f. sp. cubense race 1
gi|399170962|emb|CCE28056.1| uncharacterized protein CPUR_01530 ...    80   8e-13   Claviceps purpurea 20.1
gi|408393540|gb|EKJ72803.1| hypothetical protein FPSE_07069 [Fus...    80   9e-13   Fusarium pseudograminearum CS3096
gi|429857449|gb|ELA32317.1| methyltransferase domain-containing ...    80   9e-13   Colletotrichum gloeosporioides Nara gc5
gi|392589589|gb|EIW78919.1| S-adenosyl-L-methionine-dependent me...    80   9e-13   Coniophora puteana RWD-64-598 SS2
gi|399164029|emb|CCE35188.1| uncharacterized protein CPUR_02119 ...    79   9e-13   Claviceps purpurea 20.1
gi|399164027|emb|CCE35186.1| uncharacterized protein CPUR_02117 ...    79   1e-12   Claviceps purpurea 20.1
gi|346974954|gb|EGY18406.1| hypothetical protein VDAG_08740 [Ver...    79   1e-12   Verticillium dahliae VdLs.17
gi|399170482|emb|CCE28859.1| uncharacterized protein CPUR_02548 ...    79   1e-12   Claviceps purpurea 20.1
gi|451850406|gb|EMD63708.1| hypothetical protein COCSADRAFT_1719...    79   1e-12   Bipolaris sorokiniana ND90Pr
gi|367052841|ref|XP_003656799.1| hypothetical protein THITE_2121...    79   1e-12   Thielavia terrestris NRRL 8126
gi|399170956|emb|CCE28050.1| uncharacterized protein CPUR_01524 ...    79   1e-12   Claviceps purpurea 20.1
gi|399167612|emb|CCE31627.1| uncharacterized protein CPUR_05480 ...    79   1e-12   Claviceps purpurea 20.1
gi|390603017|gb|EIN12409.1| hypothetical protein PUNSTDRAFT_1242...    79   1e-12   Punctularia strigosozonata HHB-11173 SS5
gi|171681148|ref|XP_001905518.1| hypothetical protein [Podospora...    79   1e-12   Podospora anserina S mat+
gi|50080882|gb|AAT69749.1| UMTA [Emericella nidulans]                  79   1e-12   Aspergillus nidulans
gi|336273327|ref|XP_003351418.1| hypothetical protein SMAC_07617...    79   1e-12   Sordaria macrospora k-hell
gi|342884432|gb|EGU84647.1| hypothetical protein FOXB_04835 [Fus...    79   1e-12   Fusarium oxysporum Fo5176
gi|494830790|gb|EON67305.1| hypothetical protein W97_06558 [Coni...    79   1e-12   Coniosporium apollinis CBS 100218
gi|399164032|emb|CCE35191.1| uncharacterized protein CPUR_02122 ...    79   1e-12   Claviceps purpurea 20.1
gi|296425776|ref|XP_002842415.1| hypothetical protein [Tuber mel...    79   1e-12   Tuber melanosporum Mel28
gi|399170460|emb|CCE28837.1| uncharacterized protein CPUR_02526 ...    79   1e-12   Claviceps purpurea 20.1
gi|399168845|emb|CCE30379.1| uncharacterized protein CPUR_04227 ...    79   1e-12   Claviceps purpurea 20.1
gi|320587899|gb|EFX00374.1| hypothetical protein CMQ_7376 [Grosm...    79   1e-12   Grosmannia clavigera kw1407
gi|399167621|emb|CCE31636.1| uncharacterized protein CPUR_05489 ...    79   1e-12   Claviceps purpurea 20.1
gi|477523845|gb|ENH75830.1| Demethylmenaquinone methyltransferas...    79   1e-12   Fusarium oxysporum f. sp. cubense race 1
gi|384494613|gb|EIE85104.1| hypothetical protein RO3G_09814 [Rhi...    79   1e-12   
gi|477519833|gb|ENH71988.1| Demethylmenaquinone methyltransferas...    79   2e-12   
gi|475672347|gb|EMT69511.1| Demethylmenaquinone methyltransferas...    79   2e-12   
gi|408398597|gb|EKJ77727.1| hypothetical protein FPSE_02225 [Fus...    79   2e-12   
gi|399166201|emb|CCE32993.1| uncharacterized protein CPUR_06916 ...    79   2e-12   
gi|400593355|gb|EJP61306.1| methyltransferase domain-containing ...    79   2e-12   
gi|384492823|gb|EIE83314.1| hypothetical protein RO3G_08019 [Rhi...    79   2e-12   
gi|494834432|gb|EON70036.1| hypothetical protein W97_09304 [Coni...    79   2e-12   
gi|399170968|emb|CCE28062.1| uncharacterized protein CPUR_01536 ...    79   2e-12   
gi|399167620|emb|CCE31635.1| uncharacterized protein CPUR_05488 ...    79   2e-12   
gi|342877418|gb|EGU78878.1| hypothetical protein FOXB_10616 [Fus...    79   2e-12   
gi|302885814|ref|XP_003041798.1| hypothetical protein NECHADRAFT...    79   2e-12   
gi|399167617|emb|CCE31632.1| uncharacterized protein CPUR_05485 ...    79   2e-12   
gi|398407481|ref|XP_003855206.1| hypothetical protein MYCGRDRAFT...    79   2e-12   
gi|46126639|ref|XP_387873.1| hypothetical protein FG07697.1 [Fus...    79   2e-12   
gi|477509586|gb|ENH62877.1| hypothetical protein FOC1_g10006343 ...    79   2e-12   
gi|399164028|emb|CCE35187.1| uncharacterized protein CPUR_02118 ...    79   2e-12   
gi|452982587|gb|EME82346.1| hypothetical protein MYCFIDRAFT_4039...    79   2e-12   
gi|440639825|gb|ELR09744.1| hypothetical protein GMDG_04230 [Geo...    79   2e-12   
gi|291510280|gb|ADE10096.1| AdoMet-MTases [Tremella fuciformis]        79   2e-12   
gi|340966799|gb|EGS22306.1| hypothetical protein CTHT_0018290 [C...    79   2e-12   
gi|408397823|gb|EKJ76961.1| hypothetical protein FPSE_02836 [Fus...    79   2e-12   
gi|380091286|emb|CCC11143.1| unnamed protein product [Sordaria m...    78   2e-12   
gi|322710014|gb|EFZ01589.1| TAM domain methyltransferase [Metarh...    78   2e-12   
gi|408392780|gb|EKJ72100.1| hypothetical protein FPSE_07725 [Fus...    78   2e-12   
gi|477510760|gb|ENH63670.1| hypothetical protein FOC1_g10004278 ...    78   2e-12   
gi|399164035|emb|CCE35194.1| uncharacterized protein CPUR_02125 ...    78   2e-12   
gi|399167616|emb|CCE31631.1| uncharacterized protein CPUR_05484 ...    78   2e-12   
gi|302883725|ref|XP_003040761.1| hypothetical protein NECHADRAFT...    78   2e-12   
gi|399170472|emb|CCE28849.1| uncharacterized protein CPUR_02538 ...    78   3e-12   
gi|308081263|ref|NP_001183133.1| uncharacterized protein LOC1005...    78   3e-12   
gi|358401588|gb|EHK50889.1| hypothetical protein TRIATDRAFT_2326...    78   3e-12   
gi|380483099|emb|CCF40826.1| methyltransferase [Colletotrichum h...    78   3e-12   
gi|302423258|ref|XP_003009459.1| conserved hypothetical protein ...    78   3e-12   
gi|399166185|emb|CCE32977.1| uncharacterized protein CPUR_06899 ...    78   3e-12   
gi|299743279|ref|XP_001835655.2| hypothetical protein CC1G_03437...    78   3e-12   
gi|408396178|gb|EKJ75342.1| hypothetical protein FPSE_04470 [Fus...    78   3e-12   
gi|475675723|gb|EMT72786.1| mRNA 3'-end-processing protein YTH1 ...    78   3e-12   
gi|46115890|ref|XP_383963.1| hypothetical protein FG03787.1 [Fus...    78   3e-12   
gi|399170947|emb|CCE28041.1| uncharacterized protein CPUR_01515 ...    78   3e-12   
gi|399166191|emb|CCE32983.1| uncharacterized protein CPUR_06906 ...    78   3e-12   
gi|399164038|emb|CCE35197.1| uncharacterized protein CPUR_02128 ...    78   3e-12   
gi|302885120|ref|XP_003041453.1| hypothetical protein NECHADRAFT...    78   3e-12   
gi|408388725|gb|EKJ68404.1| hypothetical protein FPSE_11412 [Fus...    78   3e-12   
gi|399170479|emb|CCE28856.1| uncharacterized protein CPUR_02545 ...    78   4e-12   
gi|399164039|emb|CCE35198.1| uncharacterized protein CPUR_02129 ...    78   4e-12   
gi|399170492|emb|CCE28869.1| uncharacterized protein CPUR_02559 ...    77   4e-12   
gi|399164031|emb|CCE35190.1| uncharacterized protein CPUR_02121 ...    77   4e-12   
gi|440635061|gb|ELR04980.1| hypothetical protein GMDG_00237 [Geo...    77   4e-12   
gi|399166204|emb|CCE32996.1| uncharacterized protein CPUR_06919 ...    77   4e-12   
gi|302886850|ref|XP_003042314.1| hypothetical protein NECHADRAFT...    77   4e-12   
gi|315045926|ref|XP_003172338.1| UMTA [Arthroderma gypseum CBS 1...    77   4e-12   
gi|336467796|gb|EGO55960.1| hypothetical protein NEUTE1DRAFT_131...    77   4e-12   
gi|475670269|gb|EMT67638.1| Demethylmenaquinone methyltransferas...    77   4e-12   
gi|399170964|emb|CCE28058.1| uncharacterized protein CPUR_01532 ...    77   4e-12   
gi|302888697|ref|XP_003043235.1| hypothetical protein NECHADRAFT...    77   4e-12   
gi|399170967|emb|CCE28061.1| uncharacterized protein CPUR_01535 ...    77   4e-12   
gi|115396806|ref|XP_001214042.1| conserved hypothetical protein ...    77   4e-12   
gi|477534593|gb|ENH86128.1| methyltransferase domain-containing ...    77   4e-12   
gi|477510784|gb|ENH63694.1| Demethylmenaquinone methyltransferas...    77   4e-12   
gi|296411932|ref|XP_002835682.1| hypothetical protein [Tuber mel...    77   4e-12   
gi|399166193|emb|CCE32985.1| uncharacterized protein CPUR_06908 ...    77   4e-12   
gi|85109478|ref|XP_962936.1| hypothetical protein NCU07815 [Neur...    77   4e-12   
gi|346323375|gb|EGX92973.1| TAM domain methyltransferase, putati...    77   5e-12   
gi|345561315|gb|EGX44411.1| hypothetical protein AOL_s00193g139 ...    77   5e-12   
gi|500258753|gb|EOO01656.1| putative methyltransferase domain-co...    77   5e-12   
gi|156056286|ref|XP_001594067.1| hypothetical protein SS1G_05495...    77   5e-12   
gi|399172242|emb|CCE26927.1| uncharacterized protein CPUR_00396 ...    77   5e-12   
gi|399166196|emb|CCE32988.1| uncharacterized protein CPUR_06911 ...    77   5e-12   
gi|46114284|ref|XP_383160.1| hypothetical protein FG02984.1 [Fus...    77   5e-12   
gi|302688807|ref|XP_003034083.1| hypothetical protein SCHCODRAFT...    77   5e-12   
gi|342881933|gb|EGU82712.1| hypothetical protein FOXB_06767 [Fus...    77   5e-12   
gi|345565155|gb|EGX48108.1| hypothetical protein AOL_s00081g104 ...    77   5e-12   
gi|399170474|emb|CCE28851.1| uncharacterized protein CPUR_02540 ...    77   5e-12   
gi|85092379|ref|XP_959365.1| hypothetical protein NCU04917 [Neur...    77   5e-12   
gi|345567055|gb|EGX49992.1| hypothetical protein AOL_s00076g478 ...    77   5e-12   
gi|170089965|ref|XP_001876205.1| predicted protein [Laccaria bic...    77   5e-12   
gi|471569740|gb|EMR69037.1| putative methyltransferase domain-co...    77   6e-12   
gi|393214573|gb|EJD00066.1| S-adenosyl-L-methionine-dependent me...    77   6e-12   
gi|485918117|gb|EOD44847.1| putative tam domain methyltransferas...    77   6e-12   
gi|302676291|ref|XP_003027829.1| hypothetical protein SCHCODRAFT...    77   6e-12   
gi|384497598|gb|EIE88089.1| hypothetical protein RO3G_12800 [Rhi...    77   6e-12   
gi|399166200|emb|CCE32992.1| uncharacterized protein CPUR_06915 ...    77   6e-12   
gi|395331164|gb|EJF63546.1| hypothetical protein DICSQDRAFT_8331...    77   6e-12   
gi|399170971|emb|CCE28065.1| uncharacterized protein CPUR_01539 ...    77   6e-12   
gi|240282054|gb|EER45557.1| conserved hypothetical protein [Ajel...    77   6e-12   
gi|510999200|gb|EPB80932.1| hypothetical protein HMPREF1544_1238...    77   6e-12   
gi|389751134|gb|EIM92207.1| hypothetical protein STEHIDRAFT_4711...    77   7e-12   
gi|399166205|emb|CCE32997.1| uncharacterized protein CPUR_06920 ...    77   7e-12   
gi|399166189|emb|CCE32981.1| uncharacterized protein CPUR_06904 ...    77   7e-12   
gi|317141135|ref|XP_001817388.2| UMTA methyltransferase family p...    77   7e-12   
gi|408398628|gb|EKJ77758.1| hypothetical protein FPSE_02256 [Fus...    77   7e-12   
gi|429849713|gb|ELA25065.1| SAM dependent methyltransferase, put...    77   7e-12   
gi|358387959|gb|EHK25553.1| hypothetical protein TRIVIDRAFT_1775...    77   7e-12   
gi|399166186|emb|CCE32978.1| uncharacterized protein CPUR_06900 ...    77   7e-12   
gi|443895451|dbj|GAC72797.1| hypothetical protein PANT_7d00281 [...    77   7e-12   
gi|477513260|gb|ENH65763.1| hypothetical protein FOC1_g10003384 ...    77   8e-12   
gi|399164026|emb|CCE35185.1| uncharacterized protein CPUR_02116 ...    77   8e-12   
gi|325088192|gb|EGC41502.1| conserved hypothetical protein [Ajel...    77   8e-12   
gi|302885268|ref|XP_003041526.1| predicted protein [Nectria haem...    77   8e-12   
gi|322692439|gb|EFY84350.1| SAM dependent methyltransferase, put...    77   8e-12   
gi|408393500|gb|EKJ72763.1| hypothetical protein FPSE_07029 [Fus...    77   8e-12   
gi|407920182|gb|EKG13399.1| Methyltransferase type 11 [Macrophom...    76   9e-12   
gi|511003877|gb|EPB85263.1| hypothetical protein HMPREF1544_0794...    76   9e-12   
gi|399170969|emb|CCE28063.1| uncharacterized protein CPUR_01537 ...    76   9e-12   
gi|392591702|gb|EIW81029.1| hypothetical protein CONPUDRAFT_1652...    76   9e-12   
gi|85095493|ref|XP_960102.1| hypothetical protein NCU05842 [Neur...    76   9e-12   
gi|296418756|ref|XP_002838991.1| hypothetical protein [Tuber mel...    76   9e-12   
gi|407925787|gb|EKG18768.1| Methyltransferase type 11 [Macrophom...    76   9e-12   
gi|302891313|ref|XP_003044539.1| hypothetical protein NECHADRAFT...    76   1e-11   
gi|367045592|ref|XP_003653176.1| hypothetical protein THITE_2115...    76   1e-11   
gi|475676885|gb|EMT73907.1| mRNA 3'-end-processing protein YTH1 ...    76   1e-11   
gi|429860678|gb|ELA35404.1| methyltransferase domain-containing ...    76   1e-11   
gi|242813375|ref|XP_002486154.1| conserved hypothetical protein ...    76   1e-11   
gi|471560235|gb|EMR62390.1| putative methyltransferase domain-co...    76   1e-11   
gi|475673892|gb|EMT70998.1| Phosphoethanolamine N-methyltransfer...    76   1e-11   
gi|302884985|ref|XP_003041386.1| hypothetical protein NECHADRAFT...    76   1e-11   
gi|346970616|gb|EGY14068.1| hypothetical protein VDAG_00750 [Ver...    76   1e-11   
gi|399166732|emb|CCE32405.1| uncharacterized protein CPUR_06265 ...    76   1e-11   
gi|336238125|ref|XP_003342419.1| hypothetical protein SMAC_10109...    76   1e-11   
gi|475677013|gb|EMT74030.1| hypothetical protein FOC4_g10001987 ...    76   1e-11   
gi|340959882|gb|EGS21063.1| hypothetical protein CTHT_0029030 [C...    76   1e-11   
gi|302895251|ref|XP_003046506.1| hypothetical protein NECHADRAFT...    76   1e-11   
gi|322702573|gb|EFY94210.1| S-adenosylmethionine-dependent methy...    76   1e-11   
gi|302888008|ref|XP_003042891.1| hypothetical protein NECHADRAFT...    76   1e-11   
gi|429858830|gb|ELA33636.1| methyltransferase domain-containing ...    75   1e-11   
gi|402082294|gb|EJT77439.1| hypothetical protein GGTG_07351 [Gae...    75   1e-11   
gi|336262231|ref|XP_003345900.1| hypothetical protein SMAC_06301...    75   1e-11   
gi|392565922|gb|EIW59098.1| hypothetical protein TRAVEDRAFT_7128...    75   2e-11   
gi|327304827|ref|XP_003237105.1| hypothetical protein TERG_01827...    75   2e-11   
gi|367025873|ref|XP_003662221.1| hypothetical protein MYCTH_2125...    75   2e-11   
gi|389744785|gb|EIM85967.1| hypothetical protein STEHIDRAFT_1475...    75   2e-11   
gi|399166192|emb|CCE32984.1| uncharacterized protein CPUR_06907 ...    75   2e-11   
gi|475677556|gb|EMT74556.1| mRNA 3'-end-processing protein YTH1 ...    75   2e-11   
gi|495190294|ref|WP_007915084.1| type 11 methyltransferase [Kted...    75   2e-11   
gi|425767714|gb|EKV06280.1| hypothetical protein PDIG_78410 [Pen...    75   2e-11   
gi|384488578|gb|EIE80758.1| hypothetical protein RO3G_05463 [Rhi...    75   2e-11   
gi|475676513|gb|EMT73542.1| hypothetical protein FOC4_g10001510 ...    75   2e-11   
gi|296806479|ref|XP_002844049.1| conserved hypothetical protein ...    75   2e-11   
gi|336366397|gb|EGN94744.1| hypothetical protein SERLA73DRAFT_17...    75   2e-11   
gi|407925598|gb|EKG18591.1| Methyltransferase type 12 [Macrophom...    75   2e-11   
gi|169602333|ref|XP_001794588.1| hypothetical protein SNOG_04164...    75   2e-11   
gi|340975593|gb|EGS22708.1| hypothetical protein CTHT_0011820 [C...    75   2e-11   
gi|336257646|ref|XP_003343648.1| hypothetical protein SMAC_09545...    75   2e-11   
gi|399164024|emb|CCE35183.1| uncharacterized protein CPUR_02114 ...    75   2e-11   
gi|336466194|gb|EGO54359.1| hypothetical protein NEUTE1DRAFT_148...    75   2e-11   
gi|399164037|emb|CCE35196.1| uncharacterized protein CPUR_02127 ...    75   3e-11   
gi|512191454|gb|EPE07215.1| methyltransferase domain-containing ...    75   3e-11   
gi|408389191|gb|EKJ68665.1| hypothetical protein FPSE_11153 [Fus...    74   3e-11   
gi|340905497|gb|EGS17865.1| hypothetical protein CTHT_0072220 [C...    74   3e-11   
gi|398408539|ref|XP_003855735.1| hypothetical protein MYCGRDRAFT...    74   3e-11   
gi|336238661|ref|XP_003342606.1| hypothetical protein SMAC_10052...    74   3e-11   
gi|399166567|emb|CCE32550.1| uncharacterized protein CPUR_06410 ...    74   3e-11   
gi|367022696|ref|XP_003660633.1| hypothetical protein MYCTH_2116...    74   3e-11   
gi|336470548|gb|EGO58709.1| hypothetical protein NEUTE1DRAFT_144...    74   4e-11   
gi|409051943|gb|EKM61419.1| hypothetical protein PHACADRAFT_2480...    74   4e-11   
gi|336258191|ref|XP_003343914.1| hypothetical protein SMAC_09555...    74   5e-11   
gi|367028008|ref|XP_003663288.1| hypothetical protein MYCTH_2305...    74   5e-11   
gi|85097544|ref|XP_960463.1| hypothetical protein NCU05501 [Neur...    74   5e-11   
gi|46126487|ref|XP_387797.1| hypothetical protein FG07621.1 [Fus...    74   6e-11   
gi|326471892|gb|EGD95901.1| hypothetical protein TESG_03364 [Tri...    74   6e-11   
gi|342868871|gb|EGU72918.1| hypothetical protein FOXB_16573 [Fus...    73   7e-11   
gi|392574792|gb|EIW67927.1| hypothetical protein TREMEDRAFT_6381...    73   9e-11   
gi|303310401|ref|XP_003065213.1| methyltransferase, putative [Co...    73   9e-11   


>gi|384499478|gb|EIE89969.1| hypothetical protein RO3G_14680 [Rhizopus delemar RA 99-880]
          Length = 396

 Score =  145 bits (367), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 131/250 (52%), Gaps = 4/250 (1%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++ D + + HF+  +  Q  + +P+ + L    K+LDVGCGPGTW +++A  Y
Sbjct: 134 YILPCDDEEIDRLHLQHFMIRFAIQGNYLAPVHDMLRKGSKILDVGCGPGTWSMEIAGEY 193

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
             +   GID+ P+FP+EIKPSN  F Q ++LN LP++D++FDYV    M    + ++W  
Sbjct: 194 PKSTVIGIDMTPLFPREIKPSNCAFYQCNLLNKLPFEDSSFDYVFMRFMNQGISADQWLN 253

Query: 147 VIQELIRVCKPGGYIEFSEPELAV-KTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLV 205
           +++EL R+ KP G+IE+ E +  + + GP+   F   L+ L +       +   + + L 
Sbjct: 254 LLKELSRILKPNGWIEWVEADNEIHRPGPITKEFNQQLIQLMEHHQQDPSLGKHLQEKLK 313

Query: 206 SLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKL 265
             +   ++     +   G +  G  G+  M     Y+    +   LC+  G T++ Y + 
Sbjct: 314 ETNQFNHISSMFVSCP-GGQWAGKLGKLTMQAWKAYY--QALRPLLCELWGVTEKEYTEK 370

Query: 266 FKEAKKEVNE 275
            K+  +E +E
Sbjct: 371 LKQCWREADE 380



>gi|511006550|gb|EPB87860.1| hypothetical protein HMPREF1544_05389 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 282

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 115/220 (52%), Gaps = 4/220 (1%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           + Y  P    + D +   H +  Y  Q+ F +P++  L     VLD GCGP  W+ D+A 
Sbjct: 20  VAYLLPEDNDEKDRLHKQHVVLRYTLQSNFQAPLQEKLEQGITVLDSGCGPAAWVFDMAK 79

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +++F GID+   FP + KPSN EF   ++   +PY DN FDYVHQ  ++   T   W
Sbjct: 80  DFPNSQFHGIDITSTFPHDTKPSNCEFTVANLAEGIPYPDNYFDYVHQRLLILGLTDANW 139

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTL 204
            FV++EL+RV KPGGYIE  E  L    GP+L +    + ++  S+ +  +ISNE+ +  
Sbjct: 140 DFVLKELLRVLKPGGYIELHEANLN-NMGPLLKQLQYTMSSMLQSKGMPPKISNELQERA 198

Query: 205 VSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLN 244
           +       VD ++    L    GG AG+   D +   + N
Sbjct: 199 IKAGF---VDAQVQITDLKLNHGGQAGKMLWDDYQHGYTN 235



>gi|511004042|gb|EPB85423.1| hypothetical protein HMPREF1544_07794 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 347

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 121/227 (53%), Gaps = 6/227 (2%)

Query: 1   GNIFSNNKKKSHS---RREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSP 57
            N  +NN    HS   +   +      + Y  PN   + D +   H++  Y  Q+ + +P
Sbjct: 54  ANSTTNNSSNGHSFQYKDGRRYHGDSDVAYVLPNDDDEADRVHQQHWILRYALQSNYQAP 113

Query: 58  IENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVL 117
           + + L     VLD GCGP TW  ++   + ++ F GID   +FP+ IKP+NVEF  G++ 
Sbjct: 114 VTDQLEKGITVLDSGCGPATWTFEMGEAWPNSTFHGIDASCVFPENIKPANVEFVIGNIA 173

Query: 118 NTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELA--VKTGPV 175
             +PY DNTFDYVHQ  +L   T ++W   ++EL RV KPGGYIE +EP+L      GP+
Sbjct: 174 KEIPYPDNTFDYVHQRLLLLGLTNDDWENALKELYRVLKPGGYIELAEPDLQDLENMGPI 233

Query: 176 LSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTL 222
           L +    +  +  SRN+  +++ E+   L+    V N   K++ + L
Sbjct: 234 LRKLQYTMSDMLKSRNMPNKVACELEDRLIRAGFV-NTKLKMTPLKL 279



>gi|511006549|gb|EPB87859.1| hypothetical protein HMPREF1544_05388 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 333

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 137/253 (54%), Gaps = 10/253 (3%)

Query: 3   IFSNNKKKSHSRREIKKMEK-EPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENS 61
           + + NK +    R+ ++    E + Y FP+   + D +   H++  Y  Q  + +P+   
Sbjct: 45  VVAANKNQQFQFRDGRRYHADEKVSYLFPSDDDEADRVHQQHWILRYALQRNYHAPVTQL 104

Query: 62  LLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLP 121
           L     VLD GCGP TW L++  TY S++F GID   +FP+ IKPSNVEF   ++   +P
Sbjct: 105 LQQGITVLDSGCGPATWTLEMGETYPSSKFHGIDASSVFPESIKPSNVEFCVTNIAEKIP 164

Query: 122 YDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELA--VKTGPVLSRF 179
           + DNTFDY+HQ  ++   T ++W   ++EL RV KPGGYIE  EP++      GP+L + 
Sbjct: 165 FSDNTFDYIHQRLLILGLTNDDWENALKELYRVLKPGGYIEVVEPDMQDLRNMGPLLHKI 224

Query: 180 YDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGA--KKG----GNAGQA 233
              +  +  SRN+  +++ E+   L S +   N++ +++ + L    K G    G+   A
Sbjct: 225 QYTMSEMMLSRNMPPKVAIELQDRL-SRAGFVNIELEMTPLKLNHTDKAGYLLWGDYKHA 283

Query: 234 YMDIHDGYFLNDP 246
           Y+++      ++P
Sbjct: 284 YLNLQQVMAKSNP 296



>gi|511005353|gb|EPB86696.1| hypothetical protein HMPREF1544_06482 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 529

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 130/250 (52%), Gaps = 4/250 (1%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++ D + + HF+  +  Q  + +P+ + L    +VLD+GCGPG+W +++A  Y
Sbjct: 246 YLLPCDDEEVDRLHLQHFMIRFAIQGNYLAPVSDVLRKGGRVLDIGCGPGSWSMEIAGEY 305

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
             +   G+D+ P +P+EIKP+N  F Q ++L TLP++D TFDY+    M      +EW  
Sbjct: 306 PKSTVIGVDITPNYPREIKPANCAFYQCNILTTLPFEDGTFDYIFMRFMGQGVGSDEWSP 365

Query: 147 VIQELIRVCKPGGYIEFSEPELAV-KTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLV 205
           +++EL+RV KP G+IE+ E ++ + + GPV   F   L++L    N    I + +   L 
Sbjct: 366 LLKELLRVLKPNGWIEWIEADIEIHRPGPVTYEFNQKLISLMMENNQDAHIGSNLKSRLQ 425

Query: 206 SLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKL 265
            +  + N+     +   G +  G  GQ  M     Y+    +   +C++   +   Y + 
Sbjct: 426 EMDELTNISTTFVSCP-GGQWAGKLGQLTMQSWKAYY--QALRPLMCQYWDISPSEYNEK 482

Query: 266 FKEAKKEVNE 275
            KE  +E +E
Sbjct: 483 LKECWREADE 492



>gi|511004033|gb|EPB85414.1| hypothetical protein HMPREF1544_07785 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 351

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 119/220 (54%), Gaps = 7/220 (3%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           + Y  PN   + D +   H++     +  + +P+   L     VLD GCGP TW  ++  
Sbjct: 85  VAYVLPNDDDEADRVHEQHWILRAALECNYHAPVTKLLEEGITVLDSGCGPATWAFEMGE 144

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
           TY  ++F GID   +FP++IKP+NVEF  G+V   +PY D+TFDYVHQ  +    T  +W
Sbjct: 145 TYPRSKFHGIDASCVFPEDIKPANVEFVIGNVAKHIPYPDSTFDYVHQRLLFLGLTDSDW 204

Query: 145 FFVIQELIRVCKPGGYIEFSEPELA--VKTGPVLSRFYDALVTLSDSRNVKIRISNEIIK 202
              ++EL RV KPGGYI+ +EP++   +  GP +      L  +S +R +  +I+ E+ +
Sbjct: 205 ESTLKELYRVLKPGGYIDLAEPDVQSLLTAGPSMFTLQTTLSNMSKARGMVPKIALELEE 264

Query: 203 TLVSLS----TVRNVDYKIS-TVTLGAKKGGNAGQAYMDI 237
            L+        VR VD  ++ +  +G    G+   AYM+I
Sbjct: 265 RLLKAGFENPVVRRVDIPLNHSGKIGELLWGDYKHAYMNI 304



>gi|384498726|gb|EIE89217.1| hypothetical protein RO3G_13928 [Rhizopus delemar RA 99-880]
          Length = 227

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (62%), Gaps = 1/156 (0%)

Query: 52  NLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEF 111
           N F +P+   L     VLD  CGP TW L++A T+ ++ F+GID+  +FP+ IKP+N+EF
Sbjct: 5   NNFHAPLHQPLEQGITVLDSACGPATWTLEMAKTFPNSSFYGIDISSVFPENIKPANIEF 64

Query: 112 RQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK 171
             G++  ++P++DNTFDY+HQ  ++   T  +W   + EL RV KPGGYIE  EP + ++
Sbjct: 65  LTGNIAKSIPFEDNTFDYIHQRLVIVGLTEIDWQNNLAELYRVLKPGGYIELVEPVVELE 124

Query: 172 -TGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVS 206
             GP+  +  +AL ++  SRN+   I  E+   L+S
Sbjct: 125 HCGPLTRQNVEALHSVLTSRNMCPNIGQELHDRLLS 160



>gi|511004453|gb|EPB85823.1| hypothetical protein HMPREF1544_07405 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 330

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 139/273 (50%), Gaps = 7/273 (2%)

Query: 19  KMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTW 78
           +  K+P   F P   ++ + + + H L   LF   + SP+E SL +  KVLDV  GPG W
Sbjct: 56  RQSKKPNDQFLPCDDEEIERLQVNHLLFKSLFITQYFSPMEASLKSGIKVLDVSTGPGWW 115

Query: 79  LLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSV 138
           L+D+A  +  + F G D   I+P    P+N  FR  D+   LP+ D+TFD+V Q + L  
Sbjct: 116 LIDMAKEFPKSHFTGCDEM-IYPISAPPTNCHFRVIDISKGLPFADDTFDFVTQHDALFR 174

Query: 139 FTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSRFYDALVTLSDSRNVKIRIS 197
           ++ ++W  V+ ELIRV KPGGY+E  EP   ++  GP +S +   L     +R++ ++I+
Sbjct: 175 YSQKDWETVLPELIRVLKPGGYVELVEPGGVIQDIGPNMSIWMMRLTVSLQTRDINLKIA 234

Query: 198 NEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGT 257
            ++   L S+  +  ++    +  +G    G  G   ++  +  F  D +   LC+    
Sbjct: 235 TQLEGMLESIGGLDKIEASHRSAPIGWY--GRNGDIMLEAIERLF--DAIKPKLCEDWSM 290

Query: 258 TKEGYLKLFKEAKKEVNETFAPNCEIYRIWCQK 290
           +   Y K+ + A  E  + F     I+ I+ QK
Sbjct: 291 SSSKYDKVVQTASSECRD-FRSWLNIHYIFAQK 322



>gi|511010408|gb|EPB91632.1| hypothetical protein HMPREF1544_01554 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 450

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 121/222 (54%), Gaps = 9/222 (4%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIE-----NSLLNEC 66
           H++   +KM     KY  PN  ++ D +V  HF+  YLF   FS+P++     N    + 
Sbjct: 62  HNKSIDEKMANRGSKYILPNNEQELDRLVQVHFIYKYLFGANFSAPVKDLLSSNPSRRDS 121

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDD 124
            +LD+ CG GTW+L++A  +  ++F+GID+   +P  +KP+N  F Q D+LN   LPY D
Sbjct: 122 GLLDIACGNGTWILEMATEFPGSQFYGIDILANYPTTVKPANTFFCQYDILNPKGLPYPD 181

Query: 125 NTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT-GPVLSRFYDAL 183
           + FDY+H   + S F+ ++W  V++E+ R+ KPGGY+E  + +  ++  GP+   F+   
Sbjct: 182 DYFDYIHMRQVYSCFSEQDWVTVMKEIKRLLKPGGYVELRDIDPMLRNMGPISYNFFARF 241

Query: 184 VTLSDS-RNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGA 224
             L      V I  +  ++  +  +  + +V  +++ +  G 
Sbjct: 242 PPLMKKWHGVNILWARHMLDIMNDVGDMVDVHQQVNALQFGT 283



>gi|511004034|gb|EPB85415.1| hypothetical protein HMPREF1544_07786 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 248

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 92/156 (58%), Gaps = 3/156 (1%)

Query: 48  YLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPI-FPKEIKP 106
           +L    F +P+   L +   VLD GCGP TW  D+A  + S++F G+D+ P+ FP+ +KP
Sbjct: 2   WLLHRNFKAPLGKELQDGIVVLDSGCGPATWTFDMAKEFPSSKFHGVDITPLSFPEGVKP 61

Query: 107 SNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEP 166
            N EF+  ++   +PY DNTFDY+HQ  ++   T E W   ++E+ RV KPGGYIE  EP
Sbjct: 62  DNCEFQVANIAEHIPYPDNTFDYIHQRLLVMGLTHESWDKTLKEMFRVLKPGGYIELHEP 121

Query: 167 ELA--VKTGPVLSRFYDALVTLSDSRNVKIRISNEI 200
                  TGP + + ++ +  + +SR +   I+ ++
Sbjct: 122 NFVKLRNTGPFIQQLHNTISGMLESRQIPADIALQL 157



>gi|511006275|gb|EPB87591.1| hypothetical protein HMPREF1544_05573 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 334

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 91/146 (62%), Gaps = 4/146 (2%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQ-NLFSSPIENSLL---NECKVLDVGCGPGTWLLDL 82
           Y+FPN  ++ D +V  HF    LF  N+     EN  +   N  K+LD+GCGPGTW++D+
Sbjct: 70  YWFPNDDEEMDRLVGQHFALKTLFNGNIPEEAFENGTIPFENGAKILDLGCGPGTWIMDV 129

Query: 83  AATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIE 142
           A  + S+ F G+D+  +FP  I+P+NV F+ G+VL  L ++DNTFD V+    +  F  E
Sbjct: 130 ATEFPSSEFIGVDMCDVFPNNIRPANVTFQIGNVLEGLAFEDNTFDMVNFRMFILAFKTE 189

Query: 143 EWFFVIQELIRVCKPGGYIEFSEPEL 168
           EW  V++E+ RV KPGG+I   EP +
Sbjct: 190 EWAPVLKEIKRVLKPGGFILSREPGM 215



>gi|511006590|gb|EPB87899.1| hypothetical protein HMPREF1544_05306 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 338

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 87/146 (59%), Gaps = 11/146 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECK-------VLDVGCGPGTWL 79
           Y+FPN  ++ D ++  HF      + LF   I N +L +         VLD+GCGPGTWL
Sbjct: 77  YWFPNDDEEMDRLIGQHFA----LKTLFGGNISNIILKDIDMEKGDTIVLDLGCGPGTWL 132

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D+A  Y S++F G+D+  IFP  I+P NV F+ G+ L  LP+ DNTFD+++    +   
Sbjct: 133 MDVATEYPSSQFIGVDMCDIFPNNIRPPNVSFQIGNALERLPFSDNTFDFINIRLFIIAL 192

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE 165
             EEW  VIQE  R+ KPGGY++  E
Sbjct: 193 KGEEWPVVIQEAYRILKPGGYLQIVE 218



>gi|384490271|gb|EIE81493.1| hypothetical protein RO3G_06198 [Rhizopus delemar RA 99-880]
          Length = 389

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 83/144 (57%), Gaps = 4/144 (2%)

Query: 35  DTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGI 94
           + D MV  H+L   LF + F SPI + L     VLDVGCGPGTW ++++  +  + F GI
Sbjct: 105 EQDRMVTQHYLLRTLFSSDFCSPIRSQLQKGIVVLDVGCGPGTWTMEMSTAFPKSTFIGI 164

Query: 95  DLFPIFPKEIKPSNVEFRQGDVLNT----LPYDDNTFDYVHQANMLSVFTIEEWFFVIQE 150
           D    FPK+IKP N  FR    L      LP+ DN+ DY++Q +M      + W  +IQE
Sbjct: 165 DQSTFFPKDIKPRNCHFRTCYPLVQEQLPLPFPDNSIDYIYQRDMNWGLMAKTWQPLIQE 224

Query: 151 LIRVCKPGGYIEFSEPELAVKTGP 174
            +R+ KPGG+IEF EPE   +  P
Sbjct: 225 YLRILKPGGWIEFMEPEFETQNSP 248



>gi|511003178|gb|EPB84590.1| hypothetical protein HMPREF1544_08685 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 475

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 97/171 (56%), Gaps = 6/171 (3%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLN---ECKV 68
           H+RR  K    +   +  P    ++D ++  H++    F   F++P+ N L N   + KV
Sbjct: 158 HNRRYWKGHGTQ--HFMLPCDDDESDRLMTMHYILKATFHGNFTAPVYNMLENSKHKTKV 215

Query: 69  LDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFD 128
           LD+GCG GTW+L++A  + +  F+GID  P+FP  IKPSN  F   ++L  LPY DN FD
Sbjct: 216 LDIGCGSGTWILEMATEFPNTEFYGIDDCPLFPTHIKPSNSHFLLHNILKGLPYPDNEFD 275

Query: 129 YVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSR 178
           YVH   M+  F+ EE   ++ E+ R+ KPG Y E  +    ++  GP+ ++
Sbjct: 276 YVHMRMMIFYFSPEELSLLLAEISRIMKPGAYFEIVDTGYTIRHAGPISNK 326



>gi|384498349|gb|EIE88840.1| hypothetical protein RO3G_13551 [Rhizopus delemar RA 99-880]
          Length = 291

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 92/162 (56%), Gaps = 1/162 (0%)

Query: 5   SNNKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSL-L 63
           S+ +  S S  + +  E   + Y+ PN   + D +   HF    L+    S+ I + L +
Sbjct: 28  SDIQTSSTSNLDRRSSEVSTVTYWLPNHNDELDRLSSQHFALKILYDGNISNQIASKLNM 87

Query: 64  NECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYD 123
           +   VLDVGCGPGTWL+D+A  +    F GID++ IFP+ I+P+NV F+  D L  LP+ 
Sbjct: 88  DNAVVLDVGCGPGTWLMDVATEFPGGDFHGIDVYDIFPRNIRPANVHFQSCDALEGLPFP 147

Query: 124 DNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           DNTFD V+   +      +EW  + +E+ RV KPGG+++  E
Sbjct: 148 DNTFDLVNMRMLYVALKKDEWSLMFKEIYRVLKPGGFLQSCE 189



>gi|511004214|gb|EPB85591.1| hypothetical protein HMPREF1544_07680, partial [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 296

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 100/172 (58%), Gaps = 4/172 (2%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +KY  P   ++ + +V  H         LFS+PI + L +   VLD GCGPG W +D+AA
Sbjct: 24  IKYLLPTDTQEFNRLVTQHKAITTTLNGLFSAPISDQLEDGITVLDAGCGPGCWSIDMAA 83

Query: 85  TYSSARFFGIDLF-PIFPKEI-KPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIE 142
            Y +++F G+D+     PK+  KP+N +F  GD+++ +PY DNTF +++Q  +   FT E
Sbjct: 84  LYKNSQFHGVDILDSQLPKKSNKPANTQFVIGDLVDNIPYPDNTFGFIYQRLLSLAFTKE 143

Query: 143 EWFFVIQELIRVCKPGGYIEFSEPEL--AVKTGPVLSRFYDALVTLSDSRNV 192
           +W   ++EL RV KPGGY+E  E +    ++ GP+  +  +A+     SR +
Sbjct: 144 QWRRNLKELQRVLKPGGYVELIEYDHRKMLEYGPLFKKEQEAIEKYQVSRGM 195



>gi|511006015|gb|EPB87336.1| hypothetical protein HMPREF1544_05861 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 499

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 91/164 (55%), Gaps = 8/164 (4%)

Query: 18  KKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGT 77
           K M+ +P  Y       + D MV  H+L    F + F+SP+++ L     VLDVGCGPGT
Sbjct: 186 KSMDAQPQPYVLTLNNDEQDRMVAQHYLLRTAFGSDFNSPLKSQLQKGIVVLDVGCGPGT 245

Query: 78  WLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQ-GDVLNT-------LPYDDNTFDY 129
           W ++++  +  + F GID    +PK+IKP N  FR  G ++ T       LP+ DN+ DY
Sbjct: 246 WTMEMSTAFPKSTFIGIDQNAFYPKDIKPRNCHFRTCGSLVVTHISQTINLPFPDNSIDY 305

Query: 130 VHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTG 173
           ++Q +M    T + W  ++ E  R+ KPGG+IE  EP+L  +  
Sbjct: 306 IYQRDMNWALTGQTWQPLLLEYQRILKPGGWIECVEPDLETQNS 349



>gi|511009362|gb|EPB90606.1| hypothetical protein HMPREF1544_02516 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 355

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 92/160 (57%), Gaps = 9/160 (5%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--------CKVLDVGCGPGT 77
           +++ P   ++ D MVI HF   Y F     +P+  SL  +         +VLDVGCGPGT
Sbjct: 7   RFYLPCDDEEADRMVILHFCIKYGFNGNIVAPVIQSLRVKPNQNDEYSARVLDVGCGPGT 66

Query: 78  WLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVL-NTLPYDDNTFDYVHQANML 136
           W+L++A+ +    F GID+  +FP  IKPSN +F Q D L +TLPY+DN+F++V    ML
Sbjct: 67  WILEMASEFPFTEFHGIDIRTMFPTTIKPSNAKFTQHDFLQSTLPYEDNSFEFVRMRLML 126

Query: 137 SVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVL 176
              T  ++F ++ E+ RV KP GY E  + E  +    +L
Sbjct: 127 VFITESQFFHLLSEIRRVLKPDGYFEILDCEYQIHRPGIL 166



>gi|384502053|gb|EIE92544.1| hypothetical protein RO3G_17142 [Rhizopus delemar RA 99-880]
          Length = 529

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 93/170 (54%), Gaps = 6/170 (3%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKV 68
           K S S+++   + + P  Y      ++ D MV  H+L    F + F SPI + L     V
Sbjct: 215 KLSSSQQQTALITEWP--YVLTQDNEEQDRMVAQHYLLRTAFGSDFCSPIRSQLQKGIIV 272

Query: 69  LDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQ-GDVLN---TLPYDD 124
           LDVGCGPGTW +++   +  + F GID    FPK+IKP N  FR  G ++     LP+ D
Sbjct: 273 LDVGCGPGTWTMEMGTAFPKSTFIGIDQSAFFPKDIKPKNCHFRTCGHLVQHQLPLPFPD 332

Query: 125 NTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGP 174
           N+ DY++Q +M    T + W  +++E +R+ KPGG+IE  E +   +  P
Sbjct: 333 NSIDYIYQRDMNWGLTGQTWQALLKEYLRILKPGGWIEVVEQDFETQNSP 382



>gi|384494573|gb|EIE85064.1| hypothetical protein RO3G_09774 [Rhizopus delemar RA 99-880]
          Length = 330

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 87/147 (59%), Gaps = 2/147 (1%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDVGCGPGTWLLDLAA 84
           Y+ PN  ++ D +V  HF    LF       +   +  E   K+LD+GCGPGTW++D+A 
Sbjct: 68  YWLPNDDEELDRLVGQHFALKTLFGGNIPKEVHKQVDMEKGIKILDLGCGPGTWIMDMAT 127

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y ++ F GID+  +FP  I+P+NV F+  +VL  LP++D+TFD+V+ +  +     ++W
Sbjct: 128 EYPNSEFTGIDMSDVFPNNIRPANVTFQIANVLEPLPFEDDTFDFVNFSLFILALKKDQW 187

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVK 171
             V++E+ R+ KPGG     E  + +K
Sbjct: 188 IPVMKEVKRILKPGGLYHSREASMLLK 214



>gi|384489746|gb|EIE80968.1| hypothetical protein RO3G_05673 [Rhizopus delemar RA 99-880]
          Length = 293

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 3/155 (1%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECK--VLDVGCGPGTWLLDLA 83
           ++  P   ++ D +   H++   +FQ  F SP+ + L +E K  VLD+GCGPGTW L++A
Sbjct: 130 RFMLPCDDEEADRLTALHYILKVMFQWNFISPVHDLLASEKKHRVLDIGCGPGTWTLEMA 189

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVL-NTLPYDDNTFDYVHQANMLSVFTIE 142
             Y +A F+GID  PIFP  IKP N  F+  ++L   LP+++  FD+++  +M+   +  
Sbjct: 190 TEYPNADFYGIDECPIFPTTIKPPNAHFQTHNILKGPLPFENEQFDFIYMRSMMLYLSPV 249

Query: 143 EWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLS 177
           E   ++ E+ R+ KPG Y E  + +  ++    LS
Sbjct: 250 ELSNLLSEIHRIMKPGSYFEVIDTDYTIRRAGPLS 284



>gi|511001640|gb|EPB83106.1| hypothetical protein HMPREF1544_10144 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 350

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 116/243 (47%), Gaps = 14/243 (5%)

Query: 23  EPLKYFFPNFVKDTDIMVIFHFLECYLF------QNLFSSPIENSLLNECKVLDVGCGPG 76
           E   Y  P   K+ D +   HF+   L       + L S   +N  L   +VLDV CGP 
Sbjct: 79  ESSSYMLPKDDKEIDRLHEEHFVTKELLGFNIMIEALKSLDFQNGGL---EVLDVCCGPA 135

Query: 77  TWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANML 136
           TWL + +  Y + RF GID+  ++P+ I+P N+ F + +VL  +PY D TFD+V    ++
Sbjct: 136 TWLCETSLEYPNCRFTGIDMCSLWPQVIRPVNLTFTEANVLQGIPYPDKTFDFVQMRFVV 195

Query: 137 SVFTIEEWFFVIQELIRVCKPGGYIEFSEPELA-VKTGPVLSRFYDALVTLSDSRNVKIR 195
             F   EW F+I E+ RV K GGY +  E ++  + T P+   + +A  +   S  +   
Sbjct: 196 LAFRTNEWPFIISEIKRVLKDGGYFQCVELDMRIITTDPIARTYTEAFESFCASYGLDAS 255

Query: 196 ISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFM 255
              ++   L     ++ +  +   V LG   GG  G AY+ +  G    D +   L + +
Sbjct: 256 AGAKLDLMLTEGGAMKILQSEYREVPLGW--GGPIGDAYIQLFQGTL--DGLSPWLKQSL 311

Query: 256 GTT 258
           G T
Sbjct: 312 GIT 314



>gi|384499227|gb|EIE89718.1| hypothetical protein RO3G_14429 [Rhizopus delemar RA 99-880]
          Length = 341

 Score =  106 bits (264), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 100/169 (59%), Gaps = 9/169 (5%)

Query: 22  KEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDVGCGP-GTW 78
           K P +Y +P+   + +     H+L  +LFQ  F +P++ ++LN+   K LD+GCGP  +W
Sbjct: 39  KLPTEYVYPSNEAEANRQSGQHYLFKHLFQGNFFAPVD-AILNQPGSKTLDIGCGPQASW 97

Query: 79  LLDLAATYSSARFFGIDLFPIFPKEIK----PSNVEFRQGDVLNTLPYDDNTFDYVHQAN 134
           L D+A  Y    F G D+  +   E++    P+N+  ++ D+ +   Y+ NTFD+VHQ  
Sbjct: 98  LTDMAMDYPQCEFHGFDIAELSFDEVERMHLPNNLILKRADLFDGFDYESNTFDFVHQRV 157

Query: 135 MLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSRFYDA 182
           M +V+  ++  ++ QE++R+ KP G+IE  EP++  K  GP+ + F DA
Sbjct: 158 MYNVYPQDKIPWMFQEILRITKPNGWIELVEPDIKPKRAGPLFTTFVDA 206



>gi|511010507|gb|EPB91728.1| hypothetical protein HMPREF1544_01439 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 257

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 75/130 (57%)

Query: 43  HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPK 102
           HF    L+       ++  L +  +VLD+GCG G W++++A  Y   +  G+D+  +FP 
Sbjct: 12  HFSLKALYDGNILPSVKELLPSNAQVLDLGCGSGCWVMEMAIDYPQYKITGLDMADMFPT 71

Query: 103 EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
            I+P NV+F   ++LN LPY D TFDYVH   +++    EEW  VI E+ RV KPGG ++
Sbjct: 72  TIRPENVKFELHNILNGLPYPDQTFDYVHMRLLITGLRTEEWPTVIAEIHRVLKPGGLVQ 131

Query: 163 FSEPELAVKT 172
             E +   +T
Sbjct: 132 LVESDFTEET 141



>gi|384500229|gb|EIE90720.1| hypothetical protein RO3G_15431 [Rhizopus delemar RA 99-880]
          Length = 317

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 84/161 (52%), Gaps = 12/161 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLF--QNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           Y  P    + D +   HF    LF  +N+  S IE SL     +LD+GCG G W++++A 
Sbjct: 51  YILPKDEIEQDRLNSQHFAVKALFNNKNILDS-IEKSLPKGAAILDIGCGTGCWVMEMAV 109

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y    F G+DL  +FP  I+P N +F   +VL  LP+ DNTFD+V+   M + F   EW
Sbjct: 110 NYPEHNFTGVDLSDMFPTTIRPENAKFELMNVLGGLPFSDNTFDFVNMRFMATAFCTNEW 169

Query: 145 FFVIQELIRVCKPGGYIEF---------SEPELAVKTGPVL 176
             +I+E+ RV K  G +E           EP ++ K G +L
Sbjct: 170 PMIIKEIHRVLKDDGVVELMETDFPENDKEPLISTKLGSLL 210



>gi|384487154|gb|EIE79334.1| hypothetical protein RO3G_04039 [Rhizopus delemar RA 99-880]
          Length = 315

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 85/135 (62%), Gaps = 2/135 (1%)

Query: 27  YFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNE-CKVLDVGCGPGTWLLDLAA 84
           Y+ PN  ++ D +V  HF L+  L  N+    +++  L++  K+LD+GCGPGTW++D+A 
Sbjct: 56  YWLPNDDEEIDRLVGQHFALKTLLEGNIPKEALDHIDLDKGAKILDLGCGPGTWIMDMAT 115

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y ++ F GID+  IFP  I+P NV F+  ++L  LP++D+TFD  +    +     ++W
Sbjct: 116 EYPNSEFIGIDMCDIFPNNIRPVNVTFKIVNILEGLPFEDDTFDMANLTLFILALKKDQW 175

Query: 145 FFVIQELIRVCKPGG 159
             +++E+ RV KPGG
Sbjct: 176 IPLLKEIKRVIKPGG 190



>gi|511002906|gb|EPB84327.1| hypothetical protein HMPREF1544_08922 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 502

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 95/172 (55%), Gaps = 4/172 (2%)

Query: 56  SPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGD 115
           S ++N+     +VLDV CG G W+L++A  YS++ F+GID   IFP  IKP N  F+Q D
Sbjct: 187 SSVKNNWSTPTRVLDVACGSGVWVLEMATEYSNSEFYGIDAACIFPNCIKPPNTTFQQHD 246

Query: 116 VLNT--LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-T 172
           +L+    PY D  FDY+H   + + F+  +  FV+ E+ RV KPGGY+E  + +  +K  
Sbjct: 247 LLDKDGFPYSDEYFDYIHMRLVYNCFSAVDLKFVLAEINRVLKPGGYVEIRDIDPTIKHP 306

Query: 173 GPVLSR-FYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLG 223
           GP   + F +  V ++    V +  +  I + L     + ++ ++  +V  G
Sbjct: 307 GPTTEKAFSEFAVRMAQLNAVDVTWTPHICEILACQGELTDIYHQKVSVGFG 358



>gi|495197908|ref|WP_007922697.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297546375|gb|EFH80243.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 301

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 104/218 (47%), Gaps = 9/218 (4%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           + Y FP  + + D +   H+    L    + +PI++      ++LDVGCG G W  ++A 
Sbjct: 41  VPYLFPKDMPEYDRLTFQHYFLKTLLGGNYVAPIDSPR----RILDVGCGTGIWGREMAQ 96

Query: 85  TYSSARFFGIDLFP--IFPKEIK-PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
            +   +  G D+ P  +    I+ PSN  F QG+VL  LP+ D+ FD+ HQ  M++    
Sbjct: 97  PFPGTQVVGFDIEPHTLVSHVIEMPSNCLFVQGNVLQGLPFSDHDFDFTHQRLMVAALPA 156

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSRFYDALVTLSDSRNVKIRISNEI 200
             W +V+ EL+RV +PGG+IE  E     +  GP+  +F +    L         +    
Sbjct: 157 RAWPYVVSELVRVTRPGGWIELVEAADTFEHMGPMTRKFMEWWHNLESKTGFDASLMTR- 215

Query: 201 IKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIH 238
           + TL++ + +  V   I  V LGA  G        D+H
Sbjct: 216 LPTLLTKAGLSQVKESILQVPLGAWGGRGGELLAKDLH 253



>gi|511011209|gb|EPB92421.1| hypothetical protein HMPREF1544_00719 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 289

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 141/286 (49%), Gaps = 25/286 (8%)

Query: 3   IFSNNKKKSHSRREI-------KKME-KEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLF 54
           I SN+ + +HS  ++       +++  KE + Y  P+  K+ D + + H L       LF
Sbjct: 2   ISSNSNQITHSNYQVAFEWKDGRRLSVKEDVAYILPSDQKEVDRLELNHTL-----WKLF 56

Query: 55  SSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQG 114
            SP+   L    +VLD+GCGPG W LD+A  Y ++ F GID+  +F  E  PSN +F+  
Sbjct: 57  KSPLHEKLTQGIRVLDIGCGPGWWTLDMARLYPNSEFIGIDMADVFITEDIPSNAKFQLL 116

Query: 115 DVLNTLPY-DDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-T 172
           +    L Y +D +FD+V Q  ++  F  +++   ++E+ R+ KPGG IE  E     K  
Sbjct: 117 NAGTGLDYFEDESFDFVFQRFLVMGFPTDQYIRSVEEMKRILKPGGAIEILELVNEYKNA 176

Query: 173 GPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSL--STVRNVDYKISTVTLGAKKGGNA 230
           GP        +     +RN+   ++++I   L +     +++++Y    V +GA  G   
Sbjct: 177 GPAFKNINLWINEALVARNMDSYVADKISSFLANAGYQDIKDINYD---VPIGA-WGAYP 232

Query: 231 GQAYMDIHDGYFLNDPMPETL-CKFMGTTKEGYLKLFKEAKKEVNE 275
           G+ ++ I     L  P  + +  +    T E Y    +EA KEV++
Sbjct: 233 GELFLAIQR---LALPAVKVMITQLTSITSEVYDANMEEAFKEVDQ 275



>gi|495198165|ref|WP_007922954.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297546517|gb|EFH80385.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 314

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 130/279 (46%), Gaps = 12/279 (4%)

Query: 16  EIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGP 75
           E  +  +  + Y  P   ++   +   H++   + Q   S+P +     +  VLDVGCG 
Sbjct: 44  EAGRRRRTDVPYLLPKDDQEIQRLDYQHYILRQVLQGNISAPFQLES-QQGYVLDVGCGT 102

Query: 76  GTWLLDLAATYSSARFFGIDLFPIFPK-EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQAN 134
           G W  ++A +Y   +  G+DL     K   +P N +F QG+VL  LP+   +  YVHQ  
Sbjct: 103 GRWASEIATSYPHVQVIGLDLEEASSKASSRPLNYQFTQGNVLEKLPFPGESMAYVHQRL 162

Query: 135 MLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELA-VKTGPVLSRFYDALVTLSDSRNVK 193
           +++     +W +V+QEL RV + GG++E  E     V+ G    +F      LS  R + 
Sbjct: 163 LVAAIPAAKWPWVVQELARVTRRGGWVELVEMGGGFVREGAATRQFMAWFRQLSQMRGID 222

Query: 194 IRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYM-DIHDGYFLNDPMPETLC 252
           + +    +  L+  + + +V  K   + +G+  GG  G+    D+  G+    P  + LC
Sbjct: 223 LEVMGR-LDVLLQQAGLHHVQKKTLKLPVGS-WGGRMGELLARDMLSGW----PSLQPLC 276

Query: 253 -KFMGTTKEGYLKLFKEAKKEVNETFAPNCEIYRIWCQK 290
            +++  +KE +  +    + E N       E+Y ++ QK
Sbjct: 277 QQYLNISKETFDAVIASLETEWNSQ-QTEYEVYVVYGQK 314



>gi|384484246|gb|EIE76426.1| hypothetical protein RO3G_01130 [Rhizopus delemar RA 99-880]
          Length = 301

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 102/216 (47%), Gaps = 8/216 (3%)

Query: 14  RREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDV 71
           RRE     +E   Y+ P    +   +   HF    LF     S + ++L  E    VLD+
Sbjct: 25  RREFHN--EETSTYWLPKDEDEQKRLTGQHFALKELFGGNMLSSVSDALDFEKGVSVLDI 82

Query: 72  GCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVH 131
           GCG G W++D+   Y ++ + G D+  +  K +K     F  G+V   LPY DNTFD+VH
Sbjct: 83  GCGSGVWIMDMINDYPNSTYHGCDIVDVVNKSMKLDQFTFNHGNVAKGLPYADNTFDFVH 142

Query: 132 QANMLSVFTIEEWFFVIQELIRVCKPGGYIEF--SEPELAVKTGPVLSRFYDALVTLSDS 189
              ++     +EW   I+E IRV KPGG ++    EP L   T     +F +A+  +   
Sbjct: 143 MRLLVYALRKDEWPVAIKEAIRVVKPGGILQLVEGEPRLPKDTSCAYYKFTEAINNVGYM 202

Query: 190 RNVKIRISNEIIKTLVSLSTVR--NVDYKISTVTLG 223
           R    R+  EI + + +   ++    D + S ++ G
Sbjct: 203 RGQNPRVILEIEELVAANDNIKVLQSDARCSDMSAG 238



>gi|384486559|gb|EIE78739.1| hypothetical protein RO3G_03444 [Rhizopus delemar RA 99-880]
          Length = 485

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 23/205 (11%)

Query: 69  LDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNT 126
           LD+ CG GTW +++A+T+  + F+GI    I+P  IKP NV F   D+L++   P+ D  
Sbjct: 195 LDIVCGTGTWAMEMASTFPESHFYGIGYDAIYPTSIKPQNVHFSTRDILDSSGFPFKDEH 254

Query: 127 FDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSRFYDAL-V 184
           FDYVH   +   F+  +  FV+ E+ RV KPGGY+E  + +  +K TGP+ +  Y+ L  
Sbjct: 255 FDYVHMRFVWCYFSKADAKFVMSEVNRVLKPGGYVEMRDCDPIMKNTGPIGTNLYENLGA 314

Query: 185 TLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLN 244
            + +S N+    +  + + L   + + ++ +++  +T                   +  +
Sbjct: 315 HIYNSHNIDATWTQHLPELLSHQAGLTDIHHQMMPIT-------------------FERS 355

Query: 245 DPMPETLCKFMGTTKEGYLKLFKEA 269
            PM   +  F+  + + Y  LF E+
Sbjct: 356 TPMANCINNFLSDSIKSYKPLFMES 380



>gi|495192558|ref|WP_007917348.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297551358|gb|EFH85224.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 298

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 118/268 (44%), Gaps = 15/268 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++   +   HFL    FQ+ + SPI         +LDVG G G W  ++A  +
Sbjct: 40  YVLPKDTQEISRLDFQHFLLRQAFQSNYLSPITQP----KDILDVGAGTGRWADEMAQVF 95

Query: 87  SSARFFGIDLF-PIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
             A   G DL      K  K  N  F + DVL  LP+ D +FD+VHQ  +        W 
Sbjct: 96  PQAFVTGCDLVEQTTDKSFKQPNYRFVEADVLKGLPFRDRSFDFVHQRLLFLAIPAHSWP 155

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSRFYDALVTLSDSRNVKIRISNEI--IK 202
             + EL+RV +PGG+IE  E E+  +  GP   R    ++ +S  R +    S+++  + 
Sbjct: 156 SELLELVRVARPGGWIELVESEIQARNAGPATQRMGQWIIEVSKRRGID---SSQVPNLG 212

Query: 203 TLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGY 262
           T ++ + ++NV  +  TV +G   G        +I+  Y    P+   +   +G + E Y
Sbjct: 213 TYLNNAGLQNVVTRSVTVPMGQWGGRVGSMMAANINSAYQAMKPL---ITSQLGISPEEY 269

Query: 263 LKLFKEAKKEVNETFAPNCEIYRIWCQK 290
            K      +E  E   P    Y  + Q+
Sbjct: 270 EKNILLQHQEWEE-LHPTSVFYAAYGQR 296



>gi|511007540|gb|EPB88826.1| hypothetical protein HMPREF1544_04335 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 286

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNT 126
           KVLD+GCG G W++D+A  + + +F G+D   +FPK I+P+NV F Q D    LPY DNT
Sbjct: 122 KVLDIGCGAGGWVMDMATEHPATQFIGLDKVCLFPKCIRPANVSFVQHDATLGLPYKDNT 181

Query: 127 FDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTL 186
           FD VH    L  F   ++   ++E+ RV KP G ++  E E+ V  G  L + + A V  
Sbjct: 182 FDLVHLRMFLIAFNKHQYAECMKEVFRVTKPNGIVQLLEVEM-VDDGDELVKQFGAAVER 240

Query: 187 SDSRNVKIRISNEIIKTLVS 206
             + N +  +  + + T++S
Sbjct: 241 IMAANDQYAMIAQKLSTIMS 260



>gi|384491034|gb|EIE82230.1| hypothetical protein RO3G_06935 [Rhizopus delemar RA 99-880]
          Length = 263

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 7   NKKKSHSRREIKKM-EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE 65
           N++ +   +E +K+  ++ + Y  P+   + D + + H L      NL+ SPI + L+  
Sbjct: 2   NEENTFEYKEGRKLANQKDVAYILPSDQLEVDRLELNHSL-----WNLYKSPIHDKLMKG 56

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            +VLD+GCGPG W L++A  Y  ++F GID+  +F  +  PSNV F+  +    L ++D 
Sbjct: 57  IRVLDIGCGPGWWTLEMARLYPKSKFVGIDMANVFITKNMPSNVTFKIANAGTRLEFEDQ 116

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           +FD+V Q  ++   T E++   I E+ RV K GG IE  E
Sbjct: 117 SFDFVFQRFLVMGLTTEQYLGSIHEMKRVLKEGGSIEILE 156



>gi|401883649|gb|EJT47847.1| Methyltransferase type 11 [Trichosporon asahii var. asahii CBS
           2479]
          Length = 320

 Score =  100 bits (248), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 8/148 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++ D +   H L   LF    S+PIE  L    KVLDVGCGPG+W+  +   +
Sbjct: 59  YALPADGQEFDRLEAQHRLIGLLFGGTVSAPIE--LKTGSKVLDVGCGPGSWIKQVKTEH 116

Query: 87  SSARFFGIDLFPIFPKEIKPSN--VEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
                +  D    F    KPS+  V+F  GD+L  LP++D+TFD VH         + EW
Sbjct: 117 PEIEAYATDFADTF----KPSDAQVKFVHGDILKGLPFEDDTFDLVHMRFFTGALKVSEW 172

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKT 172
               +EL R+ +PGG+++  EP+  +++
Sbjct: 173 PVAAKELARITRPGGWVQMVEPDGTLRS 200



>gi|406702527|gb|EKD05542.1| Methyltransferase type 11 [Trichosporon asahii var. asahii CBS
           8904]
          Length = 294

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 8/148 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++ D +   H L   LF    S+PIE  L    KVLDVGCGPG+W+  +   +
Sbjct: 33  YALPADGQEFDRLEAQHRLIGLLFGGTVSAPIE--LKTGSKVLDVGCGPGSWIKQVKTEH 90

Query: 87  SSARFFGIDLFPIFPKEIKPSN--VEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
                +  D    F    KPS+  V+F  GD+L  LP++D+TFD VH         + EW
Sbjct: 91  PEIEAYATDFADTF----KPSDAQVKFVHGDILKGLPFEDDTFDLVHMRFFTGALKVSEW 146

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKT 172
               +EL R+ +PGG+++  EP+  +++
Sbjct: 147 PVAAKELARITRPGGWVQMVEPDGTLRS 174



>gi|384486101|gb|EIE78281.1| hypothetical protein RO3G_02985 [Rhizopus delemar RA 99-880]
          Length = 209

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 82/153 (53%), Gaps = 7/153 (4%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVGCG G+W++D+   Y +  + G D+     K +K     F +G+V   LPY +NTF
Sbjct: 9   VLDVGCGSGSWIMDMITDYPNCTYHGCDIVDTTNKILKIDQFTFSRGNVAQKLPYANNTF 68

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGP--VLSRFYDALVT 185
           D+VH   +++    +EW   I+EL+RV K GG I+ +E E  +   P     +F DA  +
Sbjct: 69  DFVHMRLLVAALREDEWPMAIRELVRVTKSGGMIQLTETEPVLNKDPSSAFYKFIDAFNS 128

Query: 186 LSDSRNVKIRISNEIIKTLVSLSTVRNVDYKIS 218
               R    +I+ E +K LVS     N D KI+
Sbjct: 129 ACRQRGQNPQIALE-LKRLVS----ENKDVKIT 156



>gi|384496141|gb|EIE86632.1| hypothetical protein RO3G_11343 [Rhizopus delemar RA 99-880]
          Length = 366

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 82/155 (52%), Gaps = 3/155 (1%)

Query: 28  FFPNFVKDTDIMVIFHFLECYLFQNLFSSPIEN--SLLNECKVLDVGCGPGTWLLDLAAT 85
             P    + D MV  H++    F   FS+P+ +    +    VLD+GCG GTW +++A  
Sbjct: 117 ILPKDESEIDRMVSQHYILRTAFDGDFSAPLLSYTKKVKRVTVLDMGCGSGTWTMEMAVQ 176

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLN-TLPYDDNTFDYVHQANMLSVFTIEEW 144
           + +  F GID   ++P+ IKP N  F   D  + +LP++D + DY+ Q +       + W
Sbjct: 177 FPNMHFIGIDHSALYPQHIKPKNCRFLTLDRNDASLPFEDASVDYIFQRDANWELKDDAW 236

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRF 179
             +IQE  R+ KPGG+IE  E ++  ++ P+   F
Sbjct: 237 EPLIQEYFRILKPGGWIELVEADIETQSSPIEEGF 271



>gi|384488579|gb|EIE80759.1| hypothetical protein RO3G_05464 [Rhizopus delemar RA 99-880]
          Length = 259

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 106/218 (48%), Gaps = 17/218 (7%)

Query: 22  KEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIE---NSLLN---ECKVLDVGCGP 75
           +E   Y+ P    +   +   HF     F+ LF   I    + +LN      VLDVGCG 
Sbjct: 15  EETSTYWLPKDEDEQQRLTGQHFA----FKELFEGNISRKAHEVLNFKEGISVLDVGCGS 70

Query: 76  GTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANM 135
           G W++D+   Y +  + G D+     K +K     +  G+VL  LPY+DNTFD+V     
Sbjct: 71  GVWIMDMINDYPNCTYHGCDIVDTTNKILKVDQFTYSYGNVLVGLPYEDNTFDFVQMRFF 130

Query: 136 LSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV--KTGPVLSRFYDALVTLSDSRNVK 193
           +     EEW   I+E+IRV KPGG I+  EP+L +   +     R   +  +++ SR   
Sbjct: 131 ILALRKEEWPLAIKEIIRVVKPGGMIQVMEPDLELPKDSSSAYHRLIKSFHSVAHSRGQD 190

Query: 194 IRISNEIIKTLVSLSTVRNVDY-----KISTVTLGAKK 226
             I++++    +  + V+ V++      +S+ T+ AKK
Sbjct: 191 FLIASQLEGFFLETNMVKIVEHDKRGCNMSSNTVTAKK 228



>gi|495189579|ref|WP_007914369.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297549711|gb|EFH83577.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 279

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 120/256 (46%), Gaps = 12/256 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLL 80
           E+E   Y  P   ++ + +   H++     +    +P++N       +LDVGCG G W  
Sbjct: 13  EQENAPYLLPRNDEEINRLDFQHYILRATLKGNALAPLQNP----TSILDVGCGTGRWCQ 68

Query: 81  DLAATYSSARFFGIDLF-PI-FPKEIK-PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLS 137
           ++A TY  A   G DL  P+  P+  + P    F QG+VL  LP+   +FDYVHQ  ++ 
Sbjct: 69  EIAVTYPQATIVGFDLVSPLSLPRSPEFPDTCRFVQGNVLEGLPFAPQSFDYVHQRLLVF 128

Query: 138 VFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV-KTGPVLSRFYDALVTLSDSRNVKIRI 196
               + W   +QEL++V +PGG++E  E ++A  + GP  ++    +   S  + +   +
Sbjct: 129 ALPTQRWPGEVQELVKVTRPGGWVELVEVDIAFEQMGPASTQLATWITEASRRKGIDPSM 188

Query: 197 SNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMG 256
           +    +TL+  + + N+ ++     +G+  G     A   +     +N  M + +   +G
Sbjct: 189 TRR-TQTLLEAAGLTNIMHRQVPNPVGSWGGRIGTMAATGVQA---VNKAMRQQVLSQLG 244

Query: 257 TTKEGYLKLFKEAKKE 272
            +   Y +    + +E
Sbjct: 245 VSPAQYDQALATSLEE 260



>gi|495198348|ref|WP_007923137.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297546640|gb|EFH80508.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 305

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 100/218 (45%), Gaps = 12/218 (5%)

Query: 27  YFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FP  + + D +   H FL+  L  + +++P+E       ++LDVG G G W  ++A T
Sbjct: 43  YLFPKDMPEYDRLTFQHYFLKTMLNNSNYAAPLEYP----KRILDVGSGTGIWGREMAQT 98

Query: 86  YSSARFFGIDLFPIFPK----EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
           +  A+  G D+    P     EI PSN  F QGDVL  LP+ DN FD+ HQ  M++    
Sbjct: 99  FPGAQVVGFDIEAQTPLSHVLEI-PSNCLFIQGDVLKGLPFSDNDFDFTHQRLMVAALPA 157

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVKT-GPVLSRFYDALVTLSDSRNVKIRISNEI 200
             W FV+ EL RV  PGGY+E  +     +  GP   ++ +              +  ++
Sbjct: 158 RIWPFVVSELTRVTHPGGYVELIDAADTFENMGPATKKYMEWWHKAERRTGFDASLMTKL 217

Query: 201 IKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIH 238
            + L         DY I  V LGA  G        D+H
Sbjct: 218 PELLGQAGLQDIKDYTIK-VPLGAWAGRGGELLAKDLH 254



>gi|302919169|ref|XP_003052805.1| hypothetical protein NECHADRAFT_99769 [Nectria haematococca mpVI
           77-13-4]
 gi|256733745|gb|EEU47092.1| hypothetical protein NECHADRAFT_99769 [Nectria haematococca mpVI
           77-13-4]
          Length = 332

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 21  EKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           EK   +YF PN  K  + + ++ H+L   L   L  +P++    N  KVLDVGCG G W 
Sbjct: 74  EKHNTQYFTPNDEKQNESLDIVHHYLTLLLDGKLHLAPLKE---NVQKVLDVGCGNGIWA 130

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D    + SA   GIDL P+ P  + P NV+F   D      + DN+FDYVH   +    
Sbjct: 131 IDFGDAHPSAEVTGIDLSPMQPTWV-PPNVKFLVDDATQPWTWPDNSFDYVHVRFLNGA- 188

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKI 194
            +++W  + +E  RVCKPGGY+E         +G    R+Y    T +D   +K+
Sbjct: 189 -LKDWPGLFREAYRVCKPGGYVE---------SGEFDPRYYCDDGTAADEDAIKV 233



>gi|511009368|gb|EPB90612.1| hypothetical protein HMPREF1544_02522 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 410

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 8/149 (5%)

Query: 28  FFPNF-VKDTDIMVIFHFLECYLFQNLFSSPI----ENSLLNECKVLDVGCGPGTWLLDL 82
             PN  ++D D MV  H++    F   +S+ I    +    ++  VLD+GCG GTW +++
Sbjct: 111 ILPNSNIQDLDRMVSQHYILRTAFGADYSASISLSEDQQGTSKTVVLDIGCGSGTWTMEM 170

Query: 83  AATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLN---TLPYDDNTFDYVHQANMLSVF 139
           A  +  A F G+D    FP +IKP N  F+  D+     +LP+ D + DY+ Q ++    
Sbjct: 171 ATQFPHAHFIGVDKHASFPHDIKPKNCHFKLFDISQSSVSLPFMDQSVDYIFQRDLNWDL 230

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPEL 168
               W  +++E  R+ KPGG+IE  EP++
Sbjct: 231 AETTWLPLVKEFFRILKPGGWIELVEPDI 259



>gi|510999582|gb|EPB81197.1| hypothetical protein HMPREF1544_12102 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 319

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 107/217 (49%), Gaps = 16/217 (7%)

Query: 50  FQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFP-KEIKPSN 108
           F+  FS P +   L   ++LDVGCGPG+W +DL+  Y   +  G+D   +FP K   PSN
Sbjct: 46  FEGEFSLPFDYRDLPSGRILDVGCGPGSWCIDLSTKYPRIQVIGVDSDDMFPSKRNLPSN 105

Query: 109 VEFRQGDVLNTLP-YDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPE 167
            +    +VL+ L  + + +FD +H   M+  FT  ++  V+++  R+ KPGGYIE  E +
Sbjct: 106 CQLLVCNVLDGLKEFPEASFDVIHIRFMVLSFTTTQYPQVVKDCWRLLKPGGYIEILETD 165

Query: 168 LAVKT-GPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTV-RNVDYKISTVTLGAK 225
           L V + GP+  +  + +  +S SR +  R   + +  L+    + R V Y+  ++ +G  
Sbjct: 166 LTVHSPGPITMKLNEEMHEVSISRGLNPRRQTDKLSELIPSDAINRQVKYR--SIPIGVW 223

Query: 226 KGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGY 262
            G            G    D M   L KF    ++ Y
Sbjct: 224 GG----------RIGVLCRDDMINMLTKFQPAVQDYY 250



>gi|384500386|gb|EIE90877.1| hypothetical protein RO3G_15588 [Rhizopus delemar RA 99-880]
          Length = 512

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 103/231 (44%), Gaps = 20/231 (8%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVGCG G WL D+A  Y +  + G D+  +  K + P     + G+VL  LP+ DNTF
Sbjct: 73  VLDVGCGSGAWLTDMALNYPNCTYNGCDIVEVANKFVTPRQFTLQYGNVLAGLPFHDNTF 132

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV--KTGPVLSRF------ 179
           D+V    ++     EEW   ++EL+RV KPGG ++  EP L +  K    L RF      
Sbjct: 133 DFVQMRLLIFALREEEWPVAVKELLRVTKPGGIVQILEPVLEIPDKAKKSLYRFSMTCND 192

Query: 180 ---------YDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNA 230
                    +  + ++  +R    RI+ E+ K  +  + V+ +  +  +     +     
Sbjct: 193 LHYLILYINHSIVFSVCQARGQNPRIAMEMEKIFMENNNVKIIQSECRSCNTNTRSSMAK 252

Query: 231 GQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKEVNETFAPNC 281
             A+  I      N  MP         +K+   K  KE + E+ +T A  C
Sbjct: 253 NFAWDAIQAA---NSMMPLFSKSPELKSKQEQQKFLKELEVELTKTGADFC 300



>gi|384496105|gb|EIE86596.1| hypothetical protein RO3G_11307 [Rhizopus delemar RA 99-880]
          Length = 267

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 74/147 (50%), Gaps = 2/147 (1%)

Query: 22  KEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDVGCGPGTWL 79
           +E   Y+ P   ++   +   HF    LF     S + NSL  E    VLD+GCG G W+
Sbjct: 31  EEASTYWLPKDEEEQRRLTGQHFAYKELFGGNLLSSVCNSLDFEKGISVLDIGCGSGVWI 90

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D+   Y +  + G D+     K +K     +  G+++  LPY DNTFD+VH    +   
Sbjct: 91  MDMINDYPNCTYHGCDIVDTTNKVLKIDQFTYSHGNIVKGLPYKDNTFDFVHMRFFIFAL 150

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEP 166
             EEW   I+E IRV KPGG ++F E 
Sbjct: 151 RAEEWPIAIKEAIRVVKPGGMVQFYEA 177



>gi|380479314|emb|CCF43091.1| TAM domain methyltransferase [Colletotrichum higginsianum]
          Length = 397

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 83/160 (51%), Gaps = 16/160 (10%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYL-FQNLFSSPIENSLLNE 65
           N+++ H  +E         +Y FPN   + +   + H +  +L   +L S+P+EN     
Sbjct: 111 NRRRYHKYKE--------GQYHFPNDDPEQEREDMKHAMVVHLCGGSLHSAPLENPQ--- 159

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            KVLDVG G G W +D+   Y  A   GIDL PI P +  P NV+F   D      Y D+
Sbjct: 160 -KVLDVGTGTGIWAIDMGDEYPEADIIGIDLSPIQP-DFVPPNVQFIVDDAEVEWVYPDD 217

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           TFDYVH  NM    +I++W  +  E  RV KPGG+IE  E
Sbjct: 218 TFDYVHLRNMAP--SIKKWPELFAEAYRVLKPGGWIEMQE 255



>gi|384491468|gb|EIE82664.1| hypothetical protein RO3G_07369 [Rhizopus delemar RA 99-880]
          Length = 211

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%)

Query: 65  ECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDD 124
           E  +LD+GCG G W++D+   Y + +++G D+     K I+    EF  G+VL  LPY+D
Sbjct: 61  EISILDIGCGSGIWVMDMITDYPNCKYYGCDMVDTTNKNIRLPQFEFAIGNVLKGLPYED 120

Query: 125 NTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV 170
           NTFD VH    +     ++W  VI+EL+RV KPG  ++ +E +L +
Sbjct: 121 NTFDLVHMRLFVFALREDQWPIVIKELVRVAKPGCIVQVTEVDLKM 166



>gi|121706360|ref|XP_001271443.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
 gi|119399589|gb|EAW10017.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
          Length = 348

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 83/162 (51%), Gaps = 16/162 (9%)

Query: 6   NNKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLN 64
            N ++ H  RE         +Y FPN   + D + ++ H     L   L+ +PI +S   
Sbjct: 60  ENGRRYHKFRE--------GEYLFPNDETEQDRLDMVHHIFRMMLGGKLYQAPIPDS--- 108

Query: 65  ECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPY-D 123
             ++LD+G G G W+LD+A     AR  GIDL PI P+ + P N EF   DV    PY  
Sbjct: 109 PKRILDIGTGTGIWVLDVADEVPGARILGIDLSPIQPQWVAP-NCEFFVDDVETEWPYSQ 167

Query: 124 DNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           +  FDY+HQ NM  V +I +W  + Q+  +  +PGGY E  E
Sbjct: 168 EKPFDYIHQRNM--VGSISDWDRLFQQAYQHLQPGGYYEIQE 207



>gi|302886149|ref|XP_003041965.1| hypothetical protein NECHADRAFT_52876 [Nectria haematococca mpVI
           77-13-4]
 gi|256722872|gb|EEU36252.1| hypothetical protein NECHADRAFT_52876 [Nectria haematococca mpVI
           77-13-4]
          Length = 322

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 81/151 (53%), Gaps = 7/151 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           ++ P +YF PN  + ++ + I H  L   L   LF +PI+  +    KVLDVG G G W 
Sbjct: 42  DRHPTEYFTPNDEQQSESIDINHQSLTLLLEGKLFLAPIKPDV---QKVLDVGTGTGIWA 98

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y +A   G DL PI P  I P NV+F   D   T  + DNTFD++H   +    
Sbjct: 99  IDFADEYPNAEVIGSDLSPIQPTWI-PPNVKFEIDDATLTWTWADNTFDFIHIRYLFGA- 156

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAV 170
            I +W  + +E  R C PGG+I+ +E ++ +
Sbjct: 157 -IRDWTGLFKEAYRCCAPGGWIQTAEADVEI 186



>gi|384500413|gb|EIE90904.1| hypothetical protein RO3G_15615 [Rhizopus delemar RA 99-880]
          Length = 266

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 2/173 (1%)

Query: 34  KDTDIMVIFHFL-ECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFF 92
           ++ D+  + + L + YL ++   S     L +   ++D G G G W L++AA Y+ ++  
Sbjct: 55  RNQDVNQLLNSLWDHYLLKSAKKSNTATQLDDSITIVDSGTGNGIWALEIAAEYTHSKVI 114

Query: 93  GIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELI 152
            +DL P   ++ KP N+ +++ D+    P + N+ D+V Q +M  V   E W  +I E+ 
Sbjct: 115 ALDLKPPTQEQGKPPNLFYKEADITKPWPIESNSVDFVFQRSMGHVIPKEHWHQLISEMY 174

Query: 153 RVCKPGGYIEFSEPELAVKT-GPVLSRFYDALVTLSDSRNVKIRISNEIIKTL 204
           RV KPGG IE +E +L     GP+   F +   +  D   +  RI+  I K +
Sbjct: 175 RVLKPGGTIELTESDLWHHNPGPMQRAFDEFFESQCDENGIDYRITETINKKI 227



>gi|475672319|gb|EMT69483.1| mRNA 3'-end-processing protein YTH1 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 362

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 83/153 (54%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDT-DIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           ++ P +YF PN  + +  I +  H L   L   LF +PI++S+    KVLDVG G G W 
Sbjct: 82  DRHPTEYFTPNDEQQSASIDINHHALTQLLSGKLFLAPIKDSVQ---KVLDVGTGTGIWA 138

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y  A   G DL PI P  + P NV+F   D      +D+NTFD++H   +    
Sbjct: 139 IDFADEYPEAEVIGSDLSPIQPSWV-PPNVKFEIDDATLRWTWDNNTFDFIHIRYLFGA- 196

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            I++W  + +E  R C P G+I+ +E ++ +++
Sbjct: 197 -IKDWSSLFKEAYRCCAPDGWIQSAEADVHIRS 228



>gi|384496097|gb|EIE86588.1| hypothetical protein RO3G_11299 [Rhizopus delemar RA 99-880]
          Length = 198

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 80/148 (54%), Gaps = 11/148 (7%)

Query: 82  LAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
           +A  Y   +F G+D+  +FP  I+P NV+F+  ++L+ LP+ DNTFD+V+   ML+ F I
Sbjct: 1   MAVEYPEFKFIGLDMADMFPTTIRPENVKFQLHNILHGLPFHDNTFDFVNMRIMLTAFLI 60

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEII 201
           +EW FVI+E+ RV KPGG++E  E +        + R  +   T+   +N  +  + E  
Sbjct: 61  DEWPFVIKEIYRVLKPGGFVELMESKFPEDDQVSIVRTVNQQCTMLQQQNFDLIETQE-- 118

Query: 202 KTLVSLSTVRNVDYKISTVTLGAKKGGN 229
                    R++ YK    +L  +  GN
Sbjct: 119 ---------RSLQYKQPLSSLAREMLGN 137



>gi|510999402|gb|EPB81043.1| hypothetical protein HMPREF1544_12258 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 508

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 104/221 (47%), Gaps = 16/221 (7%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIK--------PSNVEFRQGDVLNT 119
           +LD  CG G W LD+A TY  A+  G+D FP   K +K          N+ ++ GD+   
Sbjct: 258 ILDSACGAGFWTLDMAQTYPKAKVIGLDAFPADDKRMKGYSNATISAPNIVYKYGDLTTQ 317

Query: 120 LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSR 178
           L   D+  D ++Q +  S+   E W F+ +EL+RV KPGGYIE  E    ++  GPVL+ 
Sbjct: 318 LTLPDDYIDVLYQRDTTSIIPHERWPFLFKELMRVMKPGGYIELVEYNFDIRDPGPVLAL 377

Query: 179 FYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLG----AKKGGNAGQAY 234
             +     S S  V  R + ++   LV  +  + V+ K+ ++ +G     K     G  Y
Sbjct: 378 VNEWYKIASTSVGVDPREAKQLESKLVG-AGFQQVEKKVVSIPIGEWPTEKDQREKGFLY 436

Query: 235 MDIHDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKEVNE 275
             +    F +  M       +G T++ Y K+   A  E +E
Sbjct: 437 KQVIKALFKS--MRPWWISELGVTEQEYDKVVIAAMGEFDE 475



>gi|384491877|gb|EIE83073.1| hypothetical protein RO3G_07778 [Rhizopus delemar RA 99-880]
          Length = 318

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 6/176 (3%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLD+ CGP TWL + +  Y + RF GID+    P+ I+P N++F + ++L  LPY D +F
Sbjct: 98  VLDICCGPATWLCEESLEYPNCRFTGIDMCNSCPQVIRPVNLDFIEANILKGLPYPDKSF 157

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT---GPVLSRFYDALV 184
           D++    +   F ++EW FVI E+ R+ K GG  ++ + ++ V       ++  + +A  
Sbjct: 158 DFIQMRFVELAFRLDEWQFVISEIKRILKDGGCFQWIDVDMRVNVTNGDTIIKTYTEAFE 217

Query: 185 TLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDG 240
           +     N+   +  + +  L++   ++ +  +   + LG   GG  G AY+    G
Sbjct: 218 SFCAKYNLDPSVGPK-LDYLLTNEKMKIIQTEYREMPLGW--GGPVGHAYLQTFQG 270



>gi|384484898|gb|EIE77078.1| hypothetical protein RO3G_01782 [Rhizopus delemar RA 99-880]
          Length = 178

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 78/144 (54%), Gaps = 2/144 (1%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDVGCGPGTWLLDLAA 84
           Y+ P    +   +   HF    LF+      I+ +L +E    +LDVGCG  TW+ D+A+
Sbjct: 28  YWLPKDEDEQFRLAGQHFAIKDLFEGNMHPNIKEALDSEPNMTILDVGCGSCTWIFDMAS 87

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y    F G D+  +  KE+ P+   F+ G+V   LPY D+ FD+V+   +    + +EW
Sbjct: 88  DYPQCDFHGCDIVDVANKEMIPNQFTFQLGNVAQRLPYKDSMFDFVYARLLALALSEDEW 147

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
              IQE++RV KPGG+I+  + ++
Sbjct: 148 PRAIQEILRVTKPGGWIQLVDADV 171



>gi|302885854|ref|XP_003041818.1| hypothetical protein NECHADRAFT_87177 [Nectria haematococca mpVI
           77-13-4]
 gi|256722724|gb|EEU36105.1| hypothetical protein NECHADRAFT_87177 [Nectria haematococca mpVI
           77-13-4]
          Length = 354

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 78/148 (52%), Gaps = 7/148 (4%)

Query: 26  KYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN  +  + + +  H+L   L   LF +PI++ +    +VLDVG G G W +D A 
Sbjct: 79  EYSFPNDERQLESVDITHHYLMILLDGKLFLAPIKDDVQ---RVLDVGTGSGIWAIDFAD 135

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y  A   G DL P  PK + P NV F   D   T  + DNTFD++H   +     I +W
Sbjct: 136 QYPGAEVTGTDLSPCQPKWV-PPNVRFEIDDASETWTWKDNTFDFIHIRYLFGA--IRDW 192

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKT 172
             + +E  R C PGG+I+ +E ++  ++
Sbjct: 193 TALFKEAYRCCAPGGWIQSAEADVEFRS 220



>gi|495194496|ref|WP_007919286.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297547873|gb|EFH81740.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 321

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 100/215 (46%), Gaps = 8/215 (3%)

Query: 62  LLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDL---FPIFPKEIKPSNVEFRQGDVLN 118
           L +   +LDVGCG G W  ++A TY  A   G DL     +      P    F QG+VL 
Sbjct: 92  LQHPTSILDVGCGTGRWCQEMAVTYPQATVVGFDLVSPLALLRSPQFPDTCRFVQGNVLE 151

Query: 119 TLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV-KTGPVLS 177
            LP+   +FDYVHQ  ++     + W   IQEL++V +PGG++E  E ++   + GP  +
Sbjct: 152 GLPFAPQSFDYVHQRLLVFALPTQRWPGEIQELVKVTRPGGWVEIVEVDITFEQMGPAST 211

Query: 178 RFYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDI 237
           +    +   S  + +   ++    +TL+ ++ + N+ Y+     +G+  G     A   +
Sbjct: 212 QLATWITEASRQKGIDPSMARR-AQTLLKVAGLTNIVYQQVPNPVGSWGGRIGTMAATGV 270

Query: 238 HDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKE 272
                +N  M + +   +G +   Y +    + +E
Sbjct: 271 QA---INKAMRQQVLSQLGVSPVQYDQALATSLEE 302



>gi|477519783|gb|ENH71949.1| mRNA 3'-end-processing protein YTH1 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 362

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 82/153 (53%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDT-DIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           ++ P +YF PN  + +  I +  H L   L   LF +PI++   N  KVLDVG G G W 
Sbjct: 82  DRHPTEYFTPNDEQQSASIDINHHALTQLLSGKLFLAPIKD---NVQKVLDVGTGTGIWA 138

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y  A   G DL PI P  + P NV+F   D      +D+NTFD++H   +    
Sbjct: 139 IDFADEYPEAEVIGSDLSPIQPSWV-PPNVKFEIDDATLRWTWDNNTFDFIHIRYLFGA- 196

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            I++W  + +E  R C P G+I+ +E ++ +++
Sbjct: 197 -IKDWSSLFKEAYRCCAPDGWIQSAEADVHIRS 228



>gi|402074124|gb|EJT69653.1| hypothetical protein GGTG_12537 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 394

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (48%), Gaps = 11/160 (6%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNE 65
           N +K H R        E  +Y+ PN     + + I H + C    N LF +P++N     
Sbjct: 107 NYRKIHGR---TYQNYEDAEYWGPNDSTQNEALDIAHHMMCLALDNRLFLAPVDNPQ--- 160

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            KVLDVG G G W +D A  + SA   G DL PI P  + P N  F   +  N   Y DN
Sbjct: 161 -KVLDVGTGTGIWAIDFADEHPSAEVIGTDLSPIQPLWVPP-NCRFELDNAENEWTYADN 218

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           +FDY+H   +L    I++W    + ++R  KPGG+ E  E
Sbjct: 219 SFDYIHVRGLLGC--IKDWEKFYRNVLRTLKPGGWFEHHE 256



>gi|511002580|gb|EPB84010.1| hypothetical protein HMPREF1544_09209 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 302

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 106/210 (50%), Gaps = 15/210 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNE--CKVLDVGCGPGTWLLDLAA 84
           Y+ P   ++   +   HF    L++    + ++ +L  E    VLDVGCG G+W++D+  
Sbjct: 42  YWLPKDEEEQHRLTGQHFAVKELYEGNVLTSVKETLDFEKGISVLDVGCGAGSWIMDMII 101

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y +  + G D+  +    + PS   +  G+V+  L Y DNTFD+VH    +      EW
Sbjct: 102 DYPNCTYEGCDMVQVTNSNVTPSQFHWSYGNVIEKLDYPDNTFDFVHMRLFILALRESEW 161

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAV--KTGPVLSRFYDALVTLS-DSRNVKIRISNEII 201
              I+E++RV KPGG I+  E +L V   +G ++     ALV ++  +R    RI+ ++ 
Sbjct: 162 PIAIKEILRVTKPGGVIQLLEFDLKVVDDSGSLI-----ALVHMACRARGQDPRIALQLE 216

Query: 202 KTLVSLSTVR--NVDYK---ISTVTLGAKK 226
           K + +    +    DY+   +++ T  AKK
Sbjct: 217 KLVAANENAKVIQTDYRSIDMTSNTSAAKK 246



>gi|477522885|gb|ENH74927.1| hypothetical protein FOC1_g10002472 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 355

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 77/148 (52%), Gaps = 7/148 (4%)

Query: 26  KYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN  +  + + +  H+L   L   L+ +PI +++    K LDVG G G W +D A 
Sbjct: 81  EYSFPNDEQQLESVDISHHYLTVLLDGQLYLAPIGDNI---QKALDVGTGSGIWAIDFAD 137

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            +  A     DL P  PK + P NV F   D   T  + DNTFD+VH   +     I++W
Sbjct: 138 QFPQAEVTATDLSPTQPKWV-PPNVRFEIDDATETWTWKDNTFDFVHMRYLFGA--IQDW 194

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKT 172
             + Q+  RVC PGG++E  E ++  ++
Sbjct: 195 TALYQQAYRVCTPGGWVESVEADIHFRS 222



>gi|384483693|gb|EIE75873.1| hypothetical protein RO3G_00577 [Rhizopus delemar RA 99-880]
          Length = 232

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 76/142 (53%), Gaps = 2/142 (1%)

Query: 50  FQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFP-KEIKPSN 108
           F+  F  P +   L   K+LDVGCGPG+W +DLA  Y + + FG+D   +FP +   P N
Sbjct: 91  FEGEFLLPFDYQELENAKILDVGCGPGSWCIDLATKYPNIQVFGVDNVDMFPLQHTLPIN 150

Query: 109 VEFRQGDVLNTLP-YDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPE 167
                 DVL+ L  + D  FD +H   M+   T  ++  VI +  R+ KPGGYIE  E +
Sbjct: 151 CHLSVCDVLHGLSQFPDANFDVIHIRFMILSLTTAQYLKVISDCWRLLKPGGYIEILETD 210

Query: 168 LAVKTGPVLSRFYDALVTLSDS 189
           L V +   L++  +    L+DS
Sbjct: 211 LIVYSAGPLTQKMNKESKLNDS 232



>gi|384497298|gb|EIE87789.1| hypothetical protein RO3G_12500 [Rhizopus delemar RA 99-880]
          Length = 159

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 79/145 (54%), Gaps = 1/145 (0%)

Query: 82  LAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
           +A  Y +  F GID  P+FP++I+P+NV FRQ D+L  LP++DN+FD++     L  F  
Sbjct: 1   MATEYPNTHFIGIDQLPLFPQDIRPANVTFRQSDILAGLPFEDNSFDFIQMRLFLVAFNR 60

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEII 201
             W   + E+ R+ KPGGY++  E +L  +   V+  +   + T+ +  +    I ++ +
Sbjct: 61  TNWIDALNEVYRLLKPGGYVQLLEAQLMDEGDEVIEEYVAKIRTIMEFNDFDPEICDK-L 119

Query: 202 KTLVSLSTVRNVDYKISTVTLGAKK 226
             L+  S     D+   +V L +++
Sbjct: 120 GILIEKSGFILKDFTKKSVPLPSRR 144



>gi|302887855|ref|XP_003042815.1| hypothetical protein NECHADRAFT_72745 [Nectria haematococca mpVI
           77-13-4]
 gi|256723728|gb|EEU37102.1| hypothetical protein NECHADRAFT_72745 [Nectria haematococca mpVI
           77-13-4]
          Length = 351

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 83/155 (53%), Gaps = 9/155 (5%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLD 70
           H RR     ++    Y+ PN  +  + M I  H L   L   L+ SP++  +    +VLD
Sbjct: 63  HGRR--YHSDRGDATYWAPNDEQQNESMDINHHQLTLVLGGKLYLSPLKQDIQ---RVLD 117

Query: 71  VGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYV 130
           +G G G W +D A  + +A   G D+  I P+ + P N++F   D   T  +D+N+ DYV
Sbjct: 118 IGTGTGIWAIDFADEFPTAEVTGTDISVIQPQWV-PPNLKFEIEDCTQTWTFDENSIDYV 176

Query: 131 HQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           H   ++   +I++W  +++E  RVCKPGGY+E  E
Sbjct: 177 HMRYLIG--SIKDWPALMKEAFRVCKPGGYVESYE 209



>gi|384493293|gb|EIE83784.1| hypothetical protein RO3G_08489 [Rhizopus delemar RA 99-880]
          Length = 212

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 84/159 (52%), Gaps = 3/159 (1%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVGC  G W++D+   Y +  + G D+     K +K +   F   +V+  LPY +NTF
Sbjct: 45  VLDVGCSSGIWIMDMITDYPNCTYHGCDIVDTTNKVLKLNQFTFSYANVITGLPYPENTF 104

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTG--PVLSRFYDALVT 185
           D+V+    +     EEW  VI+E+IRV KPGG ++ +E ++ ++ G   V      A+ T
Sbjct: 105 DFVNLRFFIFALREEEWPRVIKEIIRVTKPGGMLQLTESDITLEEGISSVYHSVKRAVFT 164

Query: 186 LSDSRNVKIRISNEIIKTLVSLSTVRNVDYK-ISTVTLG 223
              SR    +I+ E+ K ++  +     +YK I  + +G
Sbjct: 165 ACKSRGQNPQIARELEKLVLENNNNDRFEYKYIKKICVG 203



>gi|85081713|ref|XP_956770.1| hypothetical protein NCU00451 [Neurospora crassa OR74A]
 gi|28917847|gb|EAA27534.1| predicted protein [Neurospora crassa OR74A]
          Length = 375

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 72/134 (53%), Gaps = 7/134 (5%)

Query: 30  PNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  + M IFH L   +    L+++P+   +    K +D+G G G W +D A  +  
Sbjct: 104 PNDARHAEAMDIFHHLNTLILSGKLYTAPLPKKIQ---KAVDIGTGTGIWAIDFADEFPE 160

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P N++F   D+     + DNTFDY+H  +++ V  +E+W    
Sbjct: 161 AEVIGTDVSPIQPTWV-PPNLKFEIDDLNLEWTWPDNTFDYIHSRSLIGV--VEDWERFY 217

Query: 149 QELIRVCKPGGYIE 162
           ++  R CKPGGY+E
Sbjct: 218 RQAFRCCKPGGYVE 231



>gi|475667102|gb|EMT64892.1| Demethylmenaquinone methyltransferase [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 380

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 79/158 (50%), Gaps = 9/158 (5%)

Query: 21  EKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+ PN     + M I  H L   L   L  +P+++ +    KVLDVG G G W 
Sbjct: 102 ERGNAEYWTPNDEHHNESMDINHHLLSLSLDAKLHLAPLKDDIK---KVLDVGTGTGIWA 158

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y +A   G D+ PI P  + P N++F   D      Y  N+FDYVH   +    
Sbjct: 159 IDFADEYPNAEVVGTDISPIQPDWV-PPNLKFEIEDCTQEWTYGPNSFDYVHMRYLYG-- 215

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE--PELAVKTGPV 175
           +I +W  + +E  RVCKPGG++E  E  P +    G V
Sbjct: 216 SISDWSALFKEAFRVCKPGGWVESYEASPRMESDDGTV 253



>gi|367028873|ref|XP_003663720.1| hypothetical protein MYCTH_2315429 [Myceliophthora thermophila ATCC
           42464]
 gi|347010990|gb|AEO58475.1| hypothetical protein MYCTH_2315429 [Myceliophthora thermophila ATCC
           42464]
          Length = 407

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (51%), Gaps = 6/151 (3%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWL 79
           ++ P +Y+ PN  K T+ M I H     L    L+ +P+E   +   KVLDVG G G W 
Sbjct: 128 DRTPAEYWGPNDEKQTECMDIQHHAFTLLLDGALYRAPLEVDKIQ--KVLDVGTGTGIWA 185

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  + +    G D+ PI P  + P NV F   D      + +N+FD+VH   +    
Sbjct: 186 IDFADEHPNVEVIGTDISPIQPGWV-PPNVFFEMEDATQAWTFAENSFDFVHMRYLYG-- 242

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAV 170
           +I +W  + +E  RV KPGGYIE  E + A+
Sbjct: 243 SIVDWNQLFREAYRVLKPGGYIETFEADSAI 273



>gi|477508784|gb|ENH62077.1| Phosphoethanolamine N-methyltransferase 3 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 394

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 79/143 (55%), Gaps = 6/143 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY FPN   + D   + H L  YL  + LF +PIE  L    +VLD+G G G W +DLA 
Sbjct: 103 KYLFPNDEAEQDREELKHNLTVYLCDDRLFFAPIEQLLERGAEVLDLGTGIGKWCIDLAD 162

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNTFDYVHQANMLSVFTIE 142
            Y +++F G+DL PI P  + P N  F   D+ +     Y D TFDY+H  +  +V +I+
Sbjct: 163 IYPNSQFHGMDLSPIQPDWV-PENAIFVVDDIEHEAGWTYGDETFDYIHIRH--TVHSIK 219

Query: 143 EWFFVIQELIRVCKPGGYIEFSE 165
           +   + + + +  KPGGY+E  E
Sbjct: 220 DRELLWERIWKHLKPGGYVEIQE 242



>gi|342871460|gb|EGU74057.1| hypothetical protein FOXB_15447 [Fusarium oxysporum Fo5176]
          Length = 425

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 94/210 (44%), Gaps = 24/210 (11%)

Query: 26  KYFFPNFVKD-TDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLL---- 80
           +Y  PN  +    + +  H+L   L  NLF +PI   +    +VLDVG G G W +    
Sbjct: 99  EYVMPNDEQQLQSVDITHHYLTMLLDNNLFLAPIPPHVQ---RVLDVGTGSGIWAMQVSL 155

Query: 81  --DLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSV 138
             D A  Y SA+  G DL P  P+ + P NV F   D   T P+ DN FD++H   +   
Sbjct: 156 PTDFADAYPSAQVIGSDLSPTQPEWVPP-NVHFEIADATLTWPWKDNYFDFIHIRYLFG- 213

Query: 139 FTIEEWFFVIQELIRVCKPGGYIEFSEPEL-------AVKTGPVLSRFYDALVTLSDSRN 191
            ++++W  + QE  R C PGG+++  E ++          + P L ++ D          
Sbjct: 214 -SVQDWPALFQEAYRCCAPGGWVQSCEADIHFYSDDGTTDSEPALQKWADLYEKGGAETG 272

Query: 192 VKIRISNEIIK----TLVSLSTVRNVDYKI 217
               +  E ++    T    + VR  DYK+
Sbjct: 273 RTFFLQQEALQERSITEAGFTDVRIFDYKL 302



>gi|477527332|gb|ENH79155.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 342

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 76/154 (49%), Gaps = 11/154 (7%)

Query: 13  SRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDV 71
           SRR  K  E +   Y FPN   + +   + H +  ++    L S+P++N      K+LDV
Sbjct: 60  SRRYHKYKEGQ---YNFPNDDWELEREDMKHAMVVHICDGKLHSAPLDNPQ----KILDV 112

Query: 72  GCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVH 131
           G G G W +D+   Y  A   GIDL PI P  I PSNV F   D      Y D  FDYVH
Sbjct: 113 GTGTGIWAIDMGDEYPEASVVGIDLSPIQPDFI-PSNVRFLVDDAEADWVYPDGNFDYVH 171

Query: 132 QANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
             NM    +I  W  +  E  RV KPGG+IE  E
Sbjct: 172 LRNMAP--SIRNWPALFAEAYRVLKPGGWIELQE 203



>gi|392574793|gb|EIW67928.1| hypothetical protein TREMEDRAFT_57395, partial [Tremella
           mesenterica DSM 1558]
          Length = 297

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 78/157 (49%), Gaps = 13/157 (8%)

Query: 65  ECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDD 124
           +C++LDVG G G W L++A+ +  A   G+DL P+   EI P+N+ +   DV   +P+ D
Sbjct: 57  DCRLLDVGTGTGIWALEMASEFPEAEVTGVDLAPVQRPEILPNNLSYLMDDVSKGIPFPD 116

Query: 125 NTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE-----------PELAVKTG 173
             FD VH   +L+   I  W   I E+IRV +PGG I F E           PE + K  
Sbjct: 117 GYFDAVHSRLLLA--GIRNWKSFINEVIRVVRPGGLIVFVEDIGRFWVDDVSPEESRKRA 174

Query: 174 PVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTV 210
           P +S++ D +      R       ++ I  L+   T+
Sbjct: 175 PGVSKWSDYIEMALTERGFDSNAGSKAIPKLIEEHTL 211



>gi|336261277|ref|XP_003345429.1| hypothetical protein SMAC_08783 [Sordaria macrospora k-hell]
 gi|380091510|emb|CCC11007.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 370

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (51%), Gaps = 13/158 (8%)

Query: 30  PNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D M +  H L   +   LF SP++   +   KVLDVG G G W +D A  + +
Sbjct: 100 PNDKRHLDSMDIAHHTLTLSIGGKLFLSPLDKKKVQ--KVLDVGTGTGLWAIDFADEFPN 157

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P NV+F   D      + D++FD++H   ++ V  +++W  + 
Sbjct: 158 AEVIGTDVSPIQPSWV-PPNVKFELDDCNREWTWADSSFDFIHMRLLIGV--VQDWHALF 214

Query: 149 QELIRVCKPGGYIE-------FSEPELAVKTGPVLSRF 179
           ++  R CKPGGY+E       F+  + +VK G  L ++
Sbjct: 215 RQAFRTCKPGGYVESFVSSAQFTSDDGSVKPGSALDQW 252



>gi|511000432|gb|EPB81971.1| hypothetical protein HMPREF1544_11287 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 357

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 69/133 (51%), Gaps = 1/133 (0%)

Query: 48  YLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPS 107
           YL ++   S     +     ++DVG G G W L++A+   + +  G+DL P   ++ KP 
Sbjct: 111 YLLKSARKSNTWGEIEGSMTIVDVGTGNGIWALEMASEQLNCKVIGLDLRPPTEQQGKPK 170

Query: 108 NVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPE 167
           N+ + + D+    P + N+ D++ Q NM      ++W  V+ E++RV KPGG IE  E +
Sbjct: 171 NLNYHEADITEIWPLESNSVDFIFQRNMGQSIQKDQWSHVLSEMLRVLKPGGTIELVEAD 230

Query: 168 LAVKT-GPVLSRF 179
           L     GPV   F
Sbjct: 231 LVHHNPGPVQRAF 243



>gi|495196549|ref|WP_007921339.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297549027|gb|EFH82894.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 312

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 72/143 (50%), Gaps = 6/143 (4%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P  + D   +   HF+        + +PI        ++LDVG G G W +++A  +
Sbjct: 48  YQLPKDLTDLQRLDFQHFILRQALMGNYVAPIHPG--ERSQILDVGTGTGRWAIEMAQNF 105

Query: 87  SSARFFGIDLFP----IFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIE 142
             A+ FG+DL         +   P N  F+ G+VL  LP+ D TFD+VHQ  +++     
Sbjct: 106 PQAQVFGVDLEESRDITGHQSSTPLNYHFQAGNVLQGLPFLDGTFDFVHQRLLVTGIPFA 165

Query: 143 EWFFVIQELIRVCKPGGYIEFSE 165
            W  VI+EL+RV K GG+IE  E
Sbjct: 166 RWGDVIRELLRVTKAGGWIEMVE 188



>gi|336266230|ref|XP_003347884.1| hypothetical protein SMAC_06716 [Sordaria macrospora k-hell]
 gi|380091817|emb|CCC10545.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 405

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 79/162 (48%), Gaps = 14/162 (8%)

Query: 26  KYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  D + I+H  +E  L   L  +PI++++    + +D+G G G W +D A 
Sbjct: 129 EYWGPNDKKHLDALEIYHEAIELMLDHKLHMAPIKDNIE---RAIDIGTGLGIWAIDFAD 185

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y +    G D+ P+ P  I P NV F   D      Y  N FD++H   M+    I +W
Sbjct: 186 KYPTCEVTGTDITPVQPSWI-PPNVRFEIDDATKEWTYKPNHFDFIHVRFMIGA--IADW 242

Query: 145 FFVIQELIRVCKPGGYIEF-------SEPELAVKTGPVLSRF 179
               QE  RVCKPGG+IE        S  + +VK G  L  +
Sbjct: 243 PAFYQEAYRVCKPGGWIEHIDHSPVVSSDDGSVKPGSALDTY 284



>gi|477535144|gb|ENH86671.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 353

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 78/154 (50%), Gaps = 10/154 (6%)

Query: 13  SRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDV 71
           +RR   K ++   KY FPN   + +   + H +  +L    L  +P+EN      K+LD+
Sbjct: 72  NRRRYHKFKEG--KYVFPNDDAEQEREDMKHAMVVFLCDGALHGAPLENPQ----KILDI 125

Query: 72  GCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVH 131
           G G G W +D+   Y  A   GIDL PI P  + P NV F   D      Y D++ DYVH
Sbjct: 126 GTGTGIWAIDMGDEYPEADVTGIDLSPIQPPYL-PPNVSFIVDDAEEEWLYPDDSIDYVH 184

Query: 132 QANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
             NM     I+ W  ++++  RV KPGG+IE  E
Sbjct: 185 VRNMGGA--IKNWTKLLEQAYRVLKPGGWIELQE 216



>gi|336260240|ref|XP_003344916.1| hypothetical protein SMAC_08396 [Sordaria macrospora k-hell]
 gi|380087677|emb|CCC14085.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 371

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 80/152 (52%), Gaps = 8/152 (5%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLD 70
           H R   K+M    ++ + PN  +    + I H     +    L++SP++   +   KV+D
Sbjct: 85  HGRTYHKEMGN--VESWQPNDERHKQALDIAHHAWTVILDGKLYNSPLDKKKIQ--KVVD 140

Query: 71  VGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYV 130
           +G G G W +D A  + +A   G D+ PI P  + P+NV+F   D  +   + DNTFD+V
Sbjct: 141 IGTGTGMWAIDFADEFPNAEVIGTDITPIQPSWV-PANVKFELDDCNSEWTWADNTFDFV 199

Query: 131 HQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
           H   M  V  +++W  + ++  RVCKPGG+ E
Sbjct: 200 HTRMMFGV--VQDWEGLFRQAYRVCKPGGWTE 229



>gi|399170491|emb|CCE28868.1| uncharacterized protein CPUR_02558 [Claviceps purpurea 20.1]
          Length = 358

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (50%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           +FFPN  +      +FH     L  + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 88  FFFPNDDQQIKSEELFHHFSTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 145

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D +    YDDN FD++H   +  V  IE+W 
Sbjct: 146 FPNASVIGTDLSPCQPQWV-PPNLCFEIDDAMLEWTYDDNHFDFIHMRYI--VGGIEDWT 202

Query: 146 FVIQELIRVCKPGGYI-------EFSEPELAVKTGPVLSRF 179
            + +E  R C PGG++       EF   + + +  P+L+ F
Sbjct: 203 ALFKEAYRCCAPGGWVESVEYDAEFRSDDGSTQLEPILASF 243



>gi|342888666|gb|EGU87903.1| hypothetical protein FOXB_01589 [Fusarium oxysporum Fo5176]
          Length = 355

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 12/152 (7%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLL 80
           ++ P +YF PN  +        H L   L   LF +PI++   N  KVLDVG G G W +
Sbjct: 82  DRHPTEYFTPNDEQH------HHALTQLLSGKLFLAPIKD---NVQKVLDVGTGTGIWAI 132

Query: 81  DLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFT 140
           D A  +  A   G DL PI P  + P NV+F   D      +D+NTFD++H   +     
Sbjct: 133 DFADEFPEAEVIGSDLSPIQPSWV-PPNVKFEIDDATLRWTWDNNTFDFIHIRYLFGA-- 189

Query: 141 IEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           I++W  + +E  R C P G+I+ +E ++ +++
Sbjct: 190 IKDWSSLFKEAYRCCAPDGWIQSAEADVHIRS 221



>gi|302902186|ref|XP_003048600.1| hypothetical protein NECHADRAFT_47669 [Nectria haematococca mpVI
           77-13-4]
 gi|256729533|gb|EEU42887.1| hypothetical protein NECHADRAFT_47669 [Nectria haematococca mpVI
           77-13-4]
          Length = 311

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 26  KYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN  +  + I +  H L   L   LF +PI++   N  KVLDVG G G W +D A 
Sbjct: 40  EYAFPNDDQQLESIDISHHSLTLLLDGQLFLAPIKD---NVQKVLDVGTGSGIWAIDFAD 96

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y+ A   G DL P  P+ + P NV+F   D      + DN FD++H   +    T   W
Sbjct: 97  QYTGAEVTGTDLSPCQPEWV-PPNVQFEVDDATERWTWGDNHFDFIHIRYLFGAIT--NW 153

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
             + +E  R C PGG++E  E ++
Sbjct: 154 HALFKEAYRCCAPGGWVESCEADV 177



>gi|408393967|gb|EKJ73224.1| hypothetical protein FPSE_06648 [Fusarium pseudograminearum CS3096]
          Length = 366

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 79/153 (51%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           +K P +YF PN  + +  + I H  L   L   LF +PI+    N  +VLDVG G G W 
Sbjct: 86  DKHPTEYFTPNDEQQSASIDINHQALTLLLGGKLFLAPIKP---NVQRVLDVGTGTGIWA 142

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y  A   G DL PI P  + P NV+F   D      +D+NTFD++H   +    
Sbjct: 143 IDFADEYPEAEVIGSDLSPIQPTWV-PPNVKFEIDDASLRWTWDNNTFDFIHIRYLFGA- 200

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            I++W  + QE  R C   G+I+  E ++ +++
Sbjct: 201 -IKDWTSLFQEAYRCCAADGWIQSGEADVHIRS 232



>gi|477520092|gb|ENH72228.1| Demethylmenaquinone methyltransferase [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 380

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 79/158 (50%), Gaps = 9/158 (5%)

Query: 21  EKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+ PN     + M I  H L   L   L  +P+++ +    K LDVG G G W 
Sbjct: 102 ERGNAEYWTPNDEHHNESMDINHHLLSLSLDGKLHLAPLKDDIQ---KALDVGTGTGIWA 158

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y +A   G D+ PI P  + P N++F   D      ++ N+FDYVH   +    
Sbjct: 159 IDFADEYPNAEVVGTDISPIQPDWV-PPNLKFEIEDCTQEWTFNPNSFDYVHMRYLYG-- 215

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE--PELAVKTGPV 175
           +I +W  + +E  RVCKPGG++E  E  P +    G V
Sbjct: 216 SISDWSALFKEAFRVCKPGGWVESYEASPRMESDDGTV 253



>gi|302884009|ref|XP_003040902.1| hypothetical protein NECHADRAFT_97579 [Nectria haematococca mpVI
           77-13-4]
 gi|256721795|gb|EEU35189.1| hypothetical protein NECHADRAFT_97579 [Nectria haematococca mpVI
           77-13-4]
          Length = 353

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 128/286 (44%), Gaps = 30/286 (10%)

Query: 26  KYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPI-ENSLLNECKVLDVGCGPGTWLLDLA 83
           +Y+ PN  K  +   I  H++   L   L+   I +N      ++LDVG G G W +D+A
Sbjct: 51  EYWAPNDEKHVEGFDISHHWITMLLDDKLYLPSIGDNPQARSIRILDVGTGSGIWAIDMA 110

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             + SA   GID+ P  P  + P NV F+  D      ++  +FD++H  ++L    I++
Sbjct: 111 DLFPSAHIIGIDISPTQPSWVPP-NVSFQIDDAQLDWTFEPESFDFIHVRSLLG--GIDD 167

Query: 144 WFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSR--------------FYDALVTLSD 188
           W  +  +L +  KPGG+ +  EP LA++   P + R              FYDA   L  
Sbjct: 168 WPKLYGQLFKFLKPGGWFQHMEPRLALRCDNPAIERPIVSYLPHFQWAQLFYDAGDRLGR 227

Query: 189 SRNVKIR----ISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLN 244
           + N+  +     ++E   T ++  T + V Y         K+ G     YMD+  G F  
Sbjct: 228 TFNITDKKMENWASEAGFTKITPKTFK-VPYAGWPKDPKLKELGRYVNFYMDMSLGGFAT 286

Query: 245 DPMPETLCKFMGTTKEGYLKLFKEAKKEVN-ETFAPNCEIYRIWCQ 289
            PM     + +G + E    L    +  +N +T  PN ++Y +  Q
Sbjct: 287 YPM----SQILGWSLEEITVLVARMRTAINDQTTLPNGDMYVLLMQ 328



>gi|429850977|gb|ELA26202.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 366

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 80/160 (50%), Gaps = 16/160 (10%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNE 65
           NK++ H  +E         +Y FPN   + +   + H +   L    L S+P++N     
Sbjct: 81  NKRRYHKYKE--------GRYAFPNDDAEQEREDMKHSMVVTLCGGALHSAPLQNPQ--- 129

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            K+LD+G G G W +D+   Y  A+  GIDL PI P  + P NV F   D      Y D+
Sbjct: 130 -KILDIGTGTGIWAIDMGDEYPEAQVTGIDLSPIQPAYV-PPNVAFIVDDAEAEWLYADD 187

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           + DY+H  NM +   I+ W  ++ +  RV KPGG+IE  E
Sbjct: 188 SIDYIHVRNMGAA--IKNWEKLLAQAYRVLKPGGWIELQE 225



>gi|336260232|ref|XP_003344912.1| hypothetical protein SMAC_08392 [Sordaria macrospora k-hell]
 gi|380087673|emb|CCC14081.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 359

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 71/134 (52%), Gaps = 6/134 (4%)

Query: 30  PNFVKDTDIMVIFHFLECYLF-QNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D M I H     L    L+ +P++   +   KVLDVG G G W +D A  +  
Sbjct: 90  PNDERHIDAMEIAHHGYMVLMGHKLYRAPLDKQRVR--KVLDVGTGTGLWAIDFADEFLK 147

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P+NV+F   D      + DNTFD+VH   ++ +  IE+W+   
Sbjct: 148 ADVVGTDITPIQPCWV-PANVKFELDDCNLEWTWPDNTFDFVHGRMLIGI--IEDWYEFH 204

Query: 149 QELIRVCKPGGYIE 162
           ++  R CKPGGY+E
Sbjct: 205 RQAFRTCKPGGYVE 218



>gi|477520492|gb|ENH72618.1| hypothetical protein FOC1_g10013276 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 351

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 82/170 (48%), Gaps = 20/170 (11%)

Query: 26  KYFFPNFVKD-TDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLL---- 80
           +Y  PN  +    + +  H+L   L  NLF +PI   +    +VLDVG G G W +    
Sbjct: 99  EYVMPNDEQQLQSVDITHHYLTMLLDNNLFLAPIPPHVQ---RVLDVGTGSGIWAMQVSL 155

Query: 81  --DLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSV 138
             D A  Y SA+  G DL P  P+ + P NV F   D   T P+ DN FD++H   +   
Sbjct: 156 PTDFADAYPSAQVIGSDLSPTQPEWVPP-NVHFEIADATLTWPWKDNYFDFIHIRYLFG- 213

Query: 139 FTIEEWFFVIQELIRVCKPGGYIEFSEPEL-------AVKTGPVLSRFYD 181
            ++++W  + QE  R C PGG+++  E ++          + P L ++ D
Sbjct: 214 -SVQDWPALFQEAYRCCAPGGWVQSCEADIHFYSDDGTTDSEPALQKWAD 262



>gi|399170957|emb|CCE28051.1| uncharacterized protein CPUR_01525 [Claviceps purpurea 20.1]
          Length = 342

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 83/163 (50%), Gaps = 13/163 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  + M + H     LF N LF +P+E    +  +VLDVG G G W ++ A  
Sbjct: 71  YFMPNDDQQIETMELCHHYLAILFDNQLFLAPLEKEKTH--RVLDVGTGCGIWAIEFADR 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++ N FD++H  ++  V  I++W 
Sbjct: 129 FPNASVIGTDLSPCQPQWV-PPNVRFEIDDATLEWTWNTNHFDFIHIRHI--VGGIQDWT 185

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRFYD 181
            + QE  R C PGG++E +E ++  ++        P+ + F D
Sbjct: 186 ALFQEAYRCCAPGGWVESAEYDIEFRSDDGTTELEPIFASFKD 228



>gi|399170467|emb|CCE28844.1| uncharacterized protein CPUR_02533 [Claviceps purpurea 20.1]
          Length = 360

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 83/161 (51%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   +  H L   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 90  YFLPNDDQQLETEELCHHCLMILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 147

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D +    YDDN FD++H   +  V  IE+W 
Sbjct: 148 FPNASVVGTDLSPCQPQWV-PPNVCFEIDDAMLEWTYDDNHFDFIHMRYI--VGGIEDWT 204

Query: 146 FVIQELIRVCKPGGYIEF--SEPEL-----AVKTGPVLSRF 179
            + +E  R C PGG++E    EPE      +V+  PVL+ +
Sbjct: 205 DLFKEAYRCCAPGGWVESLEYEPEFRSDDGSVELEPVLASY 245



>gi|399170466|emb|CCE28843.1| uncharacterized protein CPUR_02532 [Claviceps purpurea 20.1]
          Length = 386

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 82/164 (50%), Gaps = 9/164 (5%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVK--DTDIMVIFHFLECYLFQNLFSSPIENSLLNEC 66
           +K H R      +K    YF PN  +  +++ +   HFL   L   LF +P+E    +  
Sbjct: 56  RKIHGR--TYHSDKFTTNYFIPNDDQQLESEQLWSHHFLTILLDDQLFLAPLEKDKTH-- 111

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNT 126
           +VLDVG G G W ++ A  + +A   G DL P  P+ + P NV F   D +    YDDN 
Sbjct: 112 RVLDVGTGSGIWAVEFADQFPNASVIGTDLSPCQPQWVPP-NVCFEIDDAMLEWTYDDNH 170

Query: 127 FDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAV 170
           FD++H   +  V  I++W    +E  R C PGG++E  E E  +
Sbjct: 171 FDFIHMRYI--VGGIQDWTAFFKEAYRCCAPGGWVESLEYEAEI 212



>gi|336470542|gb|EGO58703.1| hypothetical protein NEUTE1DRAFT_144885 [Neurospora tetrasperma
           FGSC 2508]
 gi|350291595|gb|EGZ72790.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 365

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 120/276 (43%), Gaps = 38/276 (13%)

Query: 30  PNFVKDTDIMVIFHFLECYLF---QNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           PN  +  + M I H   CY       LF SP++   +   KV+D+G G G W +D A  +
Sbjct: 95  PNDQRHLESMDIAH--HCYTVCAGGKLFLSPLDTKKVQ--KVVDIGTGTGLWAIDFADEF 150

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
             A   G D+ PI P  + P NV+F   D      + +NTFD+VH   ++ V  +E+W  
Sbjct: 151 PHAEVIGTDITPIQPSWVPP-NVQFELEDCNQEWTWAENTFDFVHLRMLIGV--VEDWHA 207

Query: 147 VIQELIRVCKPGGYIE-------FSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNE 199
           + ++  R CKPGGY+E       F   + +VK G  L ++ +       +      +  E
Sbjct: 208 LFRQAYRTCKPGGYVESFLCSCHFVSDDGSVKPGTALDQWGNVCSQGGKAFGRTFDVYEE 267

Query: 200 -IIKTLVSLSTVRNVDYKISTVTLGA----KKGGNAGQAY-----MDIHDGYFLNDPMPE 249
            + +  +  +   ++D+K   V +G     K     G  +     MD+ +GYF       
Sbjct: 268 DLQRKGMEAAGFVDIDFKDIVVPIGVWHSDKDAAERGLWWKMVLEMDL-EGYF------N 320

Query: 250 TLC-KFMGTTKEGYLKLFKEAKKEVNETFAPNCEIY 284
            +C   +G   E        AKKE N+   PN   Y
Sbjct: 321 YICHSLLGWKPEETQAFCAHAKKEWND---PNIHGY 353



>gi|380088936|emb|CCC13216.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 258

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 72/131 (54%), Gaps = 8/131 (6%)

Query: 43  HFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFP 101
           H + C  + N LF +P+EN      +VLDVGCG G W LD A  +  A+  G D+ PI P
Sbjct: 3   HHMMCLAYDNQLFLAPLENPQ----RVLDVGCGTGIWCLDFAEQFPGAQVTGTDISPIQP 58

Query: 102 KEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYI 161
           + + P N  F   +      + +N FDY+H  +++   +I++W  + +E+IR  KPGG+ 
Sbjct: 59  RWVSP-NCRFEIDNCELEWTFAENEFDYIHIGSLIG--SIQDWPKLYKEIIRALKPGGWF 115

Query: 162 EFSEPELAVKT 172
           E  E  L V+ 
Sbjct: 116 EQREVALPVRA 126



>gi|336470002|gb|EGO58164.1| hypothetical protein NEUTE1DRAFT_101034 [Neurospora tetrasperma
           FGSC 2508]
 gi|350290309|gb|EGZ71523.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 346

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%), Gaps = 7/134 (5%)

Query: 30  PNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  + M IFH L   +    L+++P+   +    K +D+G G G W  D A  +  
Sbjct: 77  PNDARHAEAMDIFHHLNTLILSGKLYTAPLPKKIQ---KAVDIGTGTGIWAFDFADEFPE 133

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P N++F   D+     + DNTF+Y+H  +++ V  +E+W    
Sbjct: 134 AEVIGTDVSPIQPTWV-PPNLKFEIDDLNLEWTWPDNTFEYIHSRSLIGV--VEDWEGFY 190

Query: 149 QELIRVCKPGGYIE 162
           ++  R CKPGGY+E
Sbjct: 191 RQAFRCCKPGGYVE 204



>gi|302908161|ref|XP_003049805.1| hypothetical protein NECHADRAFT_30036 [Nectria haematococca mpVI
           77-13-4]
 gi|256730741|gb|EEU44092.1| hypothetical protein NECHADRAFT_30036 [Nectria haematococca mpVI
           77-13-4]
          Length = 320

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 10/151 (6%)

Query: 21  EKEPLKYFFPNFVKDTDIM---VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGT 77
           ++   +YF PN   D  +    +  H+L   L   LF +PI    +   KVLDVG G G 
Sbjct: 27  DRHSTEYFTPN--DDQQLQSQDITHHYLTVLLGDKLFLAPIAGGDVK--KVLDVGTGSGI 82

Query: 78  WLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLS 137
           W +D A  Y  A   G DL P  P  + P NV+F   D      + DN FD++H   +  
Sbjct: 83  WAIDFADQYPQAEVIGSDLSPCQPSWV-PPNVQFEVDDATQPWTWKDNEFDFIHIRYLFG 141

Query: 138 VFTIEEWFFVIQELIRVCKPGGYIEFSEPEL 168
              I +W  + Q+  R C PGG+++  E ++
Sbjct: 142 --AIADWNAIFQQACRCCAPGGWVQSCEADV 170



>gi|340897429|gb|EGS17019.1| hypothetical protein CTHT_0073450 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 357

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 72/144 (50%), Gaps = 8/144 (5%)

Query: 30  PNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  K  + M +FH +   +  + LF +P+ N      KVLD+G G G W +D    Y +
Sbjct: 84  PNDDKHAESMDLFHIMNTLVLGDKLFLAPVNNPK----KVLDIGTGTGAWAIDFGDLYPN 139

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P NV F   D   T   +DN+FD++H   +  V  I +W    
Sbjct: 140 AEVIGTDITPIQPTWV-PPNVRFEIEDCNQTWAREDNSFDFIHARTL--VGNILDWGKFF 196

Query: 149 QELIRVCKPGGYIEFSEPELAVKT 172
           +E  R  KPGG++E  E E+  K 
Sbjct: 197 REAYRCLKPGGWLENQETEMCWKA 220



>gi|495195997|ref|WP_007920787.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297548703|gb|EFH82570.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 302

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 92/202 (45%), Gaps = 5/202 (2%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           YF P   ++ + +   H        N +  P+   +     +LDVG G G W +++A  +
Sbjct: 43  YFLPKDAQEQNRLNFQHRCLYSAIGNHYLVPLRPDV---TTILDVGTGTGIWPVEMARLF 99

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
             A   G+D+     +    S+  F   DVL  LP+ D  FDYVHQ  +++     +W  
Sbjct: 100 PQAHIVGVDISAASLEFTSSSSYTFCLADVLKGLPFPDQQFDYVHQRLLVAALPATQWPS 159

Query: 147 VIQELIRVCKPGGYIEFSEPELAV-KTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLV 205
           VIQEL+RV +PGG+IE  E  + + + GP  +     +   S  R   + + + + + L 
Sbjct: 160 VIQELVRVTRPGGWIELLEIGVTIQQAGPETTHLLTWMGERSRERGFDMGLMSRLGEMLA 219

Query: 206 SLSTVRNVDYKISTVTLGAKKG 227
               +  ++ +   V LG   G
Sbjct: 220 Q-QGLEAIERQDIPVPLGEWAG 240



>gi|296423088|ref|XP_002841088.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637320|emb|CAZ85279.1| unnamed protein product [Tuber melanosporum]
          Length = 345

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 119/266 (44%), Gaps = 22/266 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN  ++ + +  FH +   L    LF +P+         VLD+G G GTW +++A  
Sbjct: 73  YMLPNDAQEIERLDHFHRIFLALLDGKLFIAPLGQDGHRVRNVLDIGTGTGTWAIEMAEE 132

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           +  A+  G DL  I P    P N EF   DV +   Y +N FD++H  ++   F  ++W 
Sbjct: 133 FPDAKVMGNDLSKIQPS-WAPRNCEFEIDDVESDWTYPENHFDFIHLRSLSGCF--QDWD 189

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTG------PVLSRFYDALVTLSDSRNVKIRISNE 199
            VI+       PGGYIEF + +  +K+G        +SR++  +V+ + S   +  +   
Sbjct: 190 MVIRRCYDHTAPGGYIEFQDYDGNLKSGLGTMPDNAVSRYW-GVVSEAASSTGRTFLVAS 248

Query: 200 IIKTLVSLSTVRNVDYKISTVTLGA-------KKGGNAGQAYMDIHDGYFLNDPMPETLC 252
            I+  +  +   +V  K     LG        K+ G  G+  M      F +      L 
Sbjct: 249 TIEERIKAAGFVDVTVKKEMWPLGPWPKDERLKEIGRLGRTGMRSAVHAFAS----ALLT 304

Query: 253 KFMGTTKEGYLKLFKEAKKEVNETFA 278
           + +G  +    KL +EA +EVN+  A
Sbjct: 305 RVLGWDEMQVQKLCQEATQEVNDGSA 330



>gi|46115986|ref|XP_384011.1| hypothetical protein FG03835.1 [Fusarium graminearum PH-1]
          Length = 372

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (51%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           ++ P +YF PN  + +  + I H  L   L   LF +P++    N  +VLDVG G G W 
Sbjct: 86  DRHPTEYFTPNDEQQSASIDINHQALTLLLGGKLFLAPVKP---NVQRVLDVGTGTGIWA 142

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y  A   G DL PI P  + P NV+F   D      +D+NTFD++H   +    
Sbjct: 143 IDFADEYPEAEVIGSDLSPIQPTWV-PPNVKFEIDDASLRWTWDNNTFDFIHIRYLFGA- 200

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            I++W  + QE  R C   G+I+  E ++ +++
Sbjct: 201 -IKDWTSLFQEAYRCCAADGWIQSGEADVHIRS 232



>gi|475666883|gb|EMT64673.1| hypothetical protein FOC4_g10007354 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 378

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (50%), Gaps = 13/150 (8%)

Query: 26  KYFFPNFVKD-TDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLL---- 80
           +Y  PN  +    + +  H+L   L  NLF +PI   +    +VLDVG G G W +    
Sbjct: 99  EYVMPNDEQQLQSVDISHHYLTMLLDNNLFLAPIPPHV---QRVLDVGTGSGIWAMQVSL 155

Query: 81  --DLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSV 138
             D A  Y SA+  G DL P  P+ + P NV F   D   T P+ DN FD++H   +   
Sbjct: 156 PTDFADAYPSAQVIGSDLSPTQPEWVPP-NVHFEIADATLTWPWKDNYFDFIHIRYLFG- 213

Query: 139 FTIEEWFFVIQELIRVCKPGGYIEFSEPEL 168
            ++++W  + QE  R C PGG+++  E ++
Sbjct: 214 -SVQDWPALFQEAYRCCAPGGWVQSCEADI 242



>gi|320592688|gb|EFX05118.1| methyltransferase type 12 [Grosmannia clavigera kw1407]
          Length = 344

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (53%), Gaps = 7/140 (5%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y+ PN  +  + + ++ H         L  +P+   L N  KV+D+G G G W +D   T
Sbjct: 67  YWGPNDDRQNEALDIMHHAFLLLHDDKLHLAPL---LDNIQKVIDIGTGTGIWAIDFGDT 123

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y +A   G DL PI P  + P NV F+  D   T  +++N+ DYVH   ++    +E+W 
Sbjct: 124 YPNAEVIGTDLSPIQPGWV-PPNVRFQIDDFRQTWLFEENSIDYVHMRWLIGC--VEDWT 180

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            + +E+ RV KPGG+IE SE
Sbjct: 181 ALFREIFRVLKPGGWIETSE 200



>gi|342873344|gb|EGU75532.1| hypothetical protein FOXB_13950 [Fusarium oxysporum Fo5176]
          Length = 358

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 8/130 (6%)

Query: 48  YLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPS 107
           Y + +L  +P+++ +    KVLDVG G G W +D A  Y +A   G D+ PI P  + P 
Sbjct: 108 YWYGSLLKAPLKDDIQ---KVLDVGTGTGIWAIDFADEYPNAEVVGTDISPIQPDWV-PP 163

Query: 108 NVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE-- 165
           N++F   D      Y  N+FDYVH   +    +I +W  + +E  RVCKPGG++E  E  
Sbjct: 164 NLKFEIEDCTQEWTYGPNSFDYVHMRYLYG--SISDWSALFKEAFRVCKPGGWVESYEAS 221

Query: 166 PELAVKTGPV 175
           P +    G V
Sbjct: 222 PRMESDDGTV 231



>gi|336470531|gb|EGO58692.1| hypothetical protein NEUTE1DRAFT_78072 [Neurospora tetrasperma FGSC
           2508]
 gi|350291584|gb|EGZ72779.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 311

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 6/134 (4%)

Query: 30  PNFVKDTDIMVIFHFL-ECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D M I H      +   L+ +P++ + +   KVLD+G G G W +D A  +  
Sbjct: 97  PNDERHIDAMEIAHHAYMVTMGHRLYCAPLDKNKVR--KVLDIGTGSGLWAIDFADEFPE 154

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P+NV F   D      +  NTFD++H A ML V  I++W+   
Sbjct: 155 ADVVGTDVTPIQPSWV-PANVRFELDDCNQEWTWPPNTFDFIH-ARML-VGVIDDWYLFH 211

Query: 149 QELIRVCKPGGYIE 162
           ++  R CKPGGY+E
Sbjct: 212 RQAFRTCKPGGYVE 225



>gi|475671568|gb|EMT68847.1| Phosphoethanolamine N-methyltransferase 3 [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 351

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 76/142 (53%), Gaps = 11/142 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECY---LFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           Y+ PN  +  +   + H  E Y   L  +L+ +PI +S     KVLD+GCG G W ++ A
Sbjct: 80  YWAPNDDRQQEAEDLMH--EVYRIILGNSLYEAPIGDS---PQKVLDIGCGTGIWAIEFA 134

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             + SA   G+DL PI P  + P N  F   D+ N   Y D+TFD++H  +M+    I +
Sbjct: 135 DEHPSADVLGVDLSPIQPNFV-PPNCRFEVDDITNEWTYPDDTFDFIHARSMIGC--IPD 191

Query: 144 WFFVIQELIRVCKPGGYIEFSE 165
           W  + ++  +  KPGG++E  E
Sbjct: 192 WTELYRKAFKHTKPGGWVESVE 213



>gi|477519248|gb|ENH71426.1| Phosphoethanolamine N-methyltransferase 3 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 351

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 76/142 (53%), Gaps = 11/142 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECY---LFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           Y+ PN  +  +   + H  E Y   L  +L+ +PI +S     KVLD+GCG G W ++ A
Sbjct: 80  YWAPNDDRQQEAEDLMH--EVYRIILGNSLYEAPIGDS---PQKVLDIGCGTGIWAIEFA 134

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             + SA   G+DL PI P  + P N  F   D+ N   Y D+TFD++H  +M+    I +
Sbjct: 135 DEHPSADVLGVDLSPIQPNFV-PPNCRFEVDDITNEWTYPDDTFDFIHARSMIGC--IPD 191

Query: 144 WFFVIQELIRVCKPGGYIEFSE 165
           W  + ++  +  KPGG++E  E
Sbjct: 192 WTELYRKAFKHTKPGGWVESVE 213



>gi|159123462|gb|EDP48581.1| methyltransferase, putative [Aspergillus fumigatus A1163]
          Length = 297

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 93/201 (46%), Gaps = 17/201 (8%)

Query: 27  YFFPNFVKDTDIMVI-----FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLD 81
           Y+ PN  +  D + +      H     L   L+ +PI     N   VLD+G G G W +D
Sbjct: 22  YWGPNDERAMDHLDLGQVYHHHLYSLILRGELYLAPISKDPQN---VLDIGTGTGIWAID 78

Query: 82  LAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
            A  + SAR  G DL PI P  + P NV+F   D  +   Y  N+FD++H   +     I
Sbjct: 79  FADRHPSARVIGTDLSPIQP-HLVPPNVQFEVDDCCDEWTYSVNSFDFIHVRGLYGC--I 135

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVKT------GPVLSRFYDALVTLSDSRNVKIR 195
            +W    +E +R  KPG Y+E +E  +  K+      G V  ++ +  +   D+    +R
Sbjct: 136 ADWTLFYKEALRHLKPGAYLEQAEQSVVPKSEDGSTAGTVFEQWGEVSLQAGDAFGKTLR 195

Query: 196 ISNEIIKTLVSLSTVRNVDYK 216
           I +E  + +++   V  V+ +
Sbjct: 196 IIDEAKEMMIAAGFVDVVERR 216



>gi|302917172|ref|XP_003052390.1| hypothetical protein NECHADRAFT_35890 [Nectria haematococca mpVI
           77-13-4]
 gi|256733330|gb|EEU46677.1| hypothetical protein NECHADRAFT_35890 [Nectria haematococca mpVI
           77-13-4]
          Length = 307

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 65/123 (52%), Gaps = 5/123 (4%)

Query: 43  HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPK 102
           H L   L   L  +P+E   ++  + +D+GCG G W +D A  Y +A   G D+ PI P 
Sbjct: 47  HILTLGLGNKLHLAPLEKDKVH--RAIDIGCGTGIWAIDFADDYPNAEITGTDISPIQPS 104

Query: 103 EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
            + P N++F   D      +  N+ DYVH   ++   +I +W F+  E  RVCKPGG++E
Sbjct: 105 WVPP-NLQFEIEDCTREWTFKSNSTDYVHMRWLMG--SIRDWDFLSSEAFRVCKPGGWVE 161

Query: 163 FSE 165
             E
Sbjct: 162 SHE 164



>gi|399170970|emb|CCE28064.1| uncharacterized protein CPUR_01538 [Claviceps purpurea 20.1]
          Length = 321

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (50%), Gaps = 13/163 (7%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  D   +  HFL   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 70  YFIPNDDQQLDSEELCHHFLTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 127

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      ++DN FD++H   +  V  I++W 
Sbjct: 128 FPNASVVGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNDNHFDFIHMRYI--VGGIQDWK 184

Query: 146 FVIQELIRVCKPGGYIEF--SEPELAVKTG-----PVLSRFYD 181
            +++E  R C PGG++E    EPE+    G     PV + + D
Sbjct: 185 ALLKEAYRCCAPGGWVESFEYEPEICSDDGTTELEPVFASYGD 227



>gi|485918769|gb|EOD45328.1| putative tam domain methyltransferase protein [Neofusicoccum parvum
           UCRNP2]
          Length = 319

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 8/141 (5%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN  ++ D + + H +   L +N LF SP+ +      KVLD+G G G W +D A 
Sbjct: 46  QYAFPNDERERDRLDMQHSMMTLLLENKLFWSPLNSP----HKVLDLGTGTGIWAMDFAE 101

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + SA   G DL  I P  ++P N +F   D      +  + FD++H  N   V +I +W
Sbjct: 102 MFPSAEVVGTDLSAIQPSWVQP-NCKFEIDDAEANWTWPPDYFDFIHNRNF--VCSIRDW 158

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
             ++++  R  KPGGY+EF E
Sbjct: 159 PRLVEQCYRHTKPGGYVEFQE 179



>gi|392574791|gb|EIW67926.1| hypothetical protein TREMEDRAFT_63814 [Tremella mesenterica DSM
           1558]
          Length = 341

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 119/277 (42%), Gaps = 27/277 (9%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNL--FSSPIENSLLNEC---KVLDVGCGPGTWLLD 81
           Y  P   K+   +   H+  C LFQ    +  P++  L N     + LDVGCG G W+++
Sbjct: 44  YVLPADQKEMSRLDHQHY-GCKLFQKGKNYVVPMDKVLENRGEGRRGLDVGCGTGVWVIE 102

Query: 82  LAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTI 141
           +A  +  A + G+DL PI      P N+ F   D +  LPY D  FD +H   +     I
Sbjct: 103 MAREFDKAEWVGVDLAPIQTDSDLPDNLTFIHEDAVRGLPYPDEYFDLIHCRVLY--MGI 160

Query: 142 EEWFFVIQELIRVCKPGGYIEFSE-----------PELAVKTGPVLSRFYDALVTLSDSR 190
             W  ++ E+ R+ +PGG   F E            E  +K  P  S+F D L   ++ R
Sbjct: 161 RNWKDLVDEVARLLRPGGMAVFVEVEGRWSLHEKTREEEIKIAPGFSKFCDYLAMATEKR 220

Query: 191 NVKIRIS-NEIIKTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDP--M 247
            + +  +   I+K +    T+ +V+     + L       + + +M       L D   +
Sbjct: 221 GLDVDAAKTNIVKYIRQNGTLEDVEQLRMFIPLSPW----SDEPHMKASGKIMLVDAIEI 276

Query: 248 PETLCKFMGTTKEGYLKLFKEAKKE-VNETFAPNCEI 283
           P+ +   +    E     F+E KK  +++   P+C +
Sbjct: 277 PDAVRHLILDAAEISPSKFEELKKGWIDDVHNPSCHV 313



>gi|85095489|ref|XP_960101.1| hypothetical protein NCU05841 [Neurospora crassa OR74A]
 gi|28921560|gb|EAA30865.1| hypothetical protein NCU05841 [Neurospora crassa OR74A]
          Length = 387

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 71/138 (51%), Gaps = 6/138 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  +++ I H     +F   L++SP+++  L     +D+G G G W +D A 
Sbjct: 111 EYWGPNDAKANELLDIMHAAMVMVFDGKLYTSPLKDEELKNA--IDIGTGTGVWAIDFAD 168

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N  F   D      Y DN FD++H   +  V  +++W
Sbjct: 169 EHPNCNVIGTDISPIQPSWVPP-NASFEINDATREWTYKDNFFDFIHFRWLTGV--MKDW 225

Query: 145 FFVIQELIRVCKPGGYIE 162
             + QE  R CKPGG+IE
Sbjct: 226 DCIYQEAYRCCKPGGWIE 243



>gi|116197022|ref|XP_001224323.1| hypothetical protein CHGG_05109 [Chaetomium globosum CBS 148.51]
 gi|88181022|gb|EAQ88490.1| hypothetical protein CHGG_05109 [Chaetomium globosum CBS 148.51]
          Length = 413

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 72/139 (51%), Gaps = 6/139 (4%)

Query: 28  FFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           + PN  K T+ M I H     L    LF +PI+   ++  KV+D+G G G W +D    +
Sbjct: 98  WTPNDEKHTESMDIHHHACTLLLDGKLFLAPIKGETIS--KVVDIGTGTGIWAIDFGDEF 155

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
            +A   G D+ PI P  I P NV+F   D      + D+TFD+VH   M+   TI +W  
Sbjct: 156 PNAEVIGTDISPIQPTWI-PPNVKFEIDDANLPWTWRDDTFDFVHVRGMIG--TIIDWPA 212

Query: 147 VIQELIRVCKPGGYIEFSE 165
             +E  R CKPGG++E  +
Sbjct: 213 FYREAFRCCKPGGWMEHHD 231



>gi|477528628|gb|ENH80409.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 381

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 79/146 (54%), Gaps = 5/146 (3%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           KY FPN + + D   + H +   L    + +P+++ L    +VLD+G GPG W+L++A  
Sbjct: 100 KYAFPNDLVEQDRDFMKHLISNLLCDKWYLAPVDDILARGAEVLDLGTGPGHWILEVAEW 159

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDV--LNTLPYDDNTFDYVHQANMLSVFTIEE 143
           + +  F G+DL PI P E+ P NV+F   D    N    D+N +D++H  + L   ++ +
Sbjct: 160 FPNTEFLGVDLSPIQPNEV-PPNVQFIVDDFEHENGWALDENFYDFIHLRHTL--HSVRD 216

Query: 144 WFFVIQELIRVCKPGGYIEFSEPELA 169
              +++   R  KPGG+ E  E E +
Sbjct: 217 RQELMERTYRHLKPGGWFEIQELEFS 242



>gi|384483931|gb|EIE76111.1| hypothetical protein RO3G_00815 [Rhizopus delemar RA 99-880]
          Length = 295

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 125/254 (49%), Gaps = 22/254 (8%)

Query: 51  QNLFSSPIENSLLNECKVLDVGCGPGTW----LLDLAATYSSARFFGIDLFPIFPK---- 102
           +++    I+  L +  +VLD+ CGPG W    +LD+A  +  + F+ +D   + P+    
Sbjct: 40  RHIIPPAIKPKLFDGIEVLDINCGPGLWDGHPILDMAQDFVHSSFYLVDTHSLLPQYASV 99

Query: 103 -----EIKPSNVEFRQGDVLNT--LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVC 155
                E +  N  F   + L    LP++ + FD++ Q  M  V+  ++W  +++EL RV 
Sbjct: 100 DTSPGEQRLDNFTFIAHNTLQEKCLPFESDKFDFIQQRLMSFVYKQQDWPVILKELQRVT 159

Query: 156 KPGGYIEFSEPELAVKT-GPVLSRFYDAL-VTLSDSRNVKIRISNEIIKTLVSLSTVRNV 213
           KPGG I+  E E+  +  GP   ++   +   + + R++ +R+++++ + L S + + ++
Sbjct: 160 KPGGCIQLVEVEIPPQNLGPQGEQWLAQVEKVMKEKRDIDVRVTSQLDQIL-SAAGLLDI 218

Query: 214 DYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKEV 273
             K  +V +G+  G + G  +   ++ +F  +     L + M  +   Y +       E+
Sbjct: 219 QTKFVSVPIGS-WGLDIGNLWRQNYELFF--ESAQPILVELMEMSHSEYKRKVDAMMDEL 275

Query: 274 NETFAPNCEIYRIW 287
           NE + P   I+ +W
Sbjct: 276 NE-YKPFSNIHLVW 288



>gi|409082773|gb|EKM83131.1| hypothetical protein AGABI1DRAFT_125607 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 288

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 116/251 (46%), Gaps = 17/251 (6%)

Query: 49  LFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA-ATYSSARFFGIDLFP-IFPK-EIK 105
           L   +  +P+E  L ++  VLD G G G WL DLA  T +  ++ GID+   +FP+    
Sbjct: 41  LNHKILYAPVE--LQDDDWVLDSGTGTGIWLEDLAKVTSTKPKYIGIDIGSNLFPRASTL 98

Query: 106 PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           P N+ F    V+N      N F  VHQ ++++     EW   ++EL RV KPGG+I+  E
Sbjct: 99  PENISFETHSVVNLPKEWTNKFTLVHQRHLIAALRRHEWESAVRELYRVVKPGGWIQMFE 158

Query: 166 PELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAK 225
             +   +GPVL++  D L  LSD  ++ +  S+  IK    L     VD  I   T G  
Sbjct: 159 MRIWT-SGPVLAKHRDLLSKLSD--DLGMMFSDIAIKLPDFLKQSGFVD--IHKDTFGTP 213

Query: 226 KGGNAGQAYMDIHDGY------FLNDPMPETLCKFMGTTKEGYLKLFKEAKKEVNETFAP 279
            G  A +  +D  +        F    +       +G+  E Y +L +E +KEV+ T   
Sbjct: 214 LGAWANRDGIDGKENLLSLFQAFKTPILTGGGYGVVGSEAE-YDELLEEIEKEVDMTPGS 272

Query: 280 NCEIYRIWCQK 290
                  W +K
Sbjct: 273 TTLWTMFWARK 283



>gi|399170478|emb|CCE28855.1| uncharacterized protein CPUR_02544 [Claviceps purpurea 20.1]
          Length = 360

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 79/149 (53%), Gaps = 8/149 (5%)

Query: 27  YFFPN---FVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           YF PN    ++  +I +  HFL   L   LF +P+E + ++  +VLDVG G G W ++ A
Sbjct: 88  YFIPNDDKQLESEEIWLYHHFLTILLDDQLFLAPLEKNKIH--RVLDVGTGSGIWAIEFA 145

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             + +A   G DL P  P+ + P N+ F   D      +D N FD++H   +  V  IE+
Sbjct: 146 DQFPNASIIGTDLSPCQPQWV-PPNLCFEIDDATLEWTWDANHFDFIHMRYI--VGGIED 202

Query: 144 WFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           W  + +E  R C PGG++E  E ++  ++
Sbjct: 203 WTALFKEAYRCCAPGGWVESVEYDVEFRS 231



>gi|296424464|ref|XP_002841768.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638016|emb|CAZ85959.1| unnamed protein product [Tuber melanosporum]
          Length = 320

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 81/161 (50%), Gaps = 18/161 (11%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLF--QNLFSSPIENSLLN 64
           N ++ H  R+         +Y  PN   + + M + H + C L    NL ++PIE+    
Sbjct: 36  NGRRYHGWRQ--------GRYAMPNDEDEQNRMDLQHHV-CLLALDGNLHAAPIEDPR-- 84

Query: 65  ECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDD 124
             ++LD+G G G W +D A  Y  AR  G DL PI P  + P N+ F   D+  T  + D
Sbjct: 85  --RILDLGTGTGIWAIDAADAYPRARVIGTDLSPIQPSLV-PPNLHFEVDDIEETWEFAD 141

Query: 125 NTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           NTF Y+H    L+ F I++W  +  + +R  KPGGY E  +
Sbjct: 142 NTFSYIH-IRQLTGF-IKDWARLYAQALRCLKPGGYFEIQD 180



>gi|429857110|gb|ELA31992.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 352

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 17/163 (10%)

Query: 4   FSNNKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQ-NLFSSPIENSL 62
           F NN++  H  RE +        Y FPN   +     + H +  ++   NL  +P+ N  
Sbjct: 68  FENNRRY-HRYREGR--------YHFPNDDSEQQREFMKHLVMVHMMSGNLHEAPVRNP- 117

Query: 63  LNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPY 122
               KVLDVG G G W +D+   Y  A   GIDL PI+P  + P NV+F   D      +
Sbjct: 118 ---QKVLDVGTGTGVWAIDVGDEYPEAAVTGIDLSPIWPDWVPP-NVKFVVDDAEAEWFH 173

Query: 123 DDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           +  +FD++   NM    +I+EW  +++   +  KPGG+IE  E
Sbjct: 174 EPGSFDFIRLGNMAP--SIQEWPKLLESAYKTLKPGGWIELQE 214



>gi|399166203|emb|CCE32995.1| uncharacterized protein CPUR_06918 [Claviceps purpurea 20.1]
          Length = 403

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 82/163 (50%), Gaps = 6/163 (3%)

Query: 27  YFFPNFVKDTDI-MVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   +  H+L   L   LF +P+E   ++  +VLDVG G G W ++    
Sbjct: 71  YFLPNDDQQLESDKLCHHYLTILLDDKLFLAPLEKEKIH--RVLDVGTGSGVWAIEFGDL 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      +D+N FD++H   +L    I++W 
Sbjct: 129 FPNASVIGTDLSPCQPQWV-PPNVRFEVDDASLEWTWDENHFDFIHIRYILG--GIQDWT 185

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSD 188
            +++E  R C PGG+++ +E +L  ++    +     L T  D
Sbjct: 186 ALLKEAYRCCAPGGWVQSAEIDLDFRSDDGSTELEPVLATYGD 228



>gi|399170468|emb|CCE28845.1| uncharacterized protein CPUR_02534 [Claviceps purpurea 20.1]
          Length = 340

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 80/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +      I H  L   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 70  YFLPNDDQQLKAEEICHHGLTILLDDQLFLAPVEKDKIH--RVLDVGTGSGIWAIEFADQ 127

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      YDDN FD++H   +  V  IE+W 
Sbjct: 128 FPNASVVGTDLSPCQPQWV-PPNVCFEIDDATLEWTYDDNHFDFIHMRYI--VGGIEDWT 184

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRF 179
            + +E  R C PGG++E  E ++  ++        PVL+ +
Sbjct: 185 ALFKEAYRCCAPGGWVESVEYDVEFRSDDGTTELEPVLASY 225



>gi|429859604|gb|ELA34381.1| SAM dependent methyltransferase, putative [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 358

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 83/160 (51%), Gaps = 7/160 (4%)

Query: 14  RREIKKMEKEPLKYFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVG 72
           RR   +   + + Y+ PN  +  + + I H+ +  +L   LF SPI +   N  +VLD+G
Sbjct: 67  RRIQGRTYTQKVDYWGPNDERQNEGLEINHWIMTLFLGDRLFLSPIGD---NPQRVLDLG 123

Query: 73  CGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQ 132
            G G W +D A  + SA  FG+D+ PI PK + P N +F+  D+     + DN F ++H 
Sbjct: 124 TGTGIWAIDFADEFPSAEVFGVDVSPIQPKWV-PINCKFQIDDIEQPWTWPDNHFHFIHI 182

Query: 133 ANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            N+     I  W  + ++      PGGYIE  E ++ +++
Sbjct: 183 GNLEGC--ISNWTDLYKQAFECMAPGGYIEVKEHDIELRS 220



>gi|495196550|ref|WP_007921340.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297549028|gb|EFH82895.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 313

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 20/168 (11%)

Query: 48  YLFQNLFSSPIENSLL-----NECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPK 102
           Y F+ +F     NSL+      E ++LDVG G G W +++A    + + +G+DL    P+
Sbjct: 62  YFFRQVFKG---NSLVPLAFGKESRMLDVGTGTGCWAIEMAEALPNVQVYGLDL--QAPQ 116

Query: 103 EIK---------PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIR 153
           +           P+N  F+ G+VL  LP+ +  F +VHQ  +L+     +W+ V++EL+R
Sbjct: 117 DASARSHRHNHHPANYHFQPGNVLKHLPFREECFAFVHQRFLLASIPPAQWYAVLRELMR 176

Query: 154 VCKPGGYIEFSE-PELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEI 200
           V +PGG+IE  E   + +  GP   +++     L+    + +  S+ +
Sbjct: 177 VTRPGGWIELVEGGTVLLDQGPATRQWFSWWEALAARSGLDLSRSSHL 224



>gi|336467795|gb|EGO55959.1| hypothetical protein NEUTE1DRAFT_117976 [Neurospora tetrasperma
           FGSC 2508]
 gi|350287545|gb|EGZ68781.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 388

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 70/138 (50%), Gaps = 6/138 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  +++ I H     LF   L++SP+ +  +     +D+G G G W +D A 
Sbjct: 112 EYWGPNDDKANELLDIMHAAMVMLFDGKLYTSPLNDKEIKNA--IDIGTGTGVWAIDFAD 169

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N  F   D      Y +N FD++H   +  V  I +W
Sbjct: 170 DHPNCNVIGTDISPIQPSWVPP-NASFEINDASREWTYHENHFDFIHIRWLTGV--IRDW 226

Query: 145 FFVIQELIRVCKPGGYIE 162
            ++ QE  R CKPGG+IE
Sbjct: 227 DYLYQEAYRCCKPGGWIE 244



>gi|495193431|ref|WP_007918221.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297547201|gb|EFH81068.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 306

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 19/197 (9%)

Query: 17  IKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPG 76
           +++  ++ + Y  P  +++ D +   H+      +  F +P+   + +   +LDVG G G
Sbjct: 25  LERRYRDDVPYLLPKDLEEGDRLNFQHYALRLALKGNFVAPLGEQVQH---ILDVGSGTG 81

Query: 77  TWLLDLAATYSSARFFGIDLFPIFPKEIK--------PSNVEFRQGDVLNTLPYDDNTFD 128
            W  ++A  +  A   G+DL P  P+ +         PSN  F QGDVL  LP+   TFD
Sbjct: 82  IWGQEMARQFPHAHIVGLDLEP--PQTVSLSAAATLPPSNYRFLQGDVLKGLPFSAPTFD 139

Query: 129 YVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSD 188
             HQ  ++      +W FV+ EL+RV    G++E  + +     GP + +  DA +    
Sbjct: 140 LTHQRLLVFAIPAAQWPFVLGELVRVTHSQGWVELLDFDGFYSMGPAMEQ-ADAWL---- 194

Query: 189 SRNVKIR-ISNEIIKTL 204
            R+++ R I  +II TL
Sbjct: 195 RRSLQARGIQMDIISTL 211



>gi|500253011|gb|EON96769.1| putative s-adenosyl-l-methionine-dependent methyltransferase
           protein [Togninia minima UCRPA7]
          Length = 189

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 64/120 (53%), Gaps = 6/120 (5%)

Query: 53  LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFR 112
           L+ +P++  +    K +D+GCG G W +D A  +   +  G DL PI P  + P N+EF+
Sbjct: 10  LYRAPLKEGIT---KAVDIGCGTGIWAIDFADEFPECQVIGTDLSPIQPGWV-PPNLEFQ 65

Query: 113 QGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
             D      + DNTFDY+H   M    +I +W  + QE  R CKPGGY E  E  + + +
Sbjct: 66  LDDANEYWTWPDNTFDYIHMRAMFG--SIVDWKALYQEAFRCCKPGGYFEDYENSIKIDS 123



>gi|399164450|emb|CCE34654.1| uncharacterized protein CPUR_08588 [Claviceps purpurea 20.1]
          Length = 340

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 86/179 (48%), Gaps = 15/179 (8%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNE 65
           N +K H R      ++    YFFPN  +  +   I  HFL   L   LF SP+E   ++ 
Sbjct: 52  NYRKIHGR--TYHSDRFTTNYFFPNDDQQLESEEICHHFLTVLLDDQLFLSPLEKDKIH- 108

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            +VLDVG G G W ++ A  + SA   G DL P  P +  P N+ F   D      ++ N
Sbjct: 109 -RVLDVGTGSGIWAIEFADQFPSASVVGTDLSPCQP-QWAPPNICFEIDDATLEWTWNAN 166

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYI-------EFSEPELAVKTGPVLS 177
            FD++H   +  V  I++W    +E  R C PGG++       EFS  + + +  PVL+
Sbjct: 167 HFDFIHMRYI--VGGIQDWTAFFKEAYRCCAPGGWVESMEYECEFSSDDGSTELEPVLA 223



>gi|302916913|ref|XP_003052267.1| hypothetical protein NECHADRAFT_60311 [Nectria haematococca mpVI
           77-13-4]
 gi|256733206|gb|EEU46554.1| hypothetical protein NECHADRAFT_60311 [Nectria haematococca mpVI
           77-13-4]
          Length = 348

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 77/148 (52%), Gaps = 7/148 (4%)

Query: 26  KYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  +  + + +  H L   L   LF +PI +   N  +V+D+G G G W +D A 
Sbjct: 63  EYWGPNDDRQNEGLELSHHMLYLALDNKLFLAPIGD---NPQRVIDIGTGTGIWAIDFAD 119

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + SA   G DL PI P  + P N +F   D     PY DN FDYVH   ++    I++W
Sbjct: 120 QFPSAEVIGTDLSPIQPPWV-PPNCKFELDDAQLPWPYPDNHFDYVHIRVLMGA--IKDW 176

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKT 172
             + +E+ R  KPGG+ E  +  + V++
Sbjct: 177 PALYKEIYRCLKPGGWFEHLDYSIDVRS 204



>gi|399166187|emb|CCE32979.1| uncharacterized protein CPUR_06901 [Claviceps purpurea 20.1]
          Length = 366

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 84/163 (51%), Gaps = 13/163 (7%)

Query: 27  YFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN  +  +   +  H+L+  L   LF +P+E   ++  +VLDVG G G W ++    
Sbjct: 89  YVFPNDDQQLESEELSHHYLKILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFGDQ 146

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      +D+N FD++H   +L    I++W 
Sbjct: 147 FPNASVTGTDLSPCQPQWVPP-NVRFEVDDASLEWTWDENHFDFIHIRYILG--GIQDWT 203

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRFYD 181
            + QE  R C PGG+++  E +L +++        P+L+ + D
Sbjct: 204 ALFQEAYRCCAPGGWVQSVEVDLDLRSDDGSTELEPILASYGD 246



>gi|302881379|ref|XP_003039604.1| hypothetical protein NECHADRAFT_55610 [Nectria haematococca mpVI
           77-13-4]
 gi|256720463|gb|EEU33891.1| hypothetical protein NECHADRAFT_55610 [Nectria haematococca mpVI
           77-13-4]
          Length = 354

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 6/133 (4%)

Query: 40  VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPI 99
           V  H +   L   LF +P++N +    KVLDVG G G W +D A  + SA   G DL PI
Sbjct: 96  VNHHAMLLVLDDKLFLAPLKNDIQ---KVLDVGTGTGIWAIDFADEFPSATVIGTDLSPI 152

Query: 100 FPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGG 159
            P  I P N+ F   D   T  ++ ++FDYVH   +    +I +W  +     RVCKPGG
Sbjct: 153 QPSWIPP-NLTFEIEDCNLTWTFEPDSFDYVHMRYLFG--SITDWNALFSNAYRVCKPGG 209

Query: 160 YIEFSEPELAVKT 172
           ++E  EP +  ++
Sbjct: 210 WVESYEPTVVAES 222



>gi|380489752|emb|CCF36491.1| UMTA [Colletotrichum higginsianum]
          Length = 340

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 85/165 (51%), Gaps = 12/165 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECK 67
           ++ H R   +K++     Y+ PN  +  + + I H+ +  +L   LF SP+  +      
Sbjct: 44  RRLHGRTYTQKVD-----YWGPNDERQNEGLDINHYCMTMFLGDKLFLSPVGKT---SHM 95

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W +D A  + SA   G+D+ PI P  + P N +F+  D+     +  + F
Sbjct: 96  VLDVGTGTGIWAIDFADEFPSAEVIGVDVSPIQPGWV-PPNCKFQIDDIEQPWTWPADYF 154

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           D+VH  N+     + +W  V ++  R  KPGGYIE  E ++ +++
Sbjct: 155 DFVHIRNLEGC--VSDWQAVYEQAYRCTKPGGYIEVKEHDIQIRS 197



>gi|85092357|ref|XP_959354.1| hypothetical protein NCU04906 [Neurospora crassa OR74A]
 gi|28920759|gb|EAA30118.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 321

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 70/136 (51%), Gaps = 10/136 (7%)

Query: 30  PNFVKDTDIMVIFHFLECYLF---QNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           PN  +  + M I H    Y+      L+ +P++ + +   KVLD+G G G W +D A   
Sbjct: 97  PNDERHIEAMEIAH--HAYMLTMGHRLYCAPLDKNKVR--KVLDIGTGSGLWAIDFADEC 152

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
             A   G D+ PI P  + P+NV F   D      +  NTFD++H   +L V  IE+W+ 
Sbjct: 153 PEADVVGTDVTPIQPSWV-PANVRFELDDCNQEWTWPANTFDFIHARMLLGV--IEDWYL 209

Query: 147 VIQELIRVCKPGGYIE 162
             ++  R CKPGGY+E
Sbjct: 210 FHRQAFRTCKPGGYVE 225



>gi|475669176|gb|EMT66938.1| Phosphoethanolamine N-methyltransferase [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 350

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN + + +   + H +  +L    L ++P+++      K++D+G G G+W +D+   
Sbjct: 79  YQFPNDLPEQEREDMKHTVAVHLLGGKLHNAPLDHP----QKIIDIGTGTGSWAIDMGDE 134

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y SA   GIDL PI P  + P NV F   D      Y +N+ D VH  NM +   I++W 
Sbjct: 135 YPSAEVIGIDLSPIQPPWV-PPNVRFLVDDAEAPWLYSENSIDLVHLRNMST--AIKDWP 191

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            ++ ++ R  KPGG+IE  E
Sbjct: 192 ALLGQIYRALKPGGWIELPE 211



>gi|399170469|emb|CCE28846.1| uncharacterized protein CPUR_02535 [Claviceps purpurea 20.1]
          Length = 316

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 82/161 (50%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   I  H+L   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 71  YFLPNDDQQLETEEICHHYLTILLDDQLFLAPLEKDKMH--RVLDVGTGFGIWAIEFADQ 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+EF   D      +D N FD+VH   +  V  I++W 
Sbjct: 129 FPNASVVGTDLSPCQPRWV-PPNLEFEIDDATLEWTWDTNHFDFVHMRYI--VGGIQDWG 185

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRF 179
            + +E  R C PGG++E  E ++  ++        PVL+ F
Sbjct: 186 ALFKEASRCCTPGGWVESIEYDVEFRSDDGTTELEPVLASF 226



>gi|399170486|emb|CCE28863.1| uncharacterized protein CPUR_02553 [Claviceps purpurea 20.1]
          Length = 356

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 6/142 (4%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   +  HFL   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 86  YFIPNDDQQLESEELCHHFLTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 143

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++DN FD++H   +  V  IE+W 
Sbjct: 144 FPNASVVGTDLSPCQPQWVPP-NVCFEIDDATLEWTWNDNHFDFIHMRYI--VGGIEDWT 200

Query: 146 FVIQELIRVCKPGGYIEFSEPE 167
            + +E  R C PGG++E  E E
Sbjct: 201 ALFKEAYRCCAPGGWVESVEYE 222



>gi|429851659|gb|ELA26840.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 338

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 84/165 (50%), Gaps = 12/165 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECK 67
           ++ H R   +K +     Y+ PN  +  + + I H+ +  +L   LF +P+ +S  N   
Sbjct: 62  RRIHGRTYTQKTD-----YWGPNDERQNEGLEINHYWMTLFLGDKLFLAPLGDSPQN--- 113

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W +D A  + SA   G+D+ PI P  + P N +F+  D+     + D+ F
Sbjct: 114 VLDVGTGTGIWAIDFADEFPSADVIGVDISPIQPGWV-PPNCKFQIDDIEQDWTFPDSHF 172

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           D+VH  NM    ++  W    ++     KPGGYIE  E ++  ++
Sbjct: 173 DFVHVRNMEG--SVSNWVDFYKKAFETMKPGGYIEIKEMDIECRS 215



>gi|392587262|gb|EIW76596.1| S-adenosyl-L-methionine-dependent methyltransferase [Coniophora
           puteana RWD-64-598 SS2]
          Length = 284

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 78/154 (50%), Gaps = 8/154 (5%)

Query: 42  FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFP-IF 100
           +  L+     N+  +P+  SL +E +VLD GCG   W+ D++  +   +  GID+   +F
Sbjct: 37  YKILKKSFGNNVLYTPV--SLSSEAEVLDSGCGTEAWVKDMSHVFPLVKIIGIDMSTNLF 94

Query: 101 PKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGY 160
           P+    +N+ F +  +L+      N FD VHQ+ + S  TI EW   + E++RV KPGG 
Sbjct: 95  PQ--NSANITFLKHSILSLPRTWTNKFDLVHQSVLFSALTISEWPIALAEILRVTKPGGS 152

Query: 161 IEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKI 194
           ++  EP   ++        Y     L  +RN+ I
Sbjct: 153 VQLMEPVFGIRAD---RHMYHVANALGRARNLLI 183



>gi|342881065|gb|EGU82047.1| hypothetical protein FOXB_07450 [Fusarium oxysporum Fo5176]
          Length = 350

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN + + +   + H +  +L    L ++P+++      K++D+G G G+W +D+   
Sbjct: 79  YQFPNDLPEQEREDMKHTVAVHLLGGKLHNAPLDHP----QKIIDIGTGTGSWAIDMGDE 134

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y SA   GIDL PI P  + P NV F   D      Y +N+ D VH  NM +   I++W 
Sbjct: 135 YPSAEVIGIDLSPIQPPWV-PPNVRFLVDDAEAPWLYSENSIDLVHLRNMST--AIKDWP 191

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            ++ ++ R  KPGG+IE  E
Sbjct: 192 ALLGQVYRALKPGGWIELPE 211



>gi|511001982|gb|EPB83433.1| hypothetical protein HMPREF1544_09817 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 341

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 84/161 (52%), Gaps = 11/161 (6%)

Query: 29  FPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLN-ECKVLDVGCGP-GTWLLDLAATY 86
           FP+   + +     H+L  ++FQ  + +PI++ L       LD+GCG   +WL+D+A  +
Sbjct: 52  FPSTTLEANRQQGEHYLLKHVFQTSYFAPIDDILSKPNTACLDIGCGTHASWLIDVANDF 111

Query: 87  SSARFFGIDL---FPIFPKEIK-----PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSV 138
            +  F G D+   F +   E       PSN E ++ D+ +   Y D TFDY HQ  M  +
Sbjct: 112 PNCTFHGFDVIQPFALNENEADVAFHIPSNCEIKKHDLFDGFGYPDCTFDYTHQRTMHLI 171

Query: 139 FTIEEWFFVIQELIRVCKPGGYIEFSEPELAVK-TGPVLSR 178
           +  ++  ++  EL+RV K  G+IE  EPE+  K  GP+  +
Sbjct: 172 YHSDKVSWMFTELMRVTKENGWIELVEPEVMPKRAGPIFGK 212



>gi|429856986|gb|ELA31874.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 341

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 76/146 (52%), Gaps = 5/146 (3%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           KY FPN + + D   + H +   L    + SP+++ L    +VLD+G GPG W+L++A  
Sbjct: 100 KYAFPNDLVEQDRDFMKHLISNLLCDRWYLSPVDDVLARGGEVLDLGTGPGHWVLEVAEW 159

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDV--LNTLPYDDNTFDYVHQANMLSVFTIEE 143
           +  + F GIDL PI P E+ P NV F   D    N    D+  +D++H  + L   ++ +
Sbjct: 160 FPDSTFLGIDLSPIQPSEV-PPNVHFMVDDFEHENGWALDEEFYDFIHLRHTL--HSVRD 216

Query: 144 WFFVIQELIRVCKPGGYIEFSEPELA 169
              ++    R  KPGG+ E  E E +
Sbjct: 217 RMELMNRAYRHLKPGGWFEIQELEFS 242



>gi|392574788|gb|EIW67923.1| hypothetical protein TREMEDRAFT_63811 [Tremella mesenterica DSM
           1558]
          Length = 359

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 54  FSSPIENSLLNECK---VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVE 110
           + +PI   L N  K   VLDVG G G W  ++A  + +A   G+DL P +     P NVE
Sbjct: 85  YLAPIPAYLPNAGKDKSVLDVGTGSGAWPCEIAQEFPNAEVIGVDLAPTWNDNDLPDNVE 144

Query: 111 FRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGG 159
           F+QGD+   LP+ D  FD VH   +  V  I +W   I E+IR+ KPGG
Sbjct: 145 FQQGDITAGLPFPDGRFDVVHGRTL--VAGIRDWPQYINEMIRLVKPGG 191



>gi|302890947|ref|XP_003044356.1| hypothetical protein NECHADRAFT_45657 [Nectria haematococca mpVI
           77-13-4]
 gi|256725279|gb|EEU38643.1| hypothetical protein NECHADRAFT_45657 [Nectria haematococca mpVI
           77-13-4]
          Length = 323

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 75/147 (51%), Gaps = 6/147 (4%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YFFPN  +  + M +  H+L   L  +LF +P++   L    VLDVG G G W ++ A  
Sbjct: 50  YFFPNDDQQLESMDMTHHYLSLLLNDDLFLAPLKADKLQ--NVLDVGTGTGIWAIEFADR 107

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y +A   G DL P  P  + P NV F   D      ++DN FD++H   +     I++W 
Sbjct: 108 YPNAEVTGTDLSPCQPTWV-PPNVRFEIDDATQPWTWNDNHFDFIHLRYLFGA--IKDWG 164

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT 172
            + +E  R   PGG+++  E ++  ++
Sbjct: 165 ALFKEAYRCAAPGGWVQTVEADIEFRS 191



>gi|85087907|ref|XP_957841.1| hypothetical protein NCU04904 [Neurospora crassa OR74A]
 gi|28919011|gb|EAA28605.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 370

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 115/267 (43%), Gaps = 33/267 (12%)

Query: 28  FFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           + PN  +  + M IFH  +   L   L+ SP++   ++  KVLDVG G G W +D A  Y
Sbjct: 98  YEPNDQRHVEAMEIFHHAMLVQLDGKLYLSPLDKKRIH--KVLDVGTGSGLWAIDFADEY 155

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
            +    G D+ PI P  + P NV+F   D      Y +N+FD++H   +  V  + +W  
Sbjct: 156 PNTEVIGTDVSPIQPSWV-PPNVKFEIDDCNLDWTYAENSFDFIHMRMLAGV--VNDWDK 212

Query: 147 VIQELIRVCKPGGYIE-------FSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRI-SN 198
           + +   R CKPGGY+E       F   + +VK G  + ++   L            +  +
Sbjct: 213 LFRNAFRCCKPGGYVESIGSSIHFLSDDGSVKEGTAMHQWGKVLGEAGKKLGRPFNVYED 272

Query: 199 EIIKTLVSLSTVRNVDYKISTVTLGA----KKGGNAGQAY-------MDIHDGYFLNDPM 247
           ++ +  +  +   ++++K     LG     KK    G  Y       ++ +  Y LN   
Sbjct: 273 DLQRKGMEAAGFVDIEFKDIQCPLGVWHPEKKAAERGLWYKLAIEEDLEGYLNYLLN--- 329

Query: 248 PETLCKFMGTTKEGYLKLFKEAKKEVN 274
                  MG T E   +    AKKE N
Sbjct: 330 -----VVMGWTPEETKRFAAHAKKEWN 351



>gi|384493124|gb|EIE83615.1| hypothetical protein RO3G_08320 [Rhizopus delemar RA 99-880]
          Length = 326

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (52%), Gaps = 3/144 (2%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSL-LNECKVLDVGCGPGTWLLDLA 83
           +K   PN   D +   + H      F+N F +PIE  L     +VLD+GCG G W  D+A
Sbjct: 31  MKPRLPNTADDIERDWVRHNALRLAFENDFKAPIERLLQAGGSEVLDIGCGAGFWTADMA 90

Query: 84  ATYSSARFFGIDLFP-IFPKEIKPSNVEFRQGDVLN-TLPYDDNTFDYVHQANMLSVFTI 141
           A +  + F GID+   + P      N+  ++ D++   LPY+D TFDY+   +ML+    
Sbjct: 91  ARFPFSYFIGIDIDKNVLPTSPCGRNILHQRIDLIELPLPYEDATFDYIFVRSMLNTMPD 150

Query: 142 EEWFFVIQELIRVCKPGGYIEFSE 165
           + W  V++E IR+ K G YIE  E
Sbjct: 151 QLWDDVLKEFIRIMKKGAYIECVE 174



>gi|429856167|gb|ELA31092.1| SAM dependent methyltransferase, putative [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 327

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 86/177 (48%), Gaps = 19/177 (10%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLEC-YLFQNLFSSPIENSLLNECKVLD 70
           H R   +K E     Y+ PN  K T+ +   HF +  Y    L  +PI +S      VLD
Sbjct: 37  HGRTYSQKTE-----YWAPNDNKQTEALDFNHFWQLDYFGGRLTMAPIGDS---PHHVLD 88

Query: 71  VGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYV 130
           VG G G W +D A TY SA   G+D+ PI P  I P NV+F+  D      + +N FD+V
Sbjct: 89  VGTGTGIWAIDFADTYPSAEVIGVDISPIQPSWI-PPNVKFQIDDFELDWTFRENFFDFV 147

Query: 131 HQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGP-------VLSRFY 180
           H  N+ +   + +W  +  +     KPGGYIE  + ++  ++         + SR+Y
Sbjct: 148 HIRNLEAA--VADWPKLYSQAFTHTKPGGYIEVKQIDIKTRSQTIELTYDHIFSRWY 202



>gi|336268312|ref|XP_003348921.1| hypothetical protein SMAC_01942 [Sordaria macrospora k-hell]
 gi|380094180|emb|CCC08397.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 401

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 69/138 (50%), Gaps = 6/138 (4%)

Query: 26  KYFFPNFVKDTDIMVIF-HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  D + I+ H     L + L  +PI+   +     +D+G G G W +D A 
Sbjct: 125 EYWGPNDSKHIDALDIYYHGAWLMLGEKLHQAPIKGDEIKH--AVDIGTGSGLWAIDFAD 182

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y++    G D+ PI P    P N++F+  D      +  N FDYVH   M    +I +W
Sbjct: 183 KYTTCAVIGTDISPIQPGWC-PPNLDFQIDDATKPWTFKGNHFDYVH--IMFMNGSIADW 239

Query: 145 FFVIQELIRVCKPGGYIE 162
             + QE  R CKPGG+IE
Sbjct: 240 DAIYQEAYRCCKPGGWIE 257



>gi|296425053|ref|XP_002842058.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638315|emb|CAZ86249.1| unnamed protein product [Tuber melanosporum]
          Length = 351

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 101/211 (47%), Gaps = 16/211 (7%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY  PN   + D + I H +   L    LF +PI + +    ++LDVG G G W +D   
Sbjct: 74  KYLIPNDEAEQDRLDIIHHVFLLLLDGKLFRAPIGDDI---QRILDVGTGTGIWAMDAGE 130

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y +A   G DL PI P  + P NV F+  D  +   +  N+FD +H  ++     I++W
Sbjct: 131 AYPAAEVIGTDLSPIQPSWV-PPNVSFQIDDAESDWTFGSNSFDLIHIRHLNG--GIKDW 187

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRFYDALVTLSDSRNVKIRIS 197
             +I +  +  KPGG+++ +E E  +++          L ++Y+ +   +D    + +I+
Sbjct: 188 RKLIGQAFKALKPGGWLDIAEYECFLRSDDGSLSAESSLFKYYELVNEAADKMGQEFKIA 247

Query: 198 NEIIKTLV--SLSTVRNVDYKISTVTLGAKK 226
             + + ++      VR+ + K+   T  A K
Sbjct: 248 ASLDQFILDAGFDKVRHEEMKVPLGTWPADK 278



>gi|336470530|gb|EGO58691.1| hypothetical protein NEUTE1DRAFT_59387 [Neurospora tetrasperma FGSC
           2508]
 gi|350291583|gb|EGZ72778.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 352

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 6/134 (4%)

Query: 30  PNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D + I H     +    L+ +P++   +   KV+D+G G G W +D A  + +
Sbjct: 82  PNDERHKDALDIAHHAYTVVMDGKLYMAPLDKKKVQ--KVVDIGTGTGLWAIDFADEFPN 139

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
               G D+ PI P  I P+NV+F   D      + DNTFD+VH   M  +  IE+W  + 
Sbjct: 140 TEVIGTDITPIQPSWI-PANVKFELDDCNREWTWPDNTFDFVHLRMMFGL--IEDWEALF 196

Query: 149 QELIRVCKPGGYIE 162
           ++  R CKPGGY E
Sbjct: 197 RQAYRTCKPGGYTE 210



>gi|477531650|gb|ENH83357.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 336

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 84/162 (51%), Gaps = 12/162 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECK 67
           ++ H R   +K E     Y+ PN  +  + + + H+ E   F + LF +PI +S     +
Sbjct: 58  RRIHGRTYTQKAE-----YWGPNDARQNEGLELTHYWETLFFDDKLFLAPIGDS---PQQ 109

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W +D A  + S+   G+D+ PI P  + P N +F+  D+     + ++ F
Sbjct: 110 VLDVGTGTGIWAIDFADEFPSSEVIGVDISPIQPGWV-PPNCKFQIDDIEQPWTWSEDFF 168

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELA 169
           DY+H  ++ +  +I +W  +  +     KPGGYIE  E E+ 
Sbjct: 169 DYIHIRHLEA--SIADWPALYAQAFEHLKPGGYIEIKEFEVG 208



>gi|399170476|emb|CCE28853.1| uncharacterized protein CPUR_02542 [Claviceps purpurea 20.1]
          Length = 330

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 6/147 (4%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YFFPN  +  + M +  H+    L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 60  YFFPNDDQQLESMELCHHYFTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 117

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      + +N FD++H   +  V  I++W 
Sbjct: 118 FRNASVIGTDLSPCQPQWV-PPNVSFEIDDATLDWTWSENHFDFIHMRYI--VGGIQDWT 174

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT 172
            + +E  R C PGG++E  E ++  ++
Sbjct: 175 ALFKEAYRCCAPGGWVESIEYDVEFRS 201



>gi|399170949|emb|CCE28043.1| uncharacterized protein CPUR_01517 [Claviceps purpurea 20.1]
          Length = 340

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 81/147 (55%), Gaps = 6/147 (4%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y +PN  +  +   + H     LF++ LF +P+EN  ++  +VLD+G G G W ++LA  
Sbjct: 69  YLYPNDEQQLESGRLNHHYLTILFEDQLFLAPLENDKIH--RVLDIGTGSGIWAIELADQ 126

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV+F   D      ++ N FD++H   +L    I++W 
Sbjct: 127 FPNASVIGTDLSPCQPQWV-PPNVQFEVDDATLQWTWNANHFDFIHLRYILG--GIQDWT 183

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT 172
            +++E  + C PGG++E  E ++  ++
Sbjct: 184 GLLKEAYKCCAPGGWVESVECDIEFRS 210



>gi|336273335|ref|XP_003351422.1| hypothetical protein SMAC_07621 [Sordaria macrospora k-hell]
 gi|380089217|emb|CCC12776.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 386

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 7/146 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  +++ IFH     LF + L+++P+   + N    LDVG G G W +D A 
Sbjct: 109 EYWGPNDEKANEVLDIFHHAMTLLFDDRLYTAPLSKDIEN---ALDVGTGTGLWAIDFAD 165

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + + R  G D+ PI P  + P N+ F   D      +  + FDY+H   +    TI++W
Sbjct: 166 EFPNCRVVGTDISPIQPSWVPP-NLSFNIDDATKEWAFQPDLFDYIHIRWLCG--TIKDW 222

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAV 170
             + +E  R  KPGG+IE  + ++ V
Sbjct: 223 PSLYKEAYRCTKPGGWIEHVDGDVNV 248



>gi|171676722|ref|XP_001903313.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936428|emb|CAP61085.1| unnamed protein product [Podospora anserina S mat+]
          Length = 385

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 73/155 (47%), Gaps = 8/155 (5%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECK 67
           +K H R        + ++Y+ PN     D + I  H L   L   LF +P    L    +
Sbjct: 94  RKLHGRTYHNFGGADKVEYWAPNDDAQNDQLDINHHLLNLALDNKLFFAP----LSKPTR 149

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W +D A  +      GIDL PI P  + P N +F   D      + DN F
Sbjct: 150 VLDVGTGTGMWAIDFADEFPDCEVTGIDLSPIQPTWV-PPNCKFELDDASQPWTFPDNHF 208

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
           DY+H   M+  F  ++W  V +E  R  KPGG+IE
Sbjct: 209 DYIHFRYMIGCF--KDWPAVYREAYRCLKPGGWIE 241



>gi|85092365|ref|XP_959358.1| hypothetical protein NCU04910 [Neurospora crassa OR74A]
 gi|28920763|gb|EAA30122.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 365

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (50%), Gaps = 15/159 (9%)

Query: 30  PNFVKDTDIMVIFH--FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYS 87
           PN  +  + M I H  F  CY  + LF SP+    +   KV+D+G G G W +D A  + 
Sbjct: 95  PNDERHLESMDIAHHCFTVCYGGK-LFLSPLNTKKVQ--KVVDIGTGTGLWAIDFADEFP 151

Query: 88  SARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFV 147
                G D+ PI P  + P NV+F   D      + DNTFD+++   ++ V  +E+W+ +
Sbjct: 152 HVEVIGTDITPIQPSWV-PPNVQFELEDCNQEWTWADNTFDFINIRMLIGV--VEDWYAL 208

Query: 148 IQELIRVCKPGGYIE-------FSEPELAVKTGPVLSRF 179
            ++  R CKPGGY+E       F   + ++K G  L ++
Sbjct: 209 FRQAYRTCKPGGYVESFVCSCHFVSDDGSIKPGTALDQW 247



>gi|399164030|emb|CCE35189.1| uncharacterized protein CPUR_02120 [Claviceps purpurea 20.1]
          Length = 344

 Score = 82.8 bits (203), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 79/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN  +  +   + H +   LF + LF +P+E   +N  +VLDVG G G W ++ A  
Sbjct: 73  YHIPNDDQQIESEELGHHMMTMLFDDQLFLAPLEKDKIN--RVLDVGTGSGIWAIEFADR 130

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++DN FD++H   +     I++W 
Sbjct: 131 FPNASVIGTDLSPSQPQWVPP-NVRFEIDDATLDWTWNDNHFDFIHARYLFG--GIQDWA 187

Query: 146 FVIQELIRVCKPGGY-------IEFSEPELAVKTGPVLSRF 179
              +E  R C PGG+       IEF   + + +  PVL+ +
Sbjct: 188 GFFKEAYRCCAPGGWVQSAECDIEFRSDDGSTELEPVLASY 228



>gi|296423617|ref|XP_002841350.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637587|emb|CAZ85541.1| unnamed protein product [Tuber melanosporum]
          Length = 366

 Score = 82.8 bits (203), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 81/159 (50%), Gaps = 16/159 (10%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNEC 66
           N ++ H+ RE          Y  PN   ++D + + H +   LF  L  +P++N      
Sbjct: 86  NGRRYHAFREGA--------YVLPNDEAESDRLDLQHQMLTLLF-GLHRAPLQNP----Q 132

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNT 126
           K+LD+G G G W +++A  + S+   G DL PI P  + P N+ F   D  +   Y  N+
Sbjct: 133 KILDIGTGTGIWAVEMADKFPSSEVIGNDLSPIQPSWVPP-NLRFEIDDAESDWAYKLNS 191

Query: 127 FDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           FDY+H   M+   +I++W  ++++     KPGGY+E  E
Sbjct: 192 FDYIHTRYMIG--SIQDWPKLLRQAYDFSKPGGYVELQE 228



>gi|399170951|emb|CCE28045.1| uncharacterized protein CPUR_01519 [Claviceps purpurea 20.1]
          Length = 341

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 27  YFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN  +  + + +  H L   L   LF +P+E + ++  +VLDVG G G W +D A  
Sbjct: 71  YIFPNDDQQLESVELSHHALTILLDDQLFLAPLEKNKIH--RVLDVGTGSGIWAIDFADQ 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           +  A   G DL P  P+ + P NV F   D      ++ N FD++H   +L    I++W 
Sbjct: 129 FPHASVIGTDLSPCQPRWV-PPNVRFEIDDATLDWTWNANHFDFIHIRYILG--GIQDWT 185

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT 172
             ++E  R C PGG++E +E ++ +++
Sbjct: 186 AFLREAYRCCAPGGWVESTEYDVELQS 212



>gi|46109724|ref|XP_381920.1| hypothetical protein FG01744.1 [Fusarium graminearum PH-1]
          Length = 375

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 77/158 (48%), Gaps = 9/158 (5%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECY-LFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+ PN       M I H L C  L   L  +P+++ +     VLDVG G GTW 
Sbjct: 97  ERGNAQYWSPNDEHHNASMDIVHHLLCLSLDGKLHLAPLKDDIQT---VLDVGTGTGTWA 153

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y +A   G D+ PI P  I P N++F   D      +  + FD+VH   +    
Sbjct: 154 IDFADEYPNAEVIGTDISPIQPDWIPP-NLKFEIEDCTQEWTFQPDFFDFVHMRYLYG-- 210

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE--PELAVKTGPV 175
           +I +W  + +E  R C+PGG++E  E  P +    G V
Sbjct: 211 SISDWPALFKEAYRACRPGGWVESHEASPRMESDDGSV 248



>gi|452841085|gb|EME43022.1| hypothetical protein DOTSEDRAFT_72425 [Dothistroma septosporum
           NZE10]
          Length = 331

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 80/144 (55%), Gaps = 8/144 (5%)

Query: 26  KYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY  PN   + + M + +H +   L +  F +PI+   +    +LD+G G G W +D+A 
Sbjct: 57  KYVMPNDESEQERMDITYHSIRLTLEEQHFVAPIQKPRM----ILDIGTGTGIWAIDVAD 112

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            +  A+  G DL PI P  + P N+EF+  D   T  + +  FD+VH + +++ F+++ W
Sbjct: 113 DFPHAQVIGTDLSPIQPTAV-PPNLEFQIADADETWTF-NQQFDFVH-SRLINGFSVKSW 169

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
            F  ++  +V +PGG++E  E +L
Sbjct: 170 EFFYEQAFKVLQPGGWVENQEFDL 193



>gi|388851535|emb|CCF54725.1| uncharacterized protein [Ustilago hordei]
          Length = 1110

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 63/106 (59%), Gaps = 6/106 (5%)

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFP--KEIKPSNVEFRQ----GDVLNT 119
           C+VLD+GCG G W LD+A  + ++ F G+D+ PI P  +E++ +++E R      ++L  
Sbjct: 370 CRVLDLGCGRGVWCLDMAREWKTSEFVGLDIVPIQPPLQELEDADLEHRVSWVIANLLEP 429

Query: 120 LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           LP+ D +FDYVH   +L     ++W  +  E  R+  PGG +E  E
Sbjct: 430 LPFPDASFDYVHIRFILQGVPEDKWVDIFSEARRILAPGGVLEVVE 475



>gi|340514160|gb|EGR44427.1| predicted protein [Trichoderma reesei QM6a]
          Length = 311

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 68/130 (52%), Gaps = 5/130 (3%)

Query: 43  HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPK 102
           H L   L   LF +P++   +   K LD+G G G W +D A  Y  A+  G D+ PI P 
Sbjct: 51  HVLSMALGDKLFMAPLKKEDVK--KALDIGTGTGIWAIDFADEYPDAQVIGTDISPIQPT 108

Query: 103 EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
            + P N++F   D      + +  FDYVH   +L   +I++W  ++Q+  RV KPGG++E
Sbjct: 109 WV-PPNLQFEIEDCTQEWTFRNEDFDYVHMRWLLG--SIQDWDALLQQAYRVLKPGGWVE 165

Query: 163 FSEPELAVKT 172
             E    V++
Sbjct: 166 SLETSAIVRS 175



>gi|384494154|gb|EIE84645.1| hypothetical protein RO3G_09355 [Rhizopus delemar RA 99-880]
          Length = 193

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (60%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y  P   ++ D + + HF+  +  Q  + +P+ + L    KVLDVGCGPGTW +++A  Y
Sbjct: 101 YLLPCDEEEVDRLHLQHFMIRFAIQGNYLAPVHDLLRKGSKVLDVGCGPGTWSMEIAGEY 160

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQ 113
             +   GID+ P+FP+EIKPSN  F Q
Sbjct: 161 PKSTVIGIDMTPLFPREIKPSNCAFYQ 187



>gi|399170485|emb|CCE28862.1| uncharacterized protein CPUR_02552 [Claviceps purpurea 20.1]
          Length = 340

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 80/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   +  HF    L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 70  YFMPNDDQQLESEDLCHHFSTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 127

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++DN FD++H   +  V  IE+W 
Sbjct: 128 FPNASVIGTDLSPCQPQWV-PPNVCFEIDDATLEWTWNDNHFDFIHVRYI--VGGIEDWT 184

Query: 146 FVIQELIRVCKPGGY-------IEFSEPELAVKTGPVLSRF 179
            + +E  R C PGG+       +EF   + + K  P+L+ F
Sbjct: 185 ALFKEAYRCCAPGGWVESLEYDVEFRSDDGSTKLEPILASF 225



>gi|429859026|gb|ELA33824.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 287

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 81/160 (50%), Gaps = 16/160 (10%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYL-FQNLFSSPIENSLLNE 65
           NK++ H  +E         +Y FPN   + +   + H +  +L   +L ++P++N     
Sbjct: 75  NKRRYHKFKE--------GRYLFPNDDLEQEREDMKHAMILHLCGGSLHNAPLKNPQ--- 123

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            ++LD+G G G W +D+   Y  A   GIDL PI P E  P NV F   DV     Y +N
Sbjct: 124 -RILDIGTGTGIWAIDMGDEYPEAEVTGIDLSPIQP-EYVPPNVSFIVDDVEAEWLYPEN 181

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           + DY+H  +M     I+ W  ++ E  RV KPGG+IE  +
Sbjct: 182 SIDYIHLRHMAPA--IKNWPKLLTEAHRVLKPGGWIELQD 219



>gi|393238105|gb|EJD45643.1| hypothetical protein AURDEDRAFT_113983 [Auricularia delicata
           TFB-10046 SS5]
          Length = 824

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFP------KEIKPSNVEFRQGDVLNTL 120
           KVLD+GCG GTW++D A  +  +RF G+D+ P+ P       +I P  V++ Q + L  L
Sbjct: 184 KVLDLGCGTGTWVMDCARLWKESRFVGLDIVPLQPDLHLLGSDIAP-RVKWVQANFLERL 242

Query: 121 PYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPEL 168
           P+DD  FD+VH   +       +W ++++E+ RV K GG  E  E +L
Sbjct: 243 PFDDEEFDFVHVRRIARGVPETKWDYLLEEITRVLKKGGAFEIVEEDL 290



>gi|429856166|gb|ELA31091.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 311

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 86/165 (52%), Gaps = 12/165 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECK 67
           ++ H R   ++ E     Y+ PN  + ++ +   HF     F+  LF +P+++   +  +
Sbjct: 4   REIHGRTYTQRSE-----YWGPNDERQSEALDFNHFWITDFFEGRLFHAPVDD---HPQR 55

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           +LD+G G G W +D+A  Y SA   G+DL PI P  + P N++F+  D      +  + F
Sbjct: 56  ILDMGTGTGIWAIDMADQYPSAEVTGVDLSPIQPTWV-PPNLKFQIDDFNQEWTWPKDHF 114

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           DY+H  N+ + FT  +    ++E     KPGGYIEF E E   ++
Sbjct: 115 DYIHGRNLEACFT--DLPTTMKEAYNHTKPGGYIEFLEFESQARS 157



>gi|367048749|ref|XP_003654754.1| hypothetical protein THITE_2079292 [Thielavia terrestris NRRL 8126]
 gi|347002017|gb|AEO68418.1| hypothetical protein THITE_2079292 [Thielavia terrestris NRRL 8126]
          Length = 355

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 81/160 (50%), Gaps = 11/160 (6%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNE 65
           N +K H R        E  +Y+ PN  +    + + H +    F++ L+ +P+EN     
Sbjct: 64  NYRKLHGR---TYQNYEGAEYWGPNDDRQNKGLDMAHHMMYLAFEDKLYLAPLENPQ--- 117

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            KVLDVG G G W +D A  + SA   G DL PI P  + P N +F   +      Y +N
Sbjct: 118 -KVLDVGTGTGIWAIDFADEHPSAEVIGTDLSPIQPAWV-PPNCKFELDNCEQPWTYAEN 175

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           +FDY+H   +  V  +++W  + ++ +R  KPGG++E  E
Sbjct: 176 SFDYIHIRGL--VGCVQDWEALYRQCLRCLKPGGWLEQHE 213



>gi|399167618|emb|CCE31633.1| uncharacterized protein CPUR_05486 [Claviceps purpurea 20.1]
          Length = 342

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 83/163 (50%), Gaps = 13/163 (7%)

Query: 27  YFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN  +  +   + H+ ++  L   LF +P+E   ++  +VLDVG G G W ++LA  
Sbjct: 71  YIIPNDDQQLESEELCHYYMKILLDDKLFLAPLEEDKIH--RVLDVGTGSGIWAIELADR 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G D+FP  P  + P NV F   D      +D N FD++H  ++++   I+ W 
Sbjct: 129 FPNASVIGTDIFPCQPHWV-PPNVRFEIDDATLEWTWDANHFDFIHIRHIMA--GIQGWT 185

Query: 146 FVIQELIRVCKPGGYIE-------FSEPELAVKTGPVLSRFYD 181
            + +E  R C PGG+++       F   + + +  PVL+ + D
Sbjct: 186 ALFKEAYRCCAPGGWVQSVEIDADFRSDDGSTRLEPVLASYGD 228



>gi|302917997|ref|XP_003052562.1| hypothetical protein NECHADRAFT_14795 [Nectria haematococca mpVI
           77-13-4]
 gi|256733502|gb|EEU46849.1| hypothetical protein NECHADRAFT_14795 [Nectria haematococca mpVI
           77-13-4]
          Length = 318

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 81/160 (50%), Gaps = 15/160 (9%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYL-FQNLFSSPIENSLLNE 65
           N ++ HS RE          Y FPN   + +   + H +   L  QNL  +PI +   + 
Sbjct: 31  NGRRYHSFREGT--------YNFPNDDVEQEREDMKHAMVKLLCSQNLHFAPIGD---HP 79

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            ++LD+G G G W +++   YSSA   GIDL PI P  + P NV F   DV +   +  N
Sbjct: 80  QEILDIGTGTGIWAIEMGDQYSSANVLGIDLSPIQPDWLPP-NVRFMVDDVESPWLHPRN 138

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
            FDY+H  +  +V  +++W  + Q  +   KPGG+IE  E
Sbjct: 139 HFDYIHSRH--TVMAVKDWPRLFQRALEHLKPGGWIELQE 176



>gi|399166568|emb|CCE32551.1| uncharacterized protein CPUR_06411 [Claviceps purpurea 20.1]
          Length = 341

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 99/219 (45%), Gaps = 17/219 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECK 67
           +K H R      +K    YF PN  +  + + +I H L   L   LF +P+E   LN  +
Sbjct: 54  RKLHGR--TYHSDKFTTNYFIPNDEQQLESVDLIHHHLAILLDDQLFLAPLEKGKLN--R 109

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W ++ A  + +    G DL P  P+ + P NV F   D      +  N F
Sbjct: 110 VLDVGTGTGIWAIEFADRFPNVSVIGTDLSPCQPQWV-PPNVRFEIDDATLEWTWSANHF 168

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRFY 180
           +++H   +  V  I +W  +++E  R C PGG+++  E ++  ++        PVL+ F 
Sbjct: 169 NFIHMRYI--VGGIADWTGLLKEAFRCCAPGGWVQSVECDIRFRSDDGTTELEPVLASFG 226

Query: 181 DALVTLSD--SRNVKIRISNEIIKTLVSLSTVRNVDYKI 217
           D         +R + ++   +        +  R V YKI
Sbjct: 227 DLFEEGGKVLNRPLSVQEPQQGAFDEAGFTETRTVQYKI 265



>gi|342884112|gb|EGU84441.1| hypothetical protein FOXB_05034 [Fusarium oxysporum Fo5176]
          Length = 348

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 7/146 (4%)

Query: 21  EKEPLKYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           +K   +YF PN  +  D I +  H+L   L   L   P  + L    KVLD+G G G W 
Sbjct: 84  DKYETEYFAPNDERQKDSIDISHHYLMLLLDGKLSLVPSSDDLE---KVLDIGTGTGIWA 140

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A    +A   G DL PI P  + P NV F   D  +   + +++FD+VH   ++   
Sbjct: 141 IDFADQCPNAEVIGTDLSPIQPDWVPP-NVRFELEDATSNWTWSNDSFDFVHMRYLIGA- 198

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE 165
            I +W  + +E  R CKPGG++E  E
Sbjct: 199 -IADWGALFKEAFRCCKPGGFVESVE 223



>gi|475669983|gb|EMT67352.1| hypothetical protein FOC4_g10005441 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 355

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 79/153 (51%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+  N  +  + M ++ HFL   L   LF SP+++++      LD+G G G W 
Sbjct: 75  ERGNAQYWASNDEQQNESMDIVHHFLSLLLDDKLFLSPLKDNIQVS---LDIGTGTGIWA 131

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  +  A+  G D+ PI P  + P N+EF   D      +  ++ D+VH   +    
Sbjct: 132 IDFADQFPGAKVVGTDISPIQPSWVPP-NLEFHIDDCTQPWTFAPDSIDFVHMRYLFG-- 188

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           +I++W  + +E  R C+PGG++E  E    +++
Sbjct: 189 SIKDWSALFKEAFRTCRPGGWVESHEASAMMES 221



>gi|320592897|gb|EFX05306.1| methyltransferase type 12 [Grosmannia clavigera kw1407]
          Length = 387

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN   + +   + H +  +L    L ++P+EN      ++LD+G G G W +D+   
Sbjct: 116 YQFPNDEPEQEREDMKHTVAIHLLGGKLHTAPLENP----QRILDIGTGTGIWAIDMGDE 171

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y  A   GIDL PI P+ + P NV F   +      YD++T D++H  NM +   I++W 
Sbjct: 172 YPEAEVTGIDLSPIQPQYVPP-NVRFYVENAEEPWVYDNDTLDFIHLRNMSTA--IKDWP 228

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            + Q   +  KPG +IE  E
Sbjct: 229 GLFQRAFQALKPGAWIELPE 248



>gi|399170954|emb|CCE28048.1| uncharacterized protein CPUR_01522 [Claviceps purpurea 20.1]
          Length = 341

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 84/163 (51%), Gaps = 6/163 (3%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  + + + H     LF + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 71  YFLPNDDQQLESVELTHHYMAILFDDRLFLAPLEKEKIH--RVLDVGTGTGIWAIEFADQ 128

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ I P NV F   D      ++ + FD++H   +L    IE+W 
Sbjct: 129 FPNASVIGTDLSPCQPQWI-PPNVRFEIDDAGLEWTWNADYFDFIHIRLILG--GIEDWT 185

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSD 188
            +++E  R C PGG++E  E E+  ++    +     L ++++
Sbjct: 186 ALLKEAYRCCAPGGWVESVEGEVDFRSDDGTTELQPVLASVAE 228



>gi|85095447|ref|XP_960091.1| hypothetical protein NCU05831 [Neurospora crassa OR74A]
 gi|28921550|gb|EAA30855.1| predicted protein [Neurospora crassa OR74A]
          Length = 373

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 81/144 (56%), Gaps = 7/144 (4%)

Query: 26  KYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN     +++ IFH F+  +L   L+++P+++++ N    LDV  G G W +D A 
Sbjct: 98  EYWGPNDEIANEMLDIFHHFMTLFLDGKLYTAPLKDNIQN---ALDVCTGTGLWAIDFAD 154

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y +   +G D+ PI P  + P N+ F   DV     Y +N FDYVH   + +V  +++W
Sbjct: 155 EYPNCNVYGTDISPIQPNWV-PPNLRFDIEDVTKPWTYQENLFDYVHIRWLTAV--VKDW 211

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
             + +E+ +  KPGG++E  + E+
Sbjct: 212 PALYREVYKCMKPGGWLEHIDAEV 235



>gi|384488140|gb|EIE80320.1| hypothetical protein RO3G_05025 [Rhizopus delemar RA 99-880]
          Length = 306

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 115/255 (45%), Gaps = 20/255 (7%)

Query: 48  YLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEI--- 104
           Y+ + +F   I   L    K+L+  CG G W L++A  Y + +  G+++ P F KE    
Sbjct: 45  YILKQVFQGNIHVKLNEPKKILESACGVGLWSLEMAHDYPTCQVIGMNILPSFEKENLSF 104

Query: 105 --------KPSNVEFRQGDVLNT-LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVC 155
                   +  N+ F+QG++L T L +  NTFD+V+Q ++ ++   + W  +I E  R+ 
Sbjct: 105 AKSSVNAGQAENICFQQGNLLTTPLSFSSNTFDFVYQRDVATILPFKLWPNLINEFYRIT 164

Query: 156 KPGGYIEFSEPELAVKT-GPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVD 214
           K GG IE  E +L  K  GPVL +  +     + +  V+   ++ + + L     +  V+
Sbjct: 165 KQGGKIELVEYDLLFKRPGPVLDKINNWYSAAAATIGVRQDYTSHLYEYLQQAGYINIVE 224

Query: 215 YKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKEVN 274
             I  + +G        + Y     GY   + + + L K M       +K+  E   +V 
Sbjct: 225 QTID-IPIGEWPTDQLQKQY-----GYLYKEQI-KALFKSMKRWWCTEIKVTPEEYDQVC 277

Query: 275 ETFAPNCEIYRIWCQ 289
               P  E Y  +CQ
Sbjct: 278 ADALPEFEKYNSFCQ 292



>gi|494830161|gb|EON66727.1| hypothetical protein W97_05973 [Coniosporium apollinis CBS 100218]
          Length = 319

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 91/188 (48%), Gaps = 14/188 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFL-ECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y+ PN    +D + IFH +    L   LF +PI     N  +VLDVG G G W +D A  
Sbjct: 58  YWGPNDEASSDTLDIFHHICTLTLGGKLFLAPISE---NPQRVLDVGTGTGIWAIDFADQ 114

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + SA+  G DL PI P ++ P NV F   D  +   +   +FD++H   M    ++ +W 
Sbjct: 115 FPSAQVIGTDLSPIQPSDVPP-NVYFEVDDACDEWVFTKESFDFIHVRAMYG--SVADWG 171

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT-----GP--VLSRFYDALVTLSDSRNVKIRISN 198
            + ++++   KPGGY E  E  +  K+     GP  + S++    +   D+    +R  +
Sbjct: 172 KLYEQVMLHLKPGGYFEQVEMSVVPKSDDDSVGPDSIFSQWGRVSLEAGDAFGKTLRCVD 231

Query: 199 EIIKTLVS 206
           E    LV+
Sbjct: 232 ESKDGLVA 239



>gi|475674986|gb|EMT72066.1| Phosphoethanolamine N-methyltransferase 1 [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 559

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 14/167 (8%)

Query: 21  EKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+  N  +  ++M +I HFL   L   L  +P+++ + +   VLDVG G G W 
Sbjct: 75  ERGNAEYWASNDAQQNEVMDIIHHFLVLTLDGKLHLAPLKDDIKS---VLDVGTGTGIWA 131

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  +  A   G D+ PI P  + P NV+F   D      +  ++FD+++   +    
Sbjct: 132 IDFADEHPQAEVIGTDISPIQPSWVPP-NVKFEIEDCTQPWTFSPDSFDFIYMRYLYG-- 188

Query: 140 TIEEWFFVIQELIRVCKPGGYIE-------FSEPELAVKTGPVLSRF 179
           +I +W  + QE  R CKPGG++E           +  VK G  +S +
Sbjct: 189 SISDWSALFQEAFRSCKPGGWVESFEASPCLESDDDTVKDGSAMSEW 235



>gi|336470543|gb|EGO58704.1| hypothetical protein NEUTE1DRAFT_116235 [Neurospora tetrasperma
           FGSC 2508]
 gi|350291596|gb|EGZ72791.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 373

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 81/159 (50%), Gaps = 13/159 (8%)

Query: 30  PNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D M ++ H     L   LF SP+E +  N  KVLDVG G G W +D A  + +
Sbjct: 104 PNDQRHVDSMDILHHTFMLSLGDKLFLSPLEKN--NIHKVLDVGTGTGLWAIDFADDFPN 161

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P NV+F   D  +   +++++FD++H   +  V  + +WF + 
Sbjct: 162 AEVIGTDVSPIQPSWVPP-NVKFELDDCNHEWTWNEDSFDFIHLRLLNGV--VSDWFSLF 218

Query: 149 QELIRVCKPGGYIE-------FSEPELAVKTGPVLSRFY 180
           +   R  +PGGY+E           + +VK G  L +++
Sbjct: 219 RNAFRCARPGGYVESLTTSAYVRSDDGSVKKGSALEQWH 257



>gi|408390893|gb|EKJ70278.1| hypothetical protein FPSE_09495 [Fusarium pseudograminearum CS3096]
          Length = 398

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 75/143 (52%), Gaps = 6/143 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY FPN   + D   + H L  YL  + LF +PI+  L    +VLD+G G G W +DLA 
Sbjct: 108 KYLFPNDEVEQDREELKHNLTVYLCDDRLFFAPIDRVLEKGAEVLDLGTGIGRWCIDLAD 167

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNTFDYVHQANMLSVFTIE 142
            Y + +F G+DL PI P  + P N  F   D+ +     Y++++FDY+H  + L      
Sbjct: 168 NYPNTQFHGMDLSPIQPDWV-PENALFFVDDIEHEAGWTYNEDSFDYIHIRHTLHSIKDR 226

Query: 143 EWFFVIQELIRVCKPGGYIEFSE 165
           E  +    + +  KPGGY+E  E
Sbjct: 227 EQLW--DRIWKHLKPGGYVEVQE 247



>gi|302888902|ref|XP_003043337.1| hypothetical protein NECHADRAFT_53587 [Nectria haematococca mpVI
           77-13-4]
 gi|256724253|gb|EEU37624.1| hypothetical protein NECHADRAFT_53587 [Nectria haematococca mpVI
           77-13-4]
          Length = 305

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 73/140 (52%), Gaps = 7/140 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFL-ECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y+ PN  +  +   + H +    L  NL+++P+     N  +VLDVGCG G W ++ A  
Sbjct: 32  YWGPNDERQQEAEDLMHEMYRIILDGNLYAAPLGE---NPQRVLDVGCGTGIWAIEFADE 88

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + SA   G+DL PI P  + P N +F   D+     + DN+FDYVH   M     I +W 
Sbjct: 89  HPSADVLGVDLSPIQPGFV-PPNCKFEVDDINQEWTFPDNSFDYVHIRAMTGC--IPDWV 145

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            + ++  +  KPGG++E  E
Sbjct: 146 ELHKKAFKALKPGGWVEHVE 165



>gi|426200640|gb|EKV50564.1| hypothetical protein AGABI2DRAFT_176878 [Agaricus bisporus var.
           bisporus H97]
          Length = 293

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 127/274 (46%), Gaps = 18/274 (6%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA- 84
           Y  P+  +++  +++ H L    F N +  +P+E  L ++  VL+   G G WL DLA  
Sbjct: 24  YALPHDTEESSRLLMQHNLFLRAFDNKVLHAPVE--LKDDDWVLEGATGTGIWLQDLAKE 81

Query: 85  TYSSARFFGIDLFP-IFPK-EIKPSNVEFRQGDVLNTLPYD-DNTFDYVHQANMLSVFTI 141
           T +   + GID+    FP+    PSN+ F    VL+ LP D  N F  VHQ  +++    
Sbjct: 82  TSTKPHYIGIDIESNFFPQASTLPSNITFEIQSVLD-LPKDWTNKFTLVHQRLLIAGLRT 140

Query: 142 EEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEII 201
           ++W   I+EL RV KPGG+++  E ++   +GP L++ +D L     S +V I   +   
Sbjct: 141 QDWEQDIKELYRVVKPGGWVQLFELKIWT-SGPALAKHWDLLCKF--SHDVGIMYRDLTT 197

Query: 202 KTLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYF-----LNDPMPETLCKFMG 256
           K    L     VD  I   T G   G  A Q  +D  D        L  P+ +     + 
Sbjct: 198 KLPEFLKQSGFVD--IHEDTRGTPLGTWANQDGIDAKDNLLGVLRGLKTPILKGGGYGVV 255

Query: 257 TTKEGYLKLFKEAKKEVNETFAPNCEIYRIWCQK 290
            ++  Y +L KE +KE++ T          W +K
Sbjct: 256 ESEVEYDELLKEIEKEMDATPGSTALWTMFWARK 289



>gi|399170960|emb|CCE28054.1| uncharacterized protein CPUR_01528 [Claviceps purpurea 20.1]
          Length = 342

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 83/163 (50%), Gaps = 13/163 (7%)

Query: 25  LKYFFPNFVKDTDIMVIFHFLECYLFQ-NLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           + Y +PN  +  + + + H     LF   LF +P+E   +   +VLDVG G GTW ++ A
Sbjct: 69  VDYLYPNDDQQLESVELCHQYLTILFDGQLFLAPLEEDKIR--RVLDVGTGSGTWAIEFA 126

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             + +A   G DL P  PK + P NV F   D      ++ N FD++H   +  V  I++
Sbjct: 127 DQFPNASVTGTDLSPCQPKWVPP-NVHFEIDDASLDWTWEANHFDFIHMRYI--VGGIQD 183

Query: 144 WFFVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRF 179
           W  +++E  R C PGG++E  E E+  ++        PVL+ F
Sbjct: 184 WTTLLKEAYRCCAPGGWVESIEYEVDFRSDDGTTELEPVLASF 226



>gi|384501454|gb|EIE91945.1| hypothetical protein RO3G_16656 [Rhizopus delemar RA 99-880]
          Length = 198

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 71/144 (49%), Gaps = 14/144 (9%)

Query: 48  YLFQNLFSSPIENSLLNE--CKVLDVGCGPGTWLL-----------DLAATYSSARFFGI 94
           ++++N+ SS +  S+  E    VLD+GCG G W+            D+   Y +  + G 
Sbjct: 53  FVYRNVLSS-VRKSMDFEKGVSVLDIGCGSGIWIKVSANYPTIDAKDMIRDYPNCTYHGC 111

Query: 95  DLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRV 154
           D+     K ++     F  G+V+  LPY D+TFD+VH   ++     EEW   IQE+IRV
Sbjct: 112 DIVDATRKLLRCDQFHFSYGNVVKGLPYADDTFDFVHMRLLVYALRAEEWPVAIQEVIRV 171

Query: 155 CKPGGYIEFSEPELAVKTGPVLSR 178
            KP G I+  E  L V     + R
Sbjct: 172 VKPDGMIQLYEGGLEVHEAHSVKR 195



>gi|495194818|ref|WP_007919608.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297548041|gb|EFH81908.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 323

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 7/108 (6%)

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPS-------NVEFRQGDVLNT 119
           +++D+GCGPG+W+L++A  Y      G+D+     K            N  F +G+VL +
Sbjct: 58  RIIDIGCGPGSWVLNVAYEYPEVEVLGLDVSKRMIKYAHTQAQTEGRENAIFMEGNVLKS 117

Query: 120 LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPE 167
           LP+ DN+FD V+   M+ V   + W  V++EL R+ +PGG I  +EP+
Sbjct: 118 LPFPDNSFDLVNARFMVGVIMRDVWPQVVEELYRIVRPGGIIRLTEPD 165



>gi|399170489|emb|CCE28866.1| uncharacterized protein CPUR_02556 [Claviceps purpurea 20.1]
          Length = 363

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 80/164 (48%), Gaps = 14/164 (8%)

Query: 27  YFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLN---ECKVLDVGCGPGTWLLDL 82
           YF PN  +  +   I H  L   L   L+ +P+E   ++     +VLDVG G G W ++ 
Sbjct: 88  YFIPNDDQQLESEAICHHCLTILLDDQLYLAPLEKDKIHVGANWRVLDVGTGSGIWAIEF 147

Query: 83  AATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIE 142
           A  + +A   G DL P  P+ + P N+ F   D      ++DN FD++H   +  V  IE
Sbjct: 148 ADQFPNASVIGTDLSPCQPQWVPP-NLCFEIDDATLEWTWNDNHFDFIHMRYI--VGGIE 204

Query: 143 EWFFVIQELIRVCKPGGYIEF--SEPELAVKTG-----PVLSRF 179
           +W  + QE  R C PGG++E    EPE     G     PVL+ +
Sbjct: 205 DWTALFQEAYRCCAPGGWVESLEYEPEFRSDDGTTELEPVLASY 248



>gi|302885914|ref|XP_003041848.1| hypothetical protein NECHADRAFT_72861 [Nectria haematococca mpVI
           77-13-4]
 gi|256722754|gb|EEU36135.1| hypothetical protein NECHADRAFT_72861 [Nectria haematococca mpVI
           77-13-4]
          Length = 351

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 7/143 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+   +Y+ PN     ++M I H L     ++ L  +PI   +    K LDVG G G W 
Sbjct: 73  ERGTAQYWAPNDALQNEVMDIHHHLLTIASEDKLHHAPINKDIE---KALDVGTGTGIWA 129

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  +S+    G DL PI P  + P N++F   D      +  +TFDY+H   +  V 
Sbjct: 130 IDFADEFSATEVIGTDLSPIQPSWV-PPNLKFEIEDCTRPWTFRPDTFDYIHMRYL--VG 186

Query: 140 TIEEWFFVIQELIRVCKPGGYIE 162
           ++++W  + ++    CKPGG++E
Sbjct: 187 SVKDWNGLFEQAFLACKPGGWVE 209



>gi|400597642|gb|EJP65372.1| methyltransferase domain-containing protein [Beauveria bassiana
           ARSEF 2860]
          Length = 352

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 77/143 (53%), Gaps = 6/143 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFS-SPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN   +     + H L  +L    +  +PI+  L N  +VLD+G G G W ++LA 
Sbjct: 67  QYAFPNDENEQRRDDLKHDLTLHLCDGKYLLAPIDEMLQNGAQVLDLGTGNGKWCIELAD 126

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNTFDYVHQANMLSVFTIE 142
            Y +A F G+DL PI P  + P NV F   D+ +     YDDN FDY+H  ++  V +I 
Sbjct: 127 IYPNATFQGMDLSPIQPDWV-PENVSFVVDDIEHAAGWTYDDNMFDYIHIRHI--VHSIR 183

Query: 143 EWFFVIQELIRVCKPGGYIEFSE 165
           +   + + + +  KPGGY+E  E
Sbjct: 184 DRQELWRRIYKHLKPGGYVEIQE 206



>gi|399170948|emb|CCE28042.1| uncharacterized protein CPUR_01516 [Claviceps purpurea 20.1]
          Length = 316

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 96/189 (50%), Gaps = 15/189 (7%)

Query: 1   GNIFSNNKKKSHSRREIKKMEKEPLKYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIE 59
           G++ ++++   HS     K EK    YF PN  +  + + +  H+++  L   LF +P+E
Sbjct: 22  GDVPADDRNDVHSV--FSKDEKFATNYFIPNDDQQLESVELSHHYMKILLDDQLFLAPLE 79

Query: 60  NSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT 119
              ++  +V+DVG G G W ++ A  + +    G DL P  P+ + P N+ F   D    
Sbjct: 80  KDKIH--RVIDVGTGSGIWAIEFADRFPNTSVIGTDLSPCQPQWV-PPNLRFEIDDAGLE 136

Query: 120 LPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTG------ 173
             ++ N FD++H   ++    I++W  +++E  R C PGG+++  E ++  ++       
Sbjct: 137 WTWNANYFDFIHIRYIMG--GIQDWTALLKEAYRCCAPGGWVQSVEMDVNYRSDDGTTDL 194

Query: 174 -PVLSRFYD 181
            PVL+ F D
Sbjct: 195 EPVLASFGD 203



>gi|384500734|gb|EIE91225.1| hypothetical protein RO3G_15936 [Rhizopus delemar RA 99-880]
          Length = 227

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 72/140 (51%), Gaps = 1/140 (0%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           +LD+G G G W L++AA  S A   G+D+ P    + KP N+ + + D+    P + N+ 
Sbjct: 3   ILDIGTGNGIWALEIAAEQSKANIIGLDIRPPAELQGKPKNLTYMEADITQPWPIESNSI 62

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT-GPVLSRFYDALVTL 186
           D++ Q +M ++    +W  V+ E+ RV KP G IE  E +L     GPV + F +   T 
Sbjct: 63  DFIFQRHMGNIILKNQWQHVLSEMYRVLKPEGTIELVEADLWHHNPGPVQTAFDEFHQTQ 122

Query: 187 SDSRNVKIRISNEIIKTLVS 206
            D   +  + +  + + L S
Sbjct: 123 YDELGLDFKFTTTLEEELRS 142



>gi|399170487|emb|CCE28864.1| uncharacterized protein CPUR_02554 [Claviceps purpurea 20.1]
          Length = 358

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 82/161 (50%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           +FFPN  +      +FH     L  + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 88  FFFPNDDQQIKSEELFHHSSTILLDDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 145

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      ++DN FD++H   +  V  IE+W 
Sbjct: 146 FPNASVIGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNDNHFDFIHMRYI--VGGIEDWT 202

Query: 146 FVIQELIRVCKPGGYIEFSEPELAV-------KTGPVLSRF 179
            + +E  R C PGG++E  E ++ +       +  P+L+ F
Sbjct: 203 ALFKEAYRCCAPGGWVESVEYDVEICSDDGSTELEPILASF 243



>gi|46127867|ref|XP_388487.1| hypothetical protein FG08311.1 [Fusarium graminearum PH-1]
          Length = 323

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 82/158 (51%), Gaps = 7/158 (4%)

Query: 11  SHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVL 69
           +H    I+ +E+   KY FPN   + D   + H L  YL ++ LF +PI+  L    +VL
Sbjct: 19  THEAAVIQSIERGE-KYLFPNDEVEQDREELKHNLTVYLCEDRLFFAPIDRVLEKGAEVL 77

Query: 70  DVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNTF 127
           D+G G G W +DLA  Y + +F G+DL PI P  + P N  F   D+ +     Y+ ++F
Sbjct: 78  DLGTGIGRWCIDLADNYPNTQFHGMDLSPIQPDWV-PENALFFVDDIEHEAGWTYNADSF 136

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           DY+H  + L      E  +    + +  KPGGY+E  E
Sbjct: 137 DYIHIRHTLHSIKDREQLW--DRIWKHLKPGGYVEVQE 172



>gi|336470533|gb|EGO58694.1| hypothetical protein NEUTE1DRAFT_116229 [Neurospora tetrasperma
           FGSC 2508]
 gi|350291586|gb|EGZ72781.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 385

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 80/155 (51%), Gaps = 8/155 (5%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECK 67
           ++ H R    +M +   + + PN  +  D M ++ H +   L   LFSSP+E   +   K
Sbjct: 96  REVHGRTYHAEMGR--AEAWQPNDQRHLDAMELVHHAVMVTLGGKLFSSPLEPKKVQ--K 151

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDV  G G W +D A  + +A   G D+ PI P  + P NV+F   D      + +NTF
Sbjct: 152 VLDVATGAGLWAIDFADEFPNAEVIGTDVSPIQPSWV-PPNVKFELEDCNQEWTWPENTF 210

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
           D+V+    L V  +++W+ + +   RV KPG Y+E
Sbjct: 211 DFVNL--RLLVGIVDDWYALFRNAYRVAKPGSYVE 243



>gi|342869589|gb|EGU73214.1| hypothetical protein FOXB_16275 [Fusarium oxysporum Fo5176]
          Length = 305

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 74/146 (50%), Gaps = 7/146 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           EK   +YF PN  + ++ + ++ H+L   L   L  +PI+  +    KV+D+G G G W 
Sbjct: 81  EKHDTQYFTPNDDRQSESLDIVHHYLTLLLDGKLHLAPIKPDVQ---KVVDIGTGDGIWA 137

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D    +  A   G DL  + P  + P NV+F   D      + ++T D+VH   +    
Sbjct: 138 IDFGDEHPDAEVIGTDLSAMQPNWVPP-NVKFEIDDATQPWTWPEHTLDFVHIRFLNGA- 195

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE 165
            I++W  + +E  R CKPGGY+E  E
Sbjct: 196 -IKDWHALFREAYRCCKPGGYVESGE 220



>gi|449549146|gb|EMD40112.1| hypothetical protein CERSUDRAFT_81393 [Ceriporiopsis subvermispora
           B]
          Length = 696

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 74/145 (51%), Gaps = 16/145 (11%)

Query: 33  VKDTDI---MVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSA 89
           V D D+   M +       L  ++F +P E       +VLD+GCG G WLL+ A T+ +A
Sbjct: 38  VVDHDVWSNMWVQQLTGGSLTWHVFETPPE-------RVLDLGCGSGPWLLEAARTWKNA 90

Query: 90  RFFGIDLFPIFP--KEIKPSNVEFR----QGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
            F G+D+ PI P  K++  S++  R      + L  LP+ D  FDYV    +       +
Sbjct: 91  HFTGLDVVPIHPDLKQLGLSDLASRITWVHANFLEGLPFSDEEFDYVRVTRIARAVPEHK 150

Query: 144 WFFVIQELIRVCKPGGYIEFSEPEL 168
           W ++ +E+ RV KPGG  E  E +L
Sbjct: 151 WDWLFEEISRVMKPGGAFELFEEDL 175



>gi|336260230|ref|XP_003344911.1| hypothetical protein SMAC_08391 [Sordaria macrospora k-hell]
 gi|380087672|emb|CCC14080.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 371

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (52%), Gaps = 6/134 (4%)

Query: 30  PNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  +  D M I +H +   +   LF SP+E   +N  + LD+G G G W +D A  + +
Sbjct: 101 PNDQRHVDAMEIWYHAVTLQMGGKLFFSPLEQKKVN--RALDIGTGLGLWAIDFADEFPN 158

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G D+ PI P  + P NV+F   D      + DNTFD+V+   ++ V  +++W  + 
Sbjct: 159 AEVIGTDVTPIQPSWV-PPNVKFELDDCNKEWTWPDNTFDFVNLRYLIGV--VDDWDALF 215

Query: 149 QELIRVCKPGGYIE 162
           +   RV KPG Y+E
Sbjct: 216 RNAYRVAKPGAYVE 229



>gi|511008085|gb|EPB89357.1| hypothetical protein HMPREF1544_03866 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 377

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 87/182 (47%), Gaps = 11/182 (6%)

Query: 3   IFSNNKKKSHSRREIKKMEKEPLKYFFPNFV----KDTDIMVIFHFLECYLFQNLFSSPI 58
           I +N ++KS S  E     K+ L    P  V    K+ D +   H+L     +    +PI
Sbjct: 78  IVNNTRRKSIS--EFFARRKQSLVSMHPTIVEEDMKEYDRLQRQHYLLKSTRKGNTWAPI 135

Query: 59  ENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLN 118
           E+  +    +++ G   G W L++A  Y  ++  G+DL P   +   P+N+ + Q +V  
Sbjct: 136 ESPKV----IVEAGTANGIWALEMATQYKESQVLGLDLKPPAFQHGNPTNLRYNQTNVNE 191

Query: 119 TLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT-GPVLS 177
             P  D T D+V Q NM      ++W  V+ E+ RV KPGGYIE  E ++     GPV  
Sbjct: 192 PWPMADATVDFVFQRNMYLHIQKDQWPKVLHEMFRVLKPGGYIELIEADMWHHNPGPVQI 251

Query: 178 RF 179
            F
Sbjct: 252 AF 253



>gi|399170475|emb|CCE28852.1| uncharacterized protein CPUR_02541 [Claviceps purpurea 20.1]
          Length = 382

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 81/163 (49%), Gaps = 6/163 (3%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YFFPN  +  + M +  HFL   L   LF +P+E    +  +VLDVG G G W ++ A  
Sbjct: 89  YFFPNDDQQLESMELCHHFLTILLDDQLFLAPLEKDKTH--RVLDVGTGSGIWAIEFADQ 146

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++ N FD++H   +  V  I +W 
Sbjct: 147 FPNASVVGTDLSPCQPEWV-PPNVCFEIDDATLEWTWNANHFDFIHMRYI--VGGIGDWT 203

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSD 188
            + +E  R C PGG++E  E ++ +++    +     L +  D
Sbjct: 204 ALFKEAYRCCAPGGWVESIEYDVELRSDDGTTELEPVLYSYGD 246



>gi|426200638|gb|EKV50562.1| hypothetical protein AGABI2DRAFT_176876 [Agaricus bisporus var.
           bisporus H97]
          Length = 288

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 76/143 (53%), Gaps = 6/143 (4%)

Query: 49  LFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA-ATYSSARFFGIDLFP-IFPK-EIK 105
           L   +  +P+E  L ++  VLD G G G WL DLA  T +  ++ GID+   +FP+    
Sbjct: 41  LNHKILYAPVE--LQDDDWVLDSGTGTGIWLEDLAQVTSTKPKYIGIDIGSNLFPQASTL 98

Query: 106 PSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           P N+ F    V+N      N F  VHQ ++++     EW   ++EL RV +PGG+I+  E
Sbjct: 99  PENIRFETHSVVNLPKEWTNKFTLVHQRHLIAALRRHEWESAVRELYRVVEPGGWIQMFE 158

Query: 166 PELAVKTGPVLSRFYDALVTLSD 188
             +   +GP L++  D L  LSD
Sbjct: 159 MRIWT-SGPALAKHRDLLSKLSD 180



>gi|164425784|ref|XP_959355.2| hypothetical protein NCU04907 [Neurospora crassa OR74A]
 gi|157071063|gb|EAA30119.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 376

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 80/155 (51%), Gaps = 8/155 (5%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECK 67
           ++ H R    +M +   + + PN  +  D M ++ H +   L   LFSSP+E   +   K
Sbjct: 87  REVHGRTYHAEMGR--AEAWQPNDQRHLDAMELVHHAVMVTLGGKLFSSPLEPKKVQ--K 142

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDV  G G W +D A  + +A   G D+ PI P  + P NV+F   D      + +NTF
Sbjct: 143 VLDVATGAGLWAIDFADEFPNAEVIGTDVSPIQPSWV-PPNVKFELEDCNQEWTWPENTF 201

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
           D+V+    L V  +++W+ + +   RV KPG Y+E
Sbjct: 202 DFVNL--RLLVGIVDDWYALFRNAYRVAKPGSYVE 234



>gi|399170480|emb|CCE28857.1| uncharacterized protein CPUR_02546 [Claviceps purpurea 20.1]
          Length = 357

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (50%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YFFPN  +  +   + H L   L  + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 87  YFFPNDDRQLESEELCHHLLTILLDDRLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 144

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      ++ N FD++H   +  V  I++W 
Sbjct: 145 FPNASVVGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNANHFDFIHMRYI--VGGIQDWT 201

Query: 146 FVIQELIRVCKPGGYIEFS--EPELAVKTG-----PVLSRF 179
            + +E  R C PGG++E    EPE+    G     PVL+ +
Sbjct: 202 ALFEEAYRCCAPGGWVESVEYEPEICSDDGSTDLEPVLASY 242



>gi|429858695|gb|ELA33506.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 367

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 76/155 (49%), Gaps = 11/155 (7%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLD 70
           ++RR  K ME    +Y  PN   + D   + H +   +    L S+P+EN      K++D
Sbjct: 81  NTRRYHKYMEG---RYLLPNDEPEQDREDMKHAMCVNVMDGKLHSAPLENPQ----KIVD 133

Query: 71  VGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYV 130
           +G G G W +D+   Y  A   GIDL PI P  + P NV F   D      + +N+ D+V
Sbjct: 134 IGTGTGIWAIDIGDEYPEADVLGIDLSPIQPDWV-PPNVRFMIDDAEADWVWPENSLDFV 192

Query: 131 HQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           H  +M     I+ W  ++ E  +  KPGG++E  E
Sbjct: 193 HARHM--CMAIKNWPGLLSEAYKSLKPGGWVELQE 225



>gi|402075003|gb|EJT70474.1| hypothetical protein GGTG_11497 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 472

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 14/159 (8%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNEC 66
           N ++ H  RE         +Y FPN   + +  ++ H +   L   L+ +PI +S  N  
Sbjct: 187 NGRRYHRLRE--------GQYNFPNDKVEQEREILKHVMIKLLCGKLYYAPIGDSPRN-- 236

Query: 67  KVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNT 126
            +LDVG G G W +++A    S+   GIDL PI P+ + P NV F   D  +   +  N 
Sbjct: 237 -ILDVGTGTGIWAIEVADQLPSSIILGIDLSPIQPEYVPP-NVRFMVDDAESEWLHPPNH 294

Query: 127 FDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE 165
           FDYVH  +  +V  I+ W  V+++     +PGG+IE  E
Sbjct: 295 FDYVHFRH--AVMAIKNWHRVLEQAFHHIRPGGWIEIQE 331



>gi|336467783|gb|EGO55947.1| hypothetical protein NEUTE1DRAFT_117972 [Neurospora tetrasperma
           FGSC 2508]
 gi|350287560|gb|EGZ68796.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 393

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 75/144 (52%), Gaps = 7/144 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  ++M I+H  +   L + L+++P+   + N    LDVG G G W +D A 
Sbjct: 118 EYWGPNDAKAMEVMDIYHHAMTLILDEKLYTAPLSKDIKN---ALDVGTGTGLWAIDFAD 174

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N++F   D      Y  + FDY+H   +    TI++W
Sbjct: 175 EFPNCTVIGTDISPIQPSWV-PPNLQFNIDDATREWTYQPDFFDYIHIRWLCG--TIKDW 231

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
             + +E  +  KPGG+IE  + E+
Sbjct: 232 ASLYKEAYKCLKPGGWIEHMDGEV 255



>gi|345563140|gb|EGX46144.1| hypothetical protein AOL_s00110g308 [Arthrobotrys oligospora ATCC
           24927]
          Length = 340

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (50%), Gaps = 16/161 (9%)

Query: 7   NKKKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNE 65
           N ++ H  RE +        Y FPN   + D + + H +   + +  L  +P++      
Sbjct: 59  NGRRYHKFREGQ--------YAFPNDETEQDRLDMHHHMLTIVQKGELHGAPLDAP---- 106

Query: 66  CKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDN 125
            +VLD+G G G W +++A  Y SA   G DL PI P  + P NV+F   D  +   + DN
Sbjct: 107 QQVLDIGTGTGIWAIEMADKYPSAVVIGNDLSPIQPTWV-PPNVKFEIDDAESQWTHPDN 165

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEP 166
           +FD+V+   ML   +I +W  +I +  +  KPGGY+E  EP
Sbjct: 166 SFDFVYARYMLG--SIADWPKLIGQAYQAIKPGGYLEIFEP 204



>gi|320589662|gb|EFX02118.1| methyltransferase type 11 [Grosmannia clavigera kw1407]
          Length = 351

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 14/162 (8%)

Query: 27  YFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  + I +  H+L   L    F +P++++L N   VLD+G G G W +D+A  
Sbjct: 78  YFMPNDGQQQEAIDIAHHYLTLLLNGAFFLAPVKDNLKN---VLDIGTGTGIWAIDVADQ 134

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A+  G D+ PI    + P N +F   D      + DN FD+VH   ++    I +W 
Sbjct: 135 FPNAQVIGTDISPIQSIWV-PPNAKFEIDDATQPWTWPDNAFDFVHIRFLVGA--ISDWD 191

Query: 146 FVIQELIRVCKPGGYIEFSE--PELAVKTG-----PVLSRFY 180
            +  +  R C+PGG+ E  E  PE     G     P+ + F+
Sbjct: 192 ALFSQAYRCCEPGGWFESCELRPEHQSDNGTDKNSPIFTEFW 233



>gi|302917505|ref|XP_003052453.1| hypothetical protein NECHADRAFT_36056 [Nectria haematococca mpVI
           77-13-4]
 gi|256733393|gb|EEU46740.1| hypothetical protein NECHADRAFT_36056 [Nectria haematococca mpVI
           77-13-4]
          Length = 383

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 6/143 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQ-NLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY FPN   + D   + H L  YL    +F +PIE  L    +VLD+G G G W +DLA 
Sbjct: 81  KYLFPNDEAEQDREELKHNLTVYLCDGQMFFAPIEKLLEEGAEVLDLGTGIGKWCIDLAD 140

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNT--LPYDDNTFDYVHQANMLSVFTIE 142
            Y +++F G+DL PI P  + P N  F   D+ +     Y +  FDY+H  +  ++ ++ 
Sbjct: 141 NYPNSQFHGMDLSPIQPDWV-PENALFVVDDIEHEGGWTYPEEKFDYIHIRH--TIHSVR 197

Query: 143 EWFFVIQELIRVCKPGGYIEFSE 165
           +   +   + +  KPGGY+E  E
Sbjct: 198 DRPLLWDRIYQHLKPGGYVEIQE 220



>gi|399170481|emb|CCE28858.1| uncharacterized protein CPUR_02547 [Claviceps purpurea 20.1]
          Length = 340

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 95/201 (47%), Gaps = 15/201 (7%)

Query: 27  YFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  K  +   I  HFL   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 70  YFIPNDDKQLETEEICHHFLTILLDDQLFLAPLEKEKIH--RVLDVGTGSGIWAIEFADQ 127

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++ + F+++H   +  V  I++W 
Sbjct: 128 FPNASVVGTDLSPCQPQWV-PPNVCFEIDDATLEWTWNPDHFEFIHMRYI--VGGIQDWA 184

Query: 146 FVIQELIRVCKPGGYIEF--SEPELAVKTG-----PVLSRFYDALVTLSDSRNVKIRISN 198
            + +E  R C PGG++E    EPE     G     PVL+ + D     S   N  + + +
Sbjct: 185 TLFKEAFRCCAPGGWVESLEYEPEFRSDDGSTDLEPVLALYGDLFRKASKILNRPLFVKD 244

Query: 199 EIIKTLVSLSTV--RNVDYKI 217
            + + L     +  R + YKI
Sbjct: 245 ILPRALDEAGFIDKRVIRYKI 265



>gi|477529620|gb|ENH81371.1| sam dependent [Colletotrichum orbiculare MAFF 240422]
          Length = 328

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 81/165 (49%), Gaps = 12/165 (7%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFL-ECYLFQNLFSSPIENSLLNECK 67
           +K H R   +K +     Y+ PN  K  + + + H+L   +L   LF +PI  +     +
Sbjct: 52  RKLHGRTYTQKTD-----YYGPNDEKQNEGLHLMHYLLTVFLDDKLFLAPIGKT---PHR 103

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLD+G G G W  D A  +  +   G+D+ PI P    P N +F+  D+  +  +  + F
Sbjct: 104 VLDLGTGTGVWASDFADEFPESEVIGVDISPIQPS-WAPPNCKFQIDDIDQSWTWPSDHF 162

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
           D+VH  N+     I +W    +E +R  KPGGYIE  E +   ++
Sbjct: 163 DFVHARNLEGC--ISDWVDFDKEALRCLKPGGYIEVIELDFHARS 205



>gi|399166733|emb|CCE32406.1| uncharacterized protein CPUR_06266 [Claviceps purpurea 20.1]
          Length = 362

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   + H     LF + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 92  YFLPNDERQLESAELSHHSLTILFDDHLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADR 149

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +    G DL P  P+ + P NV F   D      +++N FD++H   +L    IE+W 
Sbjct: 150 FPNTSVIGTDLSPCQPQWV-PPNVLFEIDDAALEWTWNNNHFDFIHIRYILG--GIEDWT 206

Query: 146 FVIQELIRVCKPGGYIEFSEPELAVKT 172
            +++E  R C PGG++E +E ++  ++
Sbjct: 207 ALLKEAYRCCAPGGWVESAELDVEFRS 233



>gi|358378574|gb|EHK16256.1| hypothetical protein TRIVIDRAFT_87441 [Trichoderma virens Gv29-8]
          Length = 367

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 63/120 (52%), Gaps = 5/120 (4%)

Query: 43  HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPK 102
           H L   +   LF +P+     N  K LD+G G G W +D A  Y  A+  G D+ PI P 
Sbjct: 108 HALSMAMGDKLFMAPLVKE--NIKKALDIGTGTGIWAIDFADEYPDAQVIGTDISPIQPT 165

Query: 103 EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
            + P N++F   D      + +  FDYVH   +L   +I++W  ++Q+  RV +PGGYIE
Sbjct: 166 WV-PPNLQFEIEDCTQDWTFRNQDFDYVHMRWLLG--SIQDWDALLQQAYRVLRPGGYIE 222



>gi|471569225|gb|EMR68660.1| putative methyltransferase domain-containing protein [Eutypa lata
           UCREL1]
          Length = 423

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 74/153 (48%), Gaps = 7/153 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWL 79
           EK   +Y+ PN  +  D + I  H L   L   L  +P+   +    KVLD+G G G W 
Sbjct: 86  EKHATRYWGPNDDRQNDAIDINHHVLTLLLDGKLHLAPLRKDI---QKVLDIGTGTGIWA 142

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  Y  A+  G DL PI P  + P N +F   D      +  +TFD+VH   +  V 
Sbjct: 143 IDFADEYPGAQVLGTDLSPIQPYWVPP-NCKFEIDDAELPWTWPADTFDFVHVRYL--VG 199

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSEPELAVKT 172
            I +W    ++     KPGG+IE  EP+ A K+
Sbjct: 200 AISDWPQFFKQAYATLKPGGWIETFEPDAAFKS 232



>gi|341038745|gb|EGS23737.1| hypothetical protein CTHT_0004390 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 352

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 67/139 (48%), Gaps = 6/139 (4%)

Query: 28  FFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           + PN  K  D M I H+       N LF +P++   +   KVLDVG G G W++D A  +
Sbjct: 80  WIPNDDKHLDSMEILHYASILALGNKLFLAPLDKDRIR--KVLDVGTGSGLWVIDFADQF 137

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
            +A+  G D+ PI P  + P NV F   D      +  NTFD++    M+    I +W  
Sbjct: 138 PNAQVTGTDITPIQPTWV-PPNVSFELDDANQDWTWSSNTFDFIRTRYMIGC--ISDWKK 194

Query: 147 VIQELIRVCKPGGYIEFSE 165
             +   R  KPGGY E  E
Sbjct: 195 FYENAFRCLKPGGYFEHEE 213



>gi|409082776|gb|EKM83134.1| hypothetical protein AGABI1DRAFT_118499 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 287

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 122/273 (44%), Gaps = 16/273 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA- 84
           Y  P+  +++  +++ H L    F N +  +P+E  L ++  VL+   G G WL DLA  
Sbjct: 18  YALPHDTEESSRLLMQHNLFLRAFDNKVLHAPVE--LKDDDWVLEGATGTGIWLQDLAKE 75

Query: 85  TYSSARFFGIDLFP-IFPK-EIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIE 142
           T +   + GID+    FP+    PSN+ F    VL+      N F  VHQ  +++    +
Sbjct: 76  TSTKPHYIGIDIESNFFPRASTLPSNMTFEIQSVLDLPKEWTNKFTLVHQRLLIAGLRTQ 135

Query: 143 EWFFVIQELIRVCKPGGYIEFSEPELAVKTGPVLSRFYDALVTLSDSRNVKIRISNEIIK 202
           +W   I+EL RV KPGG+++  E ++   +GP L++ +D L   S    +  R     + 
Sbjct: 136 DWEQDIKELYRVVKPGGWVQLFELKIWT-SGPALAKHWDLLCKFSHDVGIMYRDLTTKLP 194

Query: 203 TLVSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYF-----LNDPMPETLCKFMGT 257
             +  S       +I   T G   G  A Q  +D  D        L  P+ +     +  
Sbjct: 195 EFLKQSGF----VEIHEDTRGTPLGTWANQDGIDAKDNLLGVLRGLKTPILKGGGYGVVE 250

Query: 258 TKEGYLKLFKEAKKEVNETFAPNCEIYRIWCQK 290
           ++  Y +L KE +KE++ T          W +K
Sbjct: 251 SEAEYDELLKEIEKEMDATPGSTALWTMFWARK 283



>gi|302887024|ref|XP_003042401.1| hypothetical protein NECHADRAFT_72681 [Nectria haematococca mpVI
           77-13-4]
 gi|256723311|gb|EEU36688.1| hypothetical protein NECHADRAFT_72681 [Nectria haematococca mpVI
           77-13-4]
          Length = 340

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 122/272 (44%), Gaps = 19/272 (6%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           KY  PN   + + + + H L  Y  +N L  +P  +      +VLD+G G G W LD A 
Sbjct: 63  KYAMPNDDIENERLDLQHHLFLYTLENKLGLAPPNDHDAKVKRVLDLGTGTGIWALDYAD 122

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            +  A   GIDL P  P E  P NV+F   D+     Y    FDY+H + M+++ ++  W
Sbjct: 123 EHPEAEVIGIDLSPTQP-EFVPPNVQFIVDDIDEEWSY-SKPFDYIH-SRMMNI-SVGNW 178

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVK------TGPVLSRFYDALVTLSDSRNVKIRISN 198
              ++++    +PGG++E  E ++A+K      T       ++ L+  +  +  +  +++
Sbjct: 179 KDYLRQIYENLEPGGFVEIQEVDIAMKSDDDTLTPKNQLAIWNKLLNSASEKMGRAMVTH 238

Query: 199 EIIKTL---VSLSTVRNVDYKISTVTLGAKKGGNAGQAYMDIHDGYFLNDPMPETLCKFM 255
           + IK L   V  + + +  +K  +      K       + +I+ GY L       L +  
Sbjct: 239 KHIKDLMVEVGFTDIVDTYFKWPSNPWPKDKKHKLLGQWNNINTGYALEGAAMAPLTRIH 298

Query: 256 GTTKEGYLKLFKEAKKEVNETFAPNCEIYRIW 287
           G ++E    L   A+ E+N     N  I+  W
Sbjct: 299 GWSREEVTVLVAGARAELN-----NPAIHAYW 325



>gi|85086879|ref|XP_957775.1| hypothetical protein NCU00304 [Neurospora crassa OR74A]
 gi|28918870|gb|EAA28539.1| predicted protein [Neurospora crassa OR74A]
          Length = 386

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 71/139 (51%), Gaps = 7/139 (5%)

Query: 25  LKYFFPNFVKDTDIMVIF-HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           ++Y+ PN  K  D + I+ H +E      L  SP+++++    +V+D+G G G W +D A
Sbjct: 109 IEYWAPNDEKHLDSLEIYYHGVELLNDHQLHMSPLKDNIE---RVIDIGTGAGFWAIDFA 165

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             Y +    G D+ P+ P  + P N+ F   D      Y  N FD VH      V  IE+
Sbjct: 166 DKYPNCEVIGTDISPVQPSWVPP-NLNFEISDASKEWTYKPNYFDLVHV--RFFVGAIED 222

Query: 144 WFFVIQELIRVCKPGGYIE 162
           W    +E  +VCKPGG+IE
Sbjct: 223 WKAFYREAFKVCKPGGWIE 241



>gi|399170953|emb|CCE28047.1| uncharacterized protein CPUR_01521 [Claviceps purpurea 20.1]
          Length = 341

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  + + + H     LF + LF +P+E   L+  +VLDVG G G W ++ A  
Sbjct: 68  YFIPNDDQQLESLNLCHHYLTILFDDQLFLAPLEKDKLH--RVLDVGTGTGIWAIEFADQ 125

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P NV F   D      ++DN FD+ H   +L    I++W 
Sbjct: 126 FPNASVIGTDLSPCQPQWVPP-NVRFEIDDAALEWTWNDNFFDFTHIRYILG--GIQDWT 182

Query: 146 FVIQELIRVCKPGGY-------IEFSEPELAVKTGPVLSRF 179
            + ++  R C PGG+       +EF   +      PVL+ F
Sbjct: 183 GLFKQAYRCCAPGGWVQSVELDVEFRSDDGTTDMEPVLASF 223



>gi|302414084|ref|XP_003004874.1| UMTA [Verticillium albo-atrum VaMs.102]
 gi|261355943|gb|EEY18371.1| UMTA [Verticillium albo-atrum VaMs.102]
          Length = 348

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 29  FPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           F NF  DT+       L   +   L  +PI  S     +VLDVG G G W +D A  Y S
Sbjct: 81  FHNFKSDTE--YCHEMLLMAMDNRLHVAPISGS---PQRVLDVGTGTGIWAIDFADQYPS 135

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G DL PI P  + PSN  F   D      + DN FDY+H   ++    I++W F+ 
Sbjct: 136 AEVIGTDLSPIQPAWV-PSNCRFELDDAQLPWTFPDNHFDYIHMRLLMGA--IKDWPFLY 192

Query: 149 QELIRVCKPGGYIE 162
            E+ R  KPGG+ E
Sbjct: 193 SEVYRCLKPGGWFE 206



>gi|85095451|ref|XP_960092.1| hypothetical protein NCU05832 [Neurospora crassa OR74A]
 gi|28921551|gb|EAA30856.1| hypothetical protein NCU05832 [Neurospora crassa OR74A]
          Length = 400

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 75/144 (52%), Gaps = 7/144 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  ++M I+H  +   L + L+++P+   + N    LDVG G G W +D A 
Sbjct: 125 EYWGPNDAKAMEVMDIYHHAMTLILDEKLYTAPLSKDIKN---ALDVGTGTGLWAIDFAD 181

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N++F   D      Y  + FDY+H   +    TI++W
Sbjct: 182 EFPNCTVIGTDISPIQPSWVPP-NLQFNIDDATREWTYQPDFFDYIHIRWLCG--TIKDW 238

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
             + +E  +  KPGG+IE  + E+
Sbjct: 239 TSLYKEAYKCLKPGGWIEHMDGEV 262



>gi|310799789|gb|EFQ34682.1| methyltransferase domain-containing protein [Glomerella graminicola
           M1.001]
          Length = 328

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 73/145 (50%), Gaps = 5/145 (3%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           +Y FPN   + D   + H +   L    F SP++++L    ++LD+G GPG W ++LA  
Sbjct: 47  RYAFPNDATEQDRDEMKHIISVELCGRYFFSPVQDALTRGAEILDLGTGPGHWPIELADL 106

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDV--LNTLPYDDNTFDYVHQANMLSVFTIEE 143
             ++ F GIDL PI P E+ P N  F   D+   N    D + FD++H  + L   ++  
Sbjct: 107 NPNSTFLGIDLSPIQPHEV-PPNCHFMVDDIEHENGWDLDRDHFDFIHLRHTLH--SVRN 163

Query: 144 WFFVIQELIRVCKPGGYIEFSEPEL 168
              ++Q      KPGG+ E  E E 
Sbjct: 164 RPELMQRAYEHLKPGGWFEIQELEF 188



>gi|399166184|emb|CCE32976.1| uncharacterized protein CPUR_06898 [Claviceps purpurea 20.1]
          Length = 360

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 84/163 (51%), Gaps = 13/163 (7%)

Query: 27  YFFPNFVKDTDIMVI-FHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN  +  +   I  H+L+  L   LF +P++   ++  +VLDVG G G W ++    
Sbjct: 89  YVFPNDDQQLESDEINHHYLKILLDDQLFLAPLDKDKIH--RVLDVGTGSGVWAIEFGDR 146

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +    G DL P  P+ + P NV F   D      +D+N FD++H   ++    I++W 
Sbjct: 147 FPNVSVIGTDLSPCQPQWVPP-NVRFEVDDATLEWTWDENHFDFIHIRYIIG--GIQDWT 203

Query: 146 FVIQELIRVCKPGGYIEFSEPEL-------AVKTGPVLSRFYD 181
            +++E  R C PGG+++  E +L       +++  P+L+ + D
Sbjct: 204 ALLKEAYRCCAPGGWVQSVEIDLDCRSDDGSIELDPILTSYGD 246



>gi|342868648|gb|EGU72816.1| hypothetical protein FOXB_16675 [Fusarium oxysporum Fo5176]
          Length = 322

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 106/235 (45%), Gaps = 29/235 (12%)

Query: 30  PNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSS 88
           PN  K  +   + H +L   L   L+++PI +S     ++LDVG G G W +D+A  + S
Sbjct: 35  PNDEKHIEAFDVAHEWLTMMLDDELYAAPIGDSP-QARRILDVGTGTGIWAIDMADKFPS 93

Query: 89  ARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVI 148
           A   G+D+ P  P  + P N++F+  D      +   +FD++H   M   F  + W  + 
Sbjct: 94  AEVIGVDISPTQPSWV-PPNLKFQIDDAQLDWTFAPASFDFIHVRYMHGAF--DNWQKLY 150

Query: 149 QELIRVCKPGGYIEFSEPELAVKT------------GPVLSRFYDALVTLSDSRNVKIRI 196
            ++ +  KPGG+ +  EP + +K                   FYDA     D      ++
Sbjct: 151 HQMFKALKPGGWFQHIEPNIHLKCENPNSVAENETFKQWAQLFYDA----GDKIGRTFKV 206

Query: 197 SNEIIKTLVSLSTVRNVDYKISTVTLGA-------KKGGNAGQAYMDIH-DGYFL 243
           ++ I++     +   ++ +K+ T+ LG        K+ G     YMD+  DG+ L
Sbjct: 207 TDGIMQDSAREAGFEDIVHKVHTIPLGGWPKDARLKREGQFVGLYMDLSLDGFAL 261



>gi|409083668|gb|EKM84025.1| hypothetical protein AGABI1DRAFT_124346 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 772

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPS-NVEFRQGD-VLNTLPYDDN 125
           VLD+GCG G WLLD +  +  A+F G DL  +   E++   N+   QG+ V N+LP+ D 
Sbjct: 296 VLDLGCGQGYWLLDASYHWPYAKFAGFDLVDVMLPEVRERPNIRLVQGNFVSNSLPFPDQ 355

Query: 126 TFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTGPV 175
           +FD+V  A++      E+W FVI E  RV   GG IE  + +L    GP+
Sbjct: 356 SFDFVRLADLGLAIPHEKWSFVISEARRVLTVGGQIEVIDDQLFFPYGPL 405



>gi|336256943|ref|XP_003343500.1| hypothetical protein SMAC_09744 [Sordaria macrospora k-hell]
 gi|380086665|emb|CCC05663.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 373

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 70/138 (50%), Gaps = 6/138 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  +++ I H     LF   L++SP++   +     +D+G G G W +D A 
Sbjct: 97  EYWGPNDAKANELLDIMHAAMVMLFDGKLYTSPLDEKEIE--NAIDIGTGTGIWAIDFAD 154

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N  F   D      Y +N FD++H   +  V  I++W
Sbjct: 155 DHPNCNVIGTDISPIQPTWL-PPNACFEINDATKEWTYQENYFDFIHIRWLTGV--IKDW 211

Query: 145 FFVIQELIRVCKPGGYIE 162
             + +E  R CKPGG+IE
Sbjct: 212 DSLYKEAYRCCKPGGWIE 229



>gi|341038521|gb|EGS23513.1| hypothetical protein CTHT_0002070 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 350

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 67/139 (48%), Gaps = 6/139 (4%)

Query: 28  FFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           + PN  K T+ M + H+L     +N LF +P+    L   KVLDVG G G W +D    Y
Sbjct: 72  WTPNDDKHTESMELVHYLTLVAMKNKLFHAPLNTDKLK--KVLDVGTGTGHWAIDFGDQY 129

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
            +    G D+ PI P    P NV +   D      + +NTFD++H   ++    I  W  
Sbjct: 130 PNVEVTGTDITPIQPA-WTPPNVSWEIDDANQDWTWPENTFDFIHVRYLMGC--IRNWKK 186

Query: 147 VIQELIRVCKPGGYIEFSE 165
             Q+  R  KPGG++E  E
Sbjct: 187 FYQDAFRCLKPGGWLEHHE 205



>gi|212539277|ref|XP_002149794.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210069536|gb|EEA23627.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 327

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 73/140 (52%), Gaps = 6/140 (4%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN  K+ D + ++ H     L  +L  S  +  L+N  KVLDVG G G W +++A  
Sbjct: 54  YILPNDEKEQDRLDLLNHVFRLCLNGDLCFS--QGDLINPQKVLDVGTGTGIWAIEMADA 111

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y SA   G+DL PI P+ + P NV F   D+     +  N+FD++H   +    +I +W 
Sbjct: 112 YPSAEITGVDLSPIQPRWVPP-NVRFIIDDITQPWDFRTNSFDFIHVRCLAG--SITDWP 168

Query: 146 FVIQELIRVCKPGGYIEFSE 165
             + +  R  KPGG IE SE
Sbjct: 169 GFLAQAYRHLKPGGKIELSE 188



>gi|238482447|ref|XP_002372462.1| UMTA methyltransferase family protein [Aspergillus flavus NRRL3357]
 gi|220700512|gb|EED56850.1| UMTA methyltransferase family protein [Aspergillus flavus NRRL3357]
          Length = 375

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 26  KYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y  PN   + D + ++ H     L   LF +P+EN       +LD+G G G W +D+A 
Sbjct: 67  QYIMPNDEAEQDRLDLVHHMFSVMLNGELFLAPVENP----QTILDLGTGTGIWAIDVAD 122

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + SA+  G DL PI P  + P NVEF   D  +   +D N FDYVH   +     +++W
Sbjct: 123 QFPSAKVIGNDLSPIQPSWV-PPNVEFVVDDFEDVWMHDRNYFDYVHARTISGC--VQDW 179

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
             ++++     KP GY E +E
Sbjct: 180 GRLMKQAYDHLKPSGYFECAE 200



>gi|429858114|gb|ELA32945.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 543

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 7/141 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYL-FQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN   + +   + H +   L  Q L  +PI     N   +LD+G G G W +++  
Sbjct: 265 RYNFPNDEVEQEREDMKHAMVKLLCSQKLNFAPIGRFPQN---ILDLGTGTGAWAIEMGD 321

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y SA+  G+DL PI P  + P NV+F   DV +   Y+ N FDY+H  +  +V  I++W
Sbjct: 322 QYPSAQVLGVDLSPIQPDWVPP-NVKFEVDDVESAWLYNANHFDYIHSRH--TVVAIKDW 378

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
             ++Q  +   KPGG++E  E
Sbjct: 379 ETLLQRSLEHLKPGGWMELQE 399



>gi|452000440|gb|EMD92901.1| hypothetical protein COCHEDRAFT_1212705 [Bipolaris maydis C5]
 gi|477587632|gb|ENI04713.1| hypothetical protein COCC4DRAFT_23922 [Bipolaris maydis ATCC 48331]
          Length = 384

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 8/142 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN  ++ D + + H +   + Q  L+ +PI  S     +VLD+G G G W +D A  
Sbjct: 108 YILPNDEQEQDRLDLQHHVFLLILQGKLYDAPISPS---PQRVLDIGTGTGIWAIDFADE 164

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDD-NTFDYVHQANMLSVFTIEEW 144
           +  A   G DL PI P  + P NV+F   DV     Y     FDY+H  NM    +I +W
Sbjct: 165 FPGAEVIGTDLSPIQPTWVPP-NVKFYIDDVEAEWVYSPAEAFDYIHCRNMSG--SISDW 221

Query: 145 FFVIQELIRVCKPGGYIEFSEP 166
              +++     KPGG++EF EP
Sbjct: 222 SKFVRQAFTHTKPGGWVEFQEP 243



>gi|358388005|gb|EHK25599.1| hypothetical protein TRIVIDRAFT_212026 [Trichoderma virens Gv29-8]
          Length = 354

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN   + +   + H +  +L Q  L  +P+EN       +LD+G G G W +D+  
Sbjct: 84  RYQFPNDEPEQEREDMKHAMVVHLCQGKLHFAPLENPQ----NILDIGTGTGIWAMDMGD 139

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y  A   GIDL PI P+ + P NV F   D        + + DY+H  +M S  +I +W
Sbjct: 140 EYPGAEITGIDLSPIQPQWV-PPNVRFMVDDAEAEWVVPEASLDYIHIRHMTS--SIRDW 196

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVK 171
             ++       KPGG+IE  E +  VK
Sbjct: 197 PVLLSRAYTALKPGGWIELQELQFQVK 223



>gi|358390205|gb|EHK39611.1| hypothetical protein TRIATDRAFT_231677 [Trichoderma atroviride IMI
           206040]
          Length = 388

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 15/166 (9%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y FPN   + +   + H +  +L Q  L  +P+++      K+LDVG G G W +D+  
Sbjct: 118 RYQFPNDEPEQEREDMKHAMIVHLCQGKLHYAPLDHPQ----KILDVGTGTGIWAIDMGD 173

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            Y  A   GIDL PI P+ + P NV F   D          + DY+H  +M S  +I +W
Sbjct: 174 EYPEADIQGIDLSPIQPQWV-PPNVSFMVDDAEAEWLIPPQSLDYIHIRHMTS--SIRDW 230

Query: 145 FFVIQELIRVCKPGGYIEFSEPELAVK-------TGPVLSRFYDAL 183
             ++    R  KPGG+IE  E +  VK        G ++  FY+ +
Sbjct: 231 PTLLSRAYRALKPGGWIELQELKFQVKCDDGTLREGNMIQNFYETM 276



>gi|46114338|ref|XP_383187.1| hypothetical protein FG03011.1 [Fusarium graminearum PH-1]
          Length = 363

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 9/141 (6%)

Query: 38  IMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSA-RFFGIDL 96
           I +I H+L   L   L  +P+ +   +   VLDVG G G W +D A  + +A +  G D+
Sbjct: 102 IDIIHHYLLLALDGKLHLAPVGD---DAKSVLDVGTGTGIWAIDFADEHPNAEQVIGTDI 158

Query: 97  FPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCK 156
            PI P  + P NV+F   D      +  NTFD++H   +    +I +W  + QE  RVCK
Sbjct: 159 SPIQPSWVPP-NVKFEIEDCTQPWTFSPNTFDFIHMRYLYG--SIGDWGALFQEAYRVCK 215

Query: 157 PGGYIEFSE--PELAVKTGPV 175
           PGG++E  E  P L    G V
Sbjct: 216 PGGWVESFEASPRLESDDGTV 236



>gi|429857245|gb|ELA32119.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 293

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 69/140 (49%), Gaps = 4/140 (2%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           KY+ PN  ++ D + I + L   +F + F S  +N      +VLD+G G G W +D A  
Sbjct: 14  KYYLPNDAREQDRLDIINHLWAIVFDDGFCSCPKND--GAKRVLDLGTGTGAWAMDYADA 71

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y  A   G+DL PI P  + P N  F   DV     +    FD++   NM   FT E W 
Sbjct: 72  YPDAHVIGVDLSPIQPAYV-PPNCAFEVDDVDKEWTW-SQPFDFILCRNMNMSFTAEGWE 129

Query: 146 FVIQELIRVCKPGGYIEFSE 165
            ++++     +PGGY+E  +
Sbjct: 130 TMMRQAYDALEPGGYLEIQD 149



>gi|302881127|ref|XP_003039483.1| hypothetical protein NECHADRAFT_56071 [Nectria haematococca mpVI
           77-13-4]
 gi|256720332|gb|EEU33770.1| hypothetical protein NECHADRAFT_56071 [Nectria haematococca mpVI
           77-13-4]
          Length = 339

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 71/152 (46%), Gaps = 12/152 (7%)

Query: 12  HSRREIKKMEKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLD 70
           HS+R     E     Y+ PN  +    M I H +   L    L  +P+   +    KVLD
Sbjct: 48  HSQRGPGNAE-----YWAPNDDQHNTSMDIQHHVWTLLLDGKLHLAPLPGQV---GKVLD 99

Query: 71  VGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYV 130
           VG G G W +D A  +  A   G+DL P  P  + P N  F   DV     + +N FD+V
Sbjct: 100 VGTGTGIWAIDFADEHPEAVVVGVDLSPTQPDWV-PPNCRFEIDDVSLRWTWPENEFDFV 158

Query: 131 HQANMLSVFTIEEWFFVIQELIRVCKPGGYIE 162
           +   M   F  ++W  V  E  RVCKPGGY+E
Sbjct: 159 YLRTMFGSF--KDWQHVFNEAYRVCKPGGYVE 188



>gi|391868351|gb|EIT77569.1| hypothetical protein Ao3042_06361 [Aspergillus oryzae 3.042]
          Length = 339

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 26  KYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y  PN   + D + ++ H     L   LF +P+EN       +LD+G G G W +D+A 
Sbjct: 67  QYIMPNDEAEQDRLDLVHHMFSVMLNGELFLAPVENP----QTILDLGTGTGIWAIDVAD 122

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + SA+  G DL PI P  + P NVEF   D  +   +D N FDYVH   +     +++W
Sbjct: 123 QFPSAKVIGNDLSPIQPSWV-PPNVEFVVDDFEDVWMHDRNYFDYVHARTISGC--VQDW 179

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
             ++++     KP GY E +E
Sbjct: 180 GRLMKQAYDHLKPSGYFECAE 200



>gi|336244256|ref|XP_003343257.1| hypothetical protein SMAC_09737 [Sordaria macrospora k-hell]
 gi|380086669|emb|CCC05662.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 395

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 71/138 (51%), Gaps = 6/138 (4%)

Query: 26  KYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN  K  +++ I H     LF   L++SP+    +    V+D+G G G W +D A 
Sbjct: 119 EYWGPNDAKANEMLDILHAALVMLFDGKLYTSPLNEKEIK--NVIDIGTGTGLWAIDFAD 176

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +    G D+ PI P  + P N  F   D      Y +N FD++H   ++ V  I++W
Sbjct: 177 DHPNCNVIGTDISPIQPSWLPP-NTCFEIVDASKEWTYQENYFDFIHLRWLIGV--IKDW 233

Query: 145 FFVIQELIRVCKPGGYIE 162
             + +E  R CKPGG+IE
Sbjct: 234 DALYKEAYRCCKPGGWIE 251



>gi|409077309|gb|EKM77675.1| hypothetical protein AGABI1DRAFT_114977 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 290

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 111/245 (45%), Gaps = 13/245 (5%)

Query: 53  LFSSPIENSLLNECKVLDVGCGPGTWLLDLA-ATYSSARFFGIDL-FPIFPK-EIKPSNV 109
           +  +PI+  L ++ +VL+   G G WL DLA  T++  ++ G+D+    FPK    P N+
Sbjct: 49  VLHAPIK--LNDDDRVLETATGTGIWLQDLARETHAKPQYTGVDIESAFFPKASTLPPNM 106

Query: 110 EFRQGDVLNTLPYD-DNTFDYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPEL 168
            F    V   LP +  N F  VHQ  +++     EW   ++E+ RV KPGG+++  E + 
Sbjct: 107 RFETQSV-TALPSEWTNHFSLVHQRLLIAALRRHEWGTALKEIYRVLKPGGWVQLLEMQ- 164

Query: 169 AVKTGPVLSRFYDALVTLSDSRNVKIRISNEIIKTLVSLSTVRNVDYKISTVTLGAKKGG 228
              +GP L++  D L   SD   +  R   + +   +  S   N+        LGA  G 
Sbjct: 165 GWTSGPALAKHTDLLFKFSDDVGIMYRDIAKRLPDFLEESGFANIHQDPRATPLGAWAGT 224

Query: 229 ---NAGQAYMDIHDGYFLNDPMPETLCKFMGTTKEGYLKLFKEAKKEVNETFAPNCEIYR 285
              +  +  M + +G  L  P+       +  ++  Y  L KE  +E++ T     +   
Sbjct: 225 DGVDGKEVLMGVLEG--LKTPILRKGGYGVIESETEYDALLKEISEELDNTPGSVAKWTM 282

Query: 286 IWCQK 290
            W QK
Sbjct: 283 FWAQK 287



>gi|296416541|ref|XP_002837935.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633826|emb|CAZ82126.1| unnamed protein product [Tuber melanosporum]
          Length = 341

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 7/140 (5%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y  PN   + D + + H +   +    L  +PI +   N  K+LD+G G G W +D+A  
Sbjct: 66  YLMPNDETEQDRLDMMHHIYLMMLDGKLHLAPIGD---NPQKILDIGTGTGIWAIDMANE 122

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           Y SA   G DL PI P+ + P N  F   D  +   +  ++FD++H  ++    T  +W 
Sbjct: 123 YPSAEVIGTDLSPIQPQWVPP-NCRFEVDDAGSPWTFSPDSFDFIHSRHLSGALT--DWP 179

Query: 146 FVIQELIRVCKPGGYIEFSE 165
             I ++ R  KPG +++ SE
Sbjct: 180 EYIGQVYRTLKPGAWMQLSE 199



>gi|399170470|emb|CCE28847.1| uncharacterized protein CPUR_02536 [Claviceps purpurea 20.1]
          Length = 340

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 88/179 (49%), Gaps = 15/179 (8%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECK 67
           ++SH R      ++    YF PN  +  +   +  H+L   L   LF SP+E   ++  +
Sbjct: 54  RQSHGR--TYHSDRFAANYFIPNDDQQLESEELCHHYLTILLDDQLFLSPLEKDKVH--R 109

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLDVG G G W ++ A  + +A   G DL P  P+ + P N+ F   D      ++ N F
Sbjct: 110 VLDVGTGSGIWAIEFADQFPNASVVGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNTNHF 168

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSEPELAVKTG-------PVLSRF 179
           D++H   +  V  IE+W  + +E  R C PGG++E  E ++  ++        PVL+ +
Sbjct: 169 DFIHMRYI--VGGIEDWAALFKEAYRCCAPGGWVESVEYDVEFRSDDGTTELEPVLASY 225



>gi|399170952|emb|CCE28046.1| uncharacterized protein CPUR_01520 [Claviceps purpurea 20.1]
          Length = 340

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 10/168 (5%)

Query: 9   KKSHSRREIKKMEKEPLKYFFPNFVKDTD-IMVIFHFLECYLFQNLFSSPIENSLLNECK 67
           +++H R      +K    YF PN  +  + + +  H+L       LF +P+E   ++  +
Sbjct: 54  RRNHGR--TYHSDKFATNYFLPNDDQQLESVELAHHYLTILFGDQLFLAPLEKYKIH--R 109

Query: 68  VLDVGCGPGTWLLDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTF 127
           VLD+G G G W ++ A  + +    G DL P  P+ I P NV F   D      ++DN F
Sbjct: 110 VLDIGTGTGIWAIEFADQFPNTSVIGTDLSPCQPQWI-PPNVRFEIDDATLEWTWNDNHF 168

Query: 128 DYVHQANMLSVFTIEEWFFVIQELIRVCKPGGYIEFSE--PELAVKTG 173
           D++H   +  V  I++W  + +E  R C PGG++E  E  PE     G
Sbjct: 169 DFIHIRYI--VGGIQDWPGLFKEAYRCCAPGGWVESVEIDPEFCSDDG 214



>gi|399170488|emb|CCE28865.1| uncharacterized protein CPUR_02555 [Claviceps purpurea 20.1]
          Length = 351

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 80/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           +FFPN  +      +FH     L  + LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 81  FFFPNDDQQLKSEELFHHSSTILLDDQLFLAPLERDKIH--RVLDVGTGSGIWAIEFADQ 138

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      ++ N FD++H   +  V  IE+W 
Sbjct: 139 FPNASVIGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNANHFDFIHMRYI--VGGIEDWT 195

Query: 146 FVIQELIRVCKPGGYIEF--SEPELAVKTG-----PVLSRF 179
            + +E  R C PGG++E    EPE     G     PVL+ +
Sbjct: 196 ALFKEAYRCCAPGGWVESIEYEPEFRSDDGTTELEPVLASY 236



>gi|336467782|gb|EGO55946.1| hypothetical protein NEUTE1DRAFT_124248 [Neurospora tetrasperma
           FGSC 2508]
 gi|350287561|gb|EGZ68797.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 373

 Score = 79.7 bits (195), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 7/144 (4%)

Query: 26  KYFFPNFVKDTDIMVIFH-FLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
           +Y+ PN     +++ IFH F+  +L   L+++P+++++ N    LDV  G G W +D A 
Sbjct: 98  EYWGPNDEIANEMLDIFHHFMTLFLDGKLYTAPLKDNIQN---ALDVCTGTGLWAIDFAD 154

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
            + +   +G D+ PI P  + P N+ F   DV     Y +N FDYVH   + +V  +++W
Sbjct: 155 EHPNCNVYGTDISPIQPNWV-PPNLRFDIEDVTKPWTYQENFFDYVHIRWLTAV--VKDW 211

Query: 145 FFVIQELIRVCKPGGYIEFSEPEL 168
             + +E+ +  KPGG++E  + E+
Sbjct: 212 PALYREVYKCMKPGGWLEHIDAEV 235



>gi|336469845|gb|EGO58007.1| hypothetical protein NEUTE1DRAFT_146482 [Neurospora tetrasperma
           FGSC 2508]
 gi|350290475|gb|EGZ71689.1| S-adenosyl-L-methionine-dependent methyltransferase [Neurospora
           tetrasperma FGSC 2509]
          Length = 387

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 71/139 (51%), Gaps = 7/139 (5%)

Query: 25  LKYFFPNFVKDTDIMVIF-HFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLA 83
           ++Y+ PN  K  D + I+ H +E      L  SP+++++    +V+D+G G G W +D A
Sbjct: 110 IEYWAPNDEKHLDSLEIYYHGVELLNDHQLHMSPLKDNIE---RVIDIGTGAGFWAIDFA 166

Query: 84  ATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEE 143
             Y +    G D+ P+ P  + P N+ F   D      Y  N FD VH      V  IE+
Sbjct: 167 DKYPNCEVIGTDISPMQPSWVPP-NLNFEISDASKEWTYKPNYFDLVHV--RFFVGAIED 223

Query: 144 WFFVIQELIRVCKPGGYIE 162
           W    +E  +VCKPGG+IE
Sbjct: 224 WNAFYREAFKVCKPGGWIE 242



>gi|399171424|emb|CCE27614.1| uncharacterized protein CPUR_01088 [Claviceps purpurea 20.1]
          Length = 340

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 13/159 (8%)

Query: 27  YFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   +  HFL   L   LF +P+E   ++  +VLDVG G G W ++ A  
Sbjct: 70  YFIPNDDQQLESEELCHHFLTILLNDQLFLAPLEKDKIH--RVLDVGTGSGIWAIEFADQ 127

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      ++ N FD++H   +  V  I++W 
Sbjct: 128 FPNASVIGTDLSPCQPQWV-PPNLCFEIDDATLEWTWNANHFDFIHMRYI--VGGIQDWS 184

Query: 146 FVIQELIRVCKPGGYIEFS--EPELAVKTG-----PVLS 177
            +++E  R C PGG++E    EPE     G     PVL+
Sbjct: 185 ALLKEAYRCCAPGGWVESVEYEPEFRSDDGTTELEPVLA 223



>gi|322697875|gb|EFY89650.1| TAM domain methyltransferase [Metarhizium acridum CQMa 102]
          Length = 313

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 79/141 (56%), Gaps = 10/141 (7%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           Y FPN  ++ D + + H     L  + LF +PI+    +  ++LD+G G G W + +   
Sbjct: 42  YPFPNDEREQDRLDMLHHATTRLLDDRLFLAPIQP---DGMRILDIGTGTGLWPIQMGDL 98

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDV-LNTLPYDDNTFDYVHQANMLSVFTIEEW 144
           Y  A   G DL PI P  + P+NV F   DV L+ +  + NT+DY+H  +M +  +I++W
Sbjct: 99  YPGASITGNDLSPIQPTWV-PTNVNFLVDDVELDWI--ETNTYDYIHCRSMSA--SIKDW 153

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
             +I+++    KPGG++EF E
Sbjct: 154 PRLIRQIHDALKPGGWVEFQE 174



>gi|512206220|gb|EPE35040.1| S-adenosyl-L-methionine-dependent methyltransferase [Glarea
           lozoyensis ATCC 20868]
          Length = 390

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 72/139 (51%), Gaps = 6/139 (4%)

Query: 27  YFFPNFVKDTDIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATY 86
           Y FPN   + +   + H +   L Q L  +PI     N   VLD+G G G W +++A  Y
Sbjct: 121 YNFPNDDSEQEREDMKHAMMVNLCQTLHFAPIGP---NPQNVLDMGTGTGIWAIEMADQY 177

Query: 87  SSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFF 146
            SA   G+DL PI P+ + P NV+F   DV +     +N FDYVH  +  +V  I+ W  
Sbjct: 178 PSANVLGVDLSPIQPEWVPP-NVKFMVDDVESPWLKPENYFDYVHARH--TVMAIKNWPK 234

Query: 147 VIQELIRVCKPGGYIEFSE 165
           ++  + +  KPGG+ E  E
Sbjct: 235 LMNNVYKHLKPGGWFELQE 253



>gi|242795021|ref|XP_002482494.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242795026|ref|XP_002482495.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218719082|gb|EED18502.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218719083|gb|EED18503.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 331

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 73/141 (51%), Gaps = 6/141 (4%)

Query: 26  KYFFPNFVKDTDIM-VIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAA 84
            Y  PN  K+ D + ++ H     L  +L  S  +  L N  K+LDVG G G W +++A 
Sbjct: 57  SYMLPNDDKEQDRLDLLNHVFRLCLDGDLCYS--QKQLENPQKILDVGTGTGIWAIEMAD 114

Query: 85  TYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEW 144
           TY SA   GIDL PI PK + P NV+F   D+     +  N+FD++H   +    +I  W
Sbjct: 115 TYPSAEVVGIDLSPIQPKWV-PVNVKFIIDDITQPWDFPVNSFDFIHVRCLAG--SITNW 171

Query: 145 FFVIQELIRVCKPGGYIEFSE 165
              ++   R  KPGG IE SE
Sbjct: 172 PEFLEHAYRHLKPGGRIELSE 192



>gi|399170449|emb|CCE28826.1| uncharacterized protein CPUR_02515 [Claviceps purpurea 20.1]
          Length = 358

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 79/161 (49%), Gaps = 13/161 (8%)

Query: 27  YFFPNFVKDTDIMVIFHF-LECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAAT 85
           YF PN  +  +   I H  L   L   LF +P++   ++  +VLDVG G G W ++ A  
Sbjct: 88  YFIPNDDQQLETEEICHHGLTILLDDQLFLAPLKKDKIH--RVLDVGTGSGIWAIEFADQ 145

Query: 86  YSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWF 145
           + +A   G DL P  P+ + P N+ F   D      +D N FD++H   +  V  IE+W 
Sbjct: 146 FPNASVIGTDLSPCQPQWV-PPNLCFEIDDATLEWTWDANHFDFIHMRYI--VGGIEDWT 202

Query: 146 FVIQELIRVCKPGGYIEF--SEPELAVKTG-----PVLSRF 179
            + +E  R C PGG++E    EPE     G     PVL+ +
Sbjct: 203 ALFKEAYRCCAPGGWVESLEYEPEFCSDDGSIELEPVLASY 243



>gi|320594082|gb|EFX06485.1| methyltransferase type 11 [Grosmannia clavigera kw1407]
          Length = 375

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 7/146 (4%)

Query: 21  EKEPLKYFFPNFVKDTDIMVIFHFLECYLFQN-LFSSPIENSLLNECKVLDVGCGPGTWL 79
           E+  ++Y+  N    ++ M I H +      N L+ +P+++ +    +VLD+G G G W 
Sbjct: 95  EQGDVQYWASNDETQSESMDINHHVLLLSTNNKLYFAPLKDDV---HRVLDIGTGTGMWA 151

Query: 80  LDLAATYSSARFFGIDLFPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVF 139
           +D A  +  A   G D+ PI P  + P N +F   D      + +N+FDYVH   +    
Sbjct: 152 IDFADDHPGAEVIGTDISPIQPIWVPP-NTKFELEDFTQPWTFPENSFDYVHMRWLYG-- 208

Query: 140 TIEEWFFVIQELIRVCKPGGYIEFSE 165
           ++ +W  +I+E  RV KPGG+IE SE
Sbjct: 209 SVPDWTKLIREAYRVLKPGGWIESSE 234



>gi|399170356|emb|CCE28733.1| uncharacterized protein CPUR_02421 [Claviceps purpurea 20.1]
          Length = 344

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 73/150 (48%), Gaps = 12/150 (8%)

Query: 37  DIMVIFHFLECYLFQNLFSSPIENSLLNECKVLDVGCGPGTWLLDLAATYSSARFFGIDL 96
           +++   H L       LF +P+E   ++  +VLDVG G G W ++ A  + +A   G DL
Sbjct: 90  NVIASHHALTVLFDDQLFQAPLEKDKIH--RVLDVGTGTGIWAIEFADQFPNASVIGTDL 147

Query: 97  FPIFPKEIKPSNVEFRQGDVLNTLPYDDNTFDYVHQANMLSVFTIEEWFFVIQELIRVCK 156
            P  P+ I P NV F   D      +D N FD++H    L    IE+W  + +E  R C 
Sbjct: 148 SPCQPQWI-PPNVRFEIDDAGLEWTWDANYFDFIHM--RLIYGGIEDWTRLFKEAFRCCA 204

Query: 157 PGGYIEFSEPEL-------AVKTGPVLSRF 179
           PGG++E  E ++         K  P+L+ F
Sbjct: 205 PGGWVESVEGDVEFCSDDGTTKLEPILASF 234