BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10060_c0_seq2-m.25 5prime_partial 153-698(-) 182 (-)
         (181 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|510999527|gb|EPB81148.1| hypothetical protein HMPREF1544_1214...   218   4e-55   Mucor circinelloides f. circinelloides 1006PhL
gi|302697295|ref|XP_003038326.1| hypothetical protein SCHCODRAFT...   214   6e-54   Schizophyllum commune H4-8
gi|170106123|ref|XP_001884273.1| predicted protein [Laccaria bic...   209   3e-52   Laccaria bicolor S238N-H82
gi|451847536|gb|EMD60843.1| hypothetical protein COCSADRAFT_9810...   206   1e-51   Bipolaris sorokiniana ND90Pr
gi|451996606|gb|EMD89072.1| hypothetical protein COCHEDRAFT_1108...   206   3e-51   Bipolaris maydis C5
gi|169599362|ref|XP_001793104.1| hypothetical protein SNOG_02499...   204   6e-51   Parastagonospora nodorum SN15
gi|189204912|ref|XP_001938791.1| tRNA-specific adenosine deamina...   203   1e-50   Pyrenophora tritici-repentis Pt-1C-BFP
gi|392569025|gb|EIW62199.1| cytidine deaminase-like protein [Tra...   203   1e-50   Trametes versicolor FP-101664 SS1
gi|299747155|ref|XP_002911134.1| tRNA specific adenosine deamina...   202   2e-50   Coprinopsis cinerea okayama7#130
gi|396490433|ref|XP_003843335.1| hypothetical protein LEMA_P0744...   202   2e-50   Leptosphaeria maculans JN3
gi|330933338|ref|XP_003304140.1| hypothetical protein PTT_16586 ...   202   2e-50   Pyrenophora teres f. teres 0-1
gi|389744315|gb|EIM85498.1| cytidine deaminase-like protein [Ste...   202   3e-50   Stereum hirsutum FP-91666 SS1
gi|336368474|gb|EGN96817.1| hypothetical protein SERLA73DRAFT_11...   202   3e-50   Serpula lacrymans var. lacrymans S7.3
gi|390600804|gb|EIN10198.1| cytidine deaminase-like protein [Pun...   201   4e-50   Punctularia strigosozonata HHB-11173 SS5
gi|395330718|gb|EJF63101.1| tRNA specific adenosine deaminase [D...   201   6e-50   Dichomitus squalens LYAD-421 SS1
gi|407927088|gb|EKG19992.1| CMP/dCMP deaminase zinc-binding prot...   201   8e-50   Macrophomina phaseolina MS6
gi|388852518|emb|CCF53920.1| related to TAD2-tRNA-specific adeno...   200   1e-49   Ustilago hordei
gi|485916507|gb|EOD43836.1| putative trna-specific adenosine dea...   200   2e-49   Neofusicoccum parvum UCRNP2
gi|392590084|gb|EIW79414.1| cytidine deaminase-like protein [Con...   200   2e-49   Coniophora puteana RWD-64-598 SS2
gi|409075337|gb|EKM75718.1| hypothetical protein AGABI1DRAFT_640...   199   2e-49   Agaricus bisporus var. burnettii JB137-S8
gi|426197990|gb|EKV47916.1| hypothetical protein AGABI2DRAFT_219...   198   4e-49   Agaricus bisporus var. bisporus H97
gi|295671881|ref|XP_002796487.1| tRNA-specific adenosine deamina...   197   6e-49   
gi|393246614|gb|EJD54123.1| cytidine deaminase-like protein [Aur...   197   7e-49   Auricularia subglabra TFB-10046 SS5
gi|401881859|gb|EJT46141.1| tRNA specific adenosine deaminase [T...   197   9e-49   Trichosporon asahii var. asahii CBS 2479
gi|392572964|gb|EIW66107.1| hypothetical protein TREMEDRAFT_7486...   197   1e-48   Tremella mesenterica DSM 1558
gi|71003327|ref|XP_756344.1| hypothetical protein UM00197.1 [Ust...   196   2e-48   
gi|443896088|dbj|GAC73432.1| hypothetical protein PANT_9c00117 [...   196   2e-48   Moesziomyces antarcticus T-34
gi|482805799|gb|EOA82885.1| hypothetical protein SETTUDRAFT_9649...   196   2e-48   Setosphaeria turcica Et28A
gi|225681358|gb|EEH19642.1| tRNA-specific adenosine deaminase su...   196   2e-48   
gi|323507722|emb|CBQ67593.1| related to TAD2-tRNA-specific adeno...   196   3e-48   Sporisorium reilianum SRZ2
gi|501307785|dbj|GAC96727.1| hypothetical protein PHSY_004311 [P...   194   6e-48   Pseudozyma hubeiensis SY62
gi|325092201|gb|EGC45511.1| tRNA specific adenosine deaminase [A...   194   7e-48   Histoplasma capsulatum H88
gi|121714253|ref|XP_001274737.1| cytidine and deoxycytidylate de...   193   1e-47   Aspergillus clavatus NRRL 1
gi|353237686|emb|CCA69653.1| related to TAD2-tRNA-specific adeno...   193   1e-47   Serendipita indica DSM 11827
gi|242219384|ref|XP_002475472.1| predicted protein [Postia place...   193   2e-47   Postia placenta Mad-698-R
gi|403417271|emb|CCM03971.1| predicted protein [Fibroporia radic...   192   2e-47   Fibroporia radiculosa
gi|326470308|gb|EGD94317.1| tRNA-specific adenosine deaminase su...   192   2e-47   Trichophyton tonsurans CBS 112818
gi|321260564|ref|XP_003195002.1| tRNA specific adenosine deamina...   192   2e-47   Cryptococcus gattii WM276
gi|58268162|ref|XP_571237.1| tRNA specific adenosine deaminase [...   192   3e-47   Cryptococcus neoformans var. neoformans JEC21
gi|315040523|ref|XP_003169639.1| tRNA-specific adenosine deamina...   191   5e-47   Microsporum gypseum CBS 118893
gi|328857268|gb|EGG06385.1| hypothetical protein MELLADRAFT_8657...   191   6e-47   Melampsora larici-populina 98AG31
gi|453082997|gb|EMF11043.1| tRNA specific adenosine deaminase, p...   191   7e-47   Sphaerulina musiva SO2202
gi|449296701|gb|EMC92720.1| hypothetical protein BAUCODRAFT_1145...   191   7e-47   Baudoinia panamericana UAMH 10762
gi|240281302|gb|EER44805.1| tRNA specific adenosine deaminase [A...   191   7e-47   Histoplasma capsulatum H143
gi|393215384|gb|EJD00875.1| cytidine deaminase-like protein [Fom...   191   9e-47   Fomitiporia mediterranea MF3/22
gi|327292493|ref|XP_003230945.1| tRNA-specific adenosine deamina...   190   1e-46   Trichophyton rubrum CBS 118892
gi|212535962|ref|XP_002148137.1| tRNA-specific adenosine deamina...   189   2e-46   Talaromyces marneffei ATCC 18224
gi|440637738|gb|ELR07657.1| hypothetical protein GMDG_08512 [Geo...   189   3e-46   Pseudogymnoascus destructans 20631-21
gi|505754752|gb|EOQ99052.1| tRNA-specific adenosine deaminase 2 ...   188   4e-46   Wallemia ichthyophaga EXF-994
gi|296819611|ref|XP_002849875.1| tRNA specific adenosine deamina...   188   5e-46   Arthroderma otae CBS 113480
gi|328771384|gb|EGF81424.1| hypothetical protein BATDEDRAFT_8736...   187   6e-46   Batrachochytrium dendrobatidis JAM81
gi|242794450|ref|XP_002482376.1| cytosine deaminase, putative [T...   187   8e-46   Talaromyces stipitatus ATCC 10500
gi|452839327|gb|EME41266.1| hypothetical protein DOTSEDRAFT_7362...   186   2e-45   Dothistroma septosporum NZE10
gi|430812031|emb|CCJ30558.1| unnamed protein product, partial [P...   186   2e-45   Pneumocystis jirovecii
gi|317034863|ref|XP_001400634.2| cytidine and deoxycytidylate de...   186   3e-45   Aspergillus niger CBS 513.88
gi|50553008|ref|XP_503914.1| YALI0E13728p [Yarrowia lipolytica] ...   185   5e-45   Yarrowia lipolytica CLIB122
gi|303320905|ref|XP_003070447.1| Cytidine and deoxycytidylate de...   183   1e-44   Coccidioides posadasii C735 delta SOWgp
gi|388579183|gb|EIM19510.1| cytidine deaminase-like protein [Wal...   183   1e-44   Wallemia mellicola CBS 633.66
gi|327356422|gb|EGE85279.1| tRNA specific adenosine deaminase [A...   183   2e-44   
gi|472580906|gb|EMS18673.1| tRNA specific adenosine deaminase [R...   182   2e-44   Rhodotorula toruloides NP11
gi|119179553|ref|XP_001241350.1| hypothetical protein CIMG_08513...   182   2e-44   Coccidioides immitis RS
gi|238508831|ref|XP_002385598.1| cytosine deaminase, putative [A...   182   3e-44   Aspergillus flavus NRRL3357
gi|452977117|gb|EME76890.1| hypothetical protein MYCFIDRAFT_1224...   181   6e-44   Cercospora fijiensis CIRAD86
gi|358059398|dbj|GAA94804.1| hypothetical protein E5Q_01458 [Mix...   180   1e-43   Mixia osmundae IAM 14324
gi|398406661|ref|XP_003854796.1| hypothetical protein MYCGRDRAFT...   179   2e-43   Zymoseptoria tritici IPO323
gi|345569662|gb|EGX52527.1| hypothetical protein AOL_s00043g21 [...   178   5e-43   Arthrobotrys oligospora ATCC 24927
gi|501753157|emb|CCG83097.1| tRNA-specific adenosine deaminase s...   177   1e-42   Taphrina deformans PYCC 5710
gi|261188113|ref|XP_002620473.1| tRNA-specific adenosine-34 deam...   176   2e-42   Blastomyces gilchristii SLH14081
gi|512206567|gb|EPE35386.1| Cytidine deaminase-like protein [Gla...   175   3e-42   Glarea lozoyensis ATCC 20868
gi|336381263|gb|EGO22415.1| hypothetical protein SERLADRAFT_3626...   175   4e-42   Serpula lacrymans var. lacrymans S7.9
gi|254568360|ref|XP_002491290.1| Subunit of tRNA-specific adenos...   174   1e-41   Komagataella phaffii GS115
gi|403158227|ref|XP_003307544.2| hypothetical protein PGTG_00494...   172   4e-41   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|378732653|gb|EHY59112.1| hypothetical protein HMPREF1120_0711...   171   6e-41   Exophiala dermatitidis NIH/UT8656
gi|402226018|gb|EJU06078.1| cytidine deaminase-like protein [Dac...   170   1e-40   Dacryopinax primogenitus
gi|448110895|ref|XP_004201713.1| Piso0_001912 [Millerozyma farin...   169   3e-40   Millerozyma farinosa CBS 7064
gi|406861289|gb|EKD14344.1| tRNA-specific adenosine deaminase su...   168   4e-40   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|194033488|ref|XP_001924271.1| PREDICTED: tRNA-specific adenos...   168   4e-40   Sus scrofa [pigs]
gi|405968829|gb|EKC33858.1| tRNA-specific adenosine deaminase 2 ...   168   6e-40   Crassostrea gigas
gi|296199377|ref|XP_002747141.1| PREDICTED: tRNA-specific adenos...   167   7e-40   Callithrix jacchus [common marmoset]
gi|448096873|ref|XP_004198536.1| Piso0_001912 [Millerozyma farin...   167   8e-40   Millerozyma farinosa CBS 7064
gi|291397092|ref|XP_002714901.1| PREDICTED: deaminase domain con...   167   1e-39   Oryctolagus cuniculus [European rabbit]
gi|109072525|ref|XP_001091638.1| PREDICTED: tRNA-specific adenos...   167   1e-39   Macaca mulatta [rhesus macaque]
gi|124107608|ref|NP_872309.2| tRNA-specific adenosine deaminase ...   167   1e-39   Homo sapiens [man]
gi|507534308|ref|XP_004651210.1| PREDICTED: tRNA-specific adenos...   167   1e-39   Jaculus jaculus
gi|77736501|ref|NP_001029952.1| tRNA-specific adenosine deaminas...   166   1e-39   Bos taurus [bovine]
gi|426234913|ref|XP_004011436.1| PREDICTED: tRNA-specific adenos...   166   2e-39   Ovis aries [domestic sheep]
gi|297679305|ref|XP_002817478.1| PREDICTED: tRNA-specific adenos...   166   2e-39   Pongo abelii [Orang-utan]
gi|114609579|ref|XP_518775.2| PREDICTED: tRNA-specific adenosine...   166   2e-39   Pan troglodytes
gi|113816713|gb|AAH37955.2| ADAT2 protein [Homo sapiens]              166   2e-39   Homo sapiens [man]
gi|403269821|ref|XP_003926910.1| PREDICTED: tRNA-specific adenos...   166   2e-39   Saimiri boliviensis boliviensis
gi|470319703|gb|EMR11313.1| hypothetical protein PNEG_00342 [Pne...   166   2e-39   Pneumocystis murina B123
gi|332213485|ref|XP_003255854.1| PREDICTED: tRNA-specific adenos...   166   2e-39   Nomascus leucogenys [White-cheeked Gibbon]
gi|478533782|ref|XP_004441028.1| PREDICTED: tRNA-specific adenos...   166   2e-39   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|295442884|ref|NP_596505.2| tRNA specific adenosine deaminase ...   165   4e-39   Schizosaccharomyces pombe 972h-
gi|406607760|emb|CCH40865.1| putative riboflavin biosynthesis pr...   165   5e-39   Wickerhamomyces ciferrii
gi|410960192|ref|XP_003986678.1| PREDICTED: tRNA-specific adenos...   165   5e-39   Felis catus [cat]
gi|344263898|ref|XP_003404032.1| PREDICTED: tRNA-specific adenos...   165   5e-39   Loxodonta africana [African bush elephant]
gi|355562010|gb|EHH18642.1| hypothetical protein EGK_15289 [Maca...   164   8e-39   Macaca mulatta [rhesus macaque]
gi|301753666|ref|XP_002912694.1| PREDICTED: tRNA-specific adenos...   164   9e-39   Ailuropoda melanoleuca
gi|508784781|gb|EOY32037.1| Cytidine/deoxycytidylate deaminase f...   164   9e-39   Theobroma cacao [chocolate]
gi|198443277|pdb|3DH1|A Chain A, Crystal Structure Of Human Trna...   164   1e-38   Homo sapiens [man]
gi|502076876|ref|XP_004485484.1| PREDICTED: tRNA-specific adenos...   164   1e-38   
gi|471356643|ref|XP_004368920.1| PREDICTED: tRNA-specific adenos...   163   2e-38   Trichechus manatus latirostris
gi|395834682|ref|XP_003790323.1| PREDICTED: tRNA-specific adenos...   163   2e-38   Otolemur garnettii
gi|472354897|ref|XP_004397105.1| PREDICTED: tRNA-specific adenos...   163   2e-38   Odobenus rosmarus divergens
gi|502107339|ref|XP_004493233.1| PREDICTED: tRNA-specific adenos...   163   2e-38   
gi|512883307|ref|XP_004895702.1| PREDICTED: tRNA-specific adenos...   162   2e-38   
gi|465973583|ref|XP_004263804.1| PREDICTED: tRNA-specific adenos...   162   2e-38   Orcinus orca [Orca]
gi|511859500|ref|XP_004752802.1| PREDICTED: tRNA-specific adenos...   162   2e-38   Mustela putorius furo [black ferret]
gi|345784418|ref|XP_003432552.1| PREDICTED: tRNA-specific adenos...   162   3e-38   
gi|507634365|ref|XP_004628642.1| PREDICTED: tRNA-specific adenos...   162   4e-38   Octodon degus
gi|169234864|ref|NP_001108500.1| tRNA-specific adenosine deamina...   161   5e-38   Rattus norvegicus [brown rat]
gi|61098160|ref|NP_080024.3| tRNA-specific adenosine deaminase 2...   161   5e-38   Mus musculus [mouse]
gi|124360458|gb|ABN08468.1| CMP/dCMP deaminase, zinc-binding [Me...   161   6e-38   Medicago truncatula
gi|354475545|ref|XP_003499988.1| PREDICTED: tRNA-specific adenos...   161   6e-38   
gi|148228295|ref|NP_001089483.1| tRNA-specific adenosine deamina...   161   7e-38   Xenopus laevis [clawed frog]
gi|291244202|ref|XP_002741990.1| PREDICTED: tRNA-specific adenos...   160   8e-38   
gi|161784292|sp|Q5RIV4.2|ADAT2_DANRE RecName: Full=tRNA-specific...   160   9e-38   Danio rerio [leopard danio]
gi|290978118|ref|XP_002671783.1| predicted protein [Naegleria gr...   160   1e-37   Naegleria gruberi strain NEG-M
gi|134024903|gb|AAI35110.1| Unknown (protein for IMAGE:7163502) ...   160   1e-37   Danio rerio [leopard danio]
gi|213409075|ref|XP_002175308.1| tRNA-specific adenosine deamina...   160   1e-37   Schizosaccharomyces japonicus yFS275
gi|366986611|ref|XP_003673072.1| hypothetical protein NCAS_0A012...   160   1e-37   Naumovozyma castellii CBS 4309
gi|507925394|ref|XP_004673963.1| PREDICTED: tRNA-specific adenos...   160   2e-37   
gi|440911538|gb|ELR61196.1| tRNA-specific adenosine deaminase 2 ...   159   2e-37   Bos mutus
gi|79361008|ref|NP_564523.3| Cytidine/deoxycytidylate deaminase ...   159   2e-37   Arabidopsis thaliana [mouse-ear cress]
gi|255580984|ref|XP_002531310.1| tRNA-specific adenosine deamina...   159   3e-37   
gi|460394441|ref|XP_004242811.1| PREDICTED: tRNA-specific adenos...   158   4e-37   Solanum lycopersicum
gi|118404850|ref|NP_001072562.1| tRNA-specific adenosine deamina...   158   4e-37   Xenopus tropicalis [western clawed frog]
gi|390341832|ref|XP_789050.3| PREDICTED: tRNA-specific adenosine...   158   5e-37   
gi|255076837|ref|XP_002502085.1| predicted protein [Micromonas s...   158   5e-37   Micromonas commoda
gi|508784784|gb|EOY32040.1| Cytidine/deoxycytidylate deaminase f...   157   7e-37   Theobroma cacao [chocolate]
gi|443726587|gb|ELU13706.1| hypothetical protein CAPTEDRAFT_2116...   157   7e-37   Capitella teleta
gi|405121471|gb|AFR96240.1| tRNA specific adenosine deaminase [C...   157   7e-37   
gi|149744219|ref|XP_001497309.1| PREDICTED: tRNA-specific adenos...   157   9e-37   
gi|410079749|ref|XP_003957455.1| hypothetical protein KAFR_0E016...   157   9e-37   Kazachstania africana CBS 2517
gi|26388773|dbj|BAB32363.2| unnamed protein product [Mus musculus]    157   1e-36   Mus musculus [mouse]
gi|502076861|ref|XP_004485480.1| PREDICTED: tRNA-specific adenos...   157   1e-36   
gi|190689519|gb|ACE86534.1| adenosine deaminase, tRNA-specific 2...   156   2e-36   synthetic construct
gi|50305461|ref|XP_452690.1| hypothetical protein [Kluyveromyces...   156   2e-36   Kluyveromyces lactis NRRL Y-1140
gi|482573905|gb|EOA38092.1| hypothetical protein CARUB_v10009558...   156   2e-36   Capsella rubella
gi|308803957|ref|XP_003079291.1| Cytosine deaminase FCY1 and rel...   156   2e-36   Ostreococcus tauri
gi|502107327|ref|XP_004493229.1| PREDICTED: tRNA-specific adenos...   155   3e-36   
gi|115452727|ref|NP_001049964.1| Os03g0321900 [Oryza sativa Japo...   155   3e-36   
gi|348518351|ref|XP_003446695.1| PREDICTED: tRNA-specific adenos...   155   3e-36   Oreochromis niloticus
gi|281202068|gb|EFA76273.1| adenosine deaminase [Polysphondylium...   155   3e-36   Polysphondylium pallidum PN500
gi|297847068|ref|XP_002891415.1| EMB2191 [Arabidopsis lyrata sub...   155   4e-36   Arabidopsis lyrata subsp. lyrata
gi|47207020|emb|CAF91477.1| unnamed protein product [Tetraodon n...   155   4e-36   Tetraodon nigroviridis
gi|50742655|ref|XP_419709.1| PREDICTED: tRNA-specific adenosine ...   155   5e-36   Gallus gallus [bantam]
gi|513031308|gb|AGO11332.1| AaceriACR075Cp [Saccharomycetaceae s...   155   6e-36   Saccharomycetaceae sp. 'Ashbya aceri'
gi|299115717|emb|CBN74282.1| tRNA specific adenosine deaminase [...   154   7e-36   Ectocarpus siliculosus
gi|367014685|ref|XP_003681842.1| hypothetical protein TDEL_0E038...   154   7e-36   Torulaspora delbrueckii
gi|169642534|gb|AAI60619.1| Adat2 protein [Danio rerio]               154   8e-36   Danio rerio [leopard danio]
gi|502076873|ref|XP_004485483.1| PREDICTED: tRNA-specific adenos...   154   8e-36   
gi|410916027|ref|XP_003971488.1| PREDICTED: tRNA-specific adenos...   154   9e-36   
gi|334324233|ref|XP_001380965.2| PREDICTED: tRNA-specific adenos...   154   1e-35   
gi|365984601|ref|XP_003669133.1| hypothetical protein NDAI_0C023...   153   1e-35   Naumovozyma dairenensis CBS 421
gi|326915810|ref|XP_003204205.1| PREDICTED: tRNA-specific adenos...   153   1e-35   
gi|384491053|gb|EIE82249.1| hypothetical protein RO3G_06954 [Rhi...   153   2e-35   Rhizopus delemar RA 99-880
gi|502107336|ref|XP_004493232.1| PREDICTED: tRNA-specific adenos...   153   2e-35   
gi|281351029|gb|EFB26613.1| hypothetical protein PANDA_000408 [A...   153   2e-35   Ailuropoda melanoleuca
gi|45185761|ref|NP_983477.1| ACR075Cp [Ashbya gossypii ATCC 1089...   153   2e-35   Eremothecium gossypii ATCC 10895
gi|374106684|gb|AEY95593.1| FACR075Cp [Ashbya gossypii FDAG1]         152   2e-35   Eremothecium gossypii FDAG1
gi|260943466|ref|XP_002616031.1| hypothetical protein CLUG_03273...   152   2e-35   Clavispora lusitaniae ATCC 42720
gi|357508883|ref|XP_003624730.1| tRNA-specific adenosine deamina...   152   3e-35   
gi|356564819|ref|XP_003550645.1| PREDICTED: tRNA-specific adenos...   152   3e-35   Glycine max [soybeans]
gi|131888897|ref|NP_001076566.1| tRNA-specific adenosine deamina...   152   3e-35   Danio rerio [leopard danio]
gi|499035654|ref|XP_004568497.1| PREDICTED: tRNA-specific adenos...   152   3e-35   Maylandia zebra
gi|323304324|gb|EGA58097.1| Tad2p [Saccharomyces cerevisiae Fost...   152   4e-35   Saccharomyces cerevisiae FostersB
gi|6322425|ref|NP_012499.1| Tad2p [Saccharomyces cerevisiae S288...   152   4e-35   Saccharomyces cerevisiae S288c
gi|190409464|gb|EDV12729.1| tRNA-specific adenosine deaminase 2 ...   152   4e-35   Saccharomyces cerevisiae RM11-1a
gi|349579163|dbj|GAA24326.1| K7_Tad2p [Saccharomyces cerevisiae ...   152   5e-35   Saccharomyces cerevisiae Kyokai no. 7
gi|207343953|gb|EDZ71253.1| YJL035Cp-like protein [Saccharomyces...   152   5e-35   Saccharomyces cerevisiae AWRI1631
gi|356549373|ref|XP_003543068.1| PREDICTED: tRNA-specific adenos...   151   5e-35   Glycine max [soybeans]
gi|255718193|ref|XP_002555377.1| KLTH0G07832p [Lachancea thermot...   151   7e-35   Lachancea thermotolerans CBS 6340
gi|357119921|ref|XP_003561681.1| PREDICTED: tRNA-specific adenos...   151   7e-35   
gi|327261885|ref|XP_003215757.1| PREDICTED: tRNA-specific adenos...   151   8e-35   
gi|395535088|ref|XP_003769564.1| PREDICTED: tRNA-specific adenos...   150   9e-35   
gi|488520342|ref|XP_004452104.1| PREDICTED: tRNA-specific adenos...   150   9e-35   Dasypus novemcinctus
gi|66806365|ref|XP_636905.1| adenosine deaminase, tRNA-specific ...   150   1e-34   Dictyostelium discoideum AX4
gi|354547035|emb|CCE43768.1| hypothetical protein CPAR2_214120 [...   150   1e-34   Candida parapsilosis
gi|401625091|gb|EJS43116.1| tad2p [Saccharomyces arboricola H-6]      150   1e-34   Saccharomyces arboricola H-6
gi|168039996|ref|XP_001772482.1| predicted protein [Physcomitrel...   150   1e-34   Physcomitrella patens
gi|460394439|ref|XP_004242810.1| PREDICTED: tRNA-specific adenos...   150   1e-34   
gi|256271071|gb|EEU06172.1| Tad2p [Saccharomyces cerevisiae JAY291]   150   2e-34   Saccharomyces cerevisiae JAY291
gi|290771180|emb|CAY80744.2| Tad2p [Saccharomyces cerevisiae EC1...   150   2e-34   Saccharomyces cerevisiae EC1118
gi|432953475|ref|XP_004085413.1| PREDICTED: tRNA-specific adenos...   150   2e-34   Oryzias latipes [Japanese rice fish]
gi|255628537|gb|ACU14613.1| unknown [Glycine max]                     149   2e-34   Glycine max [soybeans]
gi|303276308|ref|XP_003057448.1| predicted protein [Micromonas p...   149   2e-34   Micromonas pusilla CCMP1545
gi|225555098|gb|EEH03391.1| tRNA specific adenosine deaminase [A...   149   3e-34   Histoplasma capsulatum G186AR
gi|485621479|gb|EOD17922.1| hypothetical protein EMIHUDRAFT_6159...   149   3e-34   Emiliania huxleyi CCMP1516
gi|449457197|ref|XP_004146335.1| PREDICTED: tRNA-specific adenos...   149   3e-34   Cucumis sativus [cucumbers]
gi|344233966|gb|EGV65836.1| cytidine deaminase-like protein [Can...   149   3e-34   Candida tenuis ATCC 10573
gi|485643250|gb|EOD37276.1| hypothetical protein EMIHUDRAFT_7056...   149   3e-34   Emiliania huxleyi CCMP1516
gi|326488167|dbj|BAJ89922.1| predicted protein [Hordeum vulgare ...   149   3e-34   Hordeum vulgare subsp. vulgare [barley]
gi|296413803|ref|XP_002836598.1| hypothetical protein [Tuber mel...   148   5e-34   Tuber melanosporum Mel28
gi|242041093|ref|XP_002467941.1| hypothetical protein SORBIDRAFT...   148   5e-34   Sorghum bicolor [broomcorn]
gi|330805063|ref|XP_003290507.1| hypothetical protein DICPUDRAFT...   148   5e-34   Dictyostelium purpureum
gi|392298400|gb|EIW09497.1| Tad2p [Saccharomyces cerevisiae CEN....   148   6e-34   Saccharomyces cerevisiae CEN.PK113-7D
gi|363756220|ref|XP_003648326.1| hypothetical protein Ecym_8224 ...   148   6e-34   Eremothecium cymbalariae DBVPG#7215
gi|449497359|ref|XP_002195924.2| PREDICTED: tRNA-specific adenos...   148   7e-34   
gi|323333035|gb|EGA74437.1| Tad2p [Saccharomyces cerevisiae AWRI...   148   7e-34   Saccharomyces cerevisiae AWRI796
gi|323308420|gb|EGA61665.1| Tad2p [Saccharomyces cerevisiae Fost...   148   7e-34   Saccharomyces cerevisiae FostersO
gi|449277893|gb|EMC85915.1| tRNA-specific adenosine deaminase 2,...   147   7e-34   Columba livia [carrier pigeon]
gi|156846411|ref|XP_001646093.1| hypothetical protein Kpol_543p6...   147   1e-33   Vanderwaltozyma polyspora DSM 70294
gi|365759969|gb|EHN01721.1| Tad2p [Saccharomyces cerevisiae x Sa...   147   1e-33   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|145347025|ref|XP_001417980.1| predicted protein [Ostreococcus...   147   1e-33   Ostreococcus lucimarinus CCE9901
gi|384253509|gb|EIE26984.1| catalytic/ hydrolase/ zinc ion bindi...   147   1e-33   Coccomyxa subellipsoidea C-169
gi|448514646|ref|XP_003867165.1| Tad2 protein [Candida orthopsil...   146   2e-33   Candida orthopsilosis Co 90-125
gi|238014692|gb|ACR38381.1| unknown [Zea mays] >gi|414872304|tpg...   146   2e-33   Zea mays [maize]
gi|323347994|gb|EGA82253.1| Tad2p [Saccharomyces cerevisiae Lalv...   146   2e-33   Saccharomyces cerevisiae Lalvin QA23
gi|345314820|ref|XP_001507477.2| PREDICTED: tRNA-specific adenos...   146   2e-33   
gi|149248448|ref|XP_001528611.1| conserved hypothetical protein ...   146   2e-33   Lodderomyces elongisporus NRRL YB-4239
gi|365764839|gb|EHN06358.1| Tad2p [Saccharomyces cerevisiae x Sa...   146   2e-33   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|226528904|ref|NP_001152082.1| tRNA-specific adenosine deamina...   145   3e-33   Zea mays [maize]
gi|68466625|ref|XP_722508.1| potential tRNA wobble position aden...   145   4e-33   Candida albicans SC5314
gi|254577709|ref|XP_002494841.1| ZYRO0A10890p [Zygosaccharomyces...   145   5e-33   Zygosaccharomyces rouxii CBS 732
gi|296090277|emb|CBI40096.3| unnamed protein product [Vitis vini...   145   5e-33   Vitis vinifera
gi|508784782|gb|EOY32038.1| Cytidine/deoxycytidylate deaminase f...   144   6e-33   Theobroma cacao [chocolate]
gi|391325021|ref|XP_003737039.1| PREDICTED: tRNA-specific adenos...   144   8e-33   Metaseiulus occidentalis
gi|294654357|ref|XP_456407.2| DEHA2A01584p [Debaryomyces hanseni...   143   1e-32   Debaryomyces hansenii CBS767
gi|470120829|ref|XP_004296490.1| PREDICTED: tRNA-specific adenos...   143   1e-32   Fragaria vesca subsp. vesca
gi|302794668|ref|XP_002979098.1| hypothetical protein SELMODRAFT...   143   2e-32   Selaginella moellendorffii
gi|326502722|dbj|BAJ98989.1| predicted protein [Hordeum vulgare ...   142   3e-32   Hordeum vulgare subsp. vulgare [barley]
gi|255724014|ref|XP_002546936.1| hypothetical protein CTRG_01242...   142   3e-32   Candida tropicalis MYA-3404
gi|347826773|emb|CCD42470.1| similar to deaminase [Botryotinia f...   142   3e-32   Botrytis cinerea T4
gi|340519546|gb|EGR49784.1| Hypothetical protein TRIREDRAFT_1243...   142   5e-32   Trichoderma reesei QM6a
gi|367002167|ref|XP_003685818.1| hypothetical protein TPHA_0E029...   141   5e-32   Tetrapisispora phaffii CBS 4417
gi|154305221|ref|XP_001553013.1| hypothetical protein BC1G_08905...   140   1e-31   Botrytis cinerea B05.10
gi|50290647|ref|XP_447756.1| hypothetical protein [Candida glabr...   140   1e-31   Candida glabrata CBS 138
gi|241617471|ref|XP_002406922.1| tRNA-specific adenosine deamina...   140   2e-31   Ixodes scapularis [blacklegged tick]
gi|470130542|ref|XP_004301162.1| PREDICTED: tRNA-specific adenos...   140   2e-31   Fragaria vesca subsp. vesca
gi|326428921|gb|EGD74491.1| tRNA-specific adenosine deaminase [S...   139   2e-31   Salpingoeca rosetta
gi|340376085|ref|XP_003386564.1| PREDICTED: tRNA-specific adenos...   139   2e-31   Amphimedon queenslandica
gi|494828435|gb|EON65247.1| hypothetical protein W97_04484 [Coni...   139   2e-31   Coniosporium apollinis CBS 100218
gi|412988854|emb|CCO15445.1| predicted protein [Bathycoccus pras...   139   3e-31   Bathycoccus prasinos
gi|462424114|gb|EMJ28377.1| hypothetical protein PRUPE_ppa020315...   139   3e-31   Prunus persica
gi|242018582|ref|XP_002429753.1| tRNA-specific adenosine deamina...   139   3e-31   Pediculus humanus corporis [human body lice]
gi|508784783|gb|EOY32039.1| Cytidine/deoxycytidylate deaminase f...   139   4e-31   Theobroma cacao [chocolate]
gi|403346083|gb|EJY72426.1| Adenosine deaminase [Oxytricha trifa...   138   4e-31   Oxytricha trifallax
gi|358385127|gb|EHK22724.1| hypothetical protein TRIVIDRAFT_2774...   138   5e-31   Trichoderma virens Gv29-8
gi|241950789|ref|XP_002418117.1| tRNA-specific adenosine deamina...   138   6e-31   Candida dubliniensis CD36
gi|198426798|ref|XP_002125101.1| PREDICTED: tRNA-specific adenos...   138   6e-31   Ciona intestinalis [sea vase]
gi|223997732|ref|XP_002288539.1| hypothetical protein THAPSDRAFT...   138   7e-31   Thalassiosira pseudonana CCMP1335
gi|408391531|gb|EKJ70905.1| hypothetical protein FPSE_08873 [Fus...   138   7e-31   Fusarium pseudograminearum CS3096
gi|321465150|gb|EFX76153.1| hypothetical protein DAPPUDRAFT_3062...   137   9e-31   Daphnia pulex
gi|325191110|emb|CCA25596.1| SUMO ligase putative [Albugo laibac...   137   2e-30   Albugo laibachii Nc14
gi|325191115|emb|CCA25601.1| SUMO ligase putative [Albugo laibac...   137   2e-30   Albugo laibachii Nc14
gi|325191109|emb|CCA25595.1| SUMO ligase putative [Albugo laibac...   136   2e-30   Albugo laibachii Nc14
gi|325191111|emb|CCA25597.1| SUMO ligase putative [Albugo laibac...   136   2e-30   Albugo laibachii Nc14
gi|325191114|emb|CCA25600.1| SUMO ligase putative [Albugo laibac...   136   2e-30   Albugo laibachii Nc14
gi|307209295|gb|EFN86380.1| tRNA-specific adenosine deaminase 2 ...   136   2e-30   Harpegnathos saltator
gi|325191112|emb|CCA25598.1| SUMO ligase putative [Albugo laibac...   135   3e-30   Albugo laibachii Nc14
gi|302833465|ref|XP_002948296.1| hypothetical protein VOLCADRAFT...   135   4e-30   Volvox carteri f. nagariensis
gi|471186549|ref|XP_004183087.1| hypothetical protein EIN_469550...   135   6e-30   Entamoeba invadens IP1
gi|238881956|gb|EEQ45594.1| conserved hypothetical protein [Cand...   134   6e-30   Candida albicans WO-1
gi|428177773|gb|EKX46651.1| hypothetical protein GUITHDRAFT_4689...   134   7e-30   Guillardia theta CCMP2712
gi|325191113|emb|CCA25599.1| SUMO ligase putative [Albugo laibac...   134   8e-30   Albugo laibachii Nc14
gi|308491803|ref|XP_003108092.1| hypothetical protein CRE_10287 ...   134   8e-30   Caenorhabditis remanei
gi|383859536|ref|XP_003705250.1| PREDICTED: tRNA-specific adenos...   134   1e-29   Megachile rotundata
gi|224087290|ref|XP_002308113.1| predicted protein [Populus tric...   133   1e-29   Populus trichocarpa [western balsam poplar]
gi|215422331|ref|NP_001135855.1| adenosine deaminase, tRNA-speci...   133   1e-29   Nasonia vitripennis
gi|31874632|emb|CAD98054.1| hypothetical protein [Homo sapiens] ...   133   2e-29   Homo sapiens [man]
gi|170032967|ref|XP_001844351.1| tRNA-specific adenosine deamina...   133   2e-29   Culex quinquefasciatus
gi|150864126|ref|XP_001382832.2| hypothetical protein PICST_2947...   133   2e-29   Scheffersomyces stipitis CBS 6054
gi|428166003|gb|EKX34987.1| hypothetical protein GUITHDRAFT_8017...   133   2e-29   Guillardia theta CCMP2712
gi|499035656|ref|XP_004568498.1| PREDICTED: tRNA-specific adenos...   133   2e-29   Maylandia zebra
gi|221129263|ref|XP_002158148.1| PREDICTED: tRNA-specific adenos...   132   3e-29   Hydra vulgaris
gi|56757936|gb|AAW27108.1| SJCHGC09107 protein [Schistosoma japo...   132   4e-29   Schistosoma japonicum
gi|322783203|gb|EFZ10789.1| hypothetical protein SINV_01360 [Sol...   132   4e-29   Solenopsis invicta [imported red fire ant]
gi|505803804|ref|XP_004609053.1| PREDICTED: tRNA-specific adenos...   132   5e-29   Sorex araneus [Eurasian shrew]
gi|507643697|ref|XP_004702194.1| PREDICTED: tRNA-specific adenos...   131   6e-29   Echinops telfairi [lesser hedgehog tenrec]
gi|403216430|emb|CCK70927.1| hypothetical protein KNAG_0F02630 [...   131   7e-29   Kazachstania naganishii CBS 8797
gi|83775265|dbj|BAE65387.1| unnamed protein product [Aspergillus...   130   9e-29   Aspergillus oryzae RIB40
gi|123448020|ref|XP_001312744.1| Cytidine and deoxycytidylate de...   130   1e-28   Trichomonas vaginalis G3
gi|683699|emb|CAA88261.1| orf2 [Saccharomyces cerevisiae]             130   1e-28   Saccharomyces cerevisiae [brewer's yeast]
gi|323337097|gb|EGA78353.1| Tad2p [Saccharomyces cerevisiae Vin13]    130   1e-28   Saccharomyces cerevisiae Vin13
gi|341881216|gb|EGT37151.1| hypothetical protein CAEBREN_15496 [...   130   1e-28   Caenorhabditis brenneri
gi|444319398|ref|XP_004180356.1| hypothetical protein TBLA_0D033...   130   1e-28   Tetrapisispora blattae CBS 6284
gi|344303240|gb|EGW33514.1| hypothetical protein SPAPADRAFT_1371...   130   1e-28   Spathaspora passalidarum NRRL Y-27907
gi|401837575|gb|EJT41487.1| TAD2-like protein [Saccharomyces kud...   129   3e-28   
gi|307170830|gb|EFN62941.1| tRNA-specific adenosine deaminase 2 ...   129   3e-28   
gi|401407030|ref|XP_003882964.1| Cytidine and deoxycytidylate de...   129   3e-28   
gi|348684385|gb|EGZ24200.1| hypothetical protein PHYSODRAFT_4837...   129   3e-28   
gi|8778532|gb|AAF79540.1|AC023673_28 F21D18.9 [Arabidopsis thali...   129   3e-28   
gi|222624837|gb|EEE58969.1| hypothetical protein OsJ_10660 [Oryz...   129   4e-28   
gi|510908911|ref|XP_004832594.1| cytosine deaminase, putative [B...   128   5e-28   
gi|219113417|ref|XP_002186292.1| predicted protein [Phaeodactylu...   128   6e-28   
gi|268552503|ref|XP_002634234.1| Hypothetical protein CBG01804 [...   128   7e-28   
gi|452823229|gb|EME30241.1| tRNA-specific adenosine deaminase [G...   127   9e-28   
gi|443923031|gb|ELU42357.1| cytidine and deoxycytidylate deamina...   127   9e-28   
gi|498986974|ref|XP_004530990.1| PREDICTED: tRNA-specific adenos...   127   1e-27   
gi|332028253|gb|EGI68300.1| tRNA-specific adenosine deaminase 2 ...   127   1e-27   
gi|157135264|ref|XP_001656575.1| tRNA-specific adenosine-34 deam...   126   2e-27   
gi|470250834|ref|XP_004358514.1| adenosine deaminase [Dictyostel...   125   3e-27   
gi|350422283|ref|XP_003493115.1| PREDICTED: tRNA-specific adenos...   124   6e-27   
gi|312378080|gb|EFR24748.1| hypothetical protein AND_10447 [Anop...   124   9e-27   
gi|322704161|gb|EFY95759.1| cytidine and deoxycytidylate deamina...   124   9e-27   
gi|198451012|ref|XP_001358211.2| GA18791 [Drosophila pseudoobscu...   124   9e-27   
gi|21355527|ref|NP_650610.1| CG5292, isoform A [Drosophila melan...   124   1e-26   
gi|256080810|ref|XP_002576669.1| cytidine/deoxycytidylate deamin...   124   1e-26   
gi|17541138|ref|NP_502546.1| Protein JC8.4 [Caenorhabditis elega...   123   1e-26   
gi|195501916|ref|XP_002098000.1| GE10118 [Drosophila yakuba] >gi...   123   2e-26   
gi|91085973|ref|XP_971753.1| PREDICTED: similar to tRNA-specific...   123   2e-26   
gi|195110631|ref|XP_001999883.1| GI24773 [Drosophila mojavensis]...   123   2e-26   
gi|195143831|ref|XP_002012900.1| GL23678 [Drosophila persimilis]...   123   2e-26   
gi|301096603|ref|XP_002897398.1| tRNA-specific adenosine deamina...   123   2e-26   
gi|322696336|gb|EFY88130.1| CMP/dCMP deaminase, zinc-binding pro...   123   2e-26   
gi|403222687|dbj|BAM40818.1| uncharacterized protein TOT_0300008...   122   3e-26   
gi|195056037|ref|XP_001994919.1| GH13454 [Drosophila grimshawi] ...   122   4e-26   
gi|498986978|ref|XP_004530991.1| PREDICTED: tRNA-specific adenos...   122   4e-26   
gi|194743340|ref|XP_001954158.1| GF18139 [Drosophila ananassae] ...   122   4e-26   
gi|194900476|ref|XP_001979783.1| GG22115 [Drosophila erecta] >gi...   122   4e-26   
gi|237831707|ref|XP_002365151.1| tRNA-specific adenosine deamina...   121   6e-26   
gi|167540179|ref|XP_001741595.1| tRNA-specific adenosine deamina...   121   8e-26   
gi|195349159|ref|XP_002041114.1| GM15219 [Drosophila sechellia] ...   120   1e-25   
gi|407033725|gb|EKE36958.1| cytidine/deoxycytidylate deaminase f...   120   1e-25   
gi|425777728|gb|EKV15884.1| hypothetical protein PDIG_22390 [Pen...   120   1e-25   
gi|347968723|ref|XP_003436275.1| AGAP013244-PA [Anopheles gambia...   120   1e-25   
gi|323454898|gb|EGB10767.1| hypothetical protein AURANDRAFT_2229...   120   2e-25   
gi|470423626|ref|XP_004337616.1| cytidine and deoxycytidylate de...   119   2e-25   
gi|195443952|ref|XP_002069651.1| GK11635 [Drosophila willistoni]...   119   3e-25   
gi|195391484|ref|XP_002054390.1| GJ24425 [Drosophila virilis] >g...   119   4e-25   
gi|311243850|ref|XP_003121217.1| PREDICTED: tRNA-specific adenos...   118   7e-25   
gi|512887020|ref|XP_004921853.1| PREDICTED: tRNA-specific adenos...   117   1e-24   
gi|72392897|ref|XP_847249.1| deaminase [Trypanosoma brucei bruce...   116   2e-24   
gi|307108051|gb|EFN56292.1| hypothetical protein CHLNCDRAFT_1446...   116   2e-24   
gi|261330463|emb|CBH13447.1| deaminase, putative [Trypanosoma br...   115   3e-24   
gi|255935941|ref|XP_002558997.1| Pc13g05630 [Penicillium chrysog...   115   4e-24   
gi|119486672|ref|XP_001262322.1| hypothetical protein NFIA_02856...   115   4e-24   
gi|357628413|gb|EHJ77756.1| hypothetical protein KGM_09157 [Dana...   115   5e-24   
gi|226288486|gb|EEH43998.1| tRNA-specific adenosine deaminase [P...   115   5e-24   
gi|300120277|emb|CBK19831.2| unnamed protein product [Blastocyst...   115   6e-24   
gi|209879105|ref|XP_002140993.1| cytidine/deoxycytidylate deamin...   114   7e-24   
gi|71652572|ref|XP_814939.1| deaminase [Trypanosoma cruzi strain...   114   1e-23   
gi|71423764|ref|XP_812564.1| deaminase [Trypanosoma cruzi strain...   113   2e-23   
gi|312078286|ref|XP_003141672.1| tRNA-specific adenosine deamina...   113   2e-23   
gi|407835048|gb|EKF99131.1| deaminase, putative [Trypanosoma cruzi]   113   2e-23   
gi|399168419|emb|CCE30680.1| probable TAD2-tRNA-specific adenosi...   112   4e-23   
gi|339247005|ref|XP_003375136.1| tRNA-specific adenosine deamina...   112   5e-23   
gi|340399726|ref|YP_004728751.1| deaminase yaaJ [Streptococcus s...   111   6e-23   
gi|489182467|ref|WP_003091914.1| deaminase [Streptococcus vestib...   111   7e-23   
gi|488981175|ref|WP_002892008.1| deaminase [Streptococcus saliva...   111   9e-23   
gi|67481305|ref|XP_656002.1| cytidine/deoxycytidylate deaminase ...   110   1e-22   
gi|431904265|gb|ELK09662.1| tRNA-specific adenosine deaminase 2 ...   110   2e-22   
gi|495811556|ref|WP_008536135.1| deaminase [Streptococcus sp. C1...   110   2e-22   
gi|387784960|ref|YP_006071043.1| putative cytidine/deoxycytidyla...   110   2e-22   
gi|386087444|ref|YP_006003318.1| Cytidine/deoxycytidylate deamin...   109   2e-22   
gi|407393204|gb|EKF26534.1| deaminase, putative [Trypanosoma cru...   109   2e-22   
gi|447032746|ref|WP_001110002.1| deaminase [Streptococcus mitis]...   109   2e-22   
gi|447032747|ref|WP_001110003.1| deaminase [Streptococcus mitis]...   109   2e-22   
gi|511802646|ref|WP_016397786.1| cytidine/deoxycytidylate deamin...   109   2e-22   
gi|511038938|ref|WP_016292953.1| hypothetical protein [Lachnospi...   109   3e-22   
gi|489041691|ref|WP_002952007.1| cytidine/deoxycytidylate deamin...   109   3e-22   
gi|55821816|ref|YP_140258.1| cytidine/deoxycytidylate deaminase ...   109   3e-22   
gi|488974895|ref|WP_002885785.1| deaminase [Streptococcus saliva...   109   3e-22   
gi|116628523|ref|YP_821142.1| cytidine/deoxycytidylate deaminase...   109   3e-22   
gi|497039939|ref|WP_009444008.1| deaminase [Streptococcus sp. or...   109   3e-22   
gi|302919326|ref|XP_003052839.1| hypothetical protein NECHADRAFT...   109   3e-22   
gi|342886058|gb|EGU86001.1| hypothetical protein FOXB_03510 [Fus...   109   4e-22   
gi|470297488|ref|XP_004345640.1| tRNA-specific adenosine deamina...   108   4e-22   
gi|477518956|gb|ENH71156.1| tRNA-specific adenosine deaminase 2 ...   108   4e-22   
gi|446493265|ref|WP_000571119.1| deaminase [Streptococcus mitis]...   108   4e-22   
gi|145511355|ref|XP_001441605.1| hypothetical protein [Parameciu...   108   4e-22   
gi|261417404|ref|YP_003251087.1| CMP/dCMP deaminase zinc-binding...   108   4e-22   
gi|490378040|ref|WP_004257638.1| cytidine/deoxycytidylate deamin...   108   4e-22   
gi|446308904|ref|WP_000386759.1| deaminase [Streptococcus oralis...   108   5e-22   
gi|446214021|ref|WP_000291876.1| deaminase [Streptococcus pneumo...   108   5e-22   
gi|374338909|ref|YP_005095627.1| tRNA-specific adenosine deamina...   108   5e-22   
gi|488977817|ref|WP_002888682.1| deaminase [Streptococcus saliva...   108   5e-22   
gi|55823732|ref|YP_142173.1| cytidine/deoxycytidylate deaminase ...   108   5e-22   
gi|447032846|ref|WP_001110102.1| deaminase [Streptococcus oralis...   108   5e-22   
gi|449019517|dbj|BAM82919.1| probable tRNA-specific adenosine-34...   108   6e-22   
gi|497346008|ref|WP_009660221.1| deaminase [Streptococcus sp. AS...   108   6e-22   
gi|444524537|gb|ELV13869.1| tRNA-specific adenosine deaminase 2 ...   108   6e-22   
gi|358393356|gb|EHK42757.1| hypothetical protein TRIATDRAFT_1759...   108   6e-22   
gi|125718966|ref|YP_001036099.1| hypothetical protein SSA_2184 [...   108   6e-22   
gi|340055428|emb|CCC49747.1| putative deaminase [Trypanosoma viv...   108   7e-22   
gi|496557208|ref|WP_009263283.1| adenosine deaminase [Lachnospir...   108   7e-22   
gi|342182690|emb|CCC92169.1| putative deaminase [Trypanosoma con...   108   7e-22   
gi|447032841|ref|WP_001110097.1| deaminase [Streptococcus sp. BS...   108   7e-22   
gi|387760469|ref|YP_006067446.1| tRNA-specific adenosine deamina...   108   7e-22   
gi|447032857|ref|WP_001110113.1| deaminase [Streptococcus mitis]...   108   7e-22   
gi|488997153|ref|WP_002907853.1| deaminase [Streptococcus sangui...   108   7e-22   
gi|446308851|ref|WP_000386706.1| deaminase [Streptococcus oralis...   108   8e-22   
gi|447032851|ref|WP_001110107.1| deaminase [Streptococcus mitis]...   108   8e-22   
gi|447032856|ref|WP_001110112.1| deaminase [Streptococcus mitis]...   107   8e-22   
gi|447032854|ref|WP_001110110.1| deaminase [Streptococcus mitis]...   107   8e-22   
gi|490750703|ref|WP_004613011.1| adenosine deaminase [Clostridiu...   107   9e-22   
gi|496548709|ref|WP_009254784.1| adenosine deaminase [Lachnospir...   107   9e-22   
gi|496566358|ref|WP_009267478.1| adenosine deaminase [Lachnospir...   107   1e-21   
gi|497078464|ref|WP_009461795.1| adenosine deaminase [Lachnospir...   107   1e-21   
gi|493115898|ref|WP_006144597.1| deaminase [Streptococcus perori...   107   1e-21   
gi|15902066|ref|NP_357616.1| cytidine/deoxycytidylate deaminase ...   107   1e-21   
gi|496263544|ref|WP_008976929.1| adenosine deaminase [Coprococcu...   107   1e-21   
gi|447032852|ref|WP_001110108.1| deaminase [Streptococcus sp. M3...   107   1e-21   
gi|85001518|ref|XP_955475.1| cytidine and deoxycytidylate deamin...   107   1e-21   
gi|447032844|ref|WP_001110100.1| deaminase [Streptococcus sp. C3...   107   1e-21   
gi|156087547|ref|XP_001611180.1| cytosine deaminase [Babesia bov...   107   1e-21   
gi|489006074|ref|WP_002916661.1| deaminase [Streptococcus sangui...   107   1e-21   
gi|447032849|ref|WP_001110105.1| deaminase [Streptococcus sp. or...   107   1e-21   
gi|490288725|ref|WP_004184343.1| deaminase [Streptococcus sangui...   107   1e-21   
gi|225860063|ref|YP_002741572.1| tRNA-specific adenosine deamina...   107   1e-21   
gi|337282830|ref|YP_004622301.1| tRNA-specific adenosine deamina...   107   2e-21   
gi|493136507|ref|WP_006154946.1| deaminase [Streptococcus infant...   107   2e-21   
gi|447032845|ref|WP_001110101.1| deaminase [Streptococcus oralis...   107   2e-21   
gi|493126340|ref|WP_006149116.1| deaminase [Streptococcus infant...   107   2e-21   
gi|307126250|ref|YP_003878281.1| tRNA-specific adenosine deamina...   107   2e-21   
gi|169833520|ref|YP_001693493.1| tRNA-specific adenosine deamina...   107   2e-21   
gi|432953477|ref|XP_004085414.1| PREDICTED: tRNA-specific adenos...   107   2e-21   
gi|489186500|ref|WP_003095914.1| deaminase [Streptococcus vestib...   106   2e-21   
gi|289166926|ref|YP_003445193.1| cytidine/deoxycytidylate deamin...   106   2e-21   
gi|490370741|ref|WP_004250346.1| deaminase [Streptococcus mitis]...   106   2e-21   
gi|488197019|ref|WP_002268227.1| putative deaminase [Streptococc...   106   2e-21   
gi|446214023|ref|WP_000291878.1| deaminase [Streptococcus pneumo...   106   2e-21   
gi|489000851|ref|WP_002911513.1| deaminase [Streptococcus sangui...   106   2e-21   
gi|446308906|ref|WP_000386761.1| deaminase [Streptococcus sp. or...   106   2e-21   
gi|447032855|ref|WP_001110111.1| deaminase [Streptococcus oralis...   106   2e-21   
gi|447032847|ref|WP_001110103.1| deaminase [Streptococcus mitis]...   106   2e-21   
gi|490353621|ref|WP_004233394.1| deaminase [Streptococcus equinu...   106   2e-21   
gi|491474124|ref|WP_005331869.1| adenosine deaminase [Dorea form...   106   2e-21   
gi|493137110|ref|WP_006155547.1| deaminase [Streptococcus infant...   106   2e-21   
gi|447032853|ref|WP_001110109.1| deaminase [Streptococcus pseudo...   106   2e-21   
gi|490298503|ref|WP_004193942.1| deaminase [Streptococcus sangui...   106   2e-21   
gi|489106948|ref|WP_003016809.1| deaminase [Streptococcus sp. F0...   106   2e-21   
gi|490343505|ref|WP_004225286.1| deaminase [Streptococcus cricet...   106   2e-21   
gi|447032842|ref|WP_001110098.1| deaminase [Streptococcus sp. GM...   106   2e-21   
gi|446214016|ref|WP_000291871.1| deaminase [Streptococcus pneumo...   106   2e-21   
gi|479156264|ref|YP_007785859.1| Cytosine/adenosine deaminases [...   106   2e-21   
gi|493129293|ref|WP_006150521.1| deaminase [Streptococcus infant...   106   2e-21   
gi|447032860|ref|WP_001110116.1| deaminase [Streptococcus mitis]...   106   2e-21   
gi|489003513|ref|WP_002914134.1| deaminase [Streptococcus sangui...   106   2e-21   
gi|446196439|ref|WP_000274294.1| deaminase [Streptococcus sp. SK...   106   2e-21   
gi|494787120|ref|WP_007522528.1| cytidine/deoxycytidylate deamin...   106   2e-21   
gi|489017699|ref|WP_002928214.1| deaminase [Streptococcus sangui...   106   2e-21   
gi|161869845|ref|YP_001599014.1| cytidine and deoxycytidylate de...   106   2e-21   
gi|488976119|ref|WP_002887004.1| deaminase [Streptococcus saliva...   106   2e-21   
gi|488164492|ref|WP_002235700.1| cytidine deaminase [Neisseria m...   106   3e-21   
gi|489015737|ref|WP_002926258.1| deaminase [Streptococcus sangui...   106   3e-21   
gi|447032840|ref|WP_001110096.1| deaminase [Streptococcus sp. GM...   106   3e-21   
gi|487775079|ref|WP_001850895.1| deaminase [Streptococcus pneumo...   106   3e-21   
gi|495362195|ref|WP_008086913.1| deaminase [Streptococcus ictalu...   106   3e-21   
gi|488991341|ref|WP_002902098.1| deaminase [Streptococcus sangui...   106   3e-21   
gi|489170491|ref|WP_003080065.1| deaminase [Streptococcus macaca...   106   3e-21   
gi|446214025|ref|WP_000291880.1| deaminase [Streptococcus pneumo...   106   3e-21   
gi|488988438|ref|WP_002899211.1| deaminase [Streptococcus sangui...   106   3e-21   
gi|488212700|ref|WP_002283908.1| putative deaminase [Streptococc...   105   3e-21   
gi|447032858|ref|WP_001110114.1| deaminase [Streptococcus mitis]...   105   3e-21   
gi|489007231|ref|WP_002917811.1| deaminase [Streptococcus sangui...   105   3e-21   
gi|496083665|ref|WP_008808172.1| deaminase [Streptococcus sp. 2_...   105   3e-21   
gi|254804815|ref|YP_003083036.1| cytidine deaminase [Neisseria m...   105   3e-21   
gi|493133644|ref|WP_006153120.1| deaminase [Streptococcus infant...   105   4e-21   
gi|385335570|ref|YP_005889517.1| putative cytosine deaminase [Ne...   105   4e-21   
gi|489784469|ref|WP_003688360.1| cytidine deaminase [Neisseria g...   105   4e-21   
gi|488652349|ref|YP_007924153.1| hypothetical protein I872_09605...   105   4e-21   
gi|489012073|ref|WP_002922608.1| deaminase [Streptococcus sangui...   105   4e-21   
gi|488146200|ref|WP_002217408.1| CRISPR-associated protein Csn1 ...   105   4e-21   
gi|254672230|emb|CBA05187.1| putative hydrolase protein [Neisser...   105   4e-21   
gi|489035386|ref|WP_002945731.1| deaminase [Streptococcus thermo...   105   5e-21   
gi|331265454|ref|YP_004325084.1| cytidine/deoxycytidylate deamin...   105   5e-21   
gi|487742610|ref|WP_001825736.1| deaminase [Streptococcus pneumo...   105   5e-21   
gi|488217708|ref|WP_002288916.1| putative deaminase [Streptococc...   105   5e-21   
gi|447032843|ref|WP_001110099.1| deaminase [Streptococcus tiguri...   105   5e-21   
gi|487753125|ref|WP_001834442.1| deaminase [Streptococcus pneumo...   105   5e-21   
gi|512654591|ref|WP_016466442.1| tRNA-specific adenosine deamina...   105   5e-21   
gi|488983188|ref|WP_002893991.1| deaminase [Streptococcus sangui...   105   5e-21   
gi|182682990|ref|YP_001834737.1| cytidine/deoxycytidylate deamin...   105   5e-21   
gi|488158148|ref|WP_002229356.1| cytidine deaminase [Neisseria m...   105   6e-21   
gi|471364019|ref|XP_004372562.1| PREDICTED: uncharacterized prot...   105   6e-21   
gi|59801336|ref|YP_208048.1| cytosine deaminase [Neisseria gonor...   105   6e-21   
gi|446308905|ref|WP_000386760.1| deaminase [Streptococcus sp. SK...   105   6e-21   
gi|495167791|ref|WP_007892588.1| deaminase [Streptococcus pseudo...   105   6e-21   
gi|302384616|ref|YP_003820438.1| CMP/dCMP deaminase zinc-binding...   105   6e-21   
gi|446214018|ref|WP_000291873.1| deaminase [Streptococcus pneumo...   105   7e-21   
gi|446214026|ref|WP_000291881.1| deaminase [Streptococcus pneumo...   105   7e-21   
gi|446308907|ref|WP_000386762.1| deaminase [Streptococcus sp. M1...   105   7e-21   
gi|488185364|ref|WP_002256572.1| cytidine and deoxycytidylate de...   104   7e-21   
gi|15899968|ref|NP_344572.1| cytidine/deoxycytidylate deaminase ...   104   7e-21   
gi|157150388|ref|YP_001449474.1| putative cytidine/deoxycytidyla...   104   7e-21   
gi|490981977|ref|WP_004843735.1| adenosine deaminase [[Ruminococ...   104   7e-21   
gi|496539496|ref|WP_009245644.1| adenosine deaminase [Lachnospir...   104   8e-21   
gi|342162759|ref|YP_004767398.1| tRNA-specific adenosine deamina...   104   8e-21   
gi|497415349|ref|WP_009729547.1| tRNA-specific adenosine deamina...   104   8e-21   
gi|385789316|ref|YP_005820439.1| cytidine/deoxycytidylate deamin...   104   9e-21   
gi|379706145|ref|YP_005204604.1| cytidine/deoxycytidylate deamin...   104   9e-21   
gi|447032850|ref|WP_001110106.1| deaminase [Streptococcus mitis]...   104   1e-20   
gi|350269176|ref|YP_004880484.1| putative deaminase [Oscillibact...   104   1e-20   
gi|496292859|ref|WP_009004897.1| adenosine deaminase [Clostridiu...   103   1e-20   
gi|298571687|gb|ADI87839.1| hypothetical protein AKSOIL_0331 [un...   103   1e-20   
gi|488222031|ref|WP_002293239.1| putative deaminase [Streptococc...   103   1e-20   
gi|489802444|ref|WP_003706325.1| cytidine deaminase [Neisseria g...   103   1e-20   
gi|288906283|ref|YP_003431505.1| cytidine/deoxycytidylate deamin...   103   1e-20   
gi|488182837|ref|WP_002254045.1| cytidine and deoxycytidylate de...   103   1e-20   
gi|493577910|ref|WP_006531022.1| deaminase [Streptococcus infant...   103   1e-20   
gi|488234146|ref|WP_002305354.1| putative deaminase [Streptococc...   103   1e-20   
gi|493643813|ref|WP_006595456.1| deaminase [Streptococcus austra...   103   1e-20   
gi|488195292|ref|WP_002266500.1| putative deaminase [Streptococc...   103   1e-20   
gi|24378807|ref|NP_720762.1| deaminase [Streptococcus mutans UA1...   103   2e-20   
gi|290581189|ref|YP_003485581.1| deaminase [Streptococcus mutans...   103   2e-20   
gi|491501208|ref|WP_005358896.1| adenosine deaminase [Eubacteriu...   103   2e-20   
gi|487785923|ref|WP_001860139.1| deaminase [Streptococcus pneumo...   103   2e-20   


>gi|510999527|gb|EPB81148.1| hypothetical protein HMPREF1544_12144 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 177

 Score =  218 bits (556), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 103/175 (58%), Positives = 130/175 (74%), Gaps = 3/175 (1%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLD-DKIIGSGRNRTNETFNGTRHAEFEA 63
           M      +MREAL  AQEAYDN E+PVGC+FVL+ D II  GRN+ NE++N TRHAE EA
Sbjct: 1   MSKYDSSFMREALVVAQEAYDNLEVPVGCVFVLNNDTIIARGRNKPNESYNATRHAEIEA 60

Query: 64  IDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
           ID IL   +Y   VF+   LYVTVEPCVMC+ ALRQ+ I+HVY+GC N++FGG GSVF+I
Sbjct: 61  IDIILK--QYDRSVFENVDLYVTVEPCVMCASALRQIGIRHVYFGCGNDKFGGNGSVFNI 118

Query: 124 HQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           + +        YP EGGY+ +E+I++LRKFY+REN+ APVP++K  RVLKTEI P
Sbjct: 119 NTELDTNQSKGYPSEGGYFHEEAILMLRKFYIRENKHAPVPRKKSNRVLKTEIIP 173



>gi|302697295|ref|XP_003038326.1| hypothetical protein SCHCODRAFT_63904 [Schizophyllum commune H4-8]
 gi|300112023|gb|EFJ03424.1| hypothetical protein SCHCODRAFT_63904 [Schizophyllum commune H4-8]
          Length = 194

 Score =  214 bits (546), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 126/181 (69%), Gaps = 4/181 (2%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           ME +H K+M EA+N AQEA D  E+PVGC+FV D+KII S RNRTNE  N TRHAE EAI
Sbjct: 1   MEEVHLKWMAEAMNMAQEALDAGEVPVGCIFVRDNKIIASARNRTNELRNATRHAELEAI 60

Query: 65  DQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           D+IL+    T E+         LYVTVEPC+MC+ ALRQL IK V+YGC N+RFGG GSV
Sbjct: 61  DRILADKTLTPEICEYPLDTTTLYVTVEPCIMCASALRQLGIKEVFYGCGNDRFGGCGSV 120

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPMK 180
             +++      HPAY    GY R+E+IM+LR+FYV EN  AP P+ K  RVLKT+I P+ 
Sbjct: 121 LGVNESVPHPKHPAYRAHPGYLREEAIMILRRFYVTENTNAPNPRSKANRVLKTDIPPLT 180

Query: 181 K 181
           K
Sbjct: 181 K 181



>gi|170106123|ref|XP_001884273.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164640619|gb|EDR04883.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 183

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 123/178 (69%), Gaps = 4/178 (2%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           M++IH ++MREAL  A+EA    E+PVGC+FV D  II   RNRTNE  N TRHAE EAI
Sbjct: 1   MDSIHDRWMREALTMAEEALAASEVPVGCVFVRDGIIIAKARNRTNELCNATRHAELEAI 60

Query: 65  DQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           D I++    T E+         LYVTVEPC+MC+ ALRQ+ IK V+YGCAN+RFGG GSV
Sbjct: 61  DSIMADRSLTPEISEYPLSNTTLYVTVEPCIMCASALRQMGIKEVFYGCANDRFGGCGSV 120

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
             +++      HP+Y   GGYYR+E+IM+LR+FY+ EN  AP+PK K  RVLKT I P
Sbjct: 121 LGVNERLPHPTHPSYSATGGYYREEAIMMLRRFYITENTNAPIPKSKANRVLKTIIYP 178



>gi|451847536|gb|EMD60843.1| hypothetical protein COCSADRAFT_98108 [Bipolaris sorokiniana
           ND90Pr]
          Length = 227

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/171 (59%), Positives = 119/171 (69%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV D ++IG G N TN T NGTRHAEF AI  IL
Sbjct: 9   HEGFMREAIAMAELALKSDETPVGCVFVKDGQVIGRGMNETNRTLNGTRHAEFVAIAGIL 68

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S  EY   V     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V  IH DP 
Sbjct: 69  S--EYPITVLNETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLKIHSDP- 125

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 126 -SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 175



>gi|451996606|gb|EMD89072.1| hypothetical protein COCHEDRAFT_1108376 [Bipolaris maydis C5]
 gi|477588128|gb|ENI05208.1| hypothetical protein COCC4DRAFT_138198 [Bipolaris maydis ATCC
           48331]
          Length = 227

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 102/171 (59%), Positives = 119/171 (69%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV D ++IG G N TN T NGTRHAEF AI  IL
Sbjct: 9   HEGFMREAIAMAELALKSDETPVGCVFVKDGQVIGRGMNETNRTLNGTRHAEFVAIAGIL 68

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S  EY   V     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V  IH DP 
Sbjct: 69  S--EYPITVLNETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLKIHSDP- 125

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 126 -SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 175



>gi|169599362|ref|XP_001793104.1| hypothetical protein SNOG_02499 [Phaeosphaeria nodorum SN15]
 gi|111069591|gb|EAT90711.1| hypothetical protein SNOG_02499 [Phaeosphaeria nodorum SN15]
          Length = 265

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 120/171 (70%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MREA+  A+ A  + E PVGC+FV D +IIG G N TN T NGTRHAEF AI  IL
Sbjct: 70  HERFMREAIAMAELALKSDETPVGCVFVKDGEIIGRGMNETNRTLNGTRHAEFVAIAGIL 129

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S      ++     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V +IH DP 
Sbjct: 130 SKSPV--KILNETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLNIHSDP- 186

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 187 -SIDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 236



>gi|189204912|ref|XP_001938791.1| tRNA-specific adenosine deaminase subunit TAD2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187985890|gb|EDU51378.1| tRNA-specific adenosine deaminase subunit TAD2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 234

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 120/171 (70%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV D +IIG G N TN T NGTRHAEF AI  IL
Sbjct: 9   HEGFMREAIAMAELALKSDETPVGCVFVKDGEIIGRGMNETNRTLNGTRHAEFVAIAGIL 68

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S  ++   +     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V +IH DP 
Sbjct: 69  S--KHPISILNETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLNIHSDP- 125

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 126 -SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 175



>gi|392569025|gb|EIW62199.1| cytidine deaminase-like protein [Trametes versicolor FP-101664 SS1]
          Length = 193

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 124/180 (68%), Gaps = 4/180 (2%)

Query: 1   GNSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAE 60
           G+S  E+IH ++M+ A+  A+EA   QE+PVGC+FV D++II   RNRTN+  N TRHAE
Sbjct: 4   GSSEGESIHLEWMQCAMEMAEEALAAQEVPVGCVFVRDNRIIARARNRTNQLRNATRHAE 63

Query: 61  FEAIDQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
            EAID+IL+  + T EV         LYVTVEPC+MC+ ALRQ+ IK VYYGC N+RFGG
Sbjct: 64  LEAIDEILADKQLTPEVTKHPLATTTLYVTVEPCIMCASALRQMGIKDVYYGCGNDRFGG 123

Query: 117 TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
            GSV  ++       HP Y   GGY  DE+IM+LR+FY+ EN  APVPK K  RVLKTEI
Sbjct: 124 CGSVLGVNSALPHPEHPEYRAVGGYMHDEAIMVLRRFYITENTNAPVPKSKANRVLKTEI 183



>gi|299747155|ref|XP_002911134.1| tRNA specific adenosine deaminase [Coprinopsis cinerea
           okayama7#130]
 gi|298407392|gb|EFI27640.1| tRNA specific adenosine deaminase [Coprinopsis cinerea
           okayama7#130]
          Length = 188

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+M+EA+N A+EA    E+PVGC+FV D+KII   RNRTNE  N TRHAE EAID IL
Sbjct: 11  HLKWMKEAMNMAEEALAAGEVPVGCVFVRDEKIIAKARNRTNELRNATRHAELEAIDCIL 70

Query: 69  SSGEYTSE-----VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
           S  E T +           LYVTVEPC+MC+ ALRQL IK V+YGC NERFGG GSV  +
Sbjct: 71  SDNELTPQKGEPYPLSTTTLYVTVEPCIMCASALRQLGIKEVFYGCGNERFGGCGSVLGV 130

Query: 124 HQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
           +Q+     HP Y    GY R+E+IM+LR+FY+ EN  AP P+ K  RVLKT I PM
Sbjct: 131 NQELPHPQHPPYKATAGYCREEAIMILRRFYITENTNAPNPRSKANRVLKTHIEPM 186



>gi|396490433|ref|XP_003843335.1| hypothetical protein LEMA_P074450.1 [Leptosphaeria maculans JN3]
 gi|312219914|emb|CBX99856.1| hypothetical protein LEMA_P074450.1 [Leptosphaeria maculans JN3]
          Length = 259

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/173 (57%), Positives = 121/173 (69%), Gaps = 4/173 (2%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
            +H  +MREA+  A+ A  + E PVGC+FV D +IIG G N TN T NGTRHAEF AI  
Sbjct: 57  ALHEGFMREAIAMAELALKSDETPVGCVFVKDGEIIGRGMNETNRTLNGTRHAEFVAIAS 116

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           ILS  ++   +     LYVTVEPCVMC+  LRQ  IK VY+GC NERFGGTG V ++H D
Sbjct: 117 ILS--KHPISILNETDLYVTVEPCVMCASMLRQYGIKAVYFGCWNERFGGTGGVLNVHCD 174

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
           P  ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 175 P--SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 225



>gi|330933338|ref|XP_003304140.1| hypothetical protein PTT_16586 [Pyrenophora teres f. teres 0-1]
 gi|311319472|gb|EFQ87774.1| hypothetical protein PTT_16586 [Pyrenophora teres f. teres 0-1]
          Length = 293

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 119/171 (69%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV D  IIG G N TN T NGTRHAEF AI  IL
Sbjct: 68  HEGFMREAIAMAELALKSDETPVGCVFVKDGHIIGRGMNETNRTLNGTRHAEFVAIAGIL 127

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S  ++   +     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V +IH DP 
Sbjct: 128 S--KHPISILNETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLNIHSDP- 184

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 185 -SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 234



>gi|389744315|gb|EIM85498.1| cytidine deaminase-like protein [Stereum hirsutum FP-91666 SS1]
          Length = 188

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/180 (53%), Positives = 121/180 (67%), Gaps = 4/180 (2%)

Query: 1   GNSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAE 60
            ++S   IH ++MR+A++ A+EA    E+PVGC+FV D K+I   RNRTNE  N TRHAE
Sbjct: 4   SDTSTADIHIQWMRQAMDMAEEALTASEVPVGCIFVRDGKVIARARNRTNELRNATRHAE 63

Query: 61  FEAIDQILSSGEYTSE----VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
            EAID IL+    T E         +LYVTVEPC+MC+ ALRQ+ IK V+YGCANERFGG
Sbjct: 64  LEAIDAILADPVLTPEHKPYPLSDTVLYVTVEPCIMCASALRQMGIKEVFYGCANERFGG 123

Query: 117 TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
            GSV  ++       HPAY    GY R+E+IM+LR+FY+ EN  AP PK K  RVLKTEI
Sbjct: 124 CGSVLGVNAGLVHPKHPAYKATAGYCREEAIMVLRRFYITENTNAPAPKSKSNRVLKTEI 183



>gi|336368474|gb|EGN96817.1| hypothetical protein SERLA73DRAFT_111549 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 194

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (69%), Gaps = 4/179 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEA 63
           S+E  H ++M+EA+  A+EA    E+PVGC+FV D++II   RNRTNE  N TRHAE EA
Sbjct: 10  SLEKAHLRWMQEAMLMAEEALAASEVPVGCVFVRDNRIIAKSRNRTNELRNATRHAELEA 69

Query: 64  IDQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGS 119
           ID+ILS  + T  +        ILYVTVEPC+MC+ ALRQ+ I+ V++GC N++FGG G+
Sbjct: 70  IDRILSDKDLTPIIVDYPLSDTILYVTVEPCMMCASALRQMGIQEVFFGCENDKFGGCGT 129

Query: 120 VFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           V  ++   +   HP+Y   GGY RDE+IM+LR+FYV EN  APVPK K  R+LKTEI P
Sbjct: 130 VLGVNDKLEHPKHPSYKATGGYCRDEAIMILRRFYVTENTNAPVPKAKANRILKTEILP 188



>gi|390600804|gb|EIN10198.1| cytidine deaminase-like protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 194

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/175 (54%), Positives = 118/175 (67%), Gaps = 4/175 (2%)

Query: 6   ETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAID 65
           +++H  +M+EA+  A+EA    E+PVGC+FV D KII   RNRTN+  N TRHAE EAID
Sbjct: 18  DSVHIAWMQEAMKMAEEALAASEVPVGCVFVRDGKIIAKARNRTNQLRNATRHAELEAID 77

Query: 66  QILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVF 121
            IL+  E T  V         LYVTVEPC+MC  ALRQ+ IK V+YGC NERFGG GSV 
Sbjct: 78  AILADRELTPTVTDYPLSDTTLYVTVEPCIMCGSALRQMGIKEVFYGCGNERFGGNGSVL 137

Query: 122 DIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
            ++       HP+Y   GGY R+E+IM+LR+FY+ EN  APVPK K  RVLKTEI
Sbjct: 138 GVNSALPHPKHPSYRSTGGYLREEAIMVLRRFYITENANAPVPKSKANRVLKTEI 192



>gi|395330718|gb|EJF63101.1| tRNA specific adenosine deaminase [Dichomitus squalens LYAD-421
           SS1]
          Length = 190

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/173 (56%), Positives = 120/173 (69%), Gaps = 4/173 (2%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           IH ++M+ A++ A+EA + +E+PVGC+FV  DKII   RNRTN+  N TRHAE EAID+I
Sbjct: 8   IHLRWMQAAMDMAEEALEAKEVPVGCVFVRGDKIIARARNRTNQLRNATRHAELEAIDEI 67

Query: 68  LSSGEYTSEVFQ----RCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
           L++ E T  V Q       LYVTVEPC+MC+ ALRQ+ IK VYYGC N RFGG GSV  +
Sbjct: 68  LANKELTPVVTQYPLSDTTLYVTVEPCIMCASALRQMGIKEVYYGCDNARFGGCGSVLGV 127

Query: 124 HQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
           H       H  Y   GGY RDE+IM+LR+FY+ EN  APVPK K  RVLKTEI
Sbjct: 128 HSVLPHPKHEGYDAHGGYLRDEAIMILRRFYITENTNAPVPKSKANRVLKTEI 180



>gi|407927088|gb|EKG19992.1| CMP/dCMP deaminase zinc-binding protein [Macrophomina phaseolina
           MS6]
          Length = 190

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MREAL  A  A    E PVGC+FV D ++IG G N TN + NGTRHAEF AI QIL
Sbjct: 19  HERFMREALLMADLALRTDETPVGCVFVHDGRVIGRGMNDTNRSLNGTRHAEFVAISQIL 78

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           ++  + + V +   LYVTVEPCVMC+ ALRQ  I+ VY+GC N+RFGGTG V +IH DP 
Sbjct: 79  AT--HPASVLRETDLYVTVEPCVMCASALRQFGIRAVYFGCWNDRFGGTGGVLNIHSDP- 135

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+EN KAP PK+K  R LKTEI P+
Sbjct: 136 -SVDQPYPVHGGIFREEAIMLLRKFYVQENVKAPEPKQKGTRELKTEIVPL 185



>gi|388852518|emb|CCF53920.1| related to TAD2-tRNA-specific adenosine deaminase 2 [Ustilago hordei]
          Length = 1258

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 115/182 (63%), Gaps = 14/182 (7%)

Query: 11   KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
            K+MREAL  AQEA D  E+PVG +FV   KII  GRNRTNE  N TRHAE EAID ILS 
Sbjct: 936  KWMREALAMAQEALDANEVPVGGVFVRKGKIIARGRNRTNELLNATRHAELEAIDHILSE 995

Query: 70   -------------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
                         SG      F+   LYVT+EPC+MC  ALRQ+ I+ V +G  NERFGG
Sbjct: 996  LPPSSADFAVSPHSGPEGDNPFKDTTLYVTIEPCIMCGAALRQIGIQRVVFGAGNERFGG 1055

Query: 117  TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             GSV  +H D  +   P Y   GGY RDE+IM+LR+FYV EN  AP P+ K +RVLKTEI
Sbjct: 1056 NGSVLGLHDDDAIVSSPGYESVGGYLRDEAIMMLRRFYVTENTNAPKPQNKSRRVLKTEI 1115

Query: 177  TP 178
             P
Sbjct: 1116 HP 1117



>gi|485916507|gb|EOD43836.1| putative trna-specific adenosine deaminase subunit tad2 protein
           [Neofusicoccum parvum UCRNP2]
          Length = 190

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/171 (54%), Positives = 124/171 (72%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MREAL  A+ A    E PVGC+FV D ++IG G N TN + NGTRHAEF AI QIL
Sbjct: 19  HERFMREALRMAELALATDETPVGCVFVRDGRVIGRGMNDTNRSLNGTRHAEFVAISQIL 78

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +  ++ + + +   LYVTVEPCVMC+ ALRQ  I+ VY+GC N+RFGGTG V ++H+DP 
Sbjct: 79  A--QHPASILRETDLYVTVEPCVMCASALRQFGIRAVYFGCWNDRFGGTGGVLNVHEDP- 135

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+++IMLLRKFYV+EN KAP PK+K  R LKT+I P+
Sbjct: 136 -SVDRPYPVHGGIFREDAIMLLRKFYVQENVKAPEPKQKGTRELKTDIEPL 185



>gi|392590084|gb|EIW79414.1| cytidine deaminase-like protein [Coniophora puteana RWD-64-598 SS2]
          Length = 187

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 121/181 (66%), Gaps = 4/181 (2%)

Query: 2   NSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEF 61
           +S  E  H  +MREA++ A++A    E+PVGC+FV +  II   RNRTNE  N TRHAE 
Sbjct: 2   SSPAEQEHLSWMREAMHMAEDALAASEVPVGCVFVRNGAIIARARNRTNELRNATRHAEL 61

Query: 62  EAIDQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
           EAID IL+    T E+        +LYVTVEPC+MC+ ALRQL I  VYYGC NE+FGG 
Sbjct: 62  EAIDGILADKTLTPEMTRYPLSDTVLYVTVEPCMMCASALRQLGIHSVYYGCENEKFGGN 121

Query: 118 GSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
           GSV  +++  +  +HP Y   GGY R+E+IM+LR+FYV EN  APVPK K  R LKTEI 
Sbjct: 122 GSVLGVNESLEHPIHPPYKSVGGYLREEAIMILRRFYVTENTNAPVPKLKANRTLKTEIL 181

Query: 178 P 178
           P
Sbjct: 182 P 182



>gi|409075337|gb|EKM75718.1| hypothetical protein AGABI1DRAFT_64087 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 184

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 119/174 (68%), Gaps = 4/174 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREAL  A+EA    E+PVGC+FV D  +I   RNRTNE  N TRHAE EAID I 
Sbjct: 7   HLNWMREALTMAEEALAAGEVPVGCVFVRDGSVISRARNRTNELRNATRHAELEAIDAIF 66

Query: 69  SSGEYTSEVFQRCI----LYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +    T ++ Q  +    LYVTVEPC+MC+ ALRQL IK+V+YGCAN+RFGG GSV  ++
Sbjct: 67  TDKSLTPKMTQYSLSTTTLYVTVEPCIMCAAALRQLGIKNVFYGCANDRFGGCGSVLGVN 126

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           +      HP +   GGY+  E+IMLLR+FYV EN  APVP+ K  RVLKTEI+P
Sbjct: 127 EGLGHPSHPPFKAIGGYFHAEAIMLLRRFYVTENNNAPVPRSKTNRVLKTEISP 180



>gi|426197990|gb|EKV47916.1| hypothetical protein AGABI2DRAFT_219136 [Agaricus bisporus var.
           bisporus H97]
          Length = 184

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 118/174 (67%), Gaps = 4/174 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREAL  A+EA    E+PVGC+FV D  +I   RNRTNE  N TRHAE EAID I 
Sbjct: 7   HLNWMREALTMAEEALTAGEVPVGCVFVRDGSVISRARNRTNELRNATRHAELEAIDAIF 66

Query: 69  SSGEYTSEVFQ----RCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +    T ++ Q       LYVTVEPC+MC+ ALRQL IK+V+YGCAN+RFGG GSV  ++
Sbjct: 67  TDKSLTPKMTQYPLSTTTLYVTVEPCIMCAAALRQLGIKNVFYGCANDRFGGCGSVLGVN 126

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           +      HP +   GGY+  E+IMLLR+FYV EN  APVP+ K  RVLKTEI+P
Sbjct: 127 EGLGHPSHPPFKAIGGYFHAEAIMLLRRFYVTENNNAPVPRSKTNRVLKTEISP 180



>gi|295671881|ref|XP_002796487.1| tRNA-specific adenosine deaminase [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226283467|gb|EEH39033.1| tRNA-specific adenosine deaminase [Paracoccidioides sp. 'lutzii'
           Pb01]
          Length = 197

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 95/171 (55%), Positives = 126/171 (73%), Gaps = 5/171 (2%)

Query: 4   SMETIHHKY-MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           S ET+ H+Y MR+AL+  +EA  + E PVGC+ V +++IIGSG N TN++ NGTRHAEF 
Sbjct: 11  SSETLKHEYFMRKALDMGEEALASGETPVGCVLVHNEEIIGSGMNDTNKSMNGTRHAEFL 70

Query: 63  AIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
           A++++L S  Y   +F    LYVTVEPC+MC+ ALRQ RI+HV++GCANERFGGTG V +
Sbjct: 71  AVEEVLRS--YPRSIFHETDLYVTVEPCIMCASALRQYRIRHVFFGCANERFGGTGGVLN 128

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           +H DP   + P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK
Sbjct: 129 LHSDP--GIDPPYELTGGLFRKEAIMLLRRFYIQENERAPNPKPKKDRELK 177



>gi|393246614|gb|EJD54123.1| cytidine deaminase-like protein [Auricularia delicata TFB-10046
           SS5]
          Length = 192

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 98/176 (55%), Positives = 116/176 (65%), Gaps = 5/176 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  AQEA+D +E+PVGC+FV D +II   RNRT E  N TRHAE EAID IL
Sbjct: 7   HLDWMQHALQMAQEAFDAREVPVGCVFVRDSRIIARARNRTIELKNATRHAELEAIDAIL 66

Query: 69  SSGEYTSE----VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +    T E          LYVTVEPC+MCS ALRQ+ IK VY+GC N+RFGG GSV   H
Sbjct: 67  ADPALTPEPTPHPLADTTLYVTVEPCIMCSSALRQMGIKAVYFGCENDRFGGCGSVLAAH 126

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPMK 180
                T H  YP   G+ RDE+IMLLR+FY+ EN  APVP+ K  RVL+TEI P K
Sbjct: 127 SIDHPT-HAPYPATSGFARDEAIMLLRRFYLTENTNAPVPRSKANRVLRTEIPPPK 181



>gi|401881859|gb|EJT46141.1| tRNA specific adenosine deaminase [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406701059|gb|EKD04213.1| tRNA specific adenosine deaminase [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 240

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 115/167 (68%), Gaps = 3/167 (1%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +MREAL  A+EA DN+E+PVGC+FV D K I   RNRTNE  N T HAE EAID +L   
Sbjct: 19  WMREALVMAEEALDNEEVPVGCVFVRDGKAIARARNRTNEWRNATLHAELEAIDHLLP-- 76

Query: 72  EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
            +      +  LYVTVEPCVMC+ ALRQ+ I  V YGC N+RFGG GSV D+     L  
Sbjct: 77  -FNPPPLSQITLYVTVEPCVMCASALRQVGIGRVVYGCGNDRFGGCGSVLDVSTSSMLDT 135

Query: 132 HPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           + ++   GGYYR+E+IMLLR+FY+ EN+ AP PK+K  RVLKTEI P
Sbjct: 136 NVSFEAVGGYYREEAIMLLRRFYMSENQNAPNPKKKTTRVLKTEIPP 182



>gi|392572964|gb|EIW66107.1| hypothetical protein TREMEDRAFT_74868 [Tremella mesenterica DSM 1558]
          Length = 1413

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/165 (57%), Positives = 112/165 (67%), Gaps = 3/165 (1%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+EA  + E+PVGC+FV D K I   RNRTNE  N T HAE EAID +L   
Sbjct: 1177 WMREALTMAEEALAHDEVPVGCVFVKDGKAIARARNRTNEWRNATLHAELEAIDHLLP-- 1234

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
             +         LYVTVEPCVMC+ ALRQ+ I  V YGC NERFGG GS+ DIH  P L  
Sbjct: 1235 -HHPAPLNSITLYVTVEPCVMCASALRQIGIGRVLYGCGNERFGGCGSLLDIHSTPHLPT 1293

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             P +  +GGYYR+E+IMLLR+FY+ EN KAP PK+K  RVLKT I
Sbjct: 1294 DPPFVAQGGYYREEAIMLLRRFYMSENSKAPQPKKKTTRVLKTNI 1338



>gi|71003327|ref|XP_756344.1| hypothetical protein UM00197.1 [Ustilago maydis 521]
 gi|46096349|gb|EAK81582.1| hypothetical protein UM00197.1 [Ustilago maydis 521]
          Length = 1260

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 97/182 (53%), Positives = 114/182 (62%), Gaps = 14/182 (7%)

Query: 11   KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
            K+MREAL  AQEA D  E+PVG +FV   ++I  GRNRTNE  N TRHAE EAID ILS 
Sbjct: 936  KWMREALVMAQEALDANEVPVGGVFVRKGEVIARGRNRTNELMNATRHAELEAIDHILSV 995

Query: 70   -------------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
                         SG      F+   LYVT+EPC+MC  ALRQ+ I  V +G  NERFGG
Sbjct: 996  MPPSAPDFAVAPHSGPEGDNPFKDTTLYVTIEPCIMCGAALRQIGIGRVVFGAGNERFGG 1055

Query: 117  TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             GSV  +H D  +   P Y   GGY RDE+IM+LR+FYV EN  AP P+ K +RVLKTEI
Sbjct: 1056 NGSVLGLHDDDAIVSSPGYESVGGYLRDEAIMMLRRFYVTENTNAPKPQNKSRRVLKTEI 1115

Query: 177  TP 178
             P
Sbjct: 1116 HP 1117



>gi|443896088|dbj|GAC73432.1| hypothetical protein PANT_9c00117 [Pseudozyma antarctica T-34]
          Length = 1269

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 97/182 (53%), Positives = 114/182 (62%), Gaps = 14/182 (7%)

Query: 11   KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
            K+MREAL  AQEA D  E+PVG +FV   ++I  GRNRTNE  N TRHAE EAID ILS 
Sbjct: 945  KWMREALAMAQEALDANEVPVGGVFVRKGEVIARGRNRTNELLNATRHAELEAIDHILSI 1004

Query: 70   -------------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
                         SG      F+   LYVT+EPC+MC  ALRQ+ I  V +G  NERFGG
Sbjct: 1005 MPPSATDFAVAPHSGPEGDNPFKDTTLYVTIEPCIMCGAALRQVGIGRVVFGAGNERFGG 1064

Query: 117  TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             GSV  +H D  +   P Y   GGY RDE+IM+LR+FYV EN  AP P+ K +RVLKTEI
Sbjct: 1065 NGSVLGLHDDDAIVSSPGYESVGGYLRDEAIMMLRRFYVTENTNAPKPQNKSRRVLKTEI 1124

Query: 177  TP 178
             P
Sbjct: 1125 HP 1126



>gi|482805799|gb|EOA82885.1| hypothetical protein SETTUDRAFT_96496 [Setosphaeria turcica Et28A]
          Length = 217

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 118/171 (69%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV    IIG G N TN T NGTRHAEF AI  IL
Sbjct: 9   HEGFMREAIAMAELALKSDETPVGCVFVRHGHIIGRGMNETNRTLNGTRHAEFVAIAGIL 68

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +  ++   +     LYVTVEPCVMC+  LRQ  I+ VY+GC NERFGGTG V +IH DP 
Sbjct: 69  A--KHPIAILHETDLYVTVEPCVMCASMLRQYGIRAVYFGCWNERFGGTGGVLNIHSDP- 125

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
            ++   YP  GG +R+E+IMLLRKFYV+ENEKAP PK+K  R LKTEI PM
Sbjct: 126 -SVDKPYPVTGGIFREEAIMLLRKFYVQENEKAPEPKQKKTRELKTEILPM 175



>gi|225681358|gb|EEH19642.1| tRNA-specific adenosine deaminase subunit TAD2 [Paracoccidioides
           brasiliensis Pb03]
          Length = 197

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/169 (55%), Positives = 125/169 (73%), Gaps = 5/169 (2%)

Query: 6   ETIHHKY-MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           ET+ H+Y MR+AL+  +EA  + E PVGC+ V +++IIGSG N TN++ NGTRHAEF A+
Sbjct: 13  ETLKHEYFMRKALDMGEEALASGETPVGCVLVHNEEIIGSGMNDTNKSMNGTRHAEFLAV 72

Query: 65  DQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +++L S  +   +F    LYVTVEPC+MC+ ALRQ RI+HVY+GCANERFGGTG V ++H
Sbjct: 73  EEVLRS--HPRSIFHETDLYVTVEPCIMCASALRQYRIRHVYFGCANERFGGTGGVLNLH 130

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
            DP +   P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK
Sbjct: 131 SDPGID--PPYELTGGLFRKEAIMLLRRFYIQENERAPNPKPKKDRELK 177



>gi|323507722|emb|CBQ67593.1| related to TAD2-tRNA-specific adenosine deaminase 2 [Sporisorium
            reilianum SRZ2]
          Length = 1276

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 114/182 (62%), Gaps = 14/182 (7%)

Query: 11   KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
            K+MREAL  AQEA +  E+PVG +FV   ++I  GRNRTNE  N TRHAE EAID ILS 
Sbjct: 944  KWMREALAMAQEALEANEVPVGGVFVRKGQVIARGRNRTNELLNATRHAELEAIDHILSI 1003

Query: 70   -------------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
                         SG      F+   LYVT+EPC+MC  ALRQ+ I  V +G  NERFGG
Sbjct: 1004 MPPSAPDFAVAPHSGPEGDNPFKDTTLYVTIEPCIMCGAALRQIGIGRVVFGAGNERFGG 1063

Query: 117  TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             GSV  +H D  +   P Y   GGY RDE+IM+LR+FYV EN  AP P+ K +RVLKTEI
Sbjct: 1064 NGSVLGLHDDDAIVSSPGYESVGGYLRDEAIMMLRRFYVTENTNAPKPQNKSRRVLKTEI 1123

Query: 177  TP 178
             P
Sbjct: 1124 HP 1125



>gi|501307785|dbj|GAC96727.1| hypothetical protein PHSY_004311 [Pseudozyma hubeiensis SY62]
          Length = 1259

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 114/182 (62%), Gaps = 14/182 (7%)

Query: 11   KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
            K+MREAL  AQEA D  E+PVG +FV   ++I  GRNRTNE  N TRHAE EAID ILS 
Sbjct: 930  KWMREALAMAQEALDANEVPVGGVFVRKGEVIARGRNRTNELLNATRHAELEAIDHILSI 989

Query: 70   -------------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
                         +G      F+   LYVT+EPC+MC  ALRQ+ I  V +G  NERFGG
Sbjct: 990  MPPSAPDFAVAPHAGPDGDNPFKDTTLYVTIEPCIMCGAALRQIGIGRVVFGAGNERFGG 1049

Query: 117  TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             GSV  +H D  +   P Y   GGY RDE+IM+LR+FYV EN  AP P+ K +RVLKTEI
Sbjct: 1050 NGSVLGLHDDDAIVSSPGYESVGGYLRDEAIMMLRRFYVTENTNAPKPQNKSRRVLKTEI 1109

Query: 177  TP 178
             P
Sbjct: 1110 HP 1111



>gi|325092201|gb|EGC45511.1| tRNA specific adenosine deaminase [Ajellomyces capsulatus H88]
          Length = 197

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 90/168 (53%), Positives = 123/168 (73%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M++AL+  +EA  + E PVGC+ V +D++IGSG N TN++ NGTRHAEF AI+++L
Sbjct: 17  HEYFMKKALDMGEEALASGETPVGCVLVHNDEVIGSGMNDTNKSMNGTRHAEFLAIEEVL 76

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y   +F+   LYVTVEPC+MC+ ALRQ +I+HVY+GCANERFGGTG V ++H DP 
Sbjct: 77  RN--YPRSIFRETDLYVTVEPCIMCASALRQYQIRHVYFGCANERFGGTGGVLNLHSDP- 133

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             + P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK + 
Sbjct: 134 -GIDPPYGLTGGLFRREAIMLLRRFYIQENERAPNPKPKKDRELKNDF 180



>gi|121714253|ref|XP_001274737.1| cytidine and deoxycytidylate deaminase zinc-binding domain protein
           [Aspergillus clavatus NRRL 1]
 gi|119402891|gb|EAW13311.1| cytidine and deoxycytidylate deaminase zinc-binding domain protein
           [Aspergillus clavatus NRRL 1]
          Length = 191

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 124/170 (72%), Gaps = 4/170 (2%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           ++  H  +M++AL   ++A +  E PVGC+ V D ++IGSG N TN++ NGTRHAEF AI
Sbjct: 14  VDPTHAYFMKQALLMGEKALEIGETPVGCVLVRDGQLIGSGMNDTNKSMNGTRHAEFIAI 73

Query: 65  DQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +++L S  +   + +   LYVTVEPCVMC+ ALRQ +I+ VY+GCANERFGGTGS+  +H
Sbjct: 74  EEMLRS--HPRSLLRSTDLYVTVEPCVMCASALRQYQIRSVYFGCANERFGGTGSILSLH 131

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
            DP  TL P YP  GG +R+E+IMLLR+FY++EN+KAP P+ K  R LKT
Sbjct: 132 SDP--TLDPPYPVHGGLFREEAIMLLRRFYIQENDKAPKPRPKKNRELKT 179



>gi|353237686|emb|CCA69653.1| related to TAD2-tRNA-specific adenosine deaminase 2 [Piriformospora
           indica DSM 11827]
          Length = 225

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/177 (54%), Positives = 119/177 (67%), Gaps = 9/177 (5%)

Query: 10  HKYMREA---LNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H+  R+A   L  A EA +  E+PVGC+FV D +II   RNRTNE  N TRHAE EAID 
Sbjct: 30  HRRSRQATKILLEANEAMEAGEVPVGCVFVRDGRIIAKARNRTNELRNSTRHAELEAIDY 89

Query: 67  ILSSGEYTSE-----VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVF 121
           ILSS E T +     + Q   LYVTVEPC+MC  ALRQ+ IK VYYGC N+RFGG GSV 
Sbjct: 90  ILSSPELTPDPTAERLLQTTTLYVTVEPCIMCGSALRQMGIKEVYYGCGNDRFGGCGSVL 149

Query: 122 DIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
            +++      +P YP   GY RDE+IM+LR+FY+ EN+ AP+P+ K  RVLKTEI P
Sbjct: 150 AVNESDH-PRNPPYPASMGYLRDEAIMILRRFYLTENKNAPIPRAKANRVLKTEILP 205



>gi|242219384|ref|XP_002475472.1| predicted protein [Postia placenta Mad-698-R]
 gi|220725331|gb|EED79323.1| predicted protein [Postia placenta Mad-698-R]
          Length = 175

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 118/169 (69%), Gaps = 4/169 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MR+A+  A+ A  + E+PVGC+FV D ++I   RNRTN+  N TRHAE EAID+IL
Sbjct: 7   HVQWMRQAMQMAEIALAHGEVPVGCIFVRDGRVIAQARNRTNKLRNATRHAELEAIDEIL 66

Query: 69  SSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +  ++T  +         LYVTVEPC+MC+ ALRQL IK V+YGC N+RFGG GSV  ++
Sbjct: 67  ADKQWTPALTPYPLSETTLYVTVEPCIMCASALRQLGIKEVFYGCENDRFGGCGSVLGVN 126

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
            +     HPAY  +GGY R+E+IM+LR+FY+ EN  APVPK K  RVLK
Sbjct: 127 AEVPHPAHPAYEAKGGYLREEAIMVLRRFYITENANAPVPKSKANRVLK 175



>gi|403417271|emb|CCM03971.1| predicted protein [Fibroporia radiculosa]
          Length = 202

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 4/172 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MR+A++ A+EA    E+PVGC+FV + K++   RNRTNE  N TRHAE EAID+IL
Sbjct: 21  HLEWMRKAMSMAEEALTAGEVPVGCIFVRNGKVVAQARNRTNELRNATRHAELEAIDEIL 80

Query: 69  SSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +    T  V         LYVTVEPC+MC+ ALRQ+ IK V+YGC N+RFGG GSV  ++
Sbjct: 81  ADKTLTPAVTPYPLAETTLYVTVEPCIMCASALRQMGIKEVFYGCENDRFGGCGSVLGVN 140

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
                  HPAY   GGY+R+E+IM+LR+FY+ EN  AP PK K  R LKT+I
Sbjct: 141 SGLPHPKHPAYRATGGYFREEAIMVLRRFYITENTNAPAPKSKTNRRLKTDI 192



>gi|326470308|gb|EGD94317.1| tRNA-specific adenosine deaminase subunit Tad2p/ADAT2 [Trichophyton
           tonsurans CBS 112818]
 gi|326481147|gb|EGE05157.1| cytidine and deoxycytidylate deaminase [Trichophyton equinum CBS
           127.97]
          Length = 189

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/168 (56%), Positives = 116/168 (69%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  A+ A    E PVGC+ V  D++IGSG N TN++ NGTRHAEF AI++ L
Sbjct: 10  HEVFMKMALKMAETALAVGETPVGCVLVNKDRVIGSGMNDTNKSLNGTRHAEFLAIEEAL 69

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S  Y   +F+   LYVTVEPC+MC+ ALRQ +I+ VY+GCANERFGGTG V  +H DP 
Sbjct: 70  RS--YPRSIFRETDLYVTVEPCIMCASALRQYQIRSVYFGCANERFGGTGGVLTLHSDP- 126

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             +   YP  GG YR E+IMLLRKFYV+ENE AP PK K  R LK EI
Sbjct: 127 -AIDQPYPVYGGIYRKEAIMLLRKFYVQENENAPNPKGKKDRKLKDEI 173



>gi|321260564|ref|XP_003195002.1| tRNA specific adenosine deaminase [Cryptococcus gattii WM276]
 gi|317461474|gb|ADV23215.1| tRNA specific adenosine deaminase, putative [Cryptococcus gattii
           WM276]
          Length = 239

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 112/166 (67%), Gaps = 3/166 (1%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGE 72
           MREAL  A+EA  N E+PVGC+FV   + I   RNRTNE  N T HAE EAID +L S  
Sbjct: 1   MREALIMAEEALSNDEVPVGCVFVKGGQAIARARNRTNEWRNATLHAELEAIDHLLPSHP 60

Query: 73  YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLH 132
                     LYVTVEPCVMC+ ALRQ+ I  V YGC N+RFGG GSV  ++  P+L  H
Sbjct: 61  AP---LSTITLYVTVEPCVMCASALRQVGIGRVVYGCGNDRFGGCGSVIPVNNSPRLDSH 117

Query: 133 PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           PAY   GG+YR+E+IMLLR+FY+ +N  AP PK+K  RVLKT+I P
Sbjct: 118 PAYVAVGGFYREEAIMLLRRFYMSQNPNAPKPKKKATRVLKTDIPP 163



>gi|58268162|ref|XP_571237.1| tRNA specific adenosine deaminase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134113420|ref|XP_774735.1| hypothetical protein CNBF4140 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257379|gb|EAL20088.1| hypothetical protein CNBF4140 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227472|gb|AAW43930.1| tRNA specific adenosine deaminase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 239

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 112/166 (67%), Gaps = 3/166 (1%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGE 72
           MREAL  A+EA  N E+PVGC+FV   + I   RNRTNE  N T HAE EAID +L S  
Sbjct: 1   MREALIMAEEALTNDEVPVGCVFVKGGQAIARARNRTNEWRNATLHAELEAIDHLLPSHP 60

Query: 73  YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLH 132
                     LYVTVEPCVMC+ ALRQ+ I  V YGC N+RFGG GSV  ++  P+L  H
Sbjct: 61  AP---LSTITLYVTVEPCVMCASALRQVGIGRVVYGCGNDRFGGCGSVIPVNNSPRLDSH 117

Query: 133 PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           PAY   GG+YR+E+IMLLR+FY+ +N  AP PK+K  RVLKT+I P
Sbjct: 118 PAYVAVGGFYREEAIMLLRRFYMSQNPNAPKPKKKATRVLKTDIPP 163



>gi|315040523|ref|XP_003169639.1| tRNA-specific adenosine deaminase subunit TAD2 [Arthroderma gypseum
           CBS 118893]
 gi|311346329|gb|EFR05532.1| tRNA-specific adenosine deaminase subunit TAD2 [Arthroderma gypseum
           CBS 118893]
          Length = 189

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 94/168 (55%), Positives = 115/168 (68%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  A+ A    E PVGC+ V  DK+IGSG N TN++ NGTRHAEF AI++ L
Sbjct: 10  HEVFMKMALRMAETALAVGETPVGCVLVNKDKVIGSGMNDTNKSLNGTRHAEFLAIEEAL 69

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S  +   +     LYVTVEPC+MC+ ALRQ R++ VY+GCANERFGGTG V  +H DP 
Sbjct: 70  RS--HPRSILHETDLYVTVEPCIMCASALRQYRVRSVYFGCANERFGGTGGVLSLHSDPA 127

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
           + L   YP  GG +R E+IMLLRKFYV+ENE AP PK K  R LK EI
Sbjct: 128 IEL--PYPVYGGIFRKEAIMLLRKFYVQENENAPNPKGKKDRKLKDEI 173



>gi|328857268|gb|EGG06385.1| hypothetical protein MELLADRAFT_86571 [Melampsora larici-populina
           98AG31]
          Length = 171

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 4/171 (2%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           M EA+  A+EA+   EIPVGC+F+  LD K+I  GRNRTNET N + HAEF+A+  +L +
Sbjct: 1   MSEAIKMAEEAFSANEIPVGCVFINELDGKLISKGRNRTNETRNASLHAEFDALSSLLPN 60

Query: 71  GEYTS--EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  +    F+   LYVTVEPC+MCS ALRQ+ IK V++GC+N+RFGG G V  IH DP+
Sbjct: 61  PKNPNLKTDFKNLTLYVTVEPCLMCSSALRQIGIKKVFFGCSNDRFGGCGGVISIHNDPR 120

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
           L     +   GGY R+E+I+LLRKFY+ EN  APVPK+K  RVLK E+ P+
Sbjct: 121 LLFSEPFVAYGGYRREEAIILLRKFYITENSNAPVPKKKTNRVLKFEMPPL 171



>gi|453082997|gb|EMF11043.1| tRNA specific adenosine deaminase, partial [Mycosphaerella
           populorum SO2202]
          Length = 183

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 92/171 (53%), Positives = 120/171 (70%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREA+  A+ A  + E PVGC+FV + KIIG G N TN + NGTRHAEF A+ +I+
Sbjct: 12  HEGFMREAIGMAEFALASDETPVGCVFVHEGKIIGRGINGTNASLNGTRHAEFVALAEIM 71

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           S  ++   +  +  LYVTVEPC+MC  ALRQ  I+ VY+GC N+RFGG G V ++H DP 
Sbjct: 72  S--KHPQSILHQTDLYVTVEPCIMCGSALRQYGIRAVYFGCLNDRFGGCGGVMNVHSDP- 128

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
             +   +PC GG +R+E+IMLLR+FYV+ENEKAP PK K  R LKTEI P+
Sbjct: 129 -GIDSTFPCYGGLFREEAIMLLRRFYVQENEKAPDPKPKKNRELKTEILPV 178



>gi|449296701|gb|EMC92720.1| hypothetical protein BAUCODRAFT_114576 [Baudoinia compniacensis
           UAMH 10762]
          Length = 215

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 90/171 (52%), Positives = 119/171 (69%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MR+A+  A+ A  + E PVGC+FV D ++IG G N TN + NGTRHAEF A+ +I+
Sbjct: 12  HEGFMRKAIEMAELALSSDETPVGCVFVHDGEVIGRGINGTNASLNGTRHAEFVALAEIM 71

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +  ++   + +   LYVTVEPC+MC+ ALRQ  I+ VY+GC N+RFGG G V  +H DP 
Sbjct: 72  A--KHPPSILKDTDLYVTVEPCIMCASALRQFGIRAVYFGCLNDRFGGCGGVMTVHSDPG 129

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
             + P YP  GG +R+E+IMLLRKFYV+EN KAP PK K  R LKTEI P+
Sbjct: 130 --VDPPYPVYGGLFREEAIMLLRKFYVQENNKAPDPKPKKNRELKTEILPI 178



>gi|240281302|gb|EER44805.1| tRNA specific adenosine deaminase [Ajellomyces capsulatus H143]
          Length = 197

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M++AL+  +EA  + E PVGC+ V +D+  GSG N TN++ NGTRHAEF AI+++L
Sbjct: 17  HEYFMKKALDMGEEALASGETPVGCVLVHNDEATGSGMNDTNKSMNGTRHAEFLAIEEVL 76

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y   +F+   LYVTVEPC+MC+ ALRQ +I+HVY+GCANERFGGTG V ++H DP 
Sbjct: 77  RN--YPRSIFRETDLYVTVEPCIMCASALRQYQIRHVYFGCANERFGGTGGVLNLHSDP- 133

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             + P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK + 
Sbjct: 134 -GIDPPYGLTGGLFRREAIMLLRRFYIQENERAPNPKPKKDRELKNDF 180



>gi|393215384|gb|EJD00875.1| cytidine deaminase-like protein [Fomitiporia mediterranea MF3/22]
          Length = 203

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 119/182 (65%), Gaps = 5/182 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEA 63
           S  ++H K+M EA   A+EA   +E+PVGC+FV D   I   RNRTNE  N TRHAE EA
Sbjct: 6   SDSSVHEKWMAEAQVMAEEALTAKEVPVGCVFVRDGVAIARARNRTNELRNATRHAELEA 65

Query: 64  IDQILSSGEYTSE-----VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           ID IL+S E T +     +     LYVTVEPC+MC+ ALRQ+ I  VYYGC NERFGG G
Sbjct: 66  IDSILASRELTPDPKEQHLLCTTTLYVTVEPCIMCASALRQMGIAAVYYGCENERFGGCG 125

Query: 119 SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           SV  +++  +   HP+Y   GGY R+ +IM+LR+FY+ EN  AP+PK K  RVLK EI  
Sbjct: 126 SVLGVNEGLRHPKHPSYKAIGGYGREAAIMILRRFYLTENVNAPIPKNKANRVLKIEIAD 185

Query: 179 MK 180
            K
Sbjct: 186 PK 187



>gi|327292493|ref|XP_003230945.1| tRNA-specific adenosine deaminase subunit TAD2 [Trichophyton rubrum
           CBS 118892]
 gi|326466882|gb|EGD92335.1| tRNA-specific adenosine deaminase subunit TAD2 [Trichophyton rubrum
           CBS 118892]
          Length = 189

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/168 (55%), Positives = 116/168 (69%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  A+ A    E PVGC+ V  D++IGSG N TN++ NGTRHAEF AI++ L
Sbjct: 10  HEVFMKMALKMAETALAVGETPVGCVLVNKDRVIGSGMNDTNKSLNGTRHAEFLAIEEAL 69

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S  +   +F+   LYVTVEPC+MC+ ALRQ +I+ VY+GCANERFGGTG V  +H DP 
Sbjct: 70  RS--HPRSIFRETDLYVTVEPCIMCASALRQYQIRSVYFGCANERFGGTGGVLTLHSDP- 126

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             +   YP  GG YR E+IMLLRKFYV+ENE AP PK K  R LK EI
Sbjct: 127 -AIDQPYPVYGGIYRKEAIMLLRKFYVQENENAPNPKGKKDRKLKDEI 173



>gi|212535962|ref|XP_002148137.1| tRNA-specific adenosine deaminase subunit TAD2, putative
           [Talaromyces marneffei ATCC 18224]
 gi|210070536|gb|EEA24626.1| tRNA-specific adenosine deaminase subunit TAD2, putative
           [Talaromyces marneffei ATCC 18224]
          Length = 190

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 118/169 (69%), Gaps = 4/169 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
             K+M+EAL+  ++A +  E PVGC+ VL  KIIGSG N TN + NGTRHAEF AI++ L
Sbjct: 23  QEKFMKEALSMGEKALEAGETPVGCVLVLQGKIIGSGMNDTNRSMNGTRHAEFLAIEEAL 82

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y   +F+   LYVTVEPCVMC+  LRQ  I+ V++GCANERFGGTGSV  +H DP 
Sbjct: 83  QT--YPRSIFKHVDLYVTVEPCVMCASLLRQYNIRRVFFGCANERFGGTGSVLSLHSDP- 139

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
             + P YP   G +++++I+LLR+FY++ENE AP PK K  R L TE +
Sbjct: 140 -CIDPRYPVHSGIFKNDAILLLRRFYIQENENAPNPKPKRNRELNTEFS 187



>gi|440637738|gb|ELR07657.1| hypothetical protein GMDG_08512 [Geomyces destructans 20631-21]
          Length = 242

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/193 (49%), Positives = 120/193 (62%), Gaps = 21/193 (10%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           +H  +MREAL  AQ A D  E PVGC+FV +  ++  G N TN T NGTRHAEF AI  +
Sbjct: 45  LHEGFMREALAMAQLALDTDETPVGCVFVHNGAVVARGMNATNRTLNGTRHAEFIAIASL 104

Query: 68  LS------------------SGE-YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYG 108
           LS                  SG  YT++V   C LYVTVEPCVMC+  LRQ  I+ VY+G
Sbjct: 105 LSPTPLPASTSPNDLPHFDPSGPAYTADVLLECDLYVTVEPCVMCASLLRQFGIRKVYFG 164

Query: 109 CANERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKH 168
            AN+RFGGTG V  IH      + PAY   GG+ R+E+IM+LR+FYV+EN KAP P+ K 
Sbjct: 165 AANDRFGGTGGVLSIHD--CEAVDPAYEVSGGWLREEAIMMLRRFYVQENGKAPAPRPKK 222

Query: 169 KRVLKTEITPMKK 181
           +RVL  E+ P+ K
Sbjct: 223 ERVLNLEVEPLVK 235



>gi|505754752|gb|EOQ99052.1| tRNA-specific adenosine deaminase 2 [Wallemia ichthyophaga EXF-994]
          Length = 234

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/186 (51%), Positives = 117/186 (62%), Gaps = 15/186 (8%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDD--------------KIIGSGRNRTNETF 53
           I   +MR AL  AQEAYD  EIPVGC+FV                 ++I   RNRTNE  
Sbjct: 13  IDKHWMRLALQMAQEAYDASEIPVGCVFVEQTEPATALHTQTQGYGRMIAKSRNRTNELR 72

Query: 54  NGTRHAEFEAIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANER 113
           N T HAE EAI QIL + +  S +  R  LYVT+EPC+MC+ ALRQ+ I HV YG  NER
Sbjct: 73  NATLHAELEAIGQILRTSDDHS-LLHRTTLYVTIEPCIMCASALRQVGINHVVYGAGNER 131

Query: 114 FGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           FGG GSV  I+ +P L    AY   GG +RDE+IMLLR+FY+ EN  AP P++K  R+LK
Sbjct: 132 FGGCGSVVPINDEPLLKYQKAYTALGGVFRDEAIMLLRRFYMTENSNAPQPRKKQTRILK 191

Query: 174 TEITPM 179
           TEI P+
Sbjct: 192 TEIPPV 197



>gi|296819611|ref|XP_002849875.1| tRNA specific adenosine deaminase [Arthroderma otae CBS 113480]
 gi|238840328|gb|EEQ29990.1| tRNA specific adenosine deaminase [Arthroderma otae CBS 113480]
          Length = 190

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/168 (54%), Positives = 115/168 (68%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  A+ A    E PVGC+ V   ++IGSG N TN++ NGTRHAEF AI++ L
Sbjct: 11  HEVFMKMALKMAETALAAGETPVGCVLVNKGRVIGSGMNDTNKSLNGTRHAEFLAIEEAL 70

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S  +   +F+   LYVTVEPC+MC+ ALRQ RI+ VY+GCANERFGGTG V  +H D  
Sbjct: 71  RS--HPRSIFRETDLYVTVEPCIMCASALRQYRIRSVYFGCANERFGGTGGVLTLHSDS- 127

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             + P YP  GG +R E+IMLLR+FYV+ENE AP PK K  R LK EI
Sbjct: 128 -AIDPPYPVYGGIFRKEAIMLLRQFYVQENENAPNPKAKKDRKLKDEI 174



>gi|328771384|gb|EGF81424.1| hypothetical protein BATDEDRAFT_87367 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 182

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/171 (55%), Positives = 117/171 (68%), Gaps = 9/171 (5%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDK-IIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           KYM  AL  A +AYD  E+PVGC+FV   K IIG GRNRTNE+ NG RHAEFEAIDQI+S
Sbjct: 11  KYMTMALQLASDAYDVGEVPVGCVFVHASKGIIGQGRNRTNESLNGVRHAEFEAIDQIMS 70

Query: 70  S-------GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
                     Y    F +  +YVTVEPC+MC+ ALR L+I+ V +GC N++FGG GSVF 
Sbjct: 71  MRPLETDLDTYVKTTFPQTDVYVTVEPCIMCASALRHLQIRRVVFGCGNDKFGGCGSVFH 130

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           IH D  +     YP  GG +++E+IM LR+FYVREN  APVP++K  RVLK
Sbjct: 131 IHDD-GVGAGFNYPAVGGLFKNEAIMALRRFYVRENNHAPVPRKKTNRVLK 180



>gi|242794450|ref|XP_002482376.1| cytosine deaminase, putative [Talaromyces stipitatus ATCC 10500]
 gi|218718964|gb|EED18384.1| cytosine deaminase, putative [Talaromyces stipitatus ATCC 10500]
          Length = 186

 Score =  187 bits (476), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 117/169 (69%), Gaps = 4/169 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
             ++M+EAL   ++A    E PVGC+ VL+ KIIGSG N TN + NGTRHAEF AI++ L
Sbjct: 19  QERFMKEALLMGEKALAVGETPVGCVLVLNGKIIGSGMNDTNRSMNGTRHAEFLAIEEAL 78

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y   +F+   LYVTVEPCVMC+  LRQ  I  V++GCANERFGGTGSV  +H DP 
Sbjct: 79  QT--YPRSIFREVDLYVTVEPCVMCASLLRQYNICRVFFGCANERFGGTGSVLSLHSDP- 135

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
            ++ P YP  GG +++++IMLLR+FY++ENE AP P+ K  R L TE  
Sbjct: 136 -SIDPPYPVYGGIFKNDAIMLLRRFYIQENENAPNPRSKRNRELNTEFA 183



>gi|452839327|gb|EME41266.1| hypothetical protein DOTSEDRAFT_73620 [Dothistroma septosporum
           NZE10]
          Length = 284

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 4/171 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MR+A++ A+ A  + E PVGC+FV + ++IG G N TN + NGTRHAEF A+ +I+
Sbjct: 12  HERFMRKAIDMAEFALASDETPVGCVFVHNGEVIGRGINGTNASLNGTRHAEFVALAEII 71

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +  ++   + +   LYVTVEPC+MC+ ALRQ  I+ V++GC N+RFGG G V +IH DP 
Sbjct: 72  A--KHPQSIIKETDLYVTVEPCIMCASALRQYGIRAVFFGCLNDRFGGCGGVMNIHSDPG 129

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
           +     YP  GG +R+E+IMLLR+FYV+ENEKAP PK K  R LKTEI P+
Sbjct: 130 VDK--PYPVYGGLFREEAIMLLRRFYVQENEKAPDPKPKKNRELKTEILPV 178



>gi|430812031|emb|CCJ30558.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 198

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 118/170 (69%), Gaps = 4/170 (2%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           T H  +M+EALN A+ A  N EIPVGC+FV  +K+I    N TN++FNG  H E  AI+ 
Sbjct: 2   TDHQDFMKEALNMAEIALKNNEIPVGCVFVHKNKMIAKEMNNTNKSFNGIFHCEIIAINN 61

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           IL   +Y S +F+   LYVTVEPC+MC+ ALRQL I+ VY+GCANERFGGTGSV  +H D
Sbjct: 62  ILK--DYPSTIFEETDLYVTVEPCIMCASALRQLHIRSVYFGCANERFGGTGSVLRLHDD 119

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
               + P YP   G YR E+I LLR+FY++EN++AP PK K  RV+K ++
Sbjct: 120 K--GVDPTYPVFPGNYRKEAIFLLRQFYLQENKRAPKPKSKKNRVMKYDL 167



>gi|317034863|ref|XP_001400634.2| cytidine and deoxycytidylate deaminase zinc-binding domain protein
           [Aspergillus niger CBS 513.88]
          Length = 190

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (70%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M++AL   ++A +  E PVGC+ V D KI+G G N TN++ NGTRHAEF AI+++L
Sbjct: 16  HAYFMKQALLMGEKALETGETPVGCVLVYDKKIVGFGMNDTNKSMNGTRHAEFIAIEEML 75

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y     +   LYVTVEPCVMC+ ALRQ +I+ VY+GC N+RFGGTGS+  +H D  
Sbjct: 76  ET--YPRSALRSTDLYVTVEPCVMCASALRQYQIRKVYFGCGNDRFGGTGSILSLHAD-- 131

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
            ++ P+YP +GG +  E+IMLLR+FY++ENEKAP P+ K  R LKT+ 
Sbjct: 132 RSIDPSYPVQGGLFHKEAIMLLRRFYIQENEKAPKPRPKKHRELKTDF 179



>gi|50553008|ref|XP_503914.1| YALI0E13728p [Yarrowia lipolytica]
 gi|49649783|emb|CAG79507.1| YALI0E13728p [Yarrowia lipolytica CLIB122]
          Length = 222

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/173 (52%), Positives = 121/173 (69%), Gaps = 6/173 (3%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M EAL  A+ + +N E+PVGC+FV + K+I  G N TN++  GTRHAEF  I+ IL
Sbjct: 8   HSGFMEEALEQAELSLNNNEVPVGCVFVHNGKVIARGMNDTNKSLCGTRHAEFLGIEHIL 67

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  +T+++F+   LYVTVEPC+MC+ ALRQL+IK VYYGCAN+RFGG GSV  IH D  
Sbjct: 68  KT--HTADIFEEVDLYVTVEPCIMCASALRQLKIKCVYYGCANDRFGGCGSVMSIHSDKG 125

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK--RVLKTEITPM 179
           +   P Y    G+YR+E+IMLLR+FY +ENE AP  K+++K  R LKT   P 
Sbjct: 126 VD--PTYKAYPGFYREEAIMLLRRFYCQENENAPTEKKENKKQRELKTAFQPF 176



>gi|303320905|ref|XP_003070447.1| Cytidine and deoxycytidylate deaminase zinc-binding domain
           containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240110143|gb|EER28302.1| Cytidine and deoxycytidylate deaminase zinc-binding domain
           containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320033053|gb|EFW15002.1| tRNA-specific adenosine deaminase subunit TAD2 [Coccidioides
           posadasii str. Silveira]
          Length = 207

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 119/174 (68%), Gaps = 4/174 (2%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           S+ +  H ++MREAL  A++A    E PVGC+ V D K+IG G N TN + NGTRHAEF 
Sbjct: 22  SADDPAHEQFMREALQMAEQALAIGETPVGCVLVHDGKVIGRGMNDTNRSLNGTRHAEFL 81

Query: 63  AIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
           AI++ L S  Y   +F+   LYVTVEPC+MC+  LRQ  I+ V++GC N+RFGGTG V +
Sbjct: 82  AIEEALRS--YPRSIFRTTDLYVTVEPCIMCASLLRQNYIRRVFFGCVNDRFGGTGGVLN 139

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
           +H D    + P Y   GG +R+E+IMLLR+FY++ENEKAP P+ K  R LK ++
Sbjct: 140 LHSD--RAIDPPYTVYGGIFRNEAIMLLRRFYIQENEKAPNPRPKSNRELKRKL 191



>gi|388579183|gb|EIM19510.1| cytidine deaminase-like protein [Wallemia sebi CBS 633.66]
          Length = 230

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 117/190 (61%), Gaps = 15/190 (7%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDD--------------KIIGSGRNRT 49
           S   +   +MR AL  AQEAYD  EIPVGC+FV                 ++I   RNRT
Sbjct: 9   SQTDVDKYWMRMALEMAQEAYDASEIPVGCVFVEQTPFGSPLYLQTEGYGRMIAKSRNRT 68

Query: 50  NETFNGTRHAEFEAIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGC 109
           NE  N T HAE EAI +IL + +   ++ +R  LYVT+EPC+MC+ ALRQ+ I HV YG 
Sbjct: 69  NELRNATLHAELEAIGEILRTSD-DKKLLERTSLYVTIEPCIMCASALRQVGINHVVYGA 127

Query: 110 ANERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
            NERFGG GSV  I+ +P L     Y   GG +RDE+IMLLR+FY+ EN  AP P++K  
Sbjct: 128 GNERFGGCGSVVPINDEPLLKYQKPYTALGGVFRDEAIMLLRRFYMTENSNAPQPRKKQT 187

Query: 170 RVLKTEITPM 179
           R LKTEI P+
Sbjct: 188 RTLKTEIPPV 197



>gi|327356422|gb|EGE85279.1| tRNA specific adenosine deaminase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 174

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 4/156 (2%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGEYTSEVFQ 79
            +EA  + E PVGC+ V +D++IGSG N TN++ NGTRHAEF AI+++L S  +   +F+
Sbjct: 5   GEEALASGETPVGCVLVHNDEVIGSGMNDTNKSMNGTRHAEFLAIEEVLRS--HPRSIFR 62

Query: 80  RCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAYPCEG 139
              LYVTVEPC+MC+ ALRQ +I+HVY+GCANERFGGTG V  +H DP   + P Y   G
Sbjct: 63  ETDLYVTVEPCIMCASALRQYQIRHVYFGCANERFGGTGGVLKLHSDP--GIDPPYGLTG 120

Query: 140 GYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTE 175
           G +R E+IMLLR+FY++ENE+AP PK K  R LK +
Sbjct: 121 GLFRKEAIMLLRRFYIQENERAPNPKPKKDRELKDD 156



>gi|472580906|gb|EMS18673.1| tRNA specific adenosine deaminase [Rhodosporidium toruloides NP11]
          Length = 252

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 119/199 (59%), Gaps = 34/199 (17%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI------- 64
           +M +A+  A+EA   +EIPVGC+ V D K++  GRNRTNE  N T HAEF+A+       
Sbjct: 14  FMDQAVVMAEEALTAREIPVGCVLVHDGKVVARGRNRTNEGRNATLHAEFDALRHLLPDR 73

Query: 65  -----------------DQILSSGEYTSEV----------FQRCILYVTVEPCVMCSYAL 97
                            D I ++ E    V           +  +LYVTVEPC+MC+ A+
Sbjct: 74  SHAQTPGLTRPYTPQAEDVIAAAAEKEGPVAGGRKIWQTPLKGVVLYVTVEPCLMCASAM 133

Query: 98  RQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRE 157
           RQ+ I+ V YGCAN+RFGGTG V  IH DP+L   P YP  GGY R+E+IMLLR+FY+ E
Sbjct: 134 RQVGIEKVVYGCANDRFGGTGGVQSIHSDPRLLYAPPYPAVGGYRREEAIMLLRRFYISE 193

Query: 158 NEKAPVPKRKHKRVLKTEI 176
           N  AP PK+K  RVLKTEI
Sbjct: 194 NSTAPKPKKKSNRVLKTEI 212



>gi|119179553|ref|XP_001241350.1| hypothetical protein CIMG_08513 [Coccidioides immitis RS]
 gi|392866732|gb|EAS30094.2| tRNA specific adenosine deaminase [Coccidioides immitis RS]
          Length = 230

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/168 (51%), Positives = 116/168 (69%), Gaps = 4/168 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MREAL  A++A    E PVGC+ V D K+IG G N TN + NGTRHAEF AI++ L
Sbjct: 51  HEQFMREALQMAEQALAIGETPVGCVLVHDGKVIGRGMNDTNRSLNGTRHAEFLAIEEAL 110

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S  Y   +F+   LYVTVEPC+MC+  LRQ  I+ V++GC N+RFGGTG V ++H D  
Sbjct: 111 RS--YPRSIFRTTDLYVTVEPCIMCASLLRQNYIRRVFFGCVNDRFGGTGGVLNLHSD-- 166

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
             + P Y   GG +R+E+IMLLR+FY++ENEKAP P+ K  R LK ++
Sbjct: 167 RAIDPPYTVYGGIFRNEAIMLLRRFYIQENEKAPNPRPKSNRELKRKL 214



>gi|238508831|ref|XP_002385598.1| cytosine deaminase, putative [Aspergillus flavus NRRL3357]
 gi|317157687|ref|XP_001826520.2| cytidine and deoxycytidylate deaminase zinc-binding domain protein
           [Aspergillus oryzae RIB40]
 gi|220688490|gb|EED44843.1| cytosine deaminase, putative [Aspergillus flavus NRRL3357]
          Length = 174

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/166 (50%), Positives = 117/166 (70%), Gaps = 4/166 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M++AL   ++A +  E PVGC+ V D++I+ SG N TN + NGTRHAEF A++++L
Sbjct: 7   HAYFMKQALLMGEKALETGETPVGCVLVYDNQIVSSGMNDTNRSMNGTRHAEFIALERML 66

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            +  Y   + +   LYVTVEPCVMC+ ALRQ RI+ VY+GC+NERFGGTGS+  +H D  
Sbjct: 67  RN--YPKSLLRSTKLYVTVEPCVMCASALRQYRIQAVYFGCSNERFGGTGSILSLHTD-- 122

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
            ++ P YP  GG +  E++MLLR+FY++ENEKAP P+ K  R L T
Sbjct: 123 FSIDPPYPVYGGLFSKEAVMLLRRFYIQENEKAPKPRPKKNRELNT 168



>gi|452977117|gb|EME76890.1| hypothetical protein MYCFIDRAFT_122470, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 162

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 115/166 (69%), Gaps = 4/166 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MR+A+  AQ A  + E PVGC+FV + ++IG G N TN + NGTRHAEF A+ +I+
Sbjct: 1   HEGFMRKAIEMAQFALASDETPVGCVFVHNGEVIGRGINGTNASLNGTRHAEFVALAEIM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +   +   +     LYVTVEPC+MC+ ALRQ  I+ VY+GC N+RFGG G V +IH DP 
Sbjct: 61  A--HHPQSILHETDLYVTVEPCIMCASALRQYGIRAVYFGCLNDRFGGCGGVMNIHSDPG 118

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           +     +PC GG +R+E+IMLLR+FYV+ENEKAP PK K  R LKT
Sbjct: 119 ID--STFPCYGGLFREEAIMLLRRFYVQENEKAPDPKPKKNRELKT 162



>gi|358059398|dbj|GAA94804.1| hypothetical protein E5Q_01458 [Mixia osmundae IAM 14324]
          Length = 193

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 117/170 (68%), Gaps = 4/170 (2%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           +M  AL  A+EA ++ EIPVGC+FV ++K++ SGRNRTNE  N T+HAEF+A+ +++   
Sbjct: 18  FMDLALQQAEEALEHVEIPVGCVFVRNNKVVASGRNRTNELRNATKHAEFDALSRLMPLE 77

Query: 70  -SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
             GE  + + +   LYVTVEPCVMCS  LRQ++I  V YGCAN+RFGG G V  IH D  
Sbjct: 78  VDGEGQTSM-KDYTLYVTVEPCVMCSSLLRQVKIGKVIYGCANDRFGGCGGVQSIHSDVN 136

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           L   P Y   GGY R+E+IM+LR+FY+ EN+ AP PK K  RVLK +  P
Sbjct: 137 LRYSPTYSALGGYRREEAIMILRRFYMLENKSAPKPKVKANRVLKHDFKP 186



>gi|398406661|ref|XP_003854796.1| hypothetical protein MYCGRDRAFT_28568, partial [Zymoseptoria
           tritici IPO323]
 gi|339474680|gb|EGP89772.1| hypothetical protein MYCGRDRAFT_28568 [Zymoseptoria tritici IPO323]
          Length = 162

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (69%), Gaps = 4/166 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+MR+A+  A+ A  + E PVGC+FV + ++IG G N TN + NGTRHAEF A+ +I+
Sbjct: 1   HEKFMRKAIEMAEFALASDETPVGCVFVHNGEVIGRGINGTNASLNGTRHAEFVALAEII 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
           +  ++   +     LYVTVEPC+MC+ ALRQ  I+ VY+GC N+RFGG G V +IH D  
Sbjct: 61  A--KHPQSILHATDLYVTVEPCIMCASALRQYGIRAVYFGCLNDRFGGCGGVMNIHADEG 118

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           +   P YP  GG +R+E+IMLLR+FYV+ENEKAP PK K  R LKT
Sbjct: 119 VD--PGYPVYGGLFREEAIMLLRRFYVQENEKAPEPKPKKNRELKT 162



>gi|345569662|gb|EGX52527.1| hypothetical protein AOL_s00043g21 [Arthrobotrys oligospora ATCC
           24927]
          Length = 215

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 116/173 (67%), Gaps = 4/173 (2%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           I   +MR+AL   + A    E+PVGC+FVLD+K+I  G N TN + +G RHAEF  I+ +
Sbjct: 14  IREYFMRQALEMGELALSIDEVPVGCVFVLDNKVIAKGMNDTNRSLSGHRHAEFAGIETV 73

Query: 68  LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
           L   +Y + VF+   LYVTVEPC+MC+ ALRQL I+ VY+GC+N+RFGG G V  ++ D 
Sbjct: 74  LC--KYPASVFKNVDLYVTVEPCIMCASALRQLGIRAVYFGCSNDRFGGCGGVLHVNLDA 131

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPMK 180
              +   YP  GG +R+E+IMLLR+FY++EN+KAP P  K  R+L T +  M 
Sbjct: 132 G--IDRCYPAIGGIFREEAIMLLRRFYLQENDKAPNPTAKRNRILNTIVENMS 182



>gi|501753157|emb|CCG83097.1| tRNA-specific adenosine deaminase subunit tad2 [Taphrina deformans
           PYCC 5710]
          Length = 196

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/164 (51%), Positives = 112/164 (68%), Gaps = 4/164 (2%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           +M+ AL  A+ A  N+E+PVGC+FV      ++ +G N+TN + NGT HAEF AI+ IL 
Sbjct: 30  FMQIALQQAETALLNKEVPVGCVFVHQPTGTVLATGANQTNASLNGTLHAEFVAIESILR 89

Query: 70  SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQL 129
             ++   +F+   LYVTVEPCVMC+ ALRQL+++ VY+GC N+RFGG GSVF IH D   
Sbjct: 90  --DHPPSIFRESDLYVTVEPCVMCASALRQLQVRKVYFGCGNDRFGGCGSVFSIHSDASK 147

Query: 130 TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           T   AY  E G +R E+IMLLR+FY+ +NE AP P  K  RVLK
Sbjct: 148 TGDAAYMVESGIFRKEAIMLLRRFYLLQNESAPKPALKSTRVLK 191



>gi|261188113|ref|XP_002620473.1| tRNA-specific adenosine-34 deaminase subunit Tad2p/ADAT2
           [Ajellomyces dermatitidis SLH14081]
 gi|239593348|gb|EEQ75929.1| tRNA-specific adenosine-34 deaminase subunit Tad2p/ADAT2
           [Ajellomyces dermatitidis SLH14081]
 gi|239609090|gb|EEQ86077.1| tRNA-specific adenosine-34 deaminase subunit Tad2p/ADAT2
           [Ajellomyces dermatitidis ER-3]
          Length = 187

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 114/167 (68%), Gaps = 13/167 (7%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGEYTSEVFQ 79
            +EA  + E PVGC+ V +D++IGSG N TN++ NGTRHAEF AI+++L S  +   +F+
Sbjct: 5   GEEALASGETPVGCVLVHNDEVIGSGMNDTNKSMNGTRHAEFLAIEEVLRS--HPRSIFR 62

Query: 80  RCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLT--------- 130
              LYVTVEPC+MC+ ALRQ +I+HVY+GCANERFGGTG V  +H +  L          
Sbjct: 63  ETDLYVTVEPCIMCASALRQYQIRHVYFGCANERFGGTGGVLKLHSEKSLLKLPGIISGS 122

Query: 131 --LHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTE 175
             + P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK +
Sbjct: 123 PGIDPPYGLTGGLFRKEAIMLLRRFYIQENERAPNPKPKKDRELKDD 169



>gi|512206567|gb|EPE35386.1| Cytidine deaminase-like protein [Glarea lozoyensis ATCC 20868]
          Length = 193

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (65%), Gaps = 5/176 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV-LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           H  YMREAL  A+ A    E PVGC+        IG G N TN T NGT HAEF AI+QI
Sbjct: 9   HLTYMREALAMAELALQTSETPVGCIIQHPTHGTIGRGMNATNRTRNGTMHAEFIAINQI 68

Query: 68  LSS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           L+   +YT ++ + C LYVTVEPC+MC+  LRQ  IK V++G +NE+FGGTG V D+H  
Sbjct: 69  LAPPSQYTPDILKECTLYVTVEPCIMCASLLRQFGIKKVFFGASNEKFGGTGGVLDVHLG 128

Query: 127 PQLTL---HPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
               +      Y   GG+ R+E+I++LR+FYV+ENE+AP P++K +RVLK E+ P+
Sbjct: 129 NGRGIGGKEGDYEVSGGWLREEAIVMLRRFYVQENERAPEPRKKAERVLKLEVEPL 184



>gi|336381263|gb|EGO22415.1| hypothetical protein SERLADRAFT_362684 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 173

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 111/159 (69%), Gaps = 4/159 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEA 63
           S+E  H ++M+EA+  A+EA    E+PVGC+FV D++II   RNRTNE  N TRHAE EA
Sbjct: 10  SLEKAHLRWMQEAMLMAEEALAASEVPVGCVFVRDNRIIAKSRNRTNELRNATRHAELEA 69

Query: 64  IDQILSSGEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGS 119
           ID+ILS  + T  +        ILYVTVEPC+MC+ ALRQ+ I+ V++GC N++FGG G+
Sbjct: 70  IDRILSDKDLTPIIVDYPLSDTILYVTVEPCMMCASALRQMGIQEVFFGCENDKFGGCGT 129

Query: 120 VFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVREN 158
           V  ++   +   HP+Y   GGY RDE+IM+LR+FYV EN
Sbjct: 130 VLGVNDKLEHPKHPSYKATGGYCRDEAIMILRRFYVTEN 168



>gi|254568360|ref|XP_002491290.1| Subunit of tRNA-specific adenosine-34 deaminase [Komagataella
           pastoris GS115]
 gi|238031087|emb|CAY69010.1| Subunit of tRNA-specific adenosine-34 deaminase [Komagataella
           pastoris GS115]
 gi|328352193|emb|CCA38592.1| hypothetical protein PP7435_Chr2-0910 [Komagataella pastoris CBS
           7435]
          Length = 220

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 116/179 (64%), Gaps = 9/179 (5%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           +ET H  +M++AL+ AQ A D  E+P+GC+FV  +KII  G N+TN T  G  HAE EAI
Sbjct: 3   LET-HFNFMKKALDAAQIALDELEVPIGCIFVYKNKIIAQGSNKTNATSCGINHAEMEAI 61

Query: 65  DQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           D+I++      E+     LYVTVEPC+MC+ ALRQL I+ V++GCAN+RFGG GSV  IH
Sbjct: 62  DEIIAKYPNYKEILPFADLYVTVEPCIMCASALRQLGIRRVFFGCANDRFGGNGSVLTIH 121

Query: 125 QDP-----QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
            D        +++P YP   G Y  E++ LLRKFY+ +NEK+P P+ K  R L  E  P
Sbjct: 122 SDKLNNKLDSSIYPVYP---GIYAKEAVTLLRKFYLNQNEKSPNPQTKKLRQLDMENFP 177



>gi|403158227|ref|XP_003307544.2| hypothetical protein PGTG_00494 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163731|gb|EFP74538.2| hypothetical protein PGTG_00494 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 352

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 107/166 (64%), Gaps = 2/166 (1%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           M +A+  A EA    EIPVGC+ V    DK++  GRNRTNET N   HAEF+AI  + S 
Sbjct: 184 MDQAIEMANEALVANEIPVGCVLVSKTTDKVLSKGRNRTNETKNACLHAEFDAIGGLHSV 243

Query: 71  GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLT 130
                  +    LYVTVEPC+MCS ALRQ+ I  VY+GC+N+RFGG G V  IH DP+L 
Sbjct: 244 TPADKIDWNDVKLYVTVEPCLMCSSALRQIGINLVYFGCSNDRFGGCGGVVSIHNDPRLI 303

Query: 131 LHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
                   GGY R+++I+LLRKFY+ EN  APVPK+K  RVLK EI
Sbjct: 304 HSQPLTALGGYRREDAIILLRKFYITENTNAPVPKKKTNRVLKMEI 349



>gi|378732653|gb|EHY59112.1| hypothetical protein HMPREF1120_07111 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 222

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 4/166 (2%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           +H  +MR A+N A+EA    E PV C+ V + +++  G N TN + NGTRHAEF AI + 
Sbjct: 58  LHQGFMRRAINVAEEALAGGETPVACVLVHNGEVVARGMNDTNRSLNGTRHAEFLAISEF 117

Query: 68  LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
           LS  ++ +E  +   LYVTVEPC+MC+ ALRQ  I+ VY+GC N+RFGG GSV  ++ D 
Sbjct: 118 LS--KFPAEKLKETDLYVTVEPCIMCASALRQYGIRCVYFGCGNDRFGGNGSVLAVNSDK 175

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
              L   YP  GG +R E+IMLLR+FY++ENE AP P+ K  R LK
Sbjct: 176 --GLEEGYPSYGGIFRKEAIMLLRRFYIQENENAPNPRAKGNRELK 219



>gi|402226018|gb|EJU06078.1| cytidine deaminase-like protein [Dacryopinax sp. DJM-731 SS1]
          Length = 208

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/182 (52%), Positives = 120/182 (65%), Gaps = 12/182 (6%)

Query: 6   ETIHHKYMREALNHAQEAYDNQEIPVGCLFV-LDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           ET  H Y+  AL  A+EA D  E+PVGC+FV  + +++ S RNRTNE  N TRHAE EAI
Sbjct: 26  ETDMH-YINLALAQAREALDAGEVPVGCVFVDSEGEVVASARNRTNELRNATRHAELEAI 84

Query: 65  DQILSSGEYTSE---VFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVF 121
           D +LSS   +           LYVTVEPC+MCS ALRQL I  V YGC+N RFGG G V+
Sbjct: 85  DHLLSSPSLSLPRPHPLSSLTLYVTVEPCIMCSSALRQLEISRVVYGCSNPRFGGCGGVW 144

Query: 122 DIHQDPQLTLHP---AYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
            +++ P    HP   AY    GY R+E+I+LLR+FY+ EN KAP PK K +RVLKT+I P
Sbjct: 145 AVNELP----HPRERAYEALEGYGREEAILLLRRFYMTENIKAPTPKSKARRVLKTDIPP 200

Query: 179 MK 180
           M+
Sbjct: 201 MR 202



>gi|448110895|ref|XP_004201713.1| Piso0_001912 [Millerozyma farinosa CBS 7064]
 gi|359464702|emb|CCE88407.1| Piso0_001912 [Millerozyma farinosa CBS 7064]
          Length = 317

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 112/183 (61%), Gaps = 16/183 (8%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           TI    M  AL  A +A  + E PV C+ V DDK+I  G N TN+T NGTRHAEFEAIDQ
Sbjct: 5   TIEFSNMSLALFLAFKALLSNETPVACILVEDDKVIAVGYNGTNKTLNGTRHAEFEAIDQ 64

Query: 67  IL---------SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
            L         ++GE   + F    LYVTVEPC+MC+ ALRQ+ +K V +GCANERFGG 
Sbjct: 65  ALRYFAANKRHAAGEDVVKEFANVTLYVTVEPCIMCASALRQIGLKKVVFGCANERFGGN 124

Query: 118 GSVFDIHQDPQLTLHPAYPCE--GGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTE 175
           G++  IHQD      P  P    GG  R ESI LLR FY++EN  APVPK K  + ++ +
Sbjct: 125 GTILKIHQD-----GPGQPYNSFGGILRTESIQLLRNFYIQENTSAPVPKIKKNKDIEGK 179

Query: 176 ITP 178
           + P
Sbjct: 180 VFP 182



>gi|406861289|gb|EKD14344.1| tRNA-specific adenosine deaminase subunit TAD2 [Marssonina brunnea
           f. sp. 'multigermtubi' MB_m1]
          Length = 239

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 120/199 (60%), Gaps = 28/199 (14%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +MREAL  A+ A    E PVGC+FV + +IIG G N TN T+NGTRHAEF AI+ IL
Sbjct: 34  HLTFMREALAMAELALQTSETPVGCVFVYNGRIIGRGMNATNRTYNGTRHAEFIAINDIL 93

Query: 69  SSGE--------YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
            +          Y  E+ + C LYVT+EPC+MC+  LRQ  ++ V++G +NE+FGGTG V
Sbjct: 94  MAPHPSEKGRKIYGPEILRECNLYVTIEPCIMCASLLRQFGVRRVFFGGSNEKFGGTGGV 153

Query: 121 FDIHQDPQLTLHPA--------------------YPCEGGYYRDESIMLLRKFYVRENEK 160
            +I ++    +                       Y   GG+ R+E+I++LR+FYV+ENE+
Sbjct: 154 LNIQRENGREVEEGDEEEVGEEERRQREWRREGDYEVYGGWLREEAIVMLRRFYVQENER 213

Query: 161 APVPKRKHKRVLKTEITPM 179
           AP P+ K +RVLK E+ P+
Sbjct: 214 APEPRGKKERVLKLEVEPI 232



>gi|194033488|ref|XP_001924271.1| PREDICTED: tRNA-specific adenosine deaminase 2 isoform 1 [Sus
           scrofa]
          Length = 191

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M +A+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEQAMQMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G+  SEVF+R +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV DI  
Sbjct: 83  WCHRGGKSPSEVFERTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLDIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|405968829|gb|EKC33858.1| tRNA-specific adenosine deaminase 2 [Crassostrea gigas]
          Length = 175

 Score =  168 bits (425), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 4/170 (2%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           M+ I   +M  + N A+EA    E+PVGC+ V +DKII  G+N  NET N TRHAE  AI
Sbjct: 1   MDDIQQNWMVRSFNFAEEALQAGEVPVGCIIVYEDKIIAVGKNEVNETKNATRHAEIVAI 60

Query: 65  DQILSSGE----YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           DQ+L   +     ++ VF + +LYVTVEPC+MC+ ALRQ+ I  V +GC NERFGG GS+
Sbjct: 61  DQVLKWSKEQDINSALVFSKSVLYVTVEPCIMCAGALRQVGIPLVIFGCHNERFGGCGSI 120

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
             IH     +L P++ C GG  ++ ++ LL++FY  EN  AP  KRK K+
Sbjct: 121 LSIHDASLESLGPSFQCIGGIMQERAVDLLKRFYQGENPNAPEDKRKVKK 170



>gi|296199377|ref|XP_002747141.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Callithrix jacchus]
          Length = 191

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+ +SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCGRSGKNSSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|448096873|ref|XP_004198536.1| Piso0_001912 [Millerozyma farinosa CBS 7064]
 gi|359379958|emb|CCE82199.1| Piso0_001912 [Millerozyma farinosa CBS 7064]
          Length = 317

 Score =  167 bits (424), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 113/177 (63%), Gaps = 16/177 (9%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL---- 68
           M  AL  A +A  + E PV C+ V DDK+I  G N TN+T NGTRHAEFEAIDQ L    
Sbjct: 11  MSLALFLAFKALLSNETPVACILVEDDKVIAVGYNGTNKTLNGTRHAEFEAIDQALRYFA 70

Query: 69  -----SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
                + GE+  + F++  LYVTVEPC+MC+ ALRQ+ IK V +GCANERFGG G++  +
Sbjct: 71  ENKRHAVGEHIVKEFEKVTLYVTVEPCIMCASALRQIGIKRVVFGCANERFGGNGTILKV 130

Query: 124 HQDPQLTLHPAYPCE--GGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           HQ+      P  P    GG  R ESI LLR FY++EN +AP+PK K  + ++ ++ P
Sbjct: 131 HQE-----GPGQPYNSFGGVLRTESIQLLRNFYIQENTQAPIPKTKKNKDIEGKVFP 182



>gi|291397092|ref|XP_002714901.1| PREDICTED: deaminase domain containing 1-like [Oryctolagus
           cuniculus]
          Length = 192

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 24  EKWMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 83

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+ ++EVF+  +LYVTVEPC+MC+ ALR L+I  V YGC NERFGG GSV +I  
Sbjct: 84  WCRRSGKSSAEVFEHTVLYVTVEPCIMCAAALRLLKIPLVVYGCQNERFGGCGSVLNIAS 143

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 144 ADLPNTGRPFQCLPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 192



>gi|109072525|ref|XP_001091638.1| PREDICTED: tRNA-specific adenosine deaminase 2 isoform 1 [Macaca
           mulatta]
 gi|402868074|ref|XP_003898145.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Papio anubis]
 gi|355748852|gb|EHH53335.1| hypothetical protein EGM_13954 [Macaca fascicularis]
          Length = 191

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|124107608|ref|NP_872309.2| tRNA-specific adenosine deaminase 2 [Homo sapiens]
 gi|74750199|sp|Q7Z6V5.1|ADAT2_HUMAN RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
 gi|119568252|gb|EAW47867.1| deaminase domain containing 1, isoform CRA_a [Homo sapiens]
          Length = 191

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|507534308|ref|XP_004651210.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Jaculus jaculus]
          Length = 191

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 112/170 (65%), Gaps = 6/170 (3%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            ++M EA+  A+EA DN E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EQWMEEAMRTAKEALDNIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI-H 124
               SG+  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRRSGQNPSAVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
            D Q T  P + C  GY  +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLQNTGRP-FQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|77736501|ref|NP_001029952.1| tRNA-specific adenosine deaminase 2 [Bos taurus]
 gi|75057795|sp|Q5E9J7.1|ADAT2_BOVIN RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
 gi|59858211|gb|AAX08940.1| deaminase domain containing 1 [Bos taurus]
 gi|296483948|tpg|DAA26063.1| TPA: tRNA-specific adenosine deaminase 2 [Bos taurus]
          Length = 191

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M +A+  A++A DN E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 23  EKWMEQAMQMAKDALDNTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G   SEVF+  +LYVTVEPC+MC+ ALR +RI  V YGC NERFGG GSV DI  
Sbjct: 83  WCRRRGRSPSEVFEHTVLYVTVEPCIMCAAALRLMRIPLVVYGCQNERFGGCGSVLDIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
               +    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPSTGKPFQCTPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECHKS 191



>gi|426234913|ref|XP_004011436.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Ovis aries]
          Length = 191

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M +A+  A++A DN E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 23  EKWMEQAMQMAKDALDNTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G   SEVF+  +LYVTVEPC+MC+ ALR +RI  V YGC NERFGG GSV DI  
Sbjct: 83  WCRRRGRSPSEVFEHTVLYVTVEPCIMCAAALRLMRIPLVVYGCQNERFGGCGSVLDIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
               +    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPSTGKPFQCTPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECHKS 191



>gi|297679305|ref|XP_002817478.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Pongo abelii]
          Length = 191

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCLQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|114609579|ref|XP_518775.2| PREDICTED: tRNA-specific adenosine deaminase 2 isoform 2 [Pan
           troglodytes]
 gi|397480671|ref|XP_003811600.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Pan paniscus]
 gi|426354771|ref|XP_004044821.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Gorilla gorilla
           gorilla]
          Length = 191

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|113816713|gb|AAH37955.2| ADAT2 protein [Homo sapiens]
          Length = 193

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 25  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 84

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 85  WCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 144

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 145 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 193



>gi|403269821|ref|XP_003926910.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Saimiri boliviensis
           boliviensis]
          Length = 191

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V + +++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNSEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCHRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|470319703|gb|EMR11313.1| hypothetical protein PNEG_00342 [Pneumocystis murina B123]
          Length = 170

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 112/168 (66%), Gaps = 19/168 (11%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFN-------------- 54
           H ++M+EALN A+ A  N E P+GC+FV  +KII    N TNE+ N              
Sbjct: 3   HKEFMKEALNMAELALKNNETPIGCVFVYKNKIIAKEMNNTNESLNVLENAFEFILFNAL 62

Query: 55  -GTRHAEFEAIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANER 113
            GT H E  AI++IL +  Y S++F+   LYVTVEPC+MC+ ALRQL IK V++GCANER
Sbjct: 63  KGTFHCEMVAINKILEN--YPSKIFEEVNLYVTVEPCIMCASALRQLHIKSVHFGCANER 120

Query: 114 FGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
           FGGTGS+F +H D  +   P YP   GYYR+++I+LLR+FY++EN+K 
Sbjct: 121 FGGTGSIFRLHDDEGID--PIYPVFLGYYREDAILLLRRFYLQENKKG 166



>gi|332213485|ref|XP_003255854.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Nomascus
           leucogenys]
          Length = 191

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAVRMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|478533782|ref|XP_004441028.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Ceratotherium simum
           simum]
          Length = 187

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 108/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 19  EKWMEEAMQMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 78

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPCVMC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 79  WCHRSGKSPSEVFEHTVLYVTVEPCVMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 138

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 139 ADLPNTGRPFQCVPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 187



>gi|295442884|ref|NP_596505.2| tRNA specific adenosine deaminase subunit Tad2 [Schizosaccharomyces
           pombe 972h-]
 gi|259016150|sp|O94642.2|TAD2_SCHPO RecName: Full=tRNA-specific adenosine deaminase subunit tad2;
           AltName: Full=tRNA-specific adenosine-34 deaminase
           subunit tad2
 gi|254745608|emb|CAB38514.2| tRNA specific adenosine deaminase subunit Tad2 [Schizosaccharomyces
           pombe]
          Length = 389

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (64%), Gaps = 7/177 (3%)

Query: 6   ETIHHKYMR---EALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           +T H  YM+   E LN           P  C+FV   ++IG G N TN + +G RHAE  
Sbjct: 211 DTQHETYMKLAHEILNLGPYFVIQPRSPGSCVFVYKGEVIGRGFNETNCSLSGIRHAELI 270

Query: 63  AIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
           AI++IL    Y + VF+   LYVTVEPC+MC+ AL+QL IK VY+GC N+RFGG GSVF 
Sbjct: 271 AIEKILE--HYPASVFKETTLYVTVEPCLMCAAALKQLHIKAVYFGCGNDRFGGCGSVFS 328

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
           I++D   ++ P+YP   G +  E++ML+R+FYV+EN KAPVP+ K +RVLK E+  +
Sbjct: 329 INKDQ--SIDPSYPVYPGLFYSEAVMLMREFYVQENVKAPVPQSKKQRVLKREVKSL 383



>gi|406607760|emb|CCH40865.1| putative riboflavin biosynthesis protein [Wickerhamomyces ciferrii]
          Length = 250

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 108/178 (60%), Gaps = 9/178 (5%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H  +M+ AL  A  A  N E+PV C+FV  +++I  G N TN++ +G  HAEF  I+ I 
Sbjct: 7   HKGFMKYALKLANNALHNNEVPVACVFVYKNQVISYGMNNTNDSLSGITHAEFRGINIIW 66

Query: 69  SS--------GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           S         G    ++F+   LYVTVEPCVMC+ AL+Q+ I++VY+GC NERFGG GS 
Sbjct: 67  SKLQSMTPTPGIALQDIFKEIDLYVTVEPCVMCASALKQIGIRNVYFGCGNERFGGNGSC 126

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
             I+QD   T    Y    G YR E+I+LLR FY  EN KAPVPK K  R+LK +  P
Sbjct: 127 LKINQD-STTSENNYKSYPGIYRKEAIILLRDFYTHENTKAPVPKEKKNRILKKDEFP 183



>gi|410960192|ref|XP_003986678.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Felis catus]
          Length = 192

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 107/168 (63%), Gaps = 4/168 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 24  EKWMEEAMQMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 83

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 84  WCHQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 143

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 144 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECPK 191



>gi|344263898|ref|XP_003404032.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Loxodonta
           africana]
          Length = 191

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 112/175 (64%), Gaps = 6/175 (3%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           S+ ET   K+M  A++ A++A +N E+PVGCL + +++I+G GRN  N+T N TRHAE  
Sbjct: 18  SAAET--EKWMEAAMHMAKDALENLEVPVGCLMIYNNEIVGKGRNEVNQTKNATRHAEMV 75

Query: 63  AIDQILS----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           AIDQ+L     SGE  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG G
Sbjct: 76  AIDQVLDWCHRSGESPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCG 135

Query: 119 SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           SV +I           + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 136 SVLNIASADLPNTGKPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 190



>gi|355562010|gb|EHH18642.1| hypothetical protein EGK_15289 [Macaca mulatta]
          Length = 191

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 109/169 (64%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ AL  ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRRSGKSPSEVFEHTVLYVTVEPCIMCAAALHLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|301753666|ref|XP_002912694.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Ailuropoda
           melanoleuca]
          Length = 192

 Score =  164 bits (415), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 107/167 (64%), Gaps = 4/167 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L  
Sbjct: 25  KWMEEAMQMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALDW 84

Query: 70  ---SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
              SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I   
Sbjct: 85  CHRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASA 144

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                   + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 145 DLPNTGRPFKCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 191



>gi|508784781|gb|EOY32037.1| Cytidine/deoxycytidylate deaminase family protein isoform 1
           [Theobroma cacao]
          Length = 202

 Score =  164 bits (415), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 102/167 (61%), Gaps = 12/167 (7%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           YM  A+  A+ A ++ E+PVGC+F+ D K+I SGRNRTNET N TRHAE EAID +L   
Sbjct: 28  YMELAIQQAKLALESLEVPVGCVFIKDGKVIASGRNRTNETRNATRHAEMEAIDILLEKW 87

Query: 70  -----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
                S    +E F +CILYVT EPC+MC+ AL  L IK VYYGCANE+FGG GS+  +H
Sbjct: 88  QRDGLSKSDVAETFSKCILYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLH 147

Query: 125 QDP-----QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                   ++     + C GG    E++ L R FY + N  AP P R
Sbjct: 148 SSALSHLSEVPQRKGFKCTGGLLASEAVSLFRSFYEQGNPNAPKPHR 194



>gi|198443277|pdb|3DH1|A Chain A, Crystal Structure Of Human Trna-Specific Adenosine-34
           Deaminase Subunit Adat2
 gi|198443278|pdb|3DH1|B Chain B, Crystal Structure Of Human Trna-Specific Adenosine-34
           Deaminase Subunit Adat2
 gi|198443279|pdb|3DH1|C Chain C, Crystal Structure Of Human Trna-Specific Adenosine-34
           Deaminase Subunit Adat2
 gi|198443280|pdb|3DH1|D Chain D, Crystal Structure Of Human Trna-Specific Adenosine-34
           Deaminase Subunit Adat2
          Length = 189

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 109/166 (65%), Gaps = 5/166 (3%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEA 63
           SME    K+M EA++ A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  A
Sbjct: 22  SMEETE-KWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVA 80

Query: 64  IDQILS----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGS 119
           IDQ+L     SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GS
Sbjct: 81  IDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGS 140

Query: 120 VFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPK 165
           V +I           + C  GY  +E++ +L+ FY +EN  AP  K
Sbjct: 141 VLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSK 186



>gi|502076876|ref|XP_004485484.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X5
           [Cicer arietinum]
 gi|502076879|ref|XP_004485485.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X6
           [Cicer arietinum]
          Length = 297

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/162 (48%), Positives = 102/162 (62%), Gaps = 7/162 (4%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 128 FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 187

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
             +G   +EV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FGG GS+  +H
Sbjct: 188 QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGIKDVFYGCSNDKFGGCGSILSLH 247

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                +L+  + C GG    E+I+LLR FY + N  AP P R
Sbjct: 248 LKDTASLNKGFKCAGGIMATEAILLLRTFYDQGNPNAPKPHR 289



>gi|471356643|ref|XP_004368920.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Trichechus manatus
           latirostris]
          Length = 191

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 108/168 (64%), Gaps = 4/168 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           K+M  A+  A++A +N E+PVGCL V +++I+G GRN  N+T N TRHAE  AIDQ+L  
Sbjct: 24  KWMEAAMYMAKDALENLEVPVGCLMVYNNEIVGKGRNEVNQTKNATRHAEMVAIDQVLDW 83

Query: 70  ---SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
              SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I   
Sbjct: 84  CHHSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASA 143

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                   + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 144 DLPNTGKPFQCVPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|395834682|ref|XP_003790323.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Otolemur garnettii]
          Length = 191

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M  A++ A+EA  N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEAAMHMAKEALANTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG   SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCRQSGRSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRLFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|472354897|ref|XP_004397105.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Odobenus rosmarus
           divergens]
          Length = 192

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 4/168 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA ++ E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 24  EKWMEEAMQMAKEALESTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 83

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 84  WCHRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 143

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 144 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 191



>gi|502107339|ref|XP_004493233.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X5
           [Cicer arietinum]
          Length = 178

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/162 (48%), Positives = 102/162 (62%), Gaps = 7/162 (4%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 9   FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 68

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
             +G   +EV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FGG GS+  +H
Sbjct: 69  QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGIKDVFYGCSNDKFGGCGSILSLH 128

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                +L+  + C GG    E+I+LLR FY + N  AP P R
Sbjct: 129 LKDTASLNKGFKCAGGIMATEAIILLRTFYDQGNPNAPKPHR 170



>gi|512883307|ref|XP_004895702.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Heterocephalus
           glaber]
 gi|512967871|ref|XP_004846102.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Heterocephalus
           glaber]
          Length = 191

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (63%), Gaps = 4/168 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           K+M EA+  A++A  N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L  
Sbjct: 24  KWMEEAMRMAKDALKNTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDW 83

Query: 70  ---SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
              +G+  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV D+   
Sbjct: 84  CHQNGQSPSSVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLDVASA 143

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                   + C  GY  +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 144 DLPNSGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|465973583|ref|XP_004263804.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Orcinus orca]
 gi|470647870|ref|XP_004327630.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Tursiops truncatus]
          Length = 191

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M +A+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 23  EKWMEQAMQMAKEALENIEVPVGCLLVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 82

Query: 70  S----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV DI  
Sbjct: 83  WCRRHGKSPSEVFEHMVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLDIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 191



>gi|511859500|ref|XP_004752802.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Mustela putorius
           furo]
 gi|511940444|ref|XP_004789030.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Mustela putorius
           furo]
          Length = 192

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 4/168 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M +A+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 24  EKWMEDAMQMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 83

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               SG+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 84  WCHRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 143

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 144 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 191



>gi|345784418|ref|XP_003432552.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Canis lupus
           familiaris]
          Length = 192

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 4/168 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L 
Sbjct: 24  EKWMEEAMQMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALD 83

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               +G+  SEVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 84  WCHQNGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 143

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 144 ADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 191



>gi|507634365|ref|XP_004628642.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Octodon degus]
          Length = 191

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 105/167 (62%), Gaps = 4/167 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           K+M EA+  A+EA  N E+PVGCL V +++++G GRN  NET N TRHAE  AIDQ+L  
Sbjct: 24  KWMEEAMRMAKEALRNTEVPVGCLMVYNNEVVGKGRNEVNETKNATRHAEMVAIDQVLDW 83

Query: 70  ---SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
              + +  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV DI   
Sbjct: 84  CHQNDQSPSSVFEHTVLYVTVEPCIMCAAALRLMKIPLVIYGCQNERFGGCGSVLDIASA 143

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                   + C  GY  +E++ LL+ FY +EN  AP  K + K   K
Sbjct: 144 DLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKECQK 190



>gi|169234864|ref|NP_001108500.1| tRNA-specific adenosine deaminase 2 [Rattus norvegicus]
 gi|165970946|gb|AAI58617.1| Deadc1 protein [Rattus norvegicus]
          Length = 191

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  S----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G+  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCHRHGQSPSAVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS 191



>gi|61098160|ref|NP_080024.3| tRNA-specific adenosine deaminase 2 [Mus musculus]
 gi|81885246|sp|Q6P6J0.1|ADAT2_MOUSE RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
 gi|38328211|gb|AAH62195.1| Adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
           [Mus musculus]
 gi|148671551|gb|EDL03498.1| deaminase domain containing 1 [Mus musculus]
          Length = 191

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L 
Sbjct: 23  EKWMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD 82

Query: 70  S----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G+  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 83  WCHQHGQSPSTVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 143 ADLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS 191



>gi|124360458|gb|ABN08468.1| CMP/dCMP deaminase, zinc-binding [Medicago truncatula]
          Length = 178

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 107/171 (62%), Gaps = 9/171 (5%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           +S ET  H +M  A+  A+ A    E+PVGC+ V D K+I SGRNRT ET N TRHAE E
Sbjct: 2   TSQET--HIFMELAIQQAKLAMGALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEME 59

Query: 63  AIDQIL----SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           AID +L     +G   +EV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FG
Sbjct: 60  AIDVLLEQWQKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALSNLGIKEVFYGCSNDKFG 119

Query: 116 GTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           G GS+  +H    ++ +  + C GG   +E+++LLR FY + N  AP P R
Sbjct: 120 GCGSILSLHLSDAVSPNKGFKCAGGIMAEEAVLLLRTFYEQGNPNAPKPHR 170



>gi|354475545|ref|XP_003499988.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Cricetulus
           griseus]
          Length = 191

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (63%), Gaps = 6/176 (3%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           S+ ET   K+M EA+  A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  
Sbjct: 18  SAQET--EKWMEEAMRMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMV 75

Query: 63  AIDQILSS----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           AIDQ+L          +EVF+  +LYVTVEPC+MC+ A+R ++I  V YGC NERFGG G
Sbjct: 76  AIDQVLDWCHQHSRSPAEVFEHTVLYVTVEPCIMCAAAVRLMKIPLVVYGCQNERFGGCG 135

Query: 119 SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           SV +I      +    + C  GY+ +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 136 SVLNIASADLPSTGRPFQCIPGYHAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS 191



>gi|148228295|ref|NP_001089483.1| tRNA-specific adenosine deaminase 2 [Xenopus laevis]
 gi|82225873|sp|Q4V7V8.1|ADAT2_XENLA RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
 gi|66912051|gb|AAH97698.1| MGC115242 protein [Xenopus laevis]
          Length = 175

 Score =  161 bits (407), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/164 (47%), Positives = 104/164 (63%), Gaps = 4/164 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A   AQ+A +N E+PVGCL V  ++++G GRN  NET N T+HAE  AIDQ+L 
Sbjct: 11  QNWMHKAFQMAQDALNNGEVPVGCLMVYGNQVVGKGRNEVNETKNATQHAEMVAIDQVLD 70

Query: 70  SGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
             E  S    +VF+  +LYVTVEPC+MC+ ALR L+I  V YGC NERFGG GSV ++  
Sbjct: 71  WCEMNSKKSTDVFENIVLYVTVEPCIMCAGALRLLKIPLVVYGCRNERFGGCGSVLNVSG 130

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           D        + C GGY  +++I LL+ FY +EN  AP  K + K
Sbjct: 131 DDIPDTGTKFKCIGGYQAEKAIELLKTFYKQENPNAPKSKVRKK 174



>gi|291244202|ref|XP_002741990.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Saccoglossus
           kowalevskii]
          Length = 209

 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 108/164 (65%), Gaps = 4/164 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           K+M ++L+ A +A  N E+PVGCL V  D++IG GRN  NET N TRHAE  AID+++  
Sbjct: 14  KWMEKSLDMAHDALFNGEVPVGCLMVYKDEVIGKGRNCVNETRNATRHAEMVAIDEVIGW 73

Query: 71  GEYTSEV----FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
            E +++V    F + +LYVTVEPC+MC+ ALR L +  V YGC+NERFGG GSV ++H+D
Sbjct: 74  CEKSNQVKEAVFSKTVLYVTVEPCIMCAGALRLLHVPLVVYGCSNERFGGCGSVLNVHKD 133

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
                   + C  G + +E+I LL+ FY  +N  AP PK K ++
Sbjct: 134 DIDNHGKPFKCISGIFAEEAIALLKDFYKGQNPNAPNPKIKPEK 177



>gi|161784292|sp|Q5RIV4.2|ADAT2_DANRE RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
          Length = 214

 Score =  160 bits (406), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 104/166 (62%), Gaps = 4/166 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A + A EA +N E+PVGCL V +++IIG GRN  NET N TRHAE  A+DQ+L 
Sbjct: 22  QTWMAKAFDMAVEALENGEVPVGCLMVYNNEIIGKGRNEVNETKNATRHAEMVALDQVLD 81

Query: 70  SGEY----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                     EV ++ +LYVTVEPC+MC+ ALR LRI  V YGC NERFGG GSV D+  
Sbjct: 82  WCRLREKDCKEVCEQTVLYVTVEPCIMCAAALRLLRIPFVVYGCKNERFGGCGSVLDVSS 141

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRV 171
           D       ++ C  GY  +E++ +L+ FY +EN  AP PK +   +
Sbjct: 142 DHLPHTGTSFKCIAGYRAEEAVEMLKTFYKQENPNAPKPKVRKDSI 187



>gi|290978118|ref|XP_002671783.1| predicted protein [Naegleria gruberi]
 gi|284085355|gb|EFC39039.1| predicted protein [Naegleria gruberi]
          Length = 214

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 113/190 (59%), Gaps = 20/190 (10%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           YMREALN AQ+A +  E+PVGC+ V D+KI+G G N+TN+  N TRHAE EA D+I    
Sbjct: 21  YMREALNMAQKALEELEVPVGCVIVHDNKIVGRGYNKTNQKKNATRHAELEAFDEITENY 80

Query: 70  SGEYTSEV--FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD- 126
           S E  + V  F+ C LYVTVEPCVMC+ AL  L+I  V  GC NERFGG GSV +IHQ  
Sbjct: 81  SEELNNNVNFFKECTLYVTVEPCVMCASALILLKIGRVVCGCMNERFGGCGSVLNIHQSC 140

Query: 127 --------------PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVL 172
                             L+  Y C  G +  E I +L++FY +EN  AP+PK K  + +
Sbjct: 141 YNSLNHNHHHDQHGNNNQLNWKYECVHGLFEKECIEILQRFYEQENPTAPIPKVKKSKTI 200

Query: 173 KTE-ITPMKK 181
             E I P +K
Sbjct: 201 PDESINPHQK 210



>gi|134024903|gb|AAI35110.1| Unknown (protein for IMAGE:7163502) [Danio rerio]
          Length = 241

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 104/166 (62%), Gaps = 4/166 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A + A EA +N E+PVGCL V +++IIG GRN  NET N TRHAE  A+DQ+L 
Sbjct: 49  QTWMAKAFDMAVEALENGEVPVGCLMVYNNEIIGKGRNEVNETKNATRHAEMVALDQVLD 108

Query: 70  SGEY----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                     EV ++ +LYVTVEPC+MC+ ALR LRI  V YGC NERFGG GSV D+  
Sbjct: 109 WCRLREKDCKEVCEQTVLYVTVEPCIMCAAALRLLRIPFVVYGCKNERFGGCGSVLDVSS 168

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRV 171
           D       ++ C  GY  +E++ +L+ FY +EN  AP PK +   +
Sbjct: 169 DHLPHTGTSFKCIAGYRAEEAVEMLKTFYKQENPNAPKPKVRKDSI 214



>gi|213409075|ref|XP_002175308.1| tRNA-specific adenosine deaminase subunit tad2 [Schizosaccharomyces
           japonicus yFS275]
 gi|212003355|gb|EEB09015.1| tRNA-specific adenosine deaminase subunit tad2 [Schizosaccharomyces
           japonicus yFS275]
          Length = 365

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 108/174 (62%), Gaps = 28/174 (16%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           S   ++HH++M+EALN A+ A    E+P                        G +HAE  
Sbjct: 211 SEENSVHHQFMKEALNMAELALKWNEVP------------------------GIQHAELV 246

Query: 63  AIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
           A++ IL    Y   +F+   LYVTVEPC+MC+ AL+QL IK VY+GC N+RFGG GSVF 
Sbjct: 247 AVEDILK--RYPPSIFEEVTLYVTVEPCLMCAAALKQLHIKEVYFGCGNDRFGGCGSVFS 304

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
           I++DP  ++ P YP   G YR E+IML+R+FYV+EN KAPVPK K +R+LK EI
Sbjct: 305 INKDP--SVDPPYPVYPGLYRAEAIMLMRQFYVQENTKAPVPKTKKQRILKLEI 356



>gi|366986611|ref|XP_003673072.1| hypothetical protein NCAS_0A01210 [Naumovozyma castellii CBS 4309]
 gi|342298935|emb|CCC66680.1| hypothetical protein NCAS_0A01210 [Naumovozyma castellii CBS 4309]
          Length = 256

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 115/186 (61%), Gaps = 11/186 (5%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAE 60
           SS    H  +M  A+  A+ A D+ E PV  +FV +  +KII  G N TN++  G  HAE
Sbjct: 2   SSSLAKHASWMESAIKLARYALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHAE 61

Query: 61  FEAIDQI--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           F  I+QI  +   E+ +E+F+  +LYVTVEPCVMC+ ALRQL IK V +GCANERFGG G
Sbjct: 62  FMGIEQIKAMVGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFGCANERFGGNG 121

Query: 119 SVFDIHQDPQLTLHP------AYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVL 172
           +V +I++D   TL P       Y       R E+IMLLR FYVRENE+AP P+ K +R L
Sbjct: 122 TVLEINKD-SCTLPPNGLPTTTYESIPFVLRREAIMLLRYFYVRENERAPTPRNKTERKL 180

Query: 173 KTEITP 178
             +  P
Sbjct: 181 DKDTFP 186



>gi|507925394|ref|XP_004673963.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Condylura cristata]
          Length = 166

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 107/166 (64%), Gaps = 4/166 (2%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS--- 69
           M EA++ A++A +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L+   
Sbjct: 1   MEEAMHMAKDALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLAWCQ 60

Query: 70  -SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
             G   +EVF+  +LYVTVEPCVMC+ ALR ++I  V YGC NERFGG GS+ +I     
Sbjct: 61  GCGRSAAEVFEHTVLYVTVEPCVMCAAALRLMKIPLVVYGCQNERFGGCGSILNIASADL 120

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                 + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 121 PNTGRPFQCIPGYRAEEAVAMLKTFYKQENPNAPKSKVRKKECQKS 166



>gi|440911538|gb|ELR61196.1| tRNA-specific adenosine deaminase 2 [Bos grunniens mutus]
          Length = 201

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 107/179 (59%), Gaps = 14/179 (7%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNET----------FNGTRHA 59
            K+M +A+  A++A DN E+PVGCL V +++++G GRN  N+T          F  TRHA
Sbjct: 23  EKWMEQAMQMAKDALDNTEVPVGCLMVYNNEVVGKGRNEVNQTKNVCQCRQLSFQATRHA 82

Query: 60  EFEAIDQILS----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           E  AIDQ L      G   SEVF+  +LYVTVEPC+MC+ ALR +RI  V YGC NERFG
Sbjct: 83  EMVAIDQALDWCRRRGRSPSEVFEHTVLYVTVEPCIMCAAALRLMRIPLVVYGCQNERFG 142

Query: 116 GTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           G GSV DI      +    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 143 GCGSVLDIASADLPSTGKPFQCTPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECHKS 201



>gi|79361008|ref|NP_564523.3| Cytidine/deoxycytidylate deaminase family protein [Arabidopsis
           thaliana]
 gi|48310033|gb|AAT41740.1| At1g48175 [Arabidopsis thaliana]
 gi|50198832|gb|AAT70448.1| At1g48175 [Arabidopsis thaliana]
 gi|332194138|gb|AEE32259.1| Cytidine/deoxycytidylate deaminase family protein [Arabidopsis
           thaliana]
          Length = 182

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 109/176 (61%), Gaps = 11/176 (6%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           H YM  AL+ A+ A +  E+PVGC+F+ D K+I SGRNRTNET N TRHAE EAIDQ++ 
Sbjct: 10  HNYMGFALHQAKLALEALEVPVGCVFLEDGKVIASGRNRTNETRNATRHAEMEAIDQLVG 69

Query: 70  -------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
                  S    +E F +C+LYVT EPC+MC+ AL  L IK VYYGC N++FGG GS+  
Sbjct: 70  QWQKDGLSPSQVAEKFSKCVLYVTCEPCIMCASALSFLGIKEVYYGCPNDKFGGCGSILS 129

Query: 123 IH-QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
           +H    +      Y C GG   +E++ L + FY + N  AP P   H+ V++ E T
Sbjct: 130 LHLGSEEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNAPKP---HRPVVQRERT 182



>gi|255580984|ref|XP_002531310.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Ricinus
           communis]
 gi|223529101|gb|EEF31082.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Ricinus
           communis]
          Length = 223

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 102/169 (60%), Gaps = 14/169 (8%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           YM  AL  A+ A D+ E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 46  YMELALEQARHALDSLEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 105

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
              G   SEV   F +C+LYVT EPC+MC+ AL  L I+ VYYGCAN++FGG GS+  +H
Sbjct: 106 QKGGLSVSEVAEKFSKCVLYVTCEPCIMCAAALSILGIEEVYYGCANDKFGGCGSILPLH 165

Query: 125 QDPQLTLHP-------AYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                +L          + C GG    E++ LLR FY + N  AP P R
Sbjct: 166 SSSTQSLTSGVVAQGKGFKCTGGIMASEAVSLLRCFYEQGNPNAPKPHR 214



>gi|460394441|ref|XP_004242811.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform 2
           [Solanum lycopersicum]
          Length = 212

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 104/174 (59%), Gaps = 14/174 (8%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           ++M+ AL  A +A  N E+PVGC+FV D ++I SGRNRT ET N TRHAE EAID ++  
Sbjct: 37  EFMKLALEQANDALANLEVPVGCVFVEDGEVIASGRNRTTETRNATRHAEMEAIDFLVQQ 96

Query: 71  GEY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
            +         SE F +C LYVT EPC+MC+ AL  L IK  YYGCAN++FGG GSV  +
Sbjct: 97  WQKNGLSPLEVSERFSKCTLYVTCEPCIMCAAALSYLGIKEAYYGCANDKFGGCGSVLSL 156

Query: 124 HQD----PQLTLHPA---YPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
           H      P   L  +   + C GG    E++ LLR FY + N  AP P R  K+
Sbjct: 157 HTSNSNLPTSELASSKKGFKCTGGIMASEAVSLLRSFYEQGNPNAPKPHRPLKQ 210



>gi|118404850|ref|NP_001072562.1| tRNA-specific adenosine deaminase 2 [Xenopus (Silurana) tropicalis]
 gi|123905851|sp|Q0P4H0.1|ADAT2_XENTR RecName: Full=tRNA-specific adenosine deaminase 2; AltName:
           Full=Deaminase domain-containing protein 1; AltName:
           Full=tRNA-specific adenosine-34 deaminase subunit ADAT2
 gi|112419108|gb|AAI22085.1| deaminase domain containing 1 [Xenopus (Silurana) tropicalis]
          Length = 170

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/164 (47%), Positives = 104/164 (63%), Gaps = 4/164 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A   AQ+A +N E+PVGCL V D++++G GRN  NET N TRHAE  AIDQ+L 
Sbjct: 6   QNWMHKAFQMAQDALNNGEVPVGCLMVYDNQVVGKGRNEVNETKNATRHAEMVAIDQVLD 65

Query: 70  SGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
             E  S    +VF+  +LYVTVEPC+MC+ ALR L+I  V YGC NERFGG GSV ++  
Sbjct: 66  WCEKNSKKSRDVFENIVLYVTVEPCIMCAGALRLLKIPLVVYGCRNERFGGCGSVLNVAG 125

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           D        +   GGY  ++++ LL+ FY +EN  AP  K + K
Sbjct: 126 DNIPDTGTEFKYIGGYQAEKAVELLKTFYKQENPNAPRSKVRKK 169



>gi|390341832|ref|XP_789050.3| PREDICTED: tRNA-specific adenosine deaminase 2-like
           [Strongylocentrotus purpuratus]
          Length = 201

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 106/168 (63%), Gaps = 4/168 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEA 63
           S E    K+M EA+N A++A    E+PVGCL V +D+IIG+G N  NET N TRHAE  A
Sbjct: 4   SEEVYDEKWMTEAVNMAKQALGRGEVPVGCLLVYEDQIIGTGGNAVNETKNATRHAEILA 63

Query: 64  IDQILSSGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGS 119
           +++ +   +       EVF R  L+VTVEPC+MC+ ALR + IK V YGC NERFGG GS
Sbjct: 64  LEEAMRWCDDKQLEREEVFSRTKLFVTVEPCIMCAGALRIMGIKKVVYGCRNERFGGCGS 123

Query: 120 VFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
           +  ++ D   ++   + C+ G Y D ++ LL++FY  +N  AP PK K
Sbjct: 124 ILSVNSDELPSMGEPFECKAGLYADTAVQLLQEFYKGQNPNAPNPKIK 171



>gi|255076837|ref|XP_002502085.1| predicted protein [Micromonas sp. RCC299]
 gi|226517350|gb|ACO63343.1| predicted protein [Micromonas sp. RCC299]
          Length = 193

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 104/181 (57%), Gaps = 27/181 (14%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS--S 70
           MR AL  A+ A    E+PVGC+ V D +++ SG NRTNE  NGTRHAEFEA+D++L+   
Sbjct: 1   MRVALEEAEGALARWEVPVGCVVVRDGEVVASGSNRTNEKRNGTRHAEFEAVDELLARHG 60

Query: 71  GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD--PQ 128
           G+  +  F RC LYVTVEPC+MC+ AL  L  + V YGC N++FGG GS+  IH D    
Sbjct: 61  GDAVAAGFDRCSLYVTVEPCIMCAGALSLLGFERVTYGCGNDKFGGNGSILSIHDDGCAP 120

Query: 129 LTLHPA-----------------------YPCEGGYYRDESIMLLRKFYVRENEKAPVPK 165
               PA                       YP  GG + +E+I LL+ FYVR N KAP P 
Sbjct: 121 CVEEPASSSKSHAGSDGKVSNDDARAANTYPSVGGLFAEEAIALLQDFYVRGNPKAPKPH 180

Query: 166 R 166
           R
Sbjct: 181 R 181



>gi|508784784|gb|EOY32040.1| Cytidine/deoxycytidylate deaminase family protein isoform 4,
           partial [Theobroma cacao]
          Length = 211

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 98/160 (61%), Gaps = 12/160 (7%)

Query: 19  HAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-------SG 71
            A+ A ++ E+PVGC+F+ D K+I SGRNRTNET N TRHAE EAID +L        S 
Sbjct: 44  QAKLALESLEVPVGCVFIKDGKVIASGRNRTNETRNATRHAEMEAIDILLEKWQRDGLSK 103

Query: 72  EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP---- 127
              +E F +CILYVT EPC+MC+ AL  L IK VYYGCANE+FGG GS+  +H       
Sbjct: 104 SDVAETFSKCILYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLHSSALSHL 163

Query: 128 -QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
            ++     + C GG    E++ L R FY + N  AP P R
Sbjct: 164 SEVPQRKGFKCTGGLLASEAVSLFRSFYEQGNPNAPKPHR 203



>gi|443726587|gb|ELU13706.1| hypothetical protein CAPTEDRAFT_2116 [Capitella teleta]
          Length = 175

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 101/169 (59%), Gaps = 8/169 (4%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLD----DKIIGSGRNRTNETFNGTRHAEFEAI 64
           H ++M+EAL  A EA+   E+PVGC+ V      + I+G GRN   ET N TRHAE  AI
Sbjct: 6   HLRWMKEALRLADEAFKVGEVPVGCILVYSHNGQEIIVGQGRNEVTETKNATRHAEMIAI 65

Query: 65  DQILSSGEY----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           DQ +   E     ++ V ++C LYVTVEPC+MC+ ALRQ RI  V YGCANERFGG GSV
Sbjct: 66  DQAMGWAEKNMFKSASVLEKCKLYVTVEPCIMCASALRQARISAVVYGCANERFGGCGSV 125

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
             +  D   +      C  G   +E+I LL+ FY  EN  AP  KRK K
Sbjct: 126 LCVSSDVLDSELAPLQCVSGILAEEAIALLKNFYKCENPNAPAEKRKIK 174



>gi|405121471|gb|AFR96240.1| tRNA specific adenosine deaminase [Cryptococcus neoformans var.
           grubii H99]
          Length = 238

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 99/173 (57%), Gaps = 21/173 (12%)

Query: 6   ETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAID 65
           + I   +MREAL  A+EA  N E+PVGC+FV   + I   RNRTNE  N T HAE EAID
Sbjct: 11  DQIDLAWMREALIMAEEALSNDEVPVGCVFVKGGQAIARARNRTNEWRNATLHAELEAID 70

Query: 66  QILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
            +L    +         LYVTVEPCVMC+ ALRQ+ I  V YGC N+RFGG GSV  ++ 
Sbjct: 71  HLL---PFHPAPLSTITLYVTVEPCVMCASALRQVGIGRVVYGCGNDRFGGCGSVIPVNN 127

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
            P+L  HPAY   GG+Y                   P PK+K  RVLKT+I P
Sbjct: 128 SPRLDSHPAYVAVGGFY------------------PPKPKKKATRVLKTDIPP 162



>gi|149744219|ref|XP_001497309.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Equus
           caballus]
          Length = 186

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           H Y +   ++A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L+
Sbjct: 18  HLYSQSTSHYAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALA 77

Query: 70  ----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                G   +EVF+R +LYVTVEPCVMC+ ALR ++I  V YGC NERFGG GSV +I  
Sbjct: 78  WCRGRGRCPAEVFERAVLYVTVEPCVMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIAS 137

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                    + C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 138 ADLPNTGRPFQCVPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 186



>gi|410079749|ref|XP_003957455.1| hypothetical protein KAFR_0E01660 [Kazachstania africana CBS 2517]
 gi|372464041|emb|CCF58320.1| hypothetical protein KAFR_0E01660 [Kazachstania africana CBS 2517]
          Length = 257

 Score =  157 bits (397), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 114/180 (63%), Gaps = 12/180 (6%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEAID 65
           +H  +MR A+  A+ A D+ E PV C+FV    +KI+  G N TN + +G  HAEF  ID
Sbjct: 8   VHFSHMRTAIKLAKYALDHGETPVACIFVHSPTNKIVAYGLNDTNNSLSGIAHAEFIGID 67

Query: 66  QILS--SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
           QI +    +   +VF+  +LYVTVEPC+MC+ AL+QL I+ V +GC NERFGG G++  I
Sbjct: 68  QIKAKFGVDRLLDVFKDLVLYVTVEPCIMCASALKQLGIQKVIFGCGNERFGGNGTILSI 127

Query: 124 HQD-----PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           ++D     P   ++ ++P   G +R E++MLLR FYV+EN+ AP P+ K  R L TE  P
Sbjct: 128 NKDDSTRSPSGLVYESFP---GIFRKEAVMLLRYFYVKENDHAPTPRNKSDRNLDTETFP 184



>gi|26388773|dbj|BAB32363.2| unnamed protein product [Mus musculus]
          Length = 191

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (61%), Gaps = 4/168 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           K+M EA   A EA +N E+PVGCL V +++++G G N  N+T N TRHAE  AIDQ+L  
Sbjct: 24  KWMEEATRMANEALENIEVPVGCLMVYNNEVVGKGTNEVNQTKNATRHAEMVAIDQVLDW 83

Query: 71  ----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
               G+  S VF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I   
Sbjct: 84  CHQHGQSPSTVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASA 143

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
                   + C  GY  +E++ LL+ FY +EN  AP  K + K   K+
Sbjct: 144 DLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS 191



>gi|502076861|ref|XP_004485480.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1
           [Cicer arietinum]
 gi|502076865|ref|XP_004485481.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X2
           [Cicer arietinum]
 gi|502076868|ref|XP_004485482.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X3
           [Cicer arietinum]
          Length = 312

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 99/159 (62%), Gaps = 7/159 (4%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 128 FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 187

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
             +G   +EV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FGG GS+  +H
Sbjct: 188 QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGIKDVFYGCSNDKFGGCGSILSLH 247

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPV 163
                +L+  + C GG    E+I+LLR FY + N    V
Sbjct: 248 LKDTASLNKGFKCAGGIMATEAILLLRTFYDQGNPNGKV 286



>gi|190689519|gb|ACE86534.1| adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
           protein [synthetic construct]
 gi|190690877|gb|ACE87213.1| adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
           protein [synthetic construct]
          Length = 160

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 103/159 (64%), Gaps = 4/159 (2%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS----SGEYTS 75
           A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ+L     SG+  S
Sbjct: 2   AKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPS 61

Query: 76  EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAY 135
           EVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I           +
Sbjct: 62  EVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPF 121

Query: 136 PCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
            C  GY  +E++ +L+ FY +EN  AP  K + K   K+
Sbjct: 122 QCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS 160



>gi|50305461|ref|XP_452690.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641823|emb|CAH01541.1| KLLA0C10989p [Kluyveromyces lactis]
          Length = 238

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 102/169 (60%), Gaps = 2/169 (1%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           +MR A+  A+ A D++E PV C+FV    +K+I  G N TNE+ +G  HAEF  I QI  
Sbjct: 7   HMRTAITLAKYALDHEETPVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQIQE 66

Query: 70  SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQL 129
                 ++    +LYVTVEPC+MC+ AL+QL IK V +GC NERFGG GS+  IH D   
Sbjct: 67  KYGTDPKILSEVVLYVTVEPCIMCASALKQLGIKKVVFGCGNERFGGNGSILCIHNDTST 126

Query: 130 TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
                Y    G  R E+IMLLR FYVREN++AP P+ K  R L  E  P
Sbjct: 127 NKSNKYVSIPGVLRREAIMLLRYFYVRENDRAPKPRTKKDRKLDKETFP 175



>gi|482573905|gb|EOA38092.1| hypothetical protein CARUB_v10009558mg [Capsella rubella]
          Length = 356

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 109/181 (60%), Gaps = 18/181 (9%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           YM  AL+ A+ A +  E+PVGC+ + D K+I SGRNRTNET N TRHAE EAIDQ++   
Sbjct: 179 YMGFALDQARLALEALEVPVGCVILEDGKVIASGRNRTNETRNATRHAEMEAIDQLVGQW 238

Query: 70  -----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
                S    +E F +CILYVT EPC+MC+ AL    IK VYYGCAN++FGG GS+  +H
Sbjct: 239 QKNGLSPSQVAEKFSKCILYVTCEPCIMCASALSFFGIKEVYYGCANDKFGGCGSILSLH 298

Query: 125 ---QDPQLTLHPA-----YPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
                P  T   A     Y C GG   +E++ L + FY + N  AP P   H+ V++ E 
Sbjct: 299 VGSPQPSDTREEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNAPKP---HRPVIQRER 355

Query: 177 T 177
           T
Sbjct: 356 T 356



>gi|308803957|ref|XP_003079291.1| Cytosine deaminase FCY1 and related enzymes (ISS) [Ostreococcus
           tauri]
 gi|116057746|emb|CAL53949.1| Cytosine deaminase FCY1 and related enzymes (ISS) [Ostreococcus
           tauri]
          Length = 205

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/164 (47%), Positives = 101/164 (61%), Gaps = 8/164 (4%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS- 70
           +MREAL  A+ A D  E+P GC  V D +I+  GRN TN T NGTRHAEFEA+D +L + 
Sbjct: 30  HMREALREARRALDAWEVPCGCALVRDGEIVARGRNATNRTRNGTRHAEFEAVDALLRAH 89

Query: 71  -GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ---- 125
            G+  +  F+   LYVT EPCVMC+ A+  L ++ V YGCAN++FGG G+V D+H     
Sbjct: 90  DGDVDACGFEEMTLYVTCEPCVMCAGAMSALGVRRVVYGCANDKFGGNGTVLDVHDSGCG 149

Query: 126 --DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
             D   T    Y   GG +  E+I L + FYVR N KAP P R+
Sbjct: 150 RCDGVGTKGATYESVGGLFETEAIRLFQDFYVRGNPKAPKPHRE 193



>gi|502107327|ref|XP_004493229.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1
           [Cicer arietinum]
 gi|502107330|ref|XP_004493230.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X2
           [Cicer arietinum]
 gi|502107333|ref|XP_004493231.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X3
           [Cicer arietinum]
          Length = 193

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 99/159 (62%), Gaps = 7/159 (4%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 9   FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 68

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
             +G   +EV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FGG GS+  +H
Sbjct: 69  QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGIKDVFYGCSNDKFGGCGSILSLH 128

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPV 163
                +L+  + C GG    E+I+LLR FY + N    V
Sbjct: 129 LKDTASLNKGFKCAGGIMATEAIILLRTFYDQGNPNGKV 167



>gi|115452727|ref|NP_001049964.1| Os03g0321900 [Oryza sativa Japonica Group]
 gi|108707878|gb|ABF95673.1| Cytidine and deoxycytidylate deaminase zinc-binding region family
           protein, expressed [Oryza sativa Japonica Group]
 gi|113548435|dbj|BAF11878.1| Os03g0321900 [Oryza sativa Japonica Group]
 gi|218192723|gb|EEC75150.1| hypothetical protein OsI_11352 [Oryza sativa Indica Group]
          Length = 183

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 101/176 (57%), Gaps = 14/176 (7%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           M     ++M  AL  A+ A DN E+PVGC+ V D K+I SG N+TN T N TRHAE EAI
Sbjct: 1   MAAAAAEFMELALEQAKFALDNLEVPVGCVIVEDGKVISSGSNKTNATRNATRHAEMEAI 60

Query: 65  DQILSSGE-------YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
           D +L   +         +E F RC LYVT EPC+MC+ AL  L I+ VY+GCAN++FGG 
Sbjct: 61  DILLREWQGMGLDQPQVAEKFARCDLYVTCEPCIMCAMALSILGIREVYFGCANDKFGGC 120

Query: 118 GSVFDIHQDPQLTLH-------PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           GS+  +HQ     L          Y C GG   +E++ L R FY + N  AP P R
Sbjct: 121 GSIMSLHQSSSAELSGEEIPGPKGYKCTGGIMAEEAVALFRNFYEQGNPNAPKPHR 176



>gi|348518351|ref|XP_003446695.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Oreochromis
           niloticus]
          Length = 186

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 101/164 (61%), Gaps = 4/164 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            ++M  A + A+EA +N E+PVGCL V  DK++G GRN  NET N TRHAE  A+DQ+L 
Sbjct: 23  ERWMARAFDMAKEALENGEVPVGCLMVYKDKVVGKGRNEVNETKNATRHAEMVALDQVLD 82

Query: 70  SGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               +S     V +R  LYVTVEPC+MC+ ALR L I  V YGC NERFGG GSV D+  
Sbjct: 83  WCWRSSLDVKSVCERIALYVTVEPCIMCAAALRLLNIPVVVYGCRNERFGGCGSVLDVSS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
                    + C  G+  +E+I +L+ FY +EN  AP PK + +
Sbjct: 143 ADLPHTGTQFKCISGHRAEEAIDMLKTFYKQENPNAPKPKTRKE 186



>gi|281202068|gb|EFA76273.1| adenosine deaminase [Polysphondylium pallidum PN500]
          Length = 213

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 106/167 (63%), Gaps = 5/167 (2%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+M+ ALN A++A D  E+PVGC+ V +D +I +G N+TN   N TRHAE EA+D I 
Sbjct: 28  HSKFMKLALNEAKKALDEGEVPVGCVIVHNDIVIAAGSNKTNIKKNATRHAEIEALDSIY 87

Query: 69  SSGEYT----SEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
            S   +     ++   C LYVTVEPC+MC+  L+  +I  VY+GC N++FGG GS+  +H
Sbjct: 88  LSENASKFGGDKLLSDCKLYVTVEPCIMCAAVLQLAKINIVYFGCYNDKFGGNGSILPVH 147

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRV 171
                     Y C  G  +D++I LL+KFY +EN+KAPVP  K KR+
Sbjct: 148 SIDCFERGHPYNCVSGVMKDQAIHLLQKFYFQENKKAPVP-NKRKRI 193



>gi|297847068|ref|XP_002891415.1| EMB2191 [Arabidopsis lyrata subsp. lyrata]
 gi|297337257|gb|EFH67674.1| EMB2191 [Arabidopsis lyrata subsp. lyrata]
          Length = 192

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 108/183 (59%), Gaps = 18/183 (9%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           H YM  AL+ A+ A +  E+PVGC+ + D K+I SGRNRTNET N TRHAE EAIDQ++ 
Sbjct: 13  HNYMGFALHQAKLALEALEVPVGCVLLEDGKVIASGRNRTNETRNATRHAEMEAIDQLVG 72

Query: 70  -------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
                  S    +E F +CILYVT EPC+MC+ AL  L IK VYYGC N++FGG GS+  
Sbjct: 73  QWQEDGLSPSQVAEKFSKCILYVTCEPCIMCASALSFLGIKEVYYGCPNDKFGGCGSILS 132

Query: 123 IHQDPQLTLH--------PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           +H     +            Y C GG   +E++ L + FY + N  AP P   H+ V++ 
Sbjct: 133 LHLGSSQSSDIIEESQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNAPKP---HRPVVQR 189

Query: 175 EIT 177
           E T
Sbjct: 190 ERT 192



>gi|47207020|emb|CAF91477.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 161

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 4/159 (2%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS--- 69
           M EA + A++A  N E+PVGCL V +++++G GRN  NET N TRHAE  A+D++L+   
Sbjct: 1   MDEAFDMAKDALQNGEVPVGCLMVYNNEVVGRGRNEVNETKNATRHAEMVALDELLNWCH 60

Query: 70  -SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
            S    S+V ++ +LYVTVEPCVMC+ ALR L I  V YGC NERFGG GSV D+     
Sbjct: 61  HSNLDVSKVSRKTVLYVTVEPCVMCAAALRLLNIALVVYGCRNERFGGCGSVLDVSGADL 120

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
                 + C  G+  DE++ +L+ FY +EN  AP PK +
Sbjct: 121 AQTGSTFKCVSGHRADEAVEMLKTFYKQENPNAPKPKMR 159



>gi|50742655|ref|XP_419709.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Gallus gallus]
          Length = 172

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 97/162 (59%), Gaps = 4/162 (2%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M  A + AQEA +  E+PVGCL V D   IG GRN  NET N TRHAE  AIDQ+L   
Sbjct: 7   WMERAFSMAQEALEAGEVPVGCLLVYDGAAIGKGRNEVNETKNATRHAEMVAIDQVLEWC 66

Query: 72  EYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
           +       EVF   +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV  I  D 
Sbjct: 67  QQHKKDHEEVFSHSVLYVTVEPCIMCAAALRLMKIPRVVYGCRNERFGGCGSVLSISSDD 126

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
            +     + C  GY   +++ +L+ FY +EN  AP  K + K
Sbjct: 127 IVDTGEPFECIAGYRAKDAVEMLKAFYRQENPNAPKSKVRKK 168



>gi|513031308|gb|AGO11332.1| AaceriACR075Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 245

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 103/171 (60%), Gaps = 3/171 (1%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           ++MR A+  A+ A D+ E PV C+FV    D+II  G N TN +  G  HAEF AI Q+ 
Sbjct: 6   QHMRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQ 65

Query: 69  SS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
              GE    +F+   +YVTVEPCVMC+ AL+QL I  V +GC NERFGG GS+  +H+D 
Sbjct: 66  ELFGEQDPAIFKEVTVYVTVEPCVMCASALKQLGIGRVIFGCGNERFGGNGSILAVHRDK 125

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
                  +    G  R E+IMLLR FYVRENEKAP P+ K  R L  E  P
Sbjct: 126 STAPQHQHLAIPGVLRREAIMLLRYFYVRENEKAPKPRAKAARKLDRETFP 176



>gi|299115717|emb|CBN74282.1| tRNA specific adenosine deaminase [Ectocarpus siliculosus]
          Length = 186

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 103/169 (60%), Gaps = 3/169 (1%)

Query: 1   GNSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRH 58
           G +S +  +  YMR AL  A+ A    E+PVGC+ V     +II  G N T+E FN TRH
Sbjct: 6   GVASSDEQNAVYMRLALKEAEMALSKGEVPVGCVVVHKPTARIISCGHNETSEAFNATRH 65

Query: 59  AEFEAIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           AE  AID IL +    S + + C L+VT EPC+MC+ ALR ++IK V +GC+N+RFGG G
Sbjct: 66  AELVAIDGILRAQTDLS-LLRECDLFVTCEPCIMCAAALRDVKIKTVVFGCSNDRFGGCG 124

Query: 119 SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
           SV  +H          YPC  G   DE+I L ++FY R+N KAP PKR+
Sbjct: 125 SVLSVHDGSLPISGHTYPCHSGLLADEAIALFKQFYSRQNVKAPEPKRR 173



>gi|367014685|ref|XP_003681842.1| hypothetical protein TDEL_0E03880 [Torulaspora delbrueckii]
 gi|359749503|emb|CCE92631.1| hypothetical protein TDEL_0E03880 [Torulaspora delbrueckii]
          Length = 240

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 109/181 (60%), Gaps = 9/181 (4%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDK--IIGSGRNRTNETFNGTRHAEFE 62
           M  +H  +MR+A+  A+ A D+ E PV CL V D K  ++  G N TN + NGT HAEF+
Sbjct: 1   MLAVHLDHMRKAVRLARYALDHNETPVACLLV-DAKGHVVSWGINDTNRSLNGTAHAEFQ 59

Query: 63  AIDQILSSG-----EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
           AID++  S      E    V   C LYVTVEPCVMC+ ALRQL +  V +GC NERFGG 
Sbjct: 60  AIDRLRDSNGVVDDEDLRHVISTCTLYVTVEPCVMCASALRQLGLPRVVFGCTNERFGGN 119

Query: 118 GSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
           G+V  I Q  Q T  P Y    G  R E+++LLR FYVR NE++P P+ K +R L  E  
Sbjct: 120 GTVLAI-QKGQSTPGPEYHVVPGILRREAVLLLRYFYVRSNERSPKPRNKTERQLDLESF 178

Query: 178 P 178
           P
Sbjct: 179 P 179



>gi|169642534|gb|AAI60619.1| Adat2 protein [Danio rerio]
          Length = 238

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A + A EA++N E+PVGCL V +++IIG GRN  NET N TRHAE  A+DQ+L 
Sbjct: 22  QTWMAKAFDMAVEAFENGEVPVGCLMVYNNEIIGKGRNEVNETKNATRHAEMVALDQVLD 81

Query: 70  SGEY----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                     EV ++ +LYVTVEPC+MC+ ALR LRI  V YGC NERFGG GSV D+  
Sbjct: 82  WCRLREKDCKEVCEQTVLYVTVEPCIMCAAALRLLRIPFVVYGCKNERFGGCGSVLDVSS 141

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
           D       ++ C  GY  +E++ +L+ FY +EN          KR
Sbjct: 142 DHLPHTGTSFKCIAGYRAEEAVEMLKTFYKQENPNGQCQTGGRKR 186



>gi|502076873|ref|XP_004485483.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X4
           [Cicer arietinum]
          Length = 310

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 102/175 (58%), Gaps = 20/175 (11%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 128 FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 187

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLR-------------IKHVYYGCAN 111
             +G   +EV   F  C LYVT EPC+MC+ AL  L              IK V+YGC+N
Sbjct: 188 QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGLLHQIINCSIYSCIKDVFYGCSN 247

Query: 112 ERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           ++FGG GS+  +H     +L+  + C GG    E+I+LLR FY + N  AP P R
Sbjct: 248 DKFGGCGSILSLHLKDTASLNKGFKCAGGIMATEAILLLRTFYDQGNPNAPKPHR 302



>gi|410916027|ref|XP_003971488.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Takifugu
           rubripes]
          Length = 180

 Score =  154 bits (389), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (61%), Gaps = 5/171 (2%)

Query: 1   GNSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAE 60
           G++++E I   +M +A + A++A  N E+PVGCL V + +++G GRN  NET N TRHAE
Sbjct: 9   GDTAVEDIE-TWMDKAFDMAKDALQNGEVPVGCLMVYNSEVVGKGRNEVNETKNATRHAE 67

Query: 61  FEAIDQIL----SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
             A+D++L    SS    S V +  +LYVTVEPCVMC+ ALR L I  V YGC NERFGG
Sbjct: 68  MVALDELLNWCHSSNLDVSRVSRNTVLYVTVEPCVMCAAALRLLNIPTVVYGCRNERFGG 127

Query: 117 TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
            GS+ D+           + C  G+   E++ +L+ FY +EN  AP PK +
Sbjct: 128 CGSILDVSSADLPQTGNTFKCVSGHRAGEAVEMLKTFYKQENPNAPKPKTR 178



>gi|334324233|ref|XP_001380965.2| PREDICTED: tRNA-specific adenosine deaminase 2-like [Monodelphis
           domestica]
          Length = 247

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 102/163 (62%), Gaps = 4/163 (2%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           K   + L  A+EA +N E+PVGCL V ++K++  GRN  N+T N TRHAE  AIDQ+L  
Sbjct: 80  KSHSQLLTKAKEALENGEVPVGCLMVYNNKVLAKGRNEVNQTKNATRHAEMVAIDQVLEW 139

Query: 71  ----GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
               G+  +EVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV DI   
Sbjct: 140 CHRYGKSPTEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLDIASA 199

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
                   + C  GY  +E++ +L+ FY +EN  AP  K + K
Sbjct: 200 DLPNTGTPFQCIPGYQAEEAVEMLKTFYKQENPNAPKSKVRKK 242



>gi|365984601|ref|XP_003669133.1| hypothetical protein NDAI_0C02300 [Naumovozyma dairenensis CBS 421]
 gi|343767901|emb|CCD23890.1| hypothetical protein NDAI_0C02300 [Naumovozyma dairenensis CBS 421]
          Length = 287

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 112/186 (60%), Gaps = 12/186 (6%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFE 62
           M  +H++ M+ A+  A+ A D+ E PV C+F+ +  + +I  G N TN +  G  HAEF 
Sbjct: 28  MGYLHYERMKLAIKLARYALDHNETPVACIFIHEPTNSVIAYGLNATNHSLTGVAHAEFM 87

Query: 63  AIDQI--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
            I+QI  L    +  + F+  +LYVTVEPC+MC+ AL+QL IK V +GCANERFGG G+V
Sbjct: 88  GIEQIKNLVGPHHLMDFFKDVVLYVTVEPCIMCASALKQLNIKKVVFGCANERFGGNGTV 147

Query: 121 FDIHQDPQLTLHPAYP-CEGGYY-------RDESIMLLRKFYVRENEKAPVPKRKHKRVL 172
             I++D  L   P+ P  E   Y       R E+IMLLR FYVREN+ A  P+ K +R L
Sbjct: 148 LHINKDKALLNAPSLPKAESASYEAIPGILRKEAIMLLRYFYVRENKSAVTPRNKAERNL 207

Query: 173 KTEITP 178
             E  P
Sbjct: 208 DKETFP 213



>gi|326915810|ref|XP_003204205.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Meleagris
           gallopavo]
          Length = 165

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 96/161 (59%), Gaps = 4/161 (2%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGE 72
           M   L  AQEA +  E+PVGCL V D + IG GRN  NET N TRHAE  AIDQ+L   +
Sbjct: 1   MHTKLAEAQEALEAGEVPVGCLLVYDGEAIGKGRNEVNETKNATRHAEMVAIDQVLEWCQ 60

Query: 73  ----YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  EVF   +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV  I  D  
Sbjct: 61  QHKKAHEEVFSHSVLYVTVEPCIMCAAALRLMKIPRVVYGCRNERFGGCGSVLSISSDDI 120

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
                 + C GGY   +++ +L+ FY +EN  AP  K + K
Sbjct: 121 ADTGEPFECIGGYRAKDAVEMLKAFYRQENPNAPKSKVRKK 161



>gi|384491053|gb|EIE82249.1| hypothetical protein RO3G_06954 [Rhizopus delemar RA 99-880]
          Length = 121

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 3/116 (2%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDK-IIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           +M+ A+  AQEAYDN E+PVGC+FVLD+K I+  GRNR NET N TRHAE EAID IL+ 
Sbjct: 8   FMKAAIEVAQEAYDNLEVPVGCVFVLDNKTILAKGRNRPNETCNATRHAEMEAIDTILN- 66

Query: 71  GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
            E+++  F    LYVTVEPC+MC+ ALRQ+ I+HVY+GC N++FGG GSVF+IH +
Sbjct: 67  -EHSTTSFSNVDLYVTVEPCIMCASALRQIGIRHVYFGCGNDKFGGNGSVFNIHSE 121



>gi|502107336|ref|XP_004493232.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X4
           [Cicer arietinum]
          Length = 191

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 102/175 (58%), Gaps = 20/175 (11%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL--- 68
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 9   FMELAIQQAKLALDALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLEQW 68

Query: 69  -SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQLR-------------IKHVYYGCAN 111
             +G   +EV   F  C LYVT EPC+MC+ AL  L              IK V+YGC+N
Sbjct: 69  QKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALATLGMLHQIFSCSMYSCIKDVFYGCSN 128

Query: 112 ERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           ++FGG GS+  +H     +L+  + C GG    E+I+LLR FY + N  AP P R
Sbjct: 129 DKFGGCGSILSLHLKDTASLNKGFKCAGGIMATEAIILLRTFYDQGNPNAPKPHR 183



>gi|281351029|gb|EFB26613.1| hypothetical protein PANDA_000408 [Ailuropoda melanoleuca]
          Length = 158

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS----SGEYTS 75
           A+EA +N E+PVGCL V +++++G GRN  N+T N TRHAE  AIDQ L     SG+  S
Sbjct: 1   AKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQALDWCHRSGKSPS 60

Query: 76  EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAY 135
           EVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I           +
Sbjct: 61  EVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPF 120

Query: 136 PCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
            C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 121 KCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQK 158



>gi|45185761|ref|NP_983477.1| ACR075Cp [Ashbya gossypii ATCC 10895]
 gi|44981516|gb|AAS51301.1| ACR075Cp [Ashbya gossypii ATCC 10895]
          Length = 245

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 107/175 (61%), Gaps = 11/175 (6%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           ++MR A+  A+ A D+ E PV C+FV    D+II  G N TN +  G  HAEF AI Q+ 
Sbjct: 6   QHMRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQ 65

Query: 69  SS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD- 126
              GE  + +F+   +YVTVEPCVMC+ AL+QL I  V +GC NERFGG GS+  + +D 
Sbjct: 66  ELFGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFGCGNERFGGNGSILAVQRDT 125

Query: 127 ---PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
              PQ   H A P   G  R E+IMLLR FYVRENE+AP P+ K  R L  E  P
Sbjct: 126 STAPQ-NRHLAIP---GVLRREAIMLLRYFYVRENERAPKPRAKAARKLDRETFP 176



>gi|374106684|gb|AEY95593.1| FACR075Cp [Ashbya gossypii FDAG1]
          Length = 245

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 107/175 (61%), Gaps = 11/175 (6%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           ++MR A+  A+ A D+ E PV C+FV    D+II  G N TN +  G  HAEF AI Q+ 
Sbjct: 6   QHMRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQ 65

Query: 69  SS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD- 126
              GE  + +F+   +YVTVEPCVMC+ AL+QL I  V +GC NERFGG GS+  + +D 
Sbjct: 66  ELFGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFGCGNERFGGNGSILAVQRDT 125

Query: 127 ---PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
              PQ   H A P   G  R E+IMLLR FYVRENE+AP P+ K  R L  E  P
Sbjct: 126 STAPQ-NRHLAIP---GVLRREAIMLLRYFYVRENERAPKPRAKAARKLDRETFP 176



>gi|260943466|ref|XP_002616031.1| hypothetical protein CLUG_03273 [Clavispora lusitaniae ATCC 42720]
 gi|238849680|gb|EEQ39144.1| hypothetical protein CLUG_03273 [Clavispora lusitaniae ATCC 42720]
          Length = 296

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 110/181 (60%), Gaps = 15/181 (8%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEAI 64
           T H +YM  A   A  A+ N E PV C+FV +    I+  G N TN + NGTRHAEF AI
Sbjct: 4   TRHFQYMAVATFVAYRAFANGETPVACVFVHEPSQTILAFGCNDTNRSLNGTRHAEFMAI 63

Query: 65  DQIL-------SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
           D+IL       SS E  +  F + +LYVTVEPCVMC+ ALR + IK VY+G AN+RFGG 
Sbjct: 64  DKILQENHLLNSSPEKVAAFFSQVVLYVTVEPCVMCASALRHVGIKKVYFGAANDRFGGN 123

Query: 118 GSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEIT 177
           G+V  + ++       +Y   GG  R E++ LLR FYV+ENE APVPK K  R ++ +  
Sbjct: 124 GTVIKVQEN------DSYLSFGGIMRVEAVHLLRNFYVQENETAPVPKLKKNRDIEGKPF 177

Query: 178 P 178
           P
Sbjct: 178 P 178



>gi|357508883|ref|XP_003624730.1| tRNA-specific adenosine deaminase [Medicago truncatula]
 gi|355499745|gb|AES80948.1| tRNA-specific adenosine deaminase [Medicago truncatula]
          Length = 191

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 107/184 (58%), Gaps = 22/184 (11%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           +S ET  H +M  A+  A+ A    E+PVGC+ V D K+I SGRNRT ET N TRHAE E
Sbjct: 2   TSQET--HIFMELAIQQAKLAMGALEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEME 59

Query: 63  AIDQIL----SSGEYTSEV---FQRCILYVTVEPCVMCSYALRQL-------------RI 102
           AID +L     +G   +EV   F  C LYVT EPC+MC+ AL  L              I
Sbjct: 60  AIDVLLEQWQKNGLSMTEVAKKFSNCSLYVTCEPCIMCASALSNLGMLIQIFSCSIYISI 119

Query: 103 KHVYYGCANERFGGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAP 162
           K V+YGC+N++FGG GS+  +H    ++ +  + C GG   +E+++LLR FY + N  AP
Sbjct: 120 KEVFYGCSNDKFGGCGSILSLHLSDAVSPNKGFKCAGGIMAEEAVLLLRTFYEQGNPNAP 179

Query: 163 VPKR 166
            P R
Sbjct: 180 KPHR 183



>gi|356564819|ref|XP_003550645.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Glycine max]
          Length = 182

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 105/181 (58%), Gaps = 15/181 (8%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           SS ET+   +M  A+  A+ A D  E+PVGC+ V DDK+I SGRNRT +T N TRHAE E
Sbjct: 2   SSPETL--TFMELAIQQAKLALDVLEVPVGCVIVEDDKVIASGRNRTTQTRNATRHAEME 59

Query: 63  AIDQILSS----GEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           A+D +L      G   SEV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FG
Sbjct: 60  AVDVLLGQWQKHGLSMSEVAEKFSNCSLYVTCEPCIMCASALSILGIKEVFYGCSNDKFG 119

Query: 116 GTGSVFDIHQDPQLTLH------PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           G GS+  +H      L+        + C G     E+++L R FY + N  AP P R   
Sbjct: 120 GCGSILSLHLSNTTPLNNEVSPGKCFKCTGCIMASEAVLLFRTFYEQGNPNAPKPHRPLA 179

Query: 170 R 170
           R
Sbjct: 180 R 180



>gi|131888897|ref|NP_001076566.1| tRNA-specific adenosine deaminase 2 [Danio rerio]
 gi|190337669|gb|AAI63783.1| Adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
           [Danio rerio]
 gi|190340014|gb|AAI63804.1| Adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
           [Danio rerio]
          Length = 206

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 4/153 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
             +M +A + A EA +N E+PVGCL V +++IIG GRN  NET N TRHAE  A+DQ+L 
Sbjct: 22  QTWMAKAFDMAVEALENGEVPVGCLMVYNNEIIGKGRNEVNETKNATRHAEMVALDQVLD 81

Query: 70  SGEY----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
                     EV ++ +LYVTVEPC+MC+ ALR LRI  V YGC NERFGG GSV D+  
Sbjct: 82  WCRLREKDCKEVCEQTVLYVTVEPCIMCAAALRLLRIPFVVYGCKNERFGGCGSVLDVSS 141

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVREN 158
           D       ++ C  GY  +E++ +L+ FY +EN
Sbjct: 142 DHLPHTGTSFKCIAGYRAEEAVEMLKTFYKQEN 174



>gi|499035654|ref|XP_004568497.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1
           [Maylandia zebra]
          Length = 186

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 101/164 (61%), Gaps = 4/164 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            ++M  A + A+EA +N E+PVGCL V  D+++G GRN  NET N TRHAE  A+DQ+L 
Sbjct: 23  ERWMARAFDMAKEALENGEVPVGCLMVYKDEVVGKGRNEVNETKNATRHAEMVALDQVLD 82

Query: 70  SGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
               +S     V +R  LYVTVEPC+MC+ ALR L I  + YGC NERFGG GSV D+  
Sbjct: 83  WCWQSSLDVKSVCERITLYVTVEPCIMCAAALRLLNIPVIVYGCRNERFGGCGSVLDVSS 142

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
                    + C  G+  +E++ +L+ FY ++N  AP PK + +
Sbjct: 143 ADLPHTGTQFKCISGHRAEEAVDMLKTFYKQQNPNAPKPKTRKE 186



>gi|323304324|gb|EGA58097.1| Tad2p [Saccharomyces cerevisiae FostersB]
          Length = 242

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HIKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|6322425|ref|NP_012499.1| Tad2p [Saccharomyces cerevisiae S288c]
 gi|1352970|sp|P47058.1|TAD2_YEAST RecName: Full=tRNA-specific adenosine deaminase subunit TAD2;
           AltName: Full=tRNA-specific adenosine-34 deaminase
           subunit TAD2
 gi|1008159|emb|CAA89326.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|6434057|emb|CAB60629.1| tRNA-specific adenosine-34 deaminase subunit Tad2p/ADAT2
           [Saccharomyces cerevisiae]
 gi|51013795|gb|AAT93191.1| YJL035C [Saccharomyces cerevisiae]
 gi|151945050|gb|EDN63301.1| tRNA-specific adenosine deaminase subunit [Saccharomyces cerevisiae
           YJM789]
 gi|285812866|tpg|DAA08764.1| TPA: Tad2p [Saccharomyces cerevisiae S288c]
          Length = 250

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HIKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|190409464|gb|EDV12729.1| tRNA-specific adenosine deaminase 2 [Saccharomyces cerevisiae
           RM11-1a]
          Length = 250

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HVKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|349579163|dbj|GAA24326.1| K7_Tad2p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 250

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HIKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|207343953|gb|EDZ71253.1| YJL035Cp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 250

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HVKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|356549373|ref|XP_003543068.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Glycine max]
          Length = 182

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 104/181 (57%), Gaps = 15/181 (8%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           +S ET+   +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE E
Sbjct: 2   TSSETL--AFMELAIQQAKLALDVLEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEME 59

Query: 63  AIDQILSS----GEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           AID +L      G   SEV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FG
Sbjct: 60  AIDVLLGQWQKHGLSMSEVAEKFSNCSLYVTCEPCIMCASALSILGIKEVFYGCSNDKFG 119

Query: 116 GTGSVFDIHQDPQLTLHPAYP------CEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           G GS+  +H      L+   P      C G     E+++L R FY + N  AP P R   
Sbjct: 120 GCGSILSLHLSNTAPLNNEVPSGKCFKCTGRIMASEAVLLFRTFYEQGNPNAPKPHRPLA 179

Query: 170 R 170
           R
Sbjct: 180 R 180



>gi|255718193|ref|XP_002555377.1| KLTH0G07832p [Lachancea thermotolerans]
 gi|238936761|emb|CAR24940.1| KLTH0G07832p [Lachancea thermotolerans CBS 6340]
          Length = 250

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 106/178 (59%), Gaps = 4/178 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEF 61
           S+++  H +MR A   A+ A D+ E PV C+FV    D+++  G N TN +  G  HAEF
Sbjct: 2   SLDSYVH-FMRMATKLARYALDHGETPVACIFVHTPADQVVAYGMNDTNRSLTGIAHAEF 60

Query: 62  EAIDQILSS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
             I+QI S  G   + +F+   LYVTVEPC+MC+ AL+QL I+ V +GC NERFGG GS+
Sbjct: 61  MGIEQIQSKFGAQDTSIFKDITLYVTVEPCIMCASALKQLGIQKVVFGCGNERFGGNGSI 120

Query: 121 FDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
             I +D        +    G  R E+IMLLR FYVRENE++P PK K  R L     P
Sbjct: 121 LSIQKDSCTAPQNKHISVPGILRKEAIMLLRYFYVRENERSPKPKAKANRKLDVSTFP 178



>gi|357119921|ref|XP_003561681.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Brachypodium
           distachyon]
          Length = 223

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 15/170 (8%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M+ AL+ A+ A +N E+PVGC+ V + K+I SG NRTN T N TRHAE EAID +L   
Sbjct: 47  FMKLALDQAKFALNNLEVPVGCVIVENGKVISSGSNRTNATRNATRHAEMEAIDDLLREW 106

Query: 72  EY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +        T+E F  C LYVT EPC+MC+ AL  L I+ VY+GCAN++FGG GSV  +H
Sbjct: 107 QSMGLDQTQTAEKFAGCDLYVTCEPCIMCASALSILGIREVYFGCANDKFGGCGSVMSLH 166

Query: 125 QDPQLTL-----HP---AYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           ++  L       +P    + C GG   +E++ L R FY + N  AP P R
Sbjct: 167 ENSSLDDLSGGHNPRLRGFKCTGGIMAEEAVALFRNFYEQGNPNAPKPHR 216



>gi|327261885|ref|XP_003215757.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Anolis
           carolinensis]
          Length = 160

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 74/158 (46%), Positives = 98/158 (62%), Gaps = 4/158 (2%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS----SGEYTS 75
           A+EA +N E+PVGCL V ++++IG G+N  NET N TRHAE  AIDQ +       +   
Sbjct: 3   AKEALENGEVPVGCLMVYNNEVIGKGKNEVNETKNATRHAEMVAIDQAIDWCHKQKKRME 62

Query: 76  EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAY 135
           EVF   +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV +I  D        +
Sbjct: 63  EVFLHTVLYVTVEPCIMCAAALRMMKIPLVVYGCQNERFGGCGSVLNISSDTLTDTGEPF 122

Query: 136 PCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
            C  GY  +E++ +L+ FY +EN  AP  K + K   K
Sbjct: 123 QCIAGYRSEEAVEMLKIFYRQENPNAPKSKVRKKECSK 160



>gi|395535088|ref|XP_003769564.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Sarcophilus
           harrisii]
          Length = 161

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 4/154 (2%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS----GEYTS 75
           A+EA +N E+PVGCL V +++++  GRN  N+T N TRHAE  AIDQ+L      G+  +
Sbjct: 3   AKEALENGEVPVGCLMVYNNEVLAKGRNEVNQTKNATRHAEMVAIDQVLEWCHHYGKSPT 62

Query: 76  EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTLHPAY 135
           EVF+  +LYVTVEPC+MC+ ALR ++I  V YGC NERFGG GSV DI           +
Sbjct: 63  EVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLDIASADLPNTGMPF 122

Query: 136 PCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
            C  GY  +E++ +L+ FY +EN  AP  K + K
Sbjct: 123 KCIPGYQAEEAVEMLKTFYKQENPNAPKSKVRKK 156



>gi|488520342|ref|XP_004452104.1| PREDICTED: tRNA-specific adenosine deaminase 2 [Dasypus
           novemcinctus]
          Length = 199

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 99/167 (59%), Gaps = 4/167 (2%)

Query: 14  REALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS---- 69
           R     A+EA +N E+PVGCL V +++++G GRN  NET N TRHAE  AIDQ L     
Sbjct: 29  RPGGTPAKEALENSEVPVGCLLVYNNEVVGKGRNEVNETKNATRHAEMVAIDQALEWCRR 88

Query: 70  SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQL 129
            G   +EVF   +LYVTVEPC+MC+ ALR + +  V YGC NERFGG GSV DI      
Sbjct: 89  GGRSPAEVFAHTVLYVTVEPCIMCAAALRLMLVPLVVYGCQNERFGGCGSVLDIASADLP 148

Query: 130 TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEI 176
                + C  GY  +E++ +L+ FY +EN  AP  K + K     E+
Sbjct: 149 NTGRPFQCIPGYRAEEAVEMLKAFYKQENPNAPKSKVRRKDCQSREL 195



>gi|66806365|ref|XP_636905.1| adenosine deaminase, tRNA-specific [Dictyostelium discoideum AX4]
 gi|60465302|gb|EAL63394.1| adenosine deaminase, tRNA-specific [Dictyostelium discoideum AX4]
          Length = 254

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 105/165 (63%), Gaps = 5/165 (3%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+M  A+    +A    E+PV C+ V   +II  G N+TN   NGTRHAE EA DQI 
Sbjct: 47  HKKFMEAAIEEGYKALKEGEVPVACVIVYKGEIIARGSNKTNIKKNGTRHAELEAFDQIF 106

Query: 69  SSGE----YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
            + E    +   + + C LYVTVEPC+MCS AL+  +IK V++GC N++FGG GSV++++
Sbjct: 107 LNKELNDRFKDSLLEECDLYVTVEPCLMCSVALQFCKIKRVFFGCHNDKFGGNGSVYELN 166

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
             P     P Y C  G  ++++I+LL+ FY +EN+KAP+P ++ +
Sbjct: 167 FSPISNGRP-YNCITGLLKNQAILLLQLFYNQENKKAPIPNKRKR 210



>gi|354547035|emb|CCE43768.1| hypothetical protein CPAR2_214120 [Candida parapsilosis]
          Length = 269

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 105/173 (60%), Gaps = 7/173 (4%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           T H ++M  AL    +A    E PV C+    D II  G N TN + NGT+HAEF A+++
Sbjct: 5   TRHFQFMSTALFVGYKALLINETPVSCIVTRGDDIISIGYNYTNISLNGTKHAEFIALER 64

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           +    +Y+        LYVTVEPC+MC+  LRQL I  VY+GC N+RFGG G++  IH D
Sbjct: 65  LGRDIDYS-----ELTLYVTVEPCIMCASYLRQLGIGRVYFGCGNDRFGGNGTILSIHND 119

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPK-RKHKRVLKTEITP 178
             L  H  YP  GG  R E+I LLR FY++ENE AP+P+ +K+K + + E  P
Sbjct: 120 TSLP-HRGYPSIGGICRTEAIQLLRNFYIQENESAPIPQVKKNKNIEEKEFPP 171



>gi|401625091|gb|EJS43116.1| tad2p [Saccharomyces arboricola H-6]
          Length = 250

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 109/179 (60%), Gaps = 9/179 (5%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H ++MR A+  A+ A D++E PV C+FV     +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HVEHMRTAIRLARYALDHEETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKVMLGSRGVIDVFKDITLYVTVEPCIMCASALKQLGIGRVVFGCGNERFGGNGTVLSVN 122

Query: 125 QD-----PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           +D     P+ +    Y    G  R E+IMLLR FYVR+NE+AP P+ K+ RVL     P
Sbjct: 123 RDTCTLAPKSSGGKGYESIPGILRREAIMLLRYFYVRQNERAPNPRSKNDRVLDKSTFP 181



>gi|168039996|ref|XP_001772482.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162676279|gb|EDQ62764.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 353

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 102/179 (56%), Gaps = 23/179 (12%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           K+M+ A   A+EA    E+PVGC+ V D ++IG G N TNET N TRHAE  AID +LS 
Sbjct: 167 KFMKLAFIEAREALARLEVPVGCVIVNDGEVIGRGSNCTNETRNATRHAEMVAIDMVLSK 226

Query: 71  GEYTS---------EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVF 121
            +  S         E FQ+C LYVT EPC+MC+ AL     + +YYGC NERFGG GSV 
Sbjct: 227 WQQLSATPNVNPSTEGFQQCDLYVTCEPCIMCAAALSLSGFRKIYYGCDNERFGGCGSVL 286

Query: 122 DIHQD---PQLTLH-----------PAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           DIH D   P    H             + C GG+  DE++ LLR FY + N+ AP P R
Sbjct: 287 DIHSDGCAPCGLSHNEAEEHEEQKTKGFECVGGFMADEAVNLLRGFYEQGNQNAPRPHR 345



>gi|460394439|ref|XP_004242810.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform 1
           [Solanum lycopersicum]
          Length = 215

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 99/168 (58%), Gaps = 14/168 (8%)

Query: 17  LNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGEY--- 73
            + A +A  N E+PVGC+FV D ++I SGRNRT ET N TRHAE EAID ++   +    
Sbjct: 46  FSQANDALANLEVPVGCVFVEDGEVIASGRNRTTETRNATRHAEMEAIDFLVQQWQKNGL 105

Query: 74  ----TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD--- 126
                SE F +C LYVT EPC+MC+ AL  L IK  YYGCAN++FGG GSV  +H     
Sbjct: 106 SPLEVSERFSKCTLYVTCEPCIMCAAALSYLGIKEAYYGCANDKFGGCGSVLSLHTSNSN 165

Query: 127 -PQLTLHPA---YPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
            P   L  +   + C GG    E++ LLR FY + N  AP P R  K+
Sbjct: 166 LPTSELASSKKGFKCTGGIMASEAVSLLRSFYEQGNPNAPKPHRPLKQ 213



>gi|256271071|gb|EEU06172.1| Tad2p [Saccharomyces cerevisiae JAY291]
          Length = 250

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 108/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLF--VLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+F      +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HVKHMRTAVRLARYALDHDETPVACIFEHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|290771180|emb|CAY80744.2| Tad2p [Saccharomyces cerevisiae EC1118]
          Length = 250

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 108/183 (59%), Gaps = 12/183 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLF--VLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H K+MR A+  A+ A D+ E PV C+F      +++  G N TN++  G  HAEF  IDQ
Sbjct: 3   HVKHMRTAVRLARYALDHDETPVACIFEHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQ 62

Query: 67  I--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           I  +       +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++
Sbjct: 63  IKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVN 122

Query: 125 QDPQLTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEIT 177
            D   TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    
Sbjct: 123 HD-TCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFP 181

Query: 178 PMK 180
           PM+
Sbjct: 182 PME 184



>gi|432953475|ref|XP_004085413.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform 1
           [Oryzias latipes]
          Length = 198

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 99/169 (58%), Gaps = 4/169 (2%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL- 68
            ++M  A   A+EA  N E+ VGCL V  D+ IG GRN  N+T N TRHAE  A+D++L 
Sbjct: 30  ERWMSRAFEMAREALQNGEVAVGCLMVYKDQAIGKGRNEVNKTKNATRHAELVALDELLD 89

Query: 69  ---SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
              +S      V +  +LYVTVEPC+MC+ ALR L +  V YGC NERFGG GSV DI  
Sbjct: 90  WCRNSNLDLRSVCEHTVLYVTVEPCIMCAAALRLLNMALVVYGCWNERFGGCGSVLDISS 149

Query: 126 DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
              L     + C  G+  DE++ +L+ FY ++N  AP PK +    L+ 
Sbjct: 150 ADLLQTGTTFKCISGHRADEAVEILKTFYKQQNPNAPKPKTRTDAALQV 198



>gi|255628537|gb|ACU14613.1| unknown [Glycine max]
          Length = 182

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 103/181 (56%), Gaps = 15/181 (8%)

Query: 3   SSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFE 62
           +S ET+   +M  A+  A+ A D  E+PVGC+   D K+I SGRNRT ET N TRHAE E
Sbjct: 2   TSSETL--AFMELAIQQARLALDVLEVPVGCVIAEDGKVIASGRNRTTETRNATRHAEME 59

Query: 63  AIDQILSS----GEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           AID +L      G   SEV   F  C LYVT EPC+MC+ AL  L IK V+YGC+N++FG
Sbjct: 60  AIDVLLGQWQKHGLSMSEVAEKFSNCSLYVTCEPCIMCASALSILGIKEVFYGCSNDKFG 119

Query: 116 GTGSVFDIHQDPQLTLHPAYP------CEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           G GS+  +H      L+   P      C G     E+++L R FY + N  AP P R   
Sbjct: 120 GCGSILSLHLSNTAPLNNEVPSGKCFKCTGRIMASEAVLLFRTFYEQGNPNAPKPHRPLA 179

Query: 170 R 170
           R
Sbjct: 180 R 180



>gi|303276308|ref|XP_003057448.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461800|gb|EEH59093.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 189

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 103/164 (62%), Gaps = 7/164 (4%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
            ++MR AL  A  A D  E+PVGC+ VLD++I+  G NRTNE  NGTRHAEFEAID +L+
Sbjct: 9   ERHMRAALAEATAALDRWEVPVGCVLVLDNEIVARGSNRTNERRNGTRHAEFEAIDALLA 68

Query: 70  SGEYTSEV--FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
           +    +    F+ C+LYVT EPC+MC+ AL  L  + V YGC N++FGG GS+     D 
Sbjct: 69  AHANDANAARFEDCVLYVTCEPCIMCAGALSLLGCRAVVYGCGNDKFGGNGSILSDGGDA 128

Query: 128 QLT-----LHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
             +         YP  GG + ++++ LLR+FYVR N KAP P R
Sbjct: 129 AASNGARGARRTYPSVGGLFAEDAVELLRRFYVRGNPKAPKPHR 172



>gi|225555098|gb|EEH03391.1| tRNA specific adenosine deaminase [Ajellomyces capsulatus G186AR]
          Length = 234

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 90/122 (73%), Gaps = 4/122 (3%)

Query: 55  GTRHAEFEAIDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERF 114
           GTRHAEF AI+++L +  Y   +F+   LYVTVEPC+MC+ ALRQ +I+HVY+GCANERF
Sbjct: 100 GTRHAEFLAIEEVLRN--YPRSIFRETDLYVTVEPCIMCASALRQYQIRHVYFGCANERF 157

Query: 115 GGTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKT 174
           GGTG V ++H DP   + P Y   GG +R E+IMLLR+FY++ENE+AP PK K  R LK 
Sbjct: 158 GGTGGVLNLHSDP--GIDPPYGLTGGLFRREAIMLLRRFYIQENERAPNPKPKKDRELKN 215

Query: 175 EI 176
           + 
Sbjct: 216 DF 217



>gi|485621479|gb|EOD17922.1| hypothetical protein EMIHUDRAFT_61598 [Emiliania huxleyi CCMP1516]
          Length = 188

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 96/148 (64%), Gaps = 3/148 (2%)

Query: 29  IPVGCLFVLDDK-IIGSGRNRTNETFNGTRHAEFEAIDQILSSGEYTSEVFQRCILYVTV 87
           +PVGC+F    + +IG GRN T  + NGTRHAE EAID++L       E    C LYVTV
Sbjct: 17  VPVGCVFAHPARGVIGRGRNNTVASRNGTRHAELEAIDRMLDVDGVPPESVAECTLYVTV 76

Query: 88  EPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL--HPAYPCEGGYYRDE 145
           EPC+MC+ ALRQLR+  V +G AN++FGG GSV  +H D   +    P YP  GG  + E
Sbjct: 77  EPCLMCASALRQLRVSRVVFGAANDKFGGCGSVLSLHADDGASAAGDPPYPAVGGVRKAE 136

Query: 146 SIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           ++ LLR FY +EN+ AP P+++ ++ L+
Sbjct: 137 AVALLRLFYAQENQNAPQPQKRTRKQLE 164



>gi|449457197|ref|XP_004146335.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Cucumis
           sativus]
          Length = 191

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 102/169 (60%), Gaps = 13/169 (7%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           ++M  A+  A+ A +N E+PVGC+ V D  +I +GRNRT ET N TRHAE EAID ++ +
Sbjct: 14  RFMELAIQQAKLALNNLEVPVGCVIVEDGMVIATGRNRTTETRNATRHAEMEAIDILIEA 73

Query: 71  ----GEYTSEV---FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
               G  TSEV   F +C LYVT EPC+MC+ AL  + IK VYYGCAN++FGG GS+  +
Sbjct: 74  WQRDGLSTSEVADKFSKCKLYVTCEPCIMCASALSIIGIKEVYYGCANDKFGGCGSILSL 133

Query: 124 H----QDPQL--TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           H    + P     L   + C  G    E++ L R FY + N  AP P R
Sbjct: 134 HLGSGEAPTSGNGLGRGFKCTAGIMASEAVGLFRSFYEQGNPNAPKPHR 182



>gi|344233966|gb|EGV65836.1| cytidine deaminase-like protein [Candida tenuis ATCC 10573]
          Length = 303

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 103/184 (55%), Gaps = 12/184 (6%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDD--KIIGSGRNRTNETFNGTRHAEFEAI 64
           T     M  AL  A  A  N E PV C+ V  +  K++  G N TN+T NGTRHAEF AI
Sbjct: 6   TTEFSMMSLALYVAYRALRNNETPVACIMVDKNIQKVLSVGYNGTNDTLNGTRHAEFIAI 65

Query: 65  DQILS---------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFG 115
           D I             EY    F   ILYVTVEPCVMC+ AL+Q+ IK   YGC N+RFG
Sbjct: 66  DSIFDQFIPKEKHGDAEYVRSFFSNVILYVTVEPCVMCASALKQIGIKRAVYGCGNDRFG 125

Query: 116 GTGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPK-RKHKRVLKT 174
           G G+V  I+ D        Y   GG  R E++ LLR FY++EN+ AP PK + +K++ + 
Sbjct: 126 GNGTVLKINDDEIDGRRGNYKSYGGVLRSEAVQLLRNFYIQENDTAPKPKIKSNKQISEK 185

Query: 175 EITP 178
           + TP
Sbjct: 186 KYTP 189



>gi|485643250|gb|EOD37276.1| hypothetical protein EMIHUDRAFT_70562 [Emiliania huxleyi CCMP1516]
          Length = 188

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 96/148 (64%), Gaps = 3/148 (2%)

Query: 29  IPVGCLFVLDDK-IIGSGRNRTNETFNGTRHAEFEAIDQILSSGEYTSEVFQRCILYVTV 87
           +PVGC+F    + +IG GRN T  + NGTRHAE EAID++L       E    C LYVTV
Sbjct: 17  VPVGCVFAHPARGVIGRGRNNTVASRNGTRHAELEAIDRMLDVDGVPPESVAECTLYVTV 76

Query: 88  EPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL--HPAYPCEGGYYRDE 145
           EPC+MC+ ALRQLR+  V +G AN++FGG GSV  +H D   +    P YP  GG  + E
Sbjct: 77  EPCLMCASALRQLRVSRVVFGAANDKFGGCGSVLSLHADGGASAAGDPPYPAVGGVRKAE 136

Query: 146 SIMLLRKFYVRENEKAPVPKRKHKRVLK 173
           ++ LLR FY +EN+ AP P+++ ++ L+
Sbjct: 137 AVALLRLFYAQENQNAPQPQKRTRKQLE 164



>gi|326488167|dbj|BAJ89922.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 218

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 99/170 (58%), Gaps = 15/170 (8%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M  AL+ A+ A DN E+PVGC+ V + K+I SG NRTN T N TRHAE EAID +L   
Sbjct: 42  FMELALDQAKFALDNLEVPVGCVIVENGKVIASGSNRTNATRNATRHAEMEAIDVLLQEW 101

Query: 72  E-------YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +         +E F  C LYVT EPC+MC+ AL  L I+ VY+GC N++FGG GSV  +H
Sbjct: 102 QSIGLDQTLVAEKFAGCDLYVTCEPCIMCASALSILGIREVYFGCPNDKFGGCGSVMSLH 161

Query: 125 QD--------PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           +          Q T    + C GG   +E++ L R FY + N  AP P R
Sbjct: 162 ESLLSDDLTGSQDTRSRGFKCTGGIMAEEAVALFRNFYEQGNPNAPKPHR 211



>gi|296413803|ref|XP_002836598.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630426|emb|CAZ80789.1| unnamed protein product [Tuber melanosporum]
          Length = 179

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 108/176 (61%), Gaps = 11/176 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGE 72
           M+ AL  A  A  + E+PVGC+FV   +II SGRN TN +  GTRHAE  AID+IL++  
Sbjct: 1   MQSALQIATSALQSNEVPVGCVFVHGSRIIASGRNDTNRSLCGTRHAELVAIDKILAT-- 58

Query: 73  YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ------- 125
           +   +F+   LYVTVEPC+MC+ ALRQ+ I+ VY+GC+N+RFGG G V  +H+       
Sbjct: 59  HPPSIFKETDLYVTVEPCIMCASALRQIGIRKVYFGCSNDRFGGCGGVLRVHEGDGMGDG 118

Query: 126 --DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
                      Y   GG Y   +++ LR+FYV+EN +APV   K  R LKT+  P+
Sbjct: 119 RNGGNGGGGGGYEVVGGIYSSSAVVKLREFYVQENGRAPVATSKKGRELKTDNLPV 174



>gi|242041093|ref|XP_002467941.1| hypothetical protein SORBIDRAFT_01g036850 [Sorghum bicolor]
 gi|241921795|gb|EER94939.1| hypothetical protein SORBIDRAFT_01g036850 [Sorghum bicolor]
          Length = 183

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 100/172 (58%), Gaps = 17/172 (9%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M +AL  A+ A DN E+PVGC+ V D K+I SG N+TN T N TRHAE EAID +L   
Sbjct: 5   FMEQALEQAKFALDNLEVPVGCVIVEDGKVISSGSNKTNATRNATRHAEMEAIDVLLREW 64

Query: 72  EY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +         +E F  C LYVT EPC+MC+ AL  + I+ VY+GCAN++FGG GS+  +H
Sbjct: 65  QSMGLDQTQVAEKFAGCDLYVTCEPCIMCATALSIIGIREVYFGCANDKFGGCGSIMSLH 124

Query: 125 Q----------DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           +            Q +    + C GG   +E++ L R FY + N  AP P R
Sbjct: 125 KGDTSSSDDLSGSQASKPKGFKCTGGIMAEEAVALFRCFYEQGNPNAPRPHR 176



>gi|330805063|ref|XP_003290507.1| hypothetical protein DICPUDRAFT_81234 [Dictyostelium purpureum]
 gi|325079386|gb|EGC32989.1| hypothetical protein DICPUDRAFT_81234 [Dictyostelium purpureum]
          Length = 259

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 106/174 (60%), Gaps = 8/174 (4%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+M+EA+   ++A    E+PV C+ V +++II  G N+TN   NGTRHAE EA DQI 
Sbjct: 43  HIKFMKEAVKEGEKALKEGEVPVACVIVHNNQIIARGSNKTNIKKNGTRHAELEAFDQIF 102

Query: 69  SSGE----YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
            + E    +   +   C LYVTVEPC+MC+ AL   +I  V++GC N++FGG GSV+ ++
Sbjct: 103 LNKELNERFKDTLLVECDLYVTVEPCLMCAGALSLAKINRVFFGCHNDKFGGNGSVYSLN 162

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVP---KRKHKRVLKTE 175
             P     P Y    G  +D++I LL+ FY +EN KAPVP   KR    VLK E
Sbjct: 163 LAPISNGKP-YNAISGLLKDDAIHLLQLFYNQENTKAPVPNKRKRVDPEVLKKE 215



>gi|392298400|gb|EIW09497.1| Tad2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 244

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 106/179 (59%), Gaps = 12/179 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFGCGNERFGGNGTVLSVNHD-T 119

Query: 129 LTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEITPMK 180
            TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    PM+
Sbjct: 120 CTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFPPME 178



>gi|363756220|ref|XP_003648326.1| hypothetical protein Ecym_8224 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891526|gb|AET41509.1| Hypothetical protein Ecym_8224 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 244

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 103/172 (59%), Gaps = 3/172 (1%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           + +M+ A+  A+ A D+ E PV C+FV    +K++  G N TN +  G  HAEF AI QI
Sbjct: 2   YDHMKTAIKLARYALDHGETPVACVFVHMPTNKVVAYGLNDTNRSLTGIAHAEFMAIAQI 61

Query: 68  LSS-GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
               GE  + +F+   +YVTVEPC+MC+ AL+QL I  V +GC NERFGG GS+  IH+D
Sbjct: 62  QELFGEICTSIFKDISVYVTVEPCIMCASALKQLGIGRVVFGCGNERFGGNGSLLSIHKD 121

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
                   +    G  R E+IMLLR FYVRENE+AP  + K  R L  E  P
Sbjct: 122 SSTARENRHTVIPGVMRREAIMLLRYFYVRENERAPKARGKMNRRLDKETFP 173



>gi|449497359|ref|XP_002195924.2| PREDICTED: tRNA-specific adenosine deaminase 2 [Taeniopygia
           guttata]
          Length = 271

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 104/173 (60%), Gaps = 6/173 (3%)

Query: 1   GNSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAE 60
           G++++      Y   AL  A+EA +  E+PVGCL V + ++IG GRN  NET N T HAE
Sbjct: 97  GSTNVAVARKTYKYLAL--AKEALEKGEVPVGCLLVYNGEVIGRGRNEVNETKNATGHAE 154

Query: 61  FEAIDQILSSGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGG 116
             AIDQ+L   +       EVF + +LYVTVEPC+MC+ A+R ++I  V YGC NERFGG
Sbjct: 155 MVAIDQVLDWCKQHKRDYREVFPQLVLYVTVEPCIMCAAAVRLMKIPRVVYGCRNERFGG 214

Query: 117 TGSVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
            GSV  I  D  +     + C  GY  +E++ LL+ FY +EN  AP  K + K
Sbjct: 215 CGSVLSISSDDMVDSGDPFECSSGYRAEEAVELLKAFYRQENPNAPKSKVRKK 267



>gi|323333035|gb|EGA74437.1| Tad2p [Saccharomyces cerevisiae AWRI796]
          Length = 244

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 106/179 (59%), Gaps = 12/179 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVNHD-T 119

Query: 129 LTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEITPMK 180
            TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    PM+
Sbjct: 120 CTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFPPME 178



>gi|323308420|gb|EGA61665.1| Tad2p [Saccharomyces cerevisiae FostersO]
 gi|323354467|gb|EGA86306.1| Tad2p [Saccharomyces cerevisiae VL3]
          Length = 244

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 106/179 (59%), Gaps = 12/179 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV C+FV     +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVNHD-T 119

Query: 129 LTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEITPMK 180
            TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    PM+
Sbjct: 120 CTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFPPME 178



>gi|449277893|gb|EMC85915.1| tRNA-specific adenosine deaminase 2, partial [Columba livia]
          Length = 166

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (63%), Gaps = 6/159 (3%)

Query: 16  ALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-----S 70
           ++  A+EA +  E+PVGCL V + + IGSGRN  NET N TRHAE  AID++L      +
Sbjct: 5   SVPQAKEAQECGEVPVGCLLVHNGQAIGSGRNEVNETKNATRHAEMVAIDRVLDWCKQHN 64

Query: 71  GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLT 130
            +YT EVF + +LYVTVEPC+MC+ A+R ++I  V YGC NERFGG GSV  I  D  + 
Sbjct: 65  RDYT-EVFPQTVLYVTVEPCIMCAAAVRLMKIPRVVYGCRNERFGGCGSVLSISSDDMVD 123

Query: 131 LHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
               + C  GY   E++ +L+ FY +EN  AP  K + K
Sbjct: 124 TGEPFECVSGYRAKEAVEMLKAFYRQENPNAPKSKVRKK 162



>gi|156846411|ref|XP_001646093.1| hypothetical protein Kpol_543p65 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116765|gb|EDO18235.1| hypothetical protein Kpol_543p65 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 268

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 107/183 (58%), Gaps = 15/183 (8%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDK---IIGSGRNRTNETFNGTRHAEFEAID 65
           H +YM  AL  A+ A D+ E PV C+FV D K   I+  G N TN +  GT HAEF AID
Sbjct: 8   HVEYMEYALKLARHALDHGETPVACIFV-DKKTGGIVSYGMNDTNNSLAGTSHAEFVAID 66

Query: 66  QILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ 125
           +I +    T + F+  I+YVTVEPC+MC+ AL+QL I ++ +GC NERFGG G+V  I+ 
Sbjct: 67  RIKNQFSSTFDKFEDIIVYVTVEPCIMCASALKQLGILNIVFGCGNERFGGNGTVLSINN 126

Query: 126 DPQLTLHPAYPCEG----------GYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTE 175
           D    L PA               G  R E+IMLLR FYVREN  AP P+ K +R L  +
Sbjct: 127 DTCTKL-PANTVNSDSNRQDLILPGILRKEAIMLLRFFYVRENTTAPKPRTKTERKLDRD 185

Query: 176 ITP 178
             P
Sbjct: 186 TFP 188



>gi|365759969|gb|EHN01721.1| Tad2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 244

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 102/175 (58%), Gaps = 9/175 (5%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV CLFV     +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLAKYALDHDETPVACLFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD-- 126
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  VGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVNHDTC 120

Query: 127 ---PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
               +      Y    G  R E+IMLLR FYVR+NEKAP P+ K  RVL  +  P
Sbjct: 121 TLAARSKAATDYESIPGILRKEAIMLLRYFYVRQNEKAPKPRSKSDRVLDKDTFP 175



>gi|145347025|ref|XP_001417980.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578208|gb|ABO96273.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 173

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (59%), Gaps = 8/162 (4%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS-- 70
           MR AL  A+ A D  E+P GC    D +I+  GRN TN T NGTRHAEFEA+D +L +  
Sbjct: 1   MRVALAQARLALDEWEVPCGCALARDGEIVAVGRNATNRTRNGTRHAEFEAVDALLDAHG 60

Query: 71  GEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ----- 125
           G+  +  F+   LYVT EPCVMC+ A+  L ++ V YGCAN++FGG G+V D H      
Sbjct: 61  GDRAACRFEDVTLYVTCEPCVMCAGAMSALGVREVVYGCANDKFGGAGTVLDAHARGCGA 120

Query: 126 -DPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                 +   Y   GG +  E+I + ++FYVR N KAP P+R
Sbjct: 121 CGGAGGVGKPYDARGGLFEREAIEMFQEFYVRGNPKAPTPRR 162



>gi|384253509|gb|EIE26984.1| catalytic/ hydrolase/ zinc ion binding protein [Coccomyxa
           subellipsoidea C-169]
          Length = 197

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/171 (42%), Positives = 102/171 (59%), Gaps = 9/171 (5%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           +M  A   A+ A    E+P+GC+ V DD++I +G N TNE+ N TRHAE +A+D+I +  
Sbjct: 14  FMLLAFEEARGALARGEVPIGCIIVQDDEVIAAGSNLTNESRNATRHAEMDAVDKIFANI 73

Query: 70  SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQL 129
           +G   +  F+RC L+VT EPC+MC+ AL  LR   V YGC N+RFGG GS+  IH++   
Sbjct: 74  AGPDRNHAFERCRLFVTCEPCIMCAGALSLLRFAQVVYGCRNDRFGGCGSILSIHENGCG 133

Query: 130 -----TLHPAYP--CEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLK 173
                T  P +   C GG   +E++ LL++FY   N KAP P R    V K
Sbjct: 134 GCGGDTTVPGFKLRCRGGLMAEEAVTLLKEFYATGNPKAPKPHRPLAPVSK 184



>gi|448514646|ref|XP_003867165.1| Tad2 protein [Candida orthopsilosis Co 90-125]
 gi|380351503|emb|CCG21727.1| Tad2 protein [Candida orthopsilosis Co 90-125]
          Length = 269

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/158 (46%), Positives = 97/158 (61%), Gaps = 6/158 (3%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           T H  +M  AL    +A  N E PV C+    D+++  G N TN + NGT+HAEF A+++
Sbjct: 5   TRHFHFMSTALFVGYKALLNNETPVSCIVTRGDEVLSIGYNYTNISLNGTKHAEFIALER 64

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           +    +Y+        LYVTVEPC+MC+  LRQL I  VYYGC N+RFGG G++  IH D
Sbjct: 65  LKRDIDYS-----ELTLYVTVEPCIMCASYLRQLGIGRVYYGCGNDRFGGNGTILSIHND 119

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVP 164
             L  +  YP  GG  R E+I LLR FY++ENE APVP
Sbjct: 120 TGLP-NSVYPSVGGICRTEAIQLLRNFYIQENESAPVP 156



>gi|238014692|gb|ACR38381.1| unknown [Zea mays]
 gi|414872304|tpg|DAA50861.1| TPA: putative cytidine/deoxycytidylate deaminase family protein
           [Zea mays]
          Length = 183

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 98/172 (56%), Gaps = 17/172 (9%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M  AL  A+ A DN E+PVGC+ V D K+I SG N+TN T N TRHAE EAID +L   
Sbjct: 5   FMELALEQAKFALDNLEVPVGCVIVEDGKVISSGSNKTNATRNATRHAEMEAIDVLLREW 64

Query: 72  EY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +         +E F  C LYVT EPC+MC+ AL  + I+ VY+GCAN++FGG GS+  +H
Sbjct: 65  QSMGLDQPQVAEKFAGCDLYVTCEPCIMCATALSIIGIREVYFGCANDKFGGCGSIMSLH 124

Query: 125 QDP----------QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                        Q +    + C GG   +E++ L R FY + N  AP P R
Sbjct: 125 NGAASSSDELSGSQASTPKGFKCTGGIMAEEAVALFRCFYEQGNPNAPRPHR 176



>gi|323347994|gb|EGA82253.1| Tad2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 244

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 105/179 (58%), Gaps = 12/179 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLF--VLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV C+F      +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLARYALDHDETPVACIFEHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVNHD-T 119

Query: 129 LTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEITPMK 180
            TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    PM+
Sbjct: 120 CTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFPPME 178



>gi|345314820|ref|XP_001507477.2| PREDICTED: tRNA-specific adenosine deaminase 2-like, partial
           [Ornithorhynchus anatinus]
          Length = 137

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 88/122 (72%), Gaps = 4/122 (3%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H+  ++  ++ AQEA +N E+PVGCL V ++KI+G GRN  NET N TRHAE  AIDQ+L
Sbjct: 6   HNTKVQPLVSTAQEALENGEVPVGCLMVYNNKIVGMGRNEVNETKNATRHAEMVAIDQVL 65

Query: 69  S----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +     G+  +EVFQR +LYVTVEPC+MC+ ALR +RI  V YGC NERFGG GSV +I 
Sbjct: 66  NWCLRRGKNPTEVFQRTVLYVTVEPCIMCAAALRIMRIPLVVYGCQNERFGGCGSVLNIS 125

Query: 125 QD 126
            D
Sbjct: 126 SD 127



>gi|149248448|ref|XP_001528611.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448565|gb|EDK42953.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 271

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 101/170 (59%), Gaps = 6/170 (3%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H K+M  AL    +A    E PV C+     +II  G N TN T NGT+HAEF A+ ++ 
Sbjct: 8   HFKFMAVALFVGYKALLKNETPVACVVTRGCQIISIGYNHTNITLNGTKHAEFIALGRLK 67

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
              +Y     +   LYVTVEPC+MC+  LRQL +K+V YGC N+RFGG G++  +H DP+
Sbjct: 68  EPVDY-----KNLTLYVTVEPCIMCASYLRQLGLKNVIYGCGNDRFGGAGTILPLHNDPK 122

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           L  H    C  G  R E+I LLR FY++ENE AP PK K  + +  ++ P
Sbjct: 123 LP-HKPLTCIDGICRTEAIQLLRNFYIQENESAPTPKLKKNKDIDDKVFP 171



>gi|365764839|gb|EHN06358.1| Tad2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 244

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 105/179 (58%), Gaps = 12/179 (6%)

Query: 13  MREALNHAQEAYDNQEIPVGCLF--VLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI--L 68
           MR A+  A+ A D+ E PV C+F      +++  G N TN++  G  HAEF  IDQI  +
Sbjct: 1   MRTAVRLARYALDHDETPVACIFEHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 60

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQ 128
                  +VF+   LYVTVEPC+MC+ AL+QL I  V +GC NERFGG G+V  ++ D  
Sbjct: 61  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLGIGKVVFGCGNERFGGNGTVLSVNHD-T 119

Query: 129 LTLHPAYPCEGGY------YRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KTEITPMK 180
            TL P      GY       R E+IMLLR FYVR+NE+AP P+ K  RVL K    PM+
Sbjct: 120 CTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTFPPME 178



>gi|226528904|ref|NP_001152082.1| tRNA-specific adenosine deaminase [Zea mays]
 gi|195624114|gb|ACG33887.1| tRNA-specific adenosine deaminase [Zea mays]
 gi|195652465|gb|ACG45700.1| tRNA-specific adenosine deaminase [Zea mays]
          Length = 183

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 98/172 (56%), Gaps = 17/172 (9%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M  AL  A+ A DN E+PVGC+ V D K+I SG N+TN T N TRHAE EAID +L   
Sbjct: 5   FMELALEQAKFALDNLEVPVGCVIVEDGKVISSGSNKTNATRNATRHAEMEAIDVLLREW 64

Query: 72  EY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +         +E F  C LYVT EPC+MC+ AL  + I+ VY+GCAN++FGG GS+  +H
Sbjct: 65  QSMGLDQPQVAEKFAGCDLYVTCEPCIMCATALSIIGIREVYFGCANDKFGGCGSIMSLH 124

Query: 125 QDP----------QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                        Q +    + C GG   +E++ L R FY + N  AP P R
Sbjct: 125 NGAASSSDDLSGSQASKPKGFKCTGGIMAEEAVALFRCFYEQGNPNAPRPHR 176



>gi|68466625|ref|XP_722508.1| potential tRNA wobble position adenosine deaminase subunit [Candida
           albicans SC5314]
 gi|68466908|ref|XP_722369.1| potential tRNA wobble position adenosine deaminase subunit [Candida
           albicans SC5314]
 gi|46444339|gb|EAL03614.1| potential tRNA wobble position adenosine deaminase subunit [Candida
           albicans SC5314]
 gi|46444487|gb|EAL03761.1| potential tRNA wobble position adenosine deaminase subunit [Candida
           albicans SC5314]
          Length = 281

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 7/175 (4%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           T H +YM  +L    +A  N E PV C+ V    DKII  G N TN + NGT+HAEF A+
Sbjct: 6   TSHFQYMAISLFVGYKALLNNETPVSCIVVDSKSDKIISIGYNYTNHSLNGTQHAEFIAL 65

Query: 65  DQILSSGEYTSEV-FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
            +    GE  S + +   ILYVTVEPC+MC+  LRQL IK V +GC N+RFGG G++  I
Sbjct: 66  QRF---GEQKSSIDYNDLILYVTVEPCIMCASYLRQLGIKKVIFGCGNDRFGGNGTILSI 122

Query: 124 HQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           H D  L  + AY   GG  R E I LLR FY+++NE AP PK K    ++++  P
Sbjct: 123 HSDITLP-NAAYSSIGGICRTEGIQLLRNFYIQQNESAPNPKIKKNTDIESKEYP 176



>gi|254577709|ref|XP_002494841.1| ZYRO0A10890p [Zygosaccharomyces rouxii]
 gi|238937730|emb|CAR25908.1| ZYRO0A10890p [Zygosaccharomyces rouxii]
          Length = 248

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 105/179 (58%), Gaps = 5/179 (2%)

Query: 4   SMETIHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEF 61
           ++  +H ++M  AL   + A D+ E PV C+FV    D+I+  G N TN +  G  HAEF
Sbjct: 2   ALANVHLRHMETALRLGRYALDHGETPVACIFVHIPTDQIVAFGMNDTNRSLTGVAHAEF 61

Query: 62  EAIDQI--LSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGS 119
             I+QI    S +     F    LYVTVEPC+MC+ AL+QL I  V +G  N+RFGG G+
Sbjct: 62  MGIEQIREFVSPDELVPFFGDIALYVTVEPCIMCASALKQLGIGKVIFGAGNDRFGGNGT 121

Query: 120 VFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           V  I+QD   TL   +    G  R E+IMLLR FYVR NEKAP P+ K +R+L  E  P
Sbjct: 122 VLSINQD-SCTLGGKHESIPGVLRREAIMLLRYFYVRSNEKAPKPRTKGERLLDKENFP 179



>gi|296090277|emb|CBI40096.3| unnamed protein product [Vitis vinifera]
          Length = 205

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 102/169 (60%), Gaps = 13/169 (7%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
           +M  A+  A+ A D+ E+PVGC+ V D K+I +GRNRT ET N TRHAE EAID +L   
Sbjct: 30  FMELAIQQAKLALDSLEVPVGCVIVEDGKLIATGRNRTTETRNATRHAEMEAIDVLLEQW 89

Query: 72  EY-------TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           +         +E+F +C LYVT EPC+MC+ +L  L IK VYYGCAN++FGG GS+  +H
Sbjct: 90  QKNGLSKLEVAEIFSKCSLYVTCEPCIMCAASLSILGIKEVYYGCANDKFGGCGSILSLH 149

Query: 125 QDPQLTLHPAYP------CEGGYYRDESIMLLRKFYVRENEKAPVPKRK 167
                 L    P      C GG    E++ LL++FY + N  AP P R+
Sbjct: 150 SSSSKLLTSGTPLVKGFKCTGGIMATEAVSLLQRFYEQGNPNAPKPHRQ 198



>gi|508784782|gb|EOY32038.1| Cytidine/deoxycytidylate deaminase family protein isoform 2
           [Theobroma cacao]
          Length = 198

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 7/123 (5%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           YM  A+  A+ A ++ E+PVGC+F+ D K+I SGRNRTNET N TRHAE EAID +L   
Sbjct: 15  YMELAIQQAKLALESLEVPVGCVFIKDGKVIASGRNRTNETRNATRHAEMEAIDILLEKW 74

Query: 70  -----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
                S    +E F +CILYVT EPC+MC+ AL  L IK VYYGCANE+FGG GS+  +H
Sbjct: 75  QRDGLSKSDVAETFSKCILYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLH 134

Query: 125 QDP 127
              
Sbjct: 135 SSA 137



>gi|391325021|ref|XP_003737039.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Metaseiulus
           occidentalis]
          Length = 172

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 7/160 (4%)

Query: 10  HKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS 69
           H +M  A   A EA DNQE+PVGC+FVLD K+I +GRNR NET N   HAEF  ++Q+++
Sbjct: 20  HDFMELAFKAATEALDNQEVPVGCVFVLDGKVIATGRNRVNETKNACMHAEFVCLNQVVA 79

Query: 70  SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQL 129
           +     EV  R  +YVTVEPC+MC+  L Q+ ++ + YG  N+RFGG GSV DI     L
Sbjct: 80  N--QGREVLPRLEVYVTVEPCIMCAAMLGQIGVRKIVYGAPNDRFGGLGSVLDI-----L 132

Query: 130 TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
             +       G  ++ ++ LL+KFY  +N      KRK+K
Sbjct: 133 RGNSRVAITSGVQKERAVALLKKFYTGQNPNTECLKRKNK 172



>gi|294654357|ref|XP_456407.2| DEHA2A01584p [Debaryomyces hansenii CBS767]
 gi|199428817|emb|CAG84359.2| DEHA2A01584p [Debaryomyces hansenii CBS767]
          Length = 321

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 13/176 (7%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVL--DDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           M  AL     A  N E PV C+ V    ++I+  G N TN + NGTRHAEF AID+++S 
Sbjct: 11  MAIALFIGYRAMINNETPVACILVSRSTNQILSIGYNDTNRSLNGTRHAEFIAIDKVMSQ 70

Query: 71  GEY--TSEV------FQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
                 S++      F   ILYVTVEPC+MC+ AL+Q+ I +V YGC N+RFGG G++  
Sbjct: 71  IPVHDRSDIAKIQGFFGDVILYVTVEPCIMCASALKQIGIGYVVYGCGNDRFGGNGTILS 130

Query: 123 IHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           IHQD    ++ AY   GG  R E++ LLR FY++EN+ AP PK K  + L+ +  P
Sbjct: 131 IHQD---KINKAYQSYGGVLRTEAVQLLRNFYIQENDSAPNPKIKKNKELENKEYP 183



>gi|470120829|ref|XP_004296490.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Fragaria vesca
           subsp. vesca]
          Length = 193

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (58%), Gaps = 16/179 (8%)

Query: 2   NSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEF 61
           NS+ +T+   +M  A+  A+ A D+ E+PVGC+ V D K+I SGRNRTNET N TRHAE 
Sbjct: 9   NSNDDTLM--FMDLAIQQAKLALDSLEVPVGCVIVRDGKVIASGRNRTNETRNSTRHAEM 66

Query: 62  EAIDQILS-------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERF 114
           EAID +L        S    +E+F +C LYVT EPC+MC+ AL  + IK V+YGCAN++F
Sbjct: 67  EAIDTLLQQWREKRLSTSEVAEMFSKCYLYVTCEPCIMCAAALSIIGIKEVFYGCANDKF 126

Query: 115 GGTG-------SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
           GG G       S  +  ++  +     + C GG    E++ L   FY + N  AP P +
Sbjct: 127 GGCGSILSLHSSSSEAPRNGGVPQGKGFKCTGGIMASEAVFLFHNFYEQGNPNAPKPHK 185



>gi|302794668|ref|XP_002979098.1| hypothetical protein SELMODRAFT_109716 [Selaginella moellendorffii]
 gi|300153416|gb|EFJ20055.1| hypothetical protein SELMODRAFT_109716 [Selaginella moellendorffii]
          Length = 162

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (61%), Gaps = 10/155 (6%)

Query: 19  HAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL-----SSGEY 73
            A++A +  E+PVGC+ V + ++I SG NRTNET N TRHAE EAID +L     SS E 
Sbjct: 1   QARQALNRLEVPVGCVIVENGRVIASGSNRTNETRNATRHAEMEAIDMLLPRWECSSHED 60

Query: 74  TSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD-----PQ 128
            S+ F  C LYVT EPC+MC+ AL  L I  V+YGC N+RFGG GS+  +H +     P+
Sbjct: 61  FSKRFAGCELYVTCEPCIMCAAALSLLGIGKVFYGCKNDRFGGCGSILSLHSNGVGHSPE 120

Query: 129 LTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPV 163
                 YPC GG   +E+I L R+FY + N K  +
Sbjct: 121 SAGGMTYPCVGGIMAEEAIGLFREFYEQGNPKGKI 155



>gi|326502722|dbj|BAJ98989.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 169

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 94/162 (58%), Gaps = 15/162 (9%)

Query: 20  AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGE------- 72
           A+ A DN E+PVGC+ V + K+I SG NRTN T N TRHAE EAID +L   +       
Sbjct: 1   AKFALDNLEVPVGCVIVENGKVIASGSNRTNATRNATRHAEMEAIDVLLQEWQSIGLDQT 60

Query: 73  YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD------ 126
             +E F  C LYVT EPC+MC+ AL  L I+ VY+GC N++FGG GSV  +H+       
Sbjct: 61  LVAEKFAGCDLYVTCEPCIMCASALSILGIREVYFGCPNDKFGGCGSVMSLHESLLSDDL 120

Query: 127 --PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
              Q T    + C GG   +E++ L R FY + N  AP P R
Sbjct: 121 TGSQDTRSRGFKCTGGIMAEEAVALFRNFYEQGNPNAPKPHR 162



>gi|255724014|ref|XP_002546936.1| hypothetical protein CTRG_01242 [Candida tropicalis MYA-3404]
 gi|240134827|gb|EER34381.1| hypothetical protein CTRG_01242 [Candida tropicalis MYA-3404]
          Length = 279

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 102/172 (59%), Gaps = 6/172 (3%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H KYM  +L    +A  N E PV C+ V    D+II  G N TN + NGT+HAEF A+ +
Sbjct: 8   HFKYMAISLFVGYKALLNNETPVSCIVVNSKTDEIISIGYNYTNHSLNGTQHAEFIALQR 67

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
             S     S  +   ILYVTVEPC+MC+  LRQL I  V +GC N+RFGG G+V  +H+D
Sbjct: 68  FESD---ESINYSDLILYVTVEPCIMCASYLRQLGIGKVIFGCGNDRFGGNGTVLPVHKD 124

Query: 127 PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
           P L   P Y   GG  R E I LLR FY+++NE AP PK K    ++++  P
Sbjct: 125 PSLPNKP-YLSVGGICRAEGIQLLRNFYIQQNEAAPNPKVKKNTAIESKEYP 175



>gi|347826773|emb|CCD42470.1| similar to deaminase [Botryotinia fuckeliana T4]
 gi|472240813|gb|EMR85562.1| putative trna-specific adenosine deaminase subunit tad2 protein
           [Botryotinia fuckeliana BcDW1]
          Length = 283

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 117/236 (49%), Gaps = 65/236 (27%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H  +MREAL  A  A    E PVGC+ V     K++  G N TN ++NGTRHAEF AID+
Sbjct: 37  HIFFMREALAMANLALSTNETPVGCVLVDPTLKKVVARGMNATNRSYNGTRHAEFIAIDE 96

Query: 67  ILSS-------------------GE-------------------YTSEVFQRCILYVTVE 88
           +LSS                   GE                   Y  E  +   LYVT+E
Sbjct: 97  LLSSSPKVERGDVDENRSVKRKRGESEIECHDEKVDESENSKRSYGPEDMRSLDLYVTIE 156

Query: 89  PCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH-QDPQLTLHPA------------- 134
           PC+MC+  L+Q  I+ V+YG  N++FGG G V +IH ++ +   H               
Sbjct: 157 PCIMCASLLQQFGIRKVWYGAVNDKFGGNGGVLNIHVENGKFDSHDVAEDKAKDGNDQTL 216

Query: 135 -----------YPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
                      Y   GG+ R+E+I++LR+FYV+EN +AP P+ K +RVLK E+ P+
Sbjct: 217 DEMRTKKHEGDYEVSGGWLREEAIVILRRFYVQENGRAPEPRNKKERVLKLEVEPI 272



>gi|340519546|gb|EGR49784.1| Hypothetical protein TRIREDRAFT_124320 [Trichoderma reesei QM6a]
          Length = 566

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 88/263 (33%), Positives = 118/263 (44%), Gaps = 97/263 (36%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQI 67
           +H +++ EAL+ A+ A    E PVGC+ V + +II  G N TN T NGTRHAEF AI  +
Sbjct: 236 VHLRFINEALDMAKLALRTNETPVGCVIVHNGEIIARGMNATNVTRNGTRHAEFMAISAL 295

Query: 68  -------------------------------LSSGEYTS--------------------- 75
                                          +SS E+ S                     
Sbjct: 296 LSVARKDGPKTTSLKPTVPPKRPIKGDSSSDISSVEWRSPDEGNEDGSKSHLYPYGQKMI 355

Query: 76  -------EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD-- 126
                   +F+ C LYVTVEPCVMC+  LRQ+ IK VY+G  N++FGGTG VF IH +  
Sbjct: 356 PKERVNGAIFRECTLYVTVEPCVMCASLLRQVGIKKVYFGAVNDKFGGTGGVFSIHANSN 415

Query: 127 ------------PQL------------------------TLHPAYPCEGGYYRDESIMLL 150
                       PQ                          + P Y  EGG+ RDE++ LL
Sbjct: 416 PIREDGQTASAHPQPVPVQHPDGGGSLGVSYPPGGGDGGNIEPGYEIEGGWGRDEAVALL 475

Query: 151 RKFYVRENEKAPVPKRKHKRVLK 173
           R+FYV+EN +APVP++K  R  +
Sbjct: 476 RRFYVQENGRAPVPRKKEGRAAR 498



>gi|367002167|ref|XP_003685818.1| hypothetical protein TPHA_0E02940 [Tetrapisispora phaffii CBS 4417]
 gi|357524117|emb|CCE63384.1| hypothetical protein TPHA_0E02940 [Tetrapisispora phaffii CBS 4417]
          Length = 255

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 99/180 (55%), Gaps = 17/180 (9%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQ 66
           H  +M   +  A+   +N E PV C+FV   +  II  G N+TNE  NG  HAEF AID+
Sbjct: 9   HIHFMNLTVQLAKFTLENNETPVACIFVNKKNKNIISYGMNKTNENLNGISHAEFIAIDK 68

Query: 67  ILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           +++        F   I+YVTVEPC+MC+ AL+QL I ++ +GC NERFGG G+V  IH D
Sbjct: 69  LINDKNIDYN-FNDIIVYVTVEPCIMCASALKQLGINYIVFGCGNERFGGNGTVLSIHND 127

Query: 127 --------PQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
                     +T+ P      G  R E I LLR FY +EN+ AP P+ K  R L     P
Sbjct: 128 NSTINESSSSMTIIP------GILRKECIFLLRLFYYKENDTAPTPRSKKNRNLDKNEFP 181



>gi|154305221|ref|XP_001553013.1| hypothetical protein BC1G_08905 [Botryotinia fuckeliana B05.10]
          Length = 243

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/232 (35%), Positives = 115/232 (49%), Gaps = 65/232 (28%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSS 70
           MREAL  A  A    E PVGC+ V     K++  G N TN ++NGTRHAEF AID++LSS
Sbjct: 1   MREALAMANLALSTNETPVGCVLVDPTLKKVVARGMNATNRSYNGTRHAEFIAIDELLSS 60

Query: 71  -------------------GE-------------------YTSEVFQRCILYVTVEPCVM 92
                              GE                   Y  E  +   LYVT+EPC+M
Sbjct: 61  SPKVERGDVDENRSVKRKRGESEIECHDEKVDESENSKRSYGPEDMRSLDLYVTIEPCIM 120

Query: 93  CSYALRQLRIKHVYYGCANERFGGTGSVFDIH-QDPQLTLHPA----------------- 134
           C+  L+Q  I+ V+YG  N++FGG G V +IH ++ +   H                   
Sbjct: 121 CASLLQQFGIRKVWYGAVNDKFGGNGGVLNIHVENGKFDSHDVAEDKAKDGNDQTLDEMR 180

Query: 135 -------YPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITPM 179
                  Y   GG+ R+E+I++LR+FYV+EN +AP P+ K +RVLK E+ P+
Sbjct: 181 TKKHEGDYEVSGGWLREEAIVILRRFYVQENGRAPEPRNKKERVLKLEVEPI 232



>gi|50290647|ref|XP_447756.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527067|emb|CAG60703.1| unnamed protein product [Candida glabrata]
          Length = 259

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 113/186 (60%), Gaps = 17/186 (9%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEAI---- 64
           K++  AL  A+ A D+ E PV C+FV +  D ++  G N TN++ +GT HAEF A+    
Sbjct: 6   KHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLR 65

Query: 65  DQILSSGEYTS----EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           D + + G Y S    ++F+  + YVTVEPC+MC+ AL+Q+ I  + +GC N+RFGG G+V
Sbjct: 66  DAVQAQG-YASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFGCGNDRFGGNGTV 124

Query: 121 FDIHQDPQLTLHPAYPCE-----GGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVL-KT 174
             IH D   T+  +   +      G  R E+IMLLR FYVREN++AP P+ K +R L K 
Sbjct: 125 LSIHSDKSTTVAGSTEYDRTILVPGIRRREAIMLLRYFYVRENDRAPKPRTKAERNLDKN 184

Query: 175 EITPMK 180
              PM+
Sbjct: 185 TFPPMQ 190



>gi|241617471|ref|XP_002406922.1| tRNA-specific adenosine deaminase, putative [Ixodes scapularis]
 gi|215500893|gb|EEC10387.1| tRNA-specific adenosine deaminase, putative [Ixodes scapularis]
          Length = 188

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 100/168 (59%), Gaps = 10/168 (5%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS--- 69
           M      A+EA    E+PVGC+     ++I  GRNR N+T N  RHAE + +DQ+L    
Sbjct: 25  MDACFQLAEEALAAGEVPVGCVMFYAGQVIARGRNRVNKTKNACRHAEMDCVDQVLDWCA 84

Query: 70  -SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP- 127
             G  T EVF+   ++VTVEPC+MC+ AL  LR+  V +GC NERFGG GSV D+ +   
Sbjct: 85  ERGLDTGEVFRGVSVFVTVEPCIMCAAALDSLRVSRVVFGCPNERFGGVGSVLDVLRGTG 144

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTE 175
             T+  A     G   + ++ LL++FY+ EN  APVPK K  RVL+T+
Sbjct: 145 GRTVVVA-----GVRAERAVNLLKEFYMGENPNAPVPKSKANRVLQTQ 187



>gi|470130542|ref|XP_004301162.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Fragaria vesca
           subsp. vesca]
          Length = 195

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 100/170 (58%), Gaps = 14/170 (8%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           K+M  A+  A+ A D+ E+PVGC+ V D K+I  GRNRTNET N TRHAE EAID +L  
Sbjct: 18  KFMELAIEQAKLALDSLEVPVGCVIVEDGKVIACGRNRTNETRNATRHAEMEAIDILLEQ 77

Query: 70  ------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG---SV 120
                 S    +E F  C LYVT EPC+MC+ +L  + IK V+YGCAN++FGG G   S+
Sbjct: 78  WREKRLSTLEVAENFSNCNLYVTCEPCIMCAASLSIVGIKEVFYGCANDKFGGCGSVLSL 137

Query: 121 FDIHQDPQLT----LHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
                +P ++       ++ C GG    E++ L R FY + N  AP P R
Sbjct: 138 HSSSSEPVMSDGVPQGKSFKCTGGIMASEAVSLFRNFYEQGNPNAPKPHR 187



>gi|326428921|gb|EGD74491.1| tRNA-specific adenosine deaminase [Salpingoeca sp. ATCC 50818]
          Length = 191

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 93/163 (57%), Gaps = 5/163 (3%)

Query: 13  MREALNHAQEAYDNQEIPVGCLFVLDD-KIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           M  A+  AQ A    E+PVGC+FV D+  +  +GRN+TN   N TRHAE  A D  ++  
Sbjct: 1   MEAAVAEAQRALAEGEVPVGCVFVDDNGNVQAAGRNQTNIEHNATRHAELVAFDDCVARC 60

Query: 70  --SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDP 127
               E   ++   C LYVTVEPCVMC+YALR L +  V +GC N+RFGG GS  D+    
Sbjct: 61  GGDVEKAKDIVASCTLYVTVEPCVMCAYALRLLGVTRVVFGCHNDRFGGCGSTMDVATCE 120

Query: 128 QLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
                P    E G  R  +I LL+ FYV EN  AP PKRK +R
Sbjct: 121 TPDGLPKLQLEAGPMRTRAINLLKLFYVNENPNAPRPKRKTRR 163



>gi|340376085|ref|XP_003386564.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Amphimedon
           queenslandica]
          Length = 180

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 105/177 (59%), Gaps = 15/177 (8%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAID 65
           +  K+M EAL  A+ A +++E+PVGC+ V   + KI+  G N  N T N TRHAE  AID
Sbjct: 1   MEEKWMSEALKMAEVAVESREVPVGCVIVNNQEQKILARGCNEVNATLNATRHAEMIAID 60

Query: 66  QIL-----SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSV 120
           +++     + G    E+  +C LYVTVEPC+MC+Y LR +++  V++GC NERFGG GS+
Sbjct: 61  KLMELCRSNGGTKLEELTPKCTLYVTVEPCIMCTYGLRLVKLTRVFFGCHNERFGGCGSM 120

Query: 121 FDIHQDPQL-------TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
            + H D +L        L P      G  ++ +I LL++FY  EN  AP  K K KR
Sbjct: 121 MNAH-DMELGGPAGVPALLPPLLVTSGIMKEIAIELLQEFYKGENPNAPEEKMKRKR 176



>gi|494828435|gb|EON65247.1| hypothetical protein W97_04484 [Coniosporium apollinis CBS 100218]
          Length = 137

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 2/118 (1%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           H ++MREA+  A+ A  N E PVGC+FV +  +IG G N TN   NGTRHAEF A+ QIL
Sbjct: 22  HERFMREAIRMAELALANDETPVGCVFVRNGAVIGRGMNDTNRALNGTRHAEFVALSQIL 81

Query: 69  SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD 126
           +  E+   + +   LYVTVEPCVMC+ ALRQ  I+ VY+GC NERFGGTG V ++H +
Sbjct: 82  A--EHPISILKETDLYVTVEPCVMCASALRQFGIRAVYFGCWNERFGGTGGVLNVHNE 137



>gi|412988854|emb|CCO15445.1| predicted protein [Bathycoccus prasinos]
          Length = 211

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 112/203 (55%), Gaps = 38/203 (18%)

Query: 2   NSSMETIHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEF 61
            SS   +  K MR+AL  A+ AY+  E+PVGC+F   ++II +GRN+TNET NGT+HAEF
Sbjct: 4   TSSFTELEQKLMRKALELAENAYECWEVPVGCVFANGEEIIATGRNKTNETRNGTKHAEF 63

Query: 62  EAIDQILSSGE--------------------YTSEVFQRCILYVTVEPCVMCSYALRQL- 100
            A++ +  + E                    Y     ++  +YVT EPC+MC+  L QL 
Sbjct: 64  VALESLTRTLETKKGDGDGVGVGDGDGDGLLYERRHPEKLDVYVTCEPCIMCASMLGQLP 123

Query: 101 --RIKHVYYGCANERFGGTGSVFDIHQ--------------DPQLTLHPAYPCEGGYYRD 144
             R+K V +GCAN++FGG G+   +H+              D   +   AY C GG ++D
Sbjct: 124 FERVK-VIFGCANDKFGGGGTCLSVHEMRGLPSCLQSDTADDGSSSSSKAYECVGGLFKD 182

Query: 145 ESIMLLRKFYVRENEKAPVPKRK 167
           E++ L ++FYVR N KAP P R+
Sbjct: 183 EAVELFQRFYVRGNPKAPSPHRE 205



>gi|462424114|gb|EMJ28377.1| hypothetical protein PRUPE_ppa020315mg [Prunus persica]
          Length = 191

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 98/169 (57%), Gaps = 14/169 (8%)

Query: 12  YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS-- 69
           +M  A+  A+ A D  E+PVGC+ V D K+I SGRNRT ET N TRHAE EAID +L   
Sbjct: 15  FMLLAIEQAKVAMDCLEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDTLLEQW 74

Query: 70  -----SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG---SVF 121
                S    +++F +C LYVT EPC+MC+ AL  + IK V+YGC N++FGG G   S+ 
Sbjct: 75  REKRLSQSEVAKIFSKCKLYVTCEPCIMCAAALSFIGIKEVFYGCGNDKFGGCGSILSLH 134

Query: 122 DIHQDPQLTLHP----AYPCEGGYYRDESIMLLRKFYVRENEKAPVPKR 166
               +P ++        + C GG    E++ L R FY + N  AP P R
Sbjct: 135 SSSSEPLISGGAPRGEGFKCNGGIMASEAVSLFRSFYEQGNPNAPKPHR 183



>gi|242018582|ref|XP_002429753.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Pediculus
           humanus corporis]
 gi|212514765|gb|EEB17015.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Pediculus
           humanus corporis]
          Length = 188

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 98/161 (60%), Gaps = 11/161 (6%)

Query: 9   HHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
            + +M+ AL  A+ A  N E+PVGC+FV D++II +G N  NET N TRHAE   ID +L
Sbjct: 13  QYDWMKIALGFAENALKNNEVPVGCIFVYDNEIIANGANTVNETKNATRHAEMNCIDTVL 72

Query: 69  SSGE----YTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
           S  +      +EVF+   + VTVEPC+MCS AL +L++K + YGC N RFGG  +VFDI 
Sbjct: 73  SWCKERNLNFTEVFKAMDVVVTVEPCIMCSAALFELKVKRITYGCKNYRFGGCSTVFDIS 132

Query: 125 QDPQLTLHPAYPC--EGGYYRDESIMLLRKFYVRENEKAPV 163
           +     ++    C   GG Y +ESI LL+ FY   N   P+
Sbjct: 133 K-----IYRNSNCVMVGGVYDEESINLLKDFYKGSNPNVPL 168



>gi|508784783|gb|EOY32039.1| Cytidine/deoxycytidylate deaminase family protein isoform 3,
           partial [Theobroma cacao]
          Length = 239

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (66%), Gaps = 8/124 (6%)

Query: 12  YMREALNH-AQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILS- 69
           YM  A+   A+ A ++ E+PVGC+F+ D K+I SGRNRTNET N TRHAE EAID +L  
Sbjct: 55  YMELAIQQQAKLALESLEVPVGCVFIKDGKVIASGRNRTNETRNATRHAEMEAIDILLEK 114

Query: 70  ------SGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
                 S    +E F +CILYVT EPC+MC+ AL  L IK VYYGCANE+FGG GS+  +
Sbjct: 115 WQRDGLSKSDVAETFSKCILYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSL 174

Query: 124 HQDP 127
           H   
Sbjct: 175 HSSA 178



>gi|403346083|gb|EJY72426.1| Adenosine deaminase [Oxytricha trifallax]
          Length = 180

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (59%), Gaps = 9/166 (5%)

Query: 6   ETIHHKYMREALNHAQEAYDNQEIPVGCLFVLD--DKIIGSGRNRTNETFNGTRHAEFEA 63
           +T   K M  A+  AQ A D  E+PVGC+F  +  DK+I    N TN+T N T H E   
Sbjct: 21  QTKDEKLMMMAVEQAQIALDVGEVPVGCVFYHEPSDKVIAKSHNLTNQTKNATTHCEINC 80

Query: 64  IDQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDI 123
           I+Q+    E   +  + C LYVTVEPC+MC+YAL    IK+V +GC N++FGG GS+  +
Sbjct: 81  INQLSDKNE--QDFLKECTLYVTVEPCIMCAYALNLAGIKNVVFGCENDKFGGNGSILSL 138

Query: 124 HQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           HQ     L+  Y  + G  +D++I LL++FY   NEKAP  KR+ K
Sbjct: 139 HQ-----LNNKYHIKKGVLKDQAINLLQRFYEHGNEKAPENKRQRK 179



>gi|358385127|gb|EHK22724.1| hypothetical protein TRIVIDRAFT_27743, partial [Trichoderma virens
           Gv29-8]
          Length = 189

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 99/175 (56%), Gaps = 31/175 (17%)

Query: 19  HAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSGEYTSEVF 78
            A+ A    E PVGC+ V D+K+I  G N TN T NGTRHAEF A+  +LS       + 
Sbjct: 2   QAKLALRTNETPVGCVVVHDNKVIARGMNATNVTRNGTRHAEFMALAALLS--RVDGSIL 59

Query: 79  QRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQD----------PQ 128
           +   LYVTVEPCVMC+  LRQ+ IK VY+G  N++FGGTG VF IH +          PQ
Sbjct: 60  RESTLYVTVEPCVMCASLLRQVGIKKVYFGAVNDKFGGTGGVFSIHANSTPGQTACAHPQ 119

Query: 129 L-----TLHPAYP--------------CEGGYYRDESIMLLRKFYVRENEKAPVP 164
                 +L  ++P               EGG+ RDE++ LLR+FYV+EN +  VP
Sbjct: 120 PKSGGGSLGTSFPPGGGDGGNIERGFEIEGGWGRDEAVALLRRFYVQENGRGNVP 174



>gi|241950789|ref|XP_002418117.1| tRNA-specific adenosine deaminase subunit, putative; tRNA-specific
           adenosine-34 deaminase subunit, putative [Candida
           dubliniensis CD36]
 gi|223641456|emb|CAX43417.1| tRNA-specific adenosine deaminase subunit, putative [Candida
           dubliniensis CD36]
          Length = 280

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (58%), Gaps = 5/174 (2%)

Query: 7   TIHHKYMREALNHAQEAYDNQEIPVGCLFV--LDDKIIGSGRNRTNETFNGTRHAEFEAI 64
           T H +YM  +L    +A  N E PV C+ V    DKII  G N TN + NGT+HAEF A+
Sbjct: 6   TPHFQYMATSLFVGYKALLNNETPVSCIVVDSKSDKIISIGYNYTNHSLNGTQHAEFIAL 65

Query: 65  DQILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIH 124
            +   + +  S  +   ILYVTVEPC+MC+  LRQL I  V +GC N+RFGG G++  IH
Sbjct: 66  QRF--TEQKPSIGYNDLILYVTVEPCIMCASYLRQLGIGKVIFGCGNDRFGGNGTILPIH 123

Query: 125 QDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKRVLKTEITP 178
            D  L  +  Y   GG  R E I LLR FY+++NE AP PK K    ++++  P
Sbjct: 124 SDTTLP-NATYSSIGGICRTEGIQLLRNFYIQQNESAPNPKIKKNTDIESKEYP 176



>gi|198426798|ref|XP_002125101.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Ciona
           intestinalis]
          Length = 178

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 99/163 (60%), Gaps = 15/163 (9%)

Query: 11  KYMREALNHAQEAYDNQEIPVGCLFVLDDK-IIGSGRNRTNETFNGTRHAEFEAID---- 65
           K+M EA N+A++A    E+PVGC+ V  +K  + +GRN+ NET N TRHAE  AID    
Sbjct: 8   KWMNEAFNYAEDALKEGEVPVGCVLVYKNKEKLSNGRNKVNETKNATRHAELVAIDNAIK 67

Query: 66  --------QILSSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGT 117
                   Q L +    ++VF+ C++YVTVEPC+MC  A+R ++I  V +GC NERFGG 
Sbjct: 68  TVTSDSWKQSLPNDWKFTDVFEHCVMYVTVEPCIMCCGAMRAMKIPLVVFGCNNERFGGC 127

Query: 118 GSVFDIHQDPQL--TLHPAYPCEGGYYRDESIMLLRKFYVREN 158
           GSV  +H + +L  +L P     GG     +I LL+ FY ++N
Sbjct: 128 GSVLSLHSNRKLNSSLGPVISTYGGQQTVRAITLLKDFYKQDN 170



>gi|223997732|ref|XP_002288539.1| hypothetical protein THAPSDRAFT_268551 [Thalassiosira pseudonana
           CCMP1335]
 gi|220975647|gb|EED93975.1| hypothetical protein THAPSDRAFT_268551 [Thalassiosira pseudonana
           CCMP1335]
          Length = 180

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 100/169 (59%), Gaps = 11/169 (6%)

Query: 12  YMREALNHAQEAYDNQEIPVGCL---FVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQIL 68
           +MR+AL  A+ A D  E+PVGC+         I+  G N+ N T + TRHAE  AID++L
Sbjct: 5   FMRQALCVARTALDIGEVPVGCIVPYMASHSVIVSHGANQVNATRDATRHAEIVAIDRML 64

Query: 69  SSGEYTS------EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFD 122
           + G  +       E+F  C LYVT EPC+MC+ AL  + I  V++GC N+RFGG GS+  
Sbjct: 65  TKGRSSDQLKLPPEIFANCDLYVTCEPCIMCAAALSVMGIGRVFFGCRNDRFGGCGSILH 124

Query: 123 IHQDPQL--TLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHK 169
           +H++  L  + H  +   GG   +E++ LLR FY REN  AP  KRK K
Sbjct: 125 LHKEDTLQSSKHHGFTIHGGLLEEEAVALLRSFYDRENFHAPDHKRKRK 173



>gi|408391531|gb|EKJ70905.1| hypothetical protein FPSE_08873 [Fusarium pseudograminearum CS3096]
          Length = 490

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 115/259 (44%), Gaps = 93/259 (35%)

Query: 8   IHHKYMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEF------ 61
           +H K+   AL+ A+ A    E PVGC+ V D +II  G N TN T NGTRHAEF      
Sbjct: 181 MHMKFTEAALDMARLALQTNETPVGCVLVHDGRIIARGMNATNVTRNGTRHAEFMALGAL 240

Query: 62  ----------------EAIDQILSSGEYTS------------------------------ 75
                           +A +Q  ++ E +S                              
Sbjct: 241 LSYPPKDGPRTTYLKPKAENQSEAASETSSIDSGPPDEGNEDGAKGHLYPYGQKCHPDAR 300

Query: 76  ---EVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQ------- 125
               + +  ILYVTVEPCVMC+  LRQL IK VY+G  N++FGGTG VF IH        
Sbjct: 301 VDRSIIRESILYVTVEPCVMCASLLRQLGIKKVYFGAVNDKFGGTGGVFSIHANSLPVST 360

Query: 126 -----------------DPQLTLHPAYP--------------CEGGYYRDESIMLLRKFY 154
                            D   TL  +YP               EGG+ RDE++ LLR+FY
Sbjct: 361 DGQTASAHPTPKPAQLPDGSGTLGVSYPPGGGDGGNIESGYEIEGGWGRDEAVGLLRRFY 420

Query: 155 VRENEKAPVPKRKHKRVLK 173
           V+EN +APVP++K  R  +
Sbjct: 421 VQENGRAPVPRKKEGRAAR 439



>gi|321465150|gb|EFX76153.1| hypothetical protein DAPPUDRAFT_306296 [Daphnia pulex]
          Length = 171

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 100/172 (58%), Gaps = 8/172 (4%)

Query: 5   METIHHKYMREALNHAQEAYDNQEIPVGCLFVLDD-KIIGSGRNRTNETFNGTRHAEFEA 63
           M  +   YM  A   A+EA    E+PVGC+  L+   IIG GRNR NET N TRHAE EA
Sbjct: 1   MSELATCYMDRAFELAREALSVGEVPVGCVLHLEGYGIIGEGRNRVNETKNATRHAELEA 60

Query: 64  IDQIL-----SSGEYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTG 118
           ID  L     ++ E  S+VF +  ++V VEPC+ C+ AL+ L    VYYGC+NERFGG G
Sbjct: 61  IDSALLWIKKNTSESYSQVFGKTEVWVNVEPCIQCAGALQILGFARVYYGCSNERFGGCG 120

Query: 119 SVFDIHQDPQLTLHPAYPCEGGYYRDESIMLLRKFYVRENEKAPVPKRKHKR 170
           SV D+ +  +         +GG   +E+I LL+ FY  EN  AP PK K  R
Sbjct: 121 SVLDVCEKDK--RFQRLQIQGGIRANEAIELLKDFYRCENPNAPNPKSKEGR 170



>gi|325191110|emb|CCA25596.1| SUMO ligase putative [Albugo laibachii Nc14]
          Length = 1279

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+ A    E+PVGC+ V  ++II    NRTNE  N T+HAE  AID I+S+ 
Sbjct: 1097 FMREALEEAERALVRGEVPVGCVAVYQNQIISFASNRTNELCNATKHAELVAIDYIVSNY 1156

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
              T  +FQ    YVT EPC+MC+ AL Q ++  V +GC N RFGG GSV  +H +P   +
Sbjct: 1157 NNTRAIFQETTFYVTCEPCIMCAAALLQCKVVRVVFGCQNFRFGGCGSVLSLH-EPTANI 1215

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
               + C  G  R E+I LL++FY + N + 
Sbjct: 1216 PRTFSCHPGILRIEAIELLQRFYEQGNPRV 1245



>gi|325191115|emb|CCA25601.1| SUMO ligase putative [Albugo laibachii Nc14]
          Length = 1298

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+ A    E+PVGC+ V  ++II    NRTNE  N T+HAE  AID I+S+ 
Sbjct: 1116 FMREALEEAERALVRGEVPVGCVAVYQNQIISFASNRTNELCNATKHAELVAIDYIVSNY 1175

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
              T  +FQ    YVT EPC+MC+ AL Q ++  V +GC N RFGG GSV  +H +P   +
Sbjct: 1176 NNTRAIFQETTFYVTCEPCIMCAAALLQCKVVRVVFGCQNFRFGGCGSVLSLH-EPTANI 1234

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
               + C  G  R E+I LL++FY + N + 
Sbjct: 1235 PRTFSCHPGILRIEAIELLQRFYEQGNPRV 1264



>gi|325191109|emb|CCA25595.1| SUMO ligase putative [Albugo laibachii Nc14]
          Length = 1295

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+ A    E+PVGC+ V  ++II    NRTNE  N T+HAE  AID I+S+ 
Sbjct: 1113 FMREALEEAERALVRGEVPVGCVAVYQNQIISFASNRTNELCNATKHAELVAIDYIVSNY 1172

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
              T  +FQ    YVT EPC+MC+ AL Q ++  V +GC N RFGG GSV  +H +P   +
Sbjct: 1173 NNTRAIFQETTFYVTCEPCIMCAAALLQCKVVRVVFGCQNFRFGGCGSVLSLH-EPTANI 1231

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
               + C  G  R E+I LL++FY + N + 
Sbjct: 1232 PRTFSCHPGILRIEAIELLQRFYEQGNPRV 1261



>gi|325191111|emb|CCA25597.1| SUMO ligase putative [Albugo laibachii Nc14]
          Length = 1290

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+ A    E+PVGC+ V  ++II    NRTNE  N T+HAE  AID I+S+ 
Sbjct: 1108 FMREALEEAERALVRGEVPVGCVAVYQNQIISFASNRTNELCNATKHAELVAIDYIVSNY 1167

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
              T  +FQ    YVT EPC+MC+ AL Q ++  V +GC N RFGG GSV  +H +P   +
Sbjct: 1168 NNTRAIFQETTFYVTCEPCIMCAAALLQCKVVRVVFGCQNFRFGGCGSVLSLH-EPTANI 1226

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
               + C  G  R E+I LL++FY + N + 
Sbjct: 1227 PRTFSCHPGILRIEAIELLQRFYEQGNPRV 1256



>gi|325191114|emb|CCA25600.1| SUMO ligase putative [Albugo laibachii Nc14]
          Length = 1287

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 12   YMREALNHAQEAYDNQEIPVGCLFVLDDKIIGSGRNRTNETFNGTRHAEFEAIDQILSSG 71
            +MREAL  A+ A    E+PVGC+ V  ++II    NRTNE  N T+HAE  AID I+S+ 
Sbjct: 1105 FMREALEEAERALVRGEVPVGCVAVYQNQIISFASNRTNELCNATKHAELVAIDYIVSNY 1164

Query: 72   EYTSEVFQRCILYVTVEPCVMCSYALRQLRIKHVYYGCANERFGGTGSVFDIHQDPQLTL 131
              T  +FQ    YVT EPC+MC+ AL Q ++  V +GC N RFGG GSV  +H +P   +
Sbjct: 1165 NNTRAIFQETTFYVTCEPCIMCAAALLQCKVVRVVFGCQNFRFGGCGSVLSLH-EPTANI 1223

Query: 132  HPAYPCEGGYYRDESIMLLRKFYVRENEKA 161
               + C  G  R E+I LL++FY + N + 
Sbjct: 1224 PRTFSCHPGILRIEAIELLQRFYEQGNPRV 1253