BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10062_c0_seq1-m.26 5prime_partial 98-1576(-) 493 (-)
         (492 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511008106|gb|EPB89377.1| hypothetical protein HMPREF1544_0374...   418   e-114   Mucor circinelloides f. circinelloides 1006PhL
gi|384490963|gb|EIE82159.1| hypothetical protein RO3G_06864 [Rhi...   409   e-111   Rhizopus delemar RA 99-880
gi|402224702|gb|EJU04764.1| hypothetical protein DACRYDRAFT_7566...   402   e-110   Dacryopinax primogenitus
gi|299749910|ref|XP_001836420.2| hypothetical protein CC1G_07067...   357   4e-96   Coprinopsis cinerea okayama7#130
gi|302765969|ref|XP_002966405.1| hypothetical protein SELMODRAFT...   354   3e-95   Selaginella moellendorffii
gi|302792787|ref|XP_002978159.1| hypothetical protein SELMODRAFT...   352   1e-94   Selaginella moellendorffii
gi|409078231|gb|EKM78594.1| hypothetical protein AGABI1DRAFT_121...   352   1e-94   Agaricus bisporus var. burnettii JB137-S8
gi|426199223|gb|EKV49148.1| hypothetical protein AGABI2DRAFT_183...   351   2e-94   Agaricus bisporus var. bisporus H97
gi|170099413|ref|XP_001880925.1| predicted protein [Laccaria bic...   351   3e-94   Laccaria bicolor S238N-H82
gi|389750164|gb|EIM91335.1| hypothetical protein STEHIDRAFT_9141...   323   6e-86   Stereum hirsutum FP-91666 SS1
gi|170099411|ref|XP_001880924.1| predicted protein [Laccaria bic...   302   2e-79   Laccaria bicolor S238N-H82
gi|409078230|gb|EKM78593.1| hypothetical protein AGABI1DRAFT_594...   297   6e-78   Agaricus bisporus var. burnettii JB137-S8
gi|426199222|gb|EKV49147.1| hypothetical protein AGABI2DRAFT_218...   295   3e-77   Agaricus bisporus var. bisporus H97
gi|389750165|gb|EIM91336.1| hypothetical protein STEHIDRAFT_9141...   291   2e-76   Stereum hirsutum FP-91666 SS1
gi|317145515|ref|XP_001820859.2| hypothetical protein AOR_1_5001...   221   4e-55   Aspergillus oryzae RIB40
gi|255937085|ref|XP_002559569.1| Pc13g11520 [Penicillium chrysog...   216   1e-53   Penicillium rubens Wisconsin 54-1255
gi|299749912|ref|XP_001836421.2| hypothetical protein CC1G_07068...   213   1e-52   Coprinopsis cinerea okayama7#130
gi|317028923|ref|XP_001390749.2| hypothetical protein ANI_1_5240...   212   2e-52   Aspergillus niger CBS 513.88
gi|134075200|emb|CAK96513.1| unnamed protein product [Aspergillu...   211   5e-52   Aspergillus niger
gi|452984231|gb|EME83988.1| hypothetical protein MYCFIDRAFT_1628...   205   3e-50   Cercospora fijiensis CIRAD86
gi|358372468|dbj|GAA89071.1| hypothetical protein AKAW_07185 [As...   201   6e-49   Aspergillus kawachii IFO 4308
gi|238490692|ref|XP_002376583.1| conserved hypothetical protein ...   193   1e-46   Aspergillus flavus NRRL3357
gi|471870129|emb|CCO36989.1| hypothetical protein BN14_11139 [Rh...   189   2e-45   Rhizoctonia solani AG-1 IB
gi|115437856|ref|XP_001217917.1| predicted protein [Aspergillus ...   181   5e-43   Aspergillus terreus NIH2624
gi|317038657|ref|XP_001401921.2| hypothetical protein ANI_1_1914...   174   5e-41   Aspergillus niger CBS 513.88
gi|119489900|ref|XP_001262910.1| hypothetical protein NFIA_06174...   172   2e-40   Aspergillus fischeri NRRL 181
gi|322712385|gb|EFZ03958.1| hypothetical protein MAA_01032 [Meta...   162   3e-37   
gi|116191247|ref|XP_001221436.1| hypothetical protein CHGG_05341...   156   1e-35   Chaetomium globosum CBS 148.51
gi|398412270|ref|XP_003857461.1| hypothetical protein MYCGRDRAFT...   155   2e-35   Zymoseptoria tritici IPO323
gi|350637317|gb|EHA25674.1| hypothetical protein ASPNIDRAFT_1406...   155   3e-35   Aspergillus niger ATCC 1015
gi|134074525|emb|CAK38819.1| unnamed protein product [Aspergillu...   146   1e-32   Aspergillus niger
gi|350632377|gb|EHA20745.1| hypothetical protein ASPNIDRAFT_1935...   146   1e-32   Aspergillus niger ATCC 1015
gi|119489898|ref|XP_001262909.1| hypothetical protein NFIA_06173...   139   2e-30   Aspergillus fischeri NRRL 181
gi|46139455|ref|XP_391418.1| hypothetical protein FG11242.1 [Fus...   138   3e-30   
gi|83768722|dbj|BAE58859.1| unnamed protein product [Aspergillus...   109   2e-21   Aspergillus oryzae RIB40
gi|391865960|gb|EIT75239.1| hypothetical protein Ao3042_08871 [A...   103   1e-19   Aspergillus oryzae 3.042
gi|492905171|ref|WP_006035577.1| putative siderophore biosynthes...   102   3e-19   Rickettsiella grylli
gi|488402581|ref|WP_002471966.1| siderophore biosynthesis protei...   102   3e-19   Staphylococcus pettenkoferi
gi|297528778|ref|YP_003670053.1| IucA/IucC family protein [Geoba...   100   7e-19   
gi|494026733|ref|WP_006968920.1| hypothetical protein [Plesiocys...    97   1e-17   Plesiocystis pacifica
gi|493889364|ref|WP_006835426.1| hypothetical protein [Bacillus ...    96   2e-17   Bacillus sp. SG-1
gi|496370958|ref|WP_009079948.1| predicted protein [Streptomyces...    96   3e-17   
gi|495269046|ref|WP_007993801.1| siderophore synthetase [Pseudom...    96   4e-17   Pseudomonas sp. GM49
gi|495260062|ref|WP_007984817.1| siderophore synthetase [Pseudom...    95   6e-17   Pseudomonas sp. GM48
gi|495324436|ref|WP_008049181.1| siderophore synthetase [Pseudom...    94   8e-17   Pseudomonas sp. GM74
gi|512477241|ref|WP_016426391.1| hypothetical protein [Staphyloc...    92   5e-16   Staphylococcus sp. HGB0015
gi|212219153|ref|YP_002305940.1| siderophore synthase [Coxiella ...    91   9e-16   
gi|495342827|ref|WP_008067559.1| siderophore synthetase [Pseudom...    91   9e-16   Pseudomonas sp. GM79
gi|154707676|ref|YP_001424990.1| siderophore synthase [Coxiella ...    91   9e-16   
gi|495209335|ref|WP_007934115.1| siderophore synthetase [Pseudom...    91   1e-15   Pseudomonas sp. GM18
gi|493889363|ref|WP_006835425.1| hypothetical protein [Bacillus ...    90   1e-15   Bacillus sp. SG-1
gi|491682718|ref|WP_005538856.1| IucA/IucC family protein [Haloa...    90   2e-15   
gi|495867461|ref|WP_008592040.1| hypothetical protein [Salimicro...    90   2e-15   Salimicrobium jeotgali
gi|319893132|ref|YP_004150007.1| siderophore synthetase superfam...    89   2e-15   
gi|241661803|ref|YP_002980163.1| IucA/IucC family protein [Ralst...    88   6e-15   
gi|187927282|ref|YP_001897769.1| IucA/IucC family protein [Ralst...    88   6e-15   
gi|496576066|ref|WP_009277184.1| IucA/IucC family siderophore bi...    88   7e-15   
gi|495222011|ref|WP_007946785.1| siderophore synthetase [Pseudom...    88   7e-15   Pseudomonas sp. GM21
gi|386716164|ref|YP_006182488.1| hypothetical protein HBHAL_4880...    87   8e-15   
gi|493884199|ref|WP_006830393.1| hypothetical protein [Planococc...    87   8e-15   Planococcus antarcticus
gi|490771566|ref|WP_004633791.1| siderophore synthetase componen...    87   1e-14   Ralstonia pickettii
gi|345568566|gb|EGX51459.1| hypothetical protein AOL_s00054g158 ...    87   1e-14   Arthrobotrys oligospora ATCC 24927
gi|489295489|ref|WP_003203001.1| IucA/IucC [Bacillus mycoides] >...    86   2e-14   Bacillus mycoides
gi|493884198|ref|WP_006830392.1| hypothetical protein [Planococc...    86   3e-14   Planococcus antarcticus
gi|73662016|ref|YP_300797.1| hypothetical protein SSP0707 [Staph...    86   4e-14   
gi|494972604|ref|WP_007698630.1| IucA/IucC family protein [Halov...    85   5e-14   Halovivax asiaticus
gi|488413269|ref|WP_002482654.1| siderophore synthetase [Staphyl...    85   6e-14   Staphylococcus saprophyticus
gi|491705331|ref|WP_005553745.1| IucA/IucC family protein [Natro...    84   8e-14   Natronococcus amylolyticus
gi|297528779|ref|YP_003670054.1| IucA/IucC family protein [Geoba...    82   3e-13   
gi|496849119|ref|WP_009384844.1| hypothetical protein [Staphyloc...    81   6e-13   Staphylococcus massiliensis
gi|488381093|ref|WP_002450478.1| siderophore synthetase [Staphyl...    80   2e-12   Staphylococcus warneri
gi|319893130|ref|YP_004150005.1| siderophore synthetase superfam...    80   2e-12   
gi|488420744|ref|WP_002490129.1| siderophore synthetase [Staphyl...    79   3e-12   Staphylococcus epidermidis
gi|488406681|ref|WP_002476066.1| siderophore synthetase [Staphyl...    79   3e-12   Staphylococcus epidermidis
gi|488426959|ref|WP_002496344.1| siderophore synthetase [Staphyl...    79   4e-12   Staphylococcus epidermidis
gi|495867462|ref|WP_008592041.1| hypothetical protein [Salimicro...    78   7e-12   Salimicrobium jeotgali
gi|488428284|ref|WP_002497669.1| siderophore synthetase [Staphyl...    78   7e-12   Staphylococcus epidermidis
gi|488441872|ref|WP_002511257.1| siderophore synthetase [Staphyl...    78   7e-12   Staphylococcus epidermidis
gi|487747655|ref|WP_001829766.1| siderophore synthetase [Staphyl...    78   7e-12   Staphylococcus epidermidis
gi|488431213|ref|WP_002500598.1| siderophore synthetase [Staphyl...    78   8e-12   Staphylococcus epidermidis
gi|488434304|ref|WP_002503689.1| siderophore synthetase [Staphyl...    78   8e-12   Staphylococcus epidermidis
gi|57867701|ref|YP_189343.1| hypothetical protein SERP1779 [Stap...    77   9e-12   
gi|488431303|ref|WP_002500688.1| siderophore synthetase [Staphyl...    77   9e-12   Staphylococcus epidermidis
gi|488377971|ref|WP_002447356.1| siderophore synthetase [Staphyl...    77   9e-12   Staphylococcus epidermidis
gi|488416516|ref|WP_002485901.1| siderophore synthetase [Staphyl...    77   1e-11   Staphylococcus epidermidis
gi|488398381|ref|WP_002467766.1| siderophore synthetase [Staphyl...    77   1e-11   Staphylococcus epidermidis
gi|488419888|ref|WP_002489273.1| siderophore synthetase [Staphyl...    77   1e-11   Staphylococcus epidermidis
gi|27468688|ref|NP_765325.1| hypothetical protein SE1770 [Staphy...    77   1e-11   Staphylococcus epidermidis ATCC 12228
gi|488401268|ref|WP_002470653.1| siderophore synthetase [Staphyl...    77   2e-11   Staphylococcus epidermidis
gi|488404721|ref|WP_002474106.1| siderophore synthetase [Staphyl...    77   2e-11   Staphylococcus epidermidis
gi|488385642|ref|WP_002455027.1| siderophore synthetase [Staphyl...    76   2e-11   Staphylococcus hominis
gi|488419241|ref|WP_002488626.1| siderophore synthetase [Staphyl...    76   2e-11   Staphylococcus hominis
gi|488424773|ref|WP_002494158.1| siderophore synthetase [Staphyl...    76   2e-11   Staphylococcus epidermidis
gi|488408235|ref|WP_002477620.1| hypothetical protein [Staphyloc...    76   2e-11   Staphylococcus epidermidis
gi|488379023|ref|WP_002448408.1| siderophore synthetase [Staphyl...    76   2e-11   Staphylococcus hominis
gi|488429198|ref|WP_002498583.1| siderophore synthetase [Staphyl...    76   2e-11   Staphylococcus epidermidis
gi|447184552|ref|WP_001261808.1| siderophore biosynthesis protei...    76   3e-11   Bacillus cereus
gi|489354455|ref|WP_003261497.1| siderophore biosynthesis protei...    76   3e-11   
gi|218896965|ref|YP_002445376.1| petrobactin biosynthesis protei...    75   4e-11   
gi|434374946|ref|YP_006609590.1| petrobactin biosynthesis protei...    75   4e-11   
gi|447157737|ref|WP_001234993.1| siderophore biosynthesis protei...    75   4e-11   Bacillus thuringiensis
gi|447184561|ref|WP_001261817.1| siderophore biosynthesis protei...    75   4e-11   Bacillus
gi|489400410|ref|WP_003306819.1| siderophore biosynthesis protei...    75   4e-11   
gi|52143438|ref|YP_083391.1| siderophore biosynthesis protein [B...    75   4e-11   
gi|490468479|ref|WP_004338999.1| hypothetical protein [Francisel...    75   5e-11   Francisella tularensis
gi|118498243|ref|YP_899293.1| siderophore biosynthesis protein [...    75   5e-11   
gi|495913438|ref|WP_008638017.1| hypothetical protein [Halobacil...    75   6e-11   Halobacillus sp. BAB-2008
gi|385793654|ref|YP_005826630.1| hypothetical protein [Francisel...    75   6e-11   
gi|489285476|ref|WP_003193066.1| siderophore synthetase [Pseudom...    75   6e-11   Pseudomonas fluorescens
gi|490469463|ref|WP_004339974.1| ribosomal L29e protein family, ...    75   6e-11   Francisella tularensis
gi|489127975|ref|WP_003037766.1| hypothetical protein [Francisel...    75   6e-11   Francisella tularensis
gi|447184553|ref|WP_001261809.1| siderophore biosynthesis protei...    75   7e-11   Bacillus cereus


>gi|511008106|gb|EPB89377.1| hypothetical protein HMPREF1544_03746 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 632

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/506 (42%), Positives = 318/506 (62%), Gaps = 18/506 (3%)

Query: 2   NNDVKSSMNFIFSSYDSNDSI---EEISAVELMRIFGVWMNLENDISNQLIAEINSSVQY 58
           N  VK ++  I SS+         +   AV +   F   + +   +  Q+  E+ SS+ +
Sbjct: 128 NQHVKQTLTSILSSHQPVGEFHLEDGYDAVHMWDRFAHDLEVNGKLREQIGQELGSSINF 187

Query: 59  QEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLI 118
           Q+ TY + K    L  SS++ WEQS++EGHA HPMHKAR +  P++ +LPGSYD  +P I
Sbjct: 188 QKYTYDHPKQLPGLQ-SSTIAWEQSVVEGHATHPMHKARKSYPPMKVLLPGSYDLEHPKI 246

Query: 119 RFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXK-------NTILIPVHELQIPNIESK 171
           R + +P +  V+RG+YE+  +++   L       +       +   I +HELQ+PN+E K
Sbjct: 247 RLVGLPKESAVLRGNYEELAQRLVDALLEAGGNAEEMRAKYNDYAFIAIHELQLPNVEQK 306

Query: 172 FPFANILPEKYSIKAKSQASLRTVVIPE-LNDIAIKLPLGIKVTSALRTVTPWSTHSGPA 230
           F  A I PE+YSI  ++ ASLR+V  P+ L  +++KL LG+K++SALRTVTP++T+ GP 
Sbjct: 307 FHDAYIFPEQYSIYVEALASLRSVARPDILPGLSVKLCLGVKISSALRTVTPFTTYFGPG 366

Query: 231 LGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIRE--DFNELNSDGERVIIC 288
              ++ KL  DR++L V +E   +    +D D+AKH + +IRE  +++    D +  I C
Sbjct: 367 FSKLVPKLTYDRDVLYVERELGTISYRHEDSDVAKHCSSVIREAIEYSPEYKD-DLFIPC 425

Query: 289 AALVE---RDEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
            ALVE   R +  +++V  VW LDTE+K++ F +R+V +  +AFLPP   NG +FEAH Q
Sbjct: 426 GALVEKIQRPDTDETLVTHVWGLDTEEKKVAFLERYVDLALRAFLPPCLENGVAFEAHGQ 485

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILY 405
           N LARFD KSGEL GFV+RDFGG+K H +TL +S GE +D+L +S  EA    EV K+LY
Sbjct: 486 NTLARFDRKSGELKGFVIRDFGGVKVHNETLKQSTGEELDILPDSCVEAHTLDEVSKLLY 545

Query: 406 HTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRDHLLYKTFLEQDKFNYKCLMEMK 465
           HTL  C   R  R L+LHYNG GW+IVR    +++P+DH+++  F+  +K   KCL+ MK
Sbjct: 546 HTLFHCQFQRLIRVLDLHYNGAGWEIVRNKMSELIPKDHVMWPMFMGHEKVPGKCLVRMK 605

Query: 466 CDGLYRDYLYIPKPNLMMYKGERIEL 491
            D LYRDY+Y P PN++++K +++ L
Sbjct: 606 IDELYRDYIYRPVPNMILFKPQQVPL 631



>gi|384490963|gb|EIE82159.1| hypothetical protein RO3G_06864 [Rhizopus delemar RA 99-880]
          Length = 634

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 312/495 (63%), Gaps = 14/495 (2%)

Query: 8   SMNFIFSSYDSNDSIEEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYK 67
           +++ I     + D ++  SAV+L   F   + + + +  Q+  E+ SS+ +Q+ TY N K
Sbjct: 137 TLSAILDGNKTFDLVDGYSAVQLWNHFAQDLEINSKLREQIGQELGSSILFQKYTYDNPK 196

Query: 68  HQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDK 127
              +LN SS+++WEQS++EGHA HPMHKAR +  P+  + PGSYD  +P +R + +P + 
Sbjct: 197 PLPTLN-SSTIKWEQSVVEGHATHPMHKARKSFPPMPPLNPGSYDLDHPAVRLVGIPREN 255

Query: 128 MVIRGSYEKTIEKITKLLXXXXXXXK-------NTILIPVHELQIPNIESKFPFANILPE 180
            ++RG YE+    +   L       K       N + I +HELQ+PNI+ KF  A I  +
Sbjct: 256 AILRGEYEELSAPLVNALMDAGGNHKDIRAQYQNYVFIAIHELQLPNIQEKFKDAVIFSK 315

Query: 181 KYSIKAKSQASLRTVVIPE-LNDIAIKLPLGIKVTSALRTVTPWSTHSGPALG-SIIDKL 238
           ++ +  ++ ASLR+V  P+ L  +++KL LGIK++SALRTVTP++T+ GP    +++ KL
Sbjct: 316 EHQLNVEALASLRSVARPDILPGLSVKLCLGIKISSALRTVTPFTTYFGPGFSFNVVPKL 375

Query: 239 EIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFN-ELNSDGERVIICAALVE---R 294
             D  +L + +E   +    +D D+AKH + +IRE    +     +  I C ALVE   R
Sbjct: 376 TYDHEVLAIERELGTITYRHEDSDVAKHCSSVIREALEYDPKYQDDLFIPCGALVEKIQR 435

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSK 354
            +  +++V  VWNLDT++KR++F DR+V    ++FLPP  +NG +FEAH QN LARFD K
Sbjct: 436 PDTDETLVAHVWNLDTKEKRVEFLDRYVDFALRSFLPPCLINGVAFEAHGQNTLARFDRK 495

Query: 355 SGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVH 414
           +G L GFV+RDFGG+K H +TL +S G  +D+L +S  EA    EV+K+LYHTL  C + 
Sbjct: 496 TGLLKGFVIRDFGGVKAHNETLKKSAGVELDILPDSCVEAHSLEEVFKLLYHTLFHCQLQ 555

Query: 415 RFARALNLHYNGIGWDIVRKHFKQIVPRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYL 474
           R  R L+LHY+G GW+IVRK+  Q VP+DH+++  F+E  K   KCL+ MK D LYRDY+
Sbjct: 556 RLIRVLDLHYSGEGWEIVRKYLTQYVPKDHVMWPMFMESSKVPGKCLVRMKIDELYRDYI 615

Query: 475 YIPKPNLMMYKGERI 489
           Y P PN++ Y+ + +
Sbjct: 616 YRPVPNMIKYEPQSV 630



>gi|402224702|gb|EJU04764.1| hypothetical protein DACRYDRAFT_75668 [Dacryopinax sp. DJM-731 SS1]
          Length = 626

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/489 (43%), Positives = 308/489 (62%), Gaps = 16/489 (3%)

Query: 12  IFSSYDSNDSIEEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLS 71
           I +S D N+ ++ ++AV+L   F +  ++E DI+ +L  E  SSV++Q  +Y +     +
Sbjct: 139 IRTSVD-NEVLDHLTAVQLWEKFALMAHVEADIAEELAEEFGSSVEWQAYSYDHPAVIPT 197

Query: 72  LNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIR 131
           L  S S++WEQ++LEGH  HPM+KAR ++ P+  I PGSYDF+NP IR + VP   + +R
Sbjct: 198 LQ-SPSIKWEQTILEGHPTHPMNKARKSLPPMPVITPGSYDFLNPTIRIMRVPRRNLKLR 256

Query: 132 GSYEKTIEKIT----KLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAK 187
           G +E   E +     K          N +L+PVHELQ+PNI+ KFP   +L E++S+KA+
Sbjct: 257 GEFENIFEPMVQAAEKNAGQTLTRTSNFVLMPVHELQLPNIKEKFPENEVLGEEFSVKAE 316

Query: 188 SQASLRTVVIPE-LNDIAIKLPLGIKVTSALRTVTPWSTHSGPALG-SIIDKLEIDRNLL 245
           S  S R+V+IPE L   ++KL + +K++SALRTVTPW+   G     +I+ KL  DR  L
Sbjct: 317 SLTSTRSVLIPEVLRKHSLKLCVSMKISSALRTVTPWTCFVGNEFTHNILPKLHYDRTAL 376

Query: 246 KVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSD--GERVIICAALVE---RDEFGKS 300
            V  E A   S   DF IAKH + ++RE + EL S+   ERVI+C AL E   R +   +
Sbjct: 377 VVEGEVASAVSNNPDFSIAKHCSTVVRESY-ELYSEKKNERVIVCTALTEKIQRPDTDIT 435

Query: 301 VVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVG 360
             E V+ LDT++KR+ F DR+V I   AFLPP+ ++G +FEAH QN + RFD  +GELVG
Sbjct: 436 QAEHVFGLDTDEKRVAFLDRYVKIAVAAFLPPLLIDGVAFEAHGQNTMTRFDMTTGELVG 495

Query: 361 FVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARAL 420
           F +RDFGGIK HQ TL  SIG+R+ VL +     +D  + +K+L+HTLI  ++HR  R L
Sbjct: 496 FAIRDFGGIKVHQPTLERSIGQRLAVLPDDAVGTEDLNDCFKLLHHTLIHVHIHRLIRVL 555

Query: 421 NLHYNGIGWDIVRKHFKQIVPRDHLLYKTFLEQDK--FNYKCLMEMKCDGLYRDYLYIPK 478
            LH +G GW IVRK+    +P+DH L K +L ++      KC ++MK   LYRDY+Y P 
Sbjct: 556 GLHEDGRGWAIVRKYLDAAIPQDHALRKAWLSEEAAFVPAKCFIKMKMTELYRDYIYSPI 615

Query: 479 PNLMMYKGE 487
           PNL+ YK +
Sbjct: 616 PNLIQYKPQ 624



>gi|299749910|ref|XP_001836420.2| hypothetical protein CC1G_07067 [Coprinopsis cinerea okayama7#130]
 gi|298408653|gb|EAU85373.2| hypothetical protein CC1G_07067 [Coprinopsis cinerea okayama7#130]
          Length = 591

 Score =  357 bits (917), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 188/477 (39%), Positives = 287/477 (60%), Gaps = 16/477 (3%)

Query: 24  EISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQS 83
           ++  + L   F + +NL+  +   +  E  SSV +QE  + NY        + SV WEQS
Sbjct: 103 DLDPIRLWHRFALSVNLDKSLVEDIELEFRSSVTWQEHAF-NYPPPSPSFDAPSVAWEQS 161

Query: 84  LLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITK 143
           +++GH  HPMHK R  + PI    PG  D ++P++RFI VP + + I  ++E+ I  + K
Sbjct: 162 IVQGHPTHPMHKTRRFLPPIPSFQPGQCDLLHPILRFISVPRENLKITYNFEELIAPLVK 221

Query: 144 LLXXXXX----XXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPE 199
           +            K+ ++IPVHELQ+ +I  KFP A I P +YS+  ++Q SLR+VV+P 
Sbjct: 222 VAEKKASKPIISPKDHVIIPVHELQVYHIRDKFPEARIYPPEYSLPLEAQQSLRSVVVPN 281

Query: 200 -LNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYSI 257
              ++ +KL +G+K+TSA+RT++P S + GP   + ++  + +DRN++ V KE A V   
Sbjct: 282 GYRNLHLKLAVGMKLTSAVRTISPESAYLGPRFSAQVVPVIRMDRNIVTVAKELASVVHT 341

Query: 258 EKDFDIAKHSTCIIREDFNELNSD-GERVIICAALVE-----RDEFGKSVVEKVWNLDTE 311
             D DIAKH   ++RE    L  D  ER+I+C +LVE     RD     V+ +++ LDTE
Sbjct: 342 HPDGDIAKHCAALVREYHEGLCEDRQERMIVCTSLVEYGHGSRDGNIPPVI-RLFGLDTE 400

Query: 312 QKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKH 371
           +KRI++  +F+ I F+AFLP V  NG +FE H QN +ARFD+++ EL GF++RDFGGI+ 
Sbjct: 401 EKRIEWLSKFLDIFFRAFLPSVLHNGVAFECHPQNCVARFDARTKELKGFIIRDFGGIRV 460

Query: 372 HQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDI 431
           H  TL  + G  +D +E     A D  +VY  +YHT+   ++ +  R L+LHYNG GW++
Sbjct: 461 HPPTLKATTGVDIDFVEGHSIIAPDLDDVYTRMYHTVFHNHLQQLIRVLDLHYNGRGWEL 520

Query: 432 VRKHFKQIVPRDHLLYKTFLEQDKFNY--KCLMEMKCDGLYRDYLYIPKPNLMMYKG 486
           VR H K  +P DH LY  +L  ++     KC M M+  G+YR +L+ P PNL+ Y+G
Sbjct: 521 VRTHLKANIPADHPLYTAWLSPERVTLPGKCFMRMRLSGMYRHHLHGPFPNLIHYRG 577



>gi|302765969|ref|XP_002966405.1| hypothetical protein SELMODRAFT_407912 [Selaginella moellendorffii]
 gi|300165825|gb|EFJ32432.1| hypothetical protein SELMODRAFT_407912 [Selaginella moellendorffii]
          Length = 602

 Score =  354 bits (909), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 190/466 (40%), Positives = 279/466 (59%), Gaps = 26/466 (5%)

Query: 40  LENDISNQLIAEINSSVQYQEITYKNYKHQLSLNF---SSSVEWEQSLLEGHAFHPMHKA 96
           L   +  Q+  E+ +SV +Q   Y +++ +        + S +WEQ ++EGHA HPMHK+
Sbjct: 141 LSAALVEQITQEMENSVSHQAAAYSHHQGRAPPELEHTTDSTQWEQLIVEGHATHPMHKS 200

Query: 97  RHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNT- 155
           R  + P   I P + D   P I F  VP  K+ +RG +EK +  + ++         ++ 
Sbjct: 201 RFHVPPTLPIDPWNNDLSAPKIHFFAVPRSKLTVRGDFEKLVAPLVQISSTRANVFMDSC 260

Query: 156 --ILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKV 213
             +++PVH +Q+P++   FP A  LP  ++ KA++QAS+RTVV+ EL    +KLP+G+K+
Sbjct: 261 DELVMPVHHVQVPSVLLHFPHARHLP--FTCKARAQASVRTVVVDELPAFNLKLPIGVKI 318

Query: 214 TSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIRE 273
           +SA RT+TPW+TH GPA   + DK+  D +LL+V  E A V S   D D+AK+ +C+IR+
Sbjct: 319 SSATRTITPWTTHIGPAFKPVADKIIEDNDLLEVAHELASVVSNHPDPDVAKNLSCVIRQ 378

Query: 274 DFNELNSD---GERVIICAALVER-----DEFGKSVVEKVWNLDTEQKRIDFFDRFVSIL 325
           D   L +    GERV++ AAL ER     D+F   VV  +++LD+ +K+  FF  +  + 
Sbjct: 379 DPQHLATTRARGERVVLSAALTERYPSRSDDF---VVNTLFHLDSLEKKELFFQNYARLF 435

Query: 326 FKAFLPPVFVNGFSFEAHLQNVLARFDSKS----GELVGFVVRDFGGIKHHQDTLFESIG 381
            +AFLPP+  +G SFEAHLQNVLARF   +     ELVGF VRD GGIK HQ TLFE+ G
Sbjct: 436 LRAFLPPLLKHGVSFEAHLQNVLARFRPAAVAGEWELVGFTVRDLGGIKAHQQTLFETTG 495

Query: 382 ERVDV--LEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQI 439
             +DV   E     A+   EV+ + +HT+I C++HR ARAL++HYN  GW+ VR     +
Sbjct: 496 LELDVWDAENCSQLAETIDEVHNLAFHTIIQCHLHRLARALSVHYNAKGWEFVRAEVDAM 555

Query: 440 VPRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYK 485
           +P        +L     N+K  + MK  GLYRDYLYI  PNL+ Y+
Sbjct: 556 LPPGCHARSLWLGA-TVNWKAFITMKLQGLYRDYLYIKVPNLITYR 600



>gi|302792787|ref|XP_002978159.1| hypothetical protein SELMODRAFT_417847 [Selaginella moellendorffii]
 gi|300154180|gb|EFJ20816.1| hypothetical protein SELMODRAFT_417847 [Selaginella moellendorffii]
          Length = 602

 Score =  352 bits (904), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 189/466 (40%), Positives = 280/466 (60%), Gaps = 26/466 (5%)

Query: 40  LENDISNQLIAEINSSVQYQEITYKNYKHQLSLNF---SSSVEWEQSLLEGHAFHPMHKA 96
           L   +  Q+  E+ +SV +Q   Y +++ +        + S++WEQ ++EGHA HPMHK+
Sbjct: 141 LSAALLEQITQEMENSVSHQAAAYSHHQGRAPPELEHTTDSMQWEQLIVEGHATHPMHKS 200

Query: 97  RHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNT- 155
           R  + P   I P + D   P I F  VP  K+ +RG +EK +  + ++         ++ 
Sbjct: 201 RFHVPPTLPIDPWNNDLSAPKIHFFAVPRSKLTVRGDFEKLVAPLVQISSARANVFMDSC 260

Query: 156 --ILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKV 213
             +++PVH +Q+P++   FP A  LP  ++ KA++QAS+RTVV+ EL    +KLP+G+K+
Sbjct: 261 DELVMPVHHVQVPSVLLHFPHARHLP--FTCKARAQASVRTVVVDELPAFNLKLPIGVKI 318

Query: 214 TSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIRE 273
           +SA RT+TPW+TH GPA   + DK+  D++LL+V  E A V S   D D+AK+ +C+IR+
Sbjct: 319 SSATRTITPWTTHIGPAFKPVADKIIEDKDLLEVAHELASVVSNHPDPDVAKNLSCVIRQ 378

Query: 274 DFNELNSD---GERVIICAALVER-----DEFGKSVVEKVWNLDTEQKRIDFFDRFVSIL 325
           D   L +     ERV++ AAL ER     D+F   VV  +++LD+ +K+  FF  +  + 
Sbjct: 379 DPQHLATTRARSERVVLSAALTERYPSRSDDF---VVNTLFHLDSLEKKELFFQNYARLF 435

Query: 326 FKAFLPPVFVNGFSFEAHLQNVLARFDSKS----GELVGFVVRDFGGIKHHQDTLFESIG 381
            +AFLPP+  +G SFEAHLQNVLARF   +     ELVGF VRD GGIK HQ TLFE+ G
Sbjct: 436 LRAFLPPLLKHGVSFEAHLQNVLARFRPAAVAGEWELVGFTVRDLGGIKAHQQTLFETTG 495

Query: 382 ERVDV--LEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQI 439
             +DV   E     A+   EV+ + +HT+I C++HR ARAL++HYN  GW+ VR     +
Sbjct: 496 LELDVWDAENCSQLAETIDEVHNLAFHTIIQCHLHRLARALSVHYNAKGWEFVRAEVDAM 555

Query: 440 VPRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYK 485
           +P        +L     N+K  + MK  GLYRDYLYI  PNL+ Y+
Sbjct: 556 LPPGCHARSLWLGA-TVNWKAFITMKLQGLYRDYLYIKVPNLITYR 600



>gi|409078231|gb|EKM78594.1| hypothetical protein AGABI1DRAFT_121041 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 631

 Score =  352 bits (903), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/465 (38%), Positives = 285/465 (61%), Gaps = 20/465 (4%)

Query: 38  MNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKAR 97
           + L+   ++ +  E  S+V++   +++N     + + S S++WE+S++EGH  HPMHK R
Sbjct: 164 LKLDAATADDIGEEFASAVRWSSYSFENPPPAPTFD-SPSIDWEESIVEGHPTHPMHKTR 222

Query: 98  HAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTIL 157
             +SP+ +  PG+YD  NP +RF+ VP   + I  ++E   E    LL        N ++
Sbjct: 223 RFLSPLPDFAPGAYDLYNPKLRFVAVPKGDLKITYNFE---ELTRPLLDAAAQRAGNPLI 279

Query: 158 IP-------VHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPEL-NDIAIKLPL 209
           IP       +HELQ+ +++ KF    + PE++++  ++Q S+R+V+IP + +++++KL +
Sbjct: 280 IPDGYAVVPIHELQVAHVQEKFSDVQVYPEEFNLDVRAQQSIRSVIIPNVYHELSLKLGV 339

Query: 210 GIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHST 268
           GIK+TSA+RT++P S + GP   S ++  LE+D  ++ V KE A V     + +I KH  
Sbjct: 340 GIKLTSAVRTISPESAYLGPRFSSQVVPFLELDPEIVTVAKELASVVHAHPNGEIGKHCA 399

Query: 269 CIIREDF-NELNSDGERVIICAALVERDEFGKS----VVEKVWNLDTEQKRIDFFDRFVS 323
            I+RE + N     GER+I+C +LVE    G+      V +V+NLDTE KR ++ D+FV+
Sbjct: 400 AIVRECYENTSEERGERLIVCTSLVESGHSGEGGDVPPVIRVFNLDTEDKRAEWLDKFVA 459

Query: 324 ILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGER 383
           I F+AF+P V  NG +FE H QN LARFD K+ EL GF++RDFGG++ H  TL+ES G  
Sbjct: 460 IFFRAFIPSVLKNGVAFECHPQNCLARFDLKTKELKGFIIRDFGGLRIHPPTLYESTGVE 519

Query: 384 VDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRD 443
           +D L      A D  +VY  +YHT+   ++ +  R L LHYNG GWDIVRK+ +  +P+ 
Sbjct: 520 LDFLSGHSIIADDLEDVYTRMYHTVFHNHLQQLIRVLGLHYNGRGWDIVRKNLRDAIPQS 579

Query: 444 HLLYKTFL--EQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKG 486
           H L+ T++  E+  F  KC M M+  G+YR +L+ P PNL+ Y G
Sbjct: 580 HPLWATWMSPERKTFPGKCFMRMRMSGMYRFHLHGPFPNLIHYTG 624



>gi|426199223|gb|EKV49148.1| hypothetical protein AGABI2DRAFT_183956 [Agaricus bisporus var.
           bisporus H97]
          Length = 631

 Score =  351 bits (901), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 180/465 (38%), Positives = 285/465 (61%), Gaps = 20/465 (4%)

Query: 38  MNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKAR 97
           + L+   ++ +  E  S+V++   +++N     + + S S++WE+S++EGH  HPMHK R
Sbjct: 164 LKLDAATADDIGEEFASAVRWSSYSFENPPPAPTFD-SPSIDWEESIVEGHPTHPMHKTR 222

Query: 98  HAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTIL 157
             +SP+ +  PG+YD  NP +RF+ VP   + I  ++E   E    LL        N ++
Sbjct: 223 RFLSPLPDFAPGAYDLYNPKLRFVAVPKGDLKITYNFE---ELTRPLLDAAAQRAGNPLI 279

Query: 158 IP-------VHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPEL-NDIAIKLPL 209
           IP       +HELQ+ +++ KF    + PE++++  ++Q S+R+V+IP + +++++KL +
Sbjct: 280 IPDGYAVVPIHELQVAHVQEKFSDVQVYPEEFNLDVRAQQSIRSVIIPNVYHELSLKLGV 339

Query: 210 GIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHST 268
           GIK+TSA+RT++P S + GP   S ++  LE+D  ++ V KE A V     + +I KH  
Sbjct: 340 GIKLTSAVRTISPESAYLGPRFSSQVVPFLELDPEIVTVAKELASVVHAHPNGEIGKHCA 399

Query: 269 CIIREDF-NELNSDGERVIICAALVERDEFGKS----VVEKVWNLDTEQKRIDFFDRFVS 323
            I+RE + N     GER+I+C +LVE    G+      V +V+NLDTE KR ++ D+FV+
Sbjct: 400 AIVRECYENTSEERGERLIVCTSLVESGHSGEGGDVPPVIRVFNLDTEDKRAEWLDKFVA 459

Query: 324 ILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGER 383
           I F+AF+P V  NG +FE H QN LARFD K+ E+ GF++RDFGG++ H  TL+ES G  
Sbjct: 460 IFFRAFIPSVLKNGVAFECHPQNCLARFDLKTKEIKGFIIRDFGGLRIHPPTLYESTGVE 519

Query: 384 VDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRD 443
           +D L      A D  +VY  +YHT+   ++ +  R L LHYNG GWDIVRK+ +  +P+ 
Sbjct: 520 LDFLSGHSIIADDLEDVYTRMYHTVFHNHLQQLIRVLGLHYNGRGWDIVRKNLRDAIPQS 579

Query: 444 HLLYKTFL--EQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKG 486
           H L+ T++  E+  F  KC M M+  G+YR +L+ P PNL+ Y G
Sbjct: 580 HPLWATWMSPERKTFPGKCFMRMRMSGMYRFHLHGPFPNLIHYTG 624



>gi|170099413|ref|XP_001880925.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644450|gb|EDR08700.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 621

 Score =  351 bits (900), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/473 (38%), Positives = 291/473 (61%), Gaps = 16/473 (3%)

Query: 28  VELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEG 87
           + L   F   +NL+  +   + +E++S+V++Q  +Y+ +     L  S+S++WEQS++EG
Sbjct: 148 ISLWNTFATGINLDQGLLVDIASELSSAVKWQTHSYQ-HPPIAPLFTSASIDWEQSIVEG 206

Query: 88  HAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEK----TIEKITK 143
           H  HPMHK R  + P+ + LPGSYD  +P +R I VP + + +  ++E      ++ +TK
Sbjct: 207 HPTHPMHKTRRFLPPLPDFLPGSYDLYHPKLRLISVPRENLKVTYNFEALSQPILDAVTK 266

Query: 144 LLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVIPEL-ND 202
                       +++PVHELQ+ +IE+KFP A I P ++S+   +Q SLR+V++P+   D
Sbjct: 267 SSGQHFSAPDGHVVVPVHELQLLHIEAKFPDAIIYPAQFSLPLLAQQSLRSVLVPDAYRD 326

Query: 203 IAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYSIEKDF 261
           + +KL +GIK+TSA+RT++P S + GP   + ++  L +D N++ V KE A V     D 
Sbjct: 327 LHLKLGVGIKLTSAVRTISPESAYLGPRFSAKVVPVLALDPNVVTVAKELASVVHGHADG 386

Query: 262 DIAKHSTCIIREDFNELNSD-GERVIICAALVERDEFG-----KSVVEKVWNLDTEQKRI 315
           +IAKH + IIRE     + +  ER+I+C ALVE    G      SV+ +V+ LD + KR 
Sbjct: 387 EIAKHCSAIIRESPESTSEERQERLIVCTALVESGHAGIDGHLPSVI-RVFGLDNDDKRA 445

Query: 316 DFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDT 375
            +F++FV + F+AFLPP+  NG +FE H QN +ARFD  + EL GF++RDFGG++ H++T
Sbjct: 446 FWFEKFVQVFFQAFLPPMLQNGVAFECHPQNCVARFDIHTKELKGFIIRDFGGLRVHRET 505

Query: 376 LFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKH 435
           L  + G  +D L+     A D  +VY  +YHT+   ++ +  R L LHYNG GW IVR  
Sbjct: 506 LLATTGVELDFLDGHSIIAADLDDVYTRMYHTVFHNHLQQLIRVLGLHYNGRGWKIVRDQ 565

Query: 436 FKQIVPRDHLLYKTFLEQDKFNY--KCLMEMKCDGLYRDYLYIPKPNLMMYKG 486
             + +P+DH L+K +L  D+ +   KC + M+  G+YR +L+ P PNL+ Y+G
Sbjct: 566 LGRSIPQDHPLHKAWLCPDRTSLPGKCFLRMRMAGMYRFHLHAPFPNLIHYQG 618



>gi|389750164|gb|EIM91335.1| hypothetical protein STEHIDRAFT_91415 [Stereum hirsutum FP-91666
           SS1]
          Length = 654

 Score =  323 bits (829), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 184/508 (36%), Positives = 282/508 (55%), Gaps = 40/508 (7%)

Query: 22  IEEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWE 81
           I     + L   F   ++LE  ++  +  E+ S+V +Q  +Y +      L+ + S++WE
Sbjct: 146 IASTDPIPLWYQFATGISLEPQLTADIAEELKSAVAWQTYSYSHPPKAPGLD-NPSIDWE 204

Query: 82  QSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYE---KTI 138
           QS++EGH  HPMHK RH + PI  I PGSYD  NP IR + +P   + I G +    K I
Sbjct: 205 QSIVEGHPTHPMHKTRHFLPPIPPITPGSYDLYNPSIRLVILPKTSLKITGPFSDLTKAI 264

Query: 139 -EKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVI 197
            E+  K          + ++IPVHELQ+ +I  KFP A IL +++S+ A++Q S+R+V++
Sbjct: 265 REEAEKRAGGPIVSHDDEVVIPVHELQVWHIREKFPEARILEKEFSVPARAQQSIRSVIL 324

Query: 198 P-ELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVY 255
           P  L + ++KL +GIK+TSA+RT++P S   GP   S ++  L  DR++L V KE A V 
Sbjct: 325 PGTLKETSLKLGVGIKLTSAVRTISPASAFLGPRFSSAVVPHLTFDRSILTVAKELASVV 384

Query: 256 SIEKDFDIAKHSTCIIREDFNELNSDG----------ERVIICAALVERD----EFGKSV 301
            +  D ++AKH   I+RE +  L+ D           ER I+C +LVE      E G   
Sbjct: 385 HVNDDGEVAKHCAAIVRECWENLSEDTGTNEGKSVGRERHIVCTSLVESGHADVENGVPT 444

Query: 302 VEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLAR--FDSKSGELV 359
           + +V+ LDTE++R+ + D FV + + AFLPP+  NG +FEAH QN + R   D    +L+
Sbjct: 445 IVRVFGLDTEERRLRWLDDFVQLFYAAFLPPMLHNGVAFEAHPQNTVLRVSLDGPEPKLL 504

Query: 360 GFVVRDFGGIKHHQDTLFESIGERVDV-LEESFTE-----AKDFPEVYKILYHTLILCNV 413
           GF++RDFGG++ H  TL  S   ++D  ++E  T      A    +VY  +YHT++  + 
Sbjct: 505 GFIIRDFGGLRIHPPTLLSSTHLKIDTPIDEIITPGHSILADTLDDVYTRMYHTVVHNHF 564

Query: 414 HRFARALNLHYNGIGWDIVRKHFKQIVP-----------RDHLLYKTFLEQDKFNYKCLM 462
            +  R L LHYNG GW+IVR+  ++ +            R+        E+     KC M
Sbjct: 565 QQLVRVLGLHYNGKGWEIVRERLREALSAEKYNGKAEGLREAWFGGEGKERWAVPGKCFM 624

Query: 463 EMKCDGLYRDYLYIPKPNLMMYKGERIE 490
            M+  G+YR +L+ P PNL+ YKG   E
Sbjct: 625 RMRMVGMYRHHLHEPFPNLLYYKGSEQE 652



>gi|170099411|ref|XP_001880924.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644449|gb|EDR08699.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 650

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 182/493 (36%), Positives = 266/493 (53%), Gaps = 55/493 (11%)

Query: 38  MNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHP----- 92
           + +E  +   +  E+ SSV++Q + Y+N     SL  S S++WEQSLL GH  HP     
Sbjct: 158 IAVEESLRQSIEKELQSSVEWQVLAYQNPPICPSLQ-SPSIQWEQSLLAGHPTHPVCCLL 216

Query: 93  ------------MHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYE----K 136
                       MH+AR     +    P  +D+ +PLIRF+ VP   +++ G  E     
Sbjct: 217 VEHLRGPDSFQKMHRAR-----MVNNGPPDFDWYHPLIRFVRVPRSSVLLNGYMEDISLS 271

Query: 137 TIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVV 196
             +K              ++ +PVHELQ+ NI +KFP   +L +   I   +Q+S+RTV+
Sbjct: 272 LAQKAADYSGRCLPPTNASVFLPVHELQVDNILAKFPDVEVL-QDICIPGLAQSSIRTVI 330

Query: 197 IPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVY 255
           +  L  +A+KL +G+K++SALRT++ ++   GP   S I+ KL ++R++L V  E A   
Sbjct: 331 VRHLPGMALKLSVGVKISSALRTISHFTADFGPRFSSQIVPKLSMNRDILSVELEPASAI 390

Query: 256 SIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEFG----KSVVEKVWNLDTE 311
               D DIAKH T +IRE++    + GE VI+CAAL+E D  G     S V+ V NL TE
Sbjct: 391 YHTPDPDIAKHLTVVIREEYQP--AVGEVVIVCAALLETDHSGIPASMSAVQHVLNLRTE 448

Query: 312 QKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKH 371
           Q    F DR++ I  +A LP +  NG +FEAH QN+LARFD K+GEL+GFV+RD GG++ 
Sbjct: 449 QSCAKFLDRYIRIACEALLPALLYNGVAFEAHAQNLLARFDKKTGELLGFVIRDLGGLRI 508

Query: 372 HQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDI 431
           H  TL  S G     L       +   E+Y   YHT +  ++ R  R L LHY+G+GW I
Sbjct: 509 HPPTLRMSTGVDFQFLPGHCIATETLDEIYPKFYHTFVHNHIQRLIRVLGLHYSGMGWQI 568

Query: 432 VRKHFKQIVPRDHLLYKTFLEQD-KF-NYKCLMEMKCDGLYRD----------------- 472
           +R+H + ++P  H L K +L  D KF + KCL+ M+    YRD                 
Sbjct: 569 LREHMESVIPDHHRLRKLWLHSDSKFVSSKCLLRMRIRDSYRDVRNLHSLLSTDFSNVST 628

Query: 473 -YLYIPKPNLMMY 484
             +Y P PNL+ Y
Sbjct: 629 QMVYSPYPNLIQY 641



>gi|409078230|gb|EKM78593.1| hypothetical protein AGABI1DRAFT_59499 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 624

 Score =  297 bits (760), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 171/479 (35%), Positives = 266/479 (55%), Gaps = 19/479 (3%)

Query: 22  IEEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWE 81
           IE    V + R F   + ++  +S  +  E+ SS ++Q++ ++      SL+ S+ +++E
Sbjct: 145 IEITDPVYIWRKFVDGIIIQESLSENIEKELLSSYEWQKLAFEGPPALPSLS-SAPIKFE 203

Query: 82  QSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKI 141
           QSL+ GH  HPMH+AR   S   E     YD+  P IRF+ VP   + I G ++     +
Sbjct: 204 QSLVAGHPTHPMHRARTFDSATLE-----YDWYQPRIRFVGVPRSSIQILGDFDNLSRNL 258

Query: 142 TKLLXXXXXXX----KNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVI 197
            +L             + I +PVHE+QI NI+ +F    +LP +  + A  Q+S+RTV++
Sbjct: 259 AELAASRAGQALPNDDSLIFMPVHEMQIGNIKKRFNDVEVLPSEVFLPALGQSSIRTVIL 318

Query: 198 PELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYS 256
           P+L    +KL +G+K++S+LRT++ ++   GP   S II KL +DR +L +  E      
Sbjct: 319 PDLPGKTLKLAVGVKISSSLRTISHFTADFGPRFSSEIIPKLAVDREILHIETETESAIY 378

Query: 257 IEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE----FGKSVVEKVWNLDTEQ 312
            ++D D AKH T ++R  +     +GE VI+ AAL+E        G S VE ++ L T++
Sbjct: 379 RDQDPDKAKHFTVVVRNAYEP--KEGETVIVVAALLEMGHGNVPAGVSAVEHLFGLHTQE 436

Query: 313 KRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHH 372
           KRI F DR++ +  +A LP +  NG +FEAH QNV+ARFD+ +G L+GF+ RD GG++  
Sbjct: 437 KRIAFLDRYIEVACRALLPALLQNGVAFEAHAQNVVARFDTATGRLLGFIYRDLGGLRID 496

Query: 373 QDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIV 432
              L ES G   + L      +    E     YHT +  ++ R  R L LH NGIGW+I+
Sbjct: 497 FKKLRESTGVDFEFLPGHCVLSDSIQEASTKFYHTFVHNHIQRLIRLLKLHSNGIGWEIL 556

Query: 433 RKHFKQIVPRDHLLYKTFL--EQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGERI 489
           RKH   ++PRDH L+  ++  E+ K   KCLM M+    YRD +Y P  N++ Y    I
Sbjct: 557 RKHMNAVIPRDHKLWDLWMNPERKKVESKCLMRMRMRDSYRDTVYSPYVNMVQYHPRAI 615



>gi|426199222|gb|EKV49147.1| hypothetical protein AGABI2DRAFT_218206 [Agaricus bisporus var.
           bisporus H97]
          Length = 624

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 171/479 (35%), Positives = 265/479 (55%), Gaps = 19/479 (3%)

Query: 22  IEEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWE 81
           IE    V + R F   + ++  +S  +  E+ SS ++Q++ ++      SL+ S+ +++E
Sbjct: 145 IEITDPVYIWRKFVDGIIIQESLSENIEKELLSSYEWQKLAFEGPPALPSLS-SAPIKFE 203

Query: 82  QSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKI 141
           QSL+ GH  HPMH+AR   S   E     YD+  P IRF+ VP   + I G ++     +
Sbjct: 204 QSLVAGHPTHPMHRARTFDSATLE-----YDWYQPRIRFVGVPRSSIQILGDFDNLSRNL 258

Query: 142 TKLLXXXXXXX----KNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVI 197
            +L             + I +PVHE+QI NI+  F    +LP +  + A  Q+S+RTV++
Sbjct: 259 AELAACRAGQALPNDDSLIFMPVHEMQIGNIKKLFNDVEVLPSEVFLPALGQSSIRTVIL 318

Query: 198 PELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCKEFAGVYS 256
           P+L    +KL +G+K++S+LRT++ ++   GP   S II KL +DR +L +  E      
Sbjct: 319 PDLPGKTLKLAVGVKISSSLRTISHFTADFGPRFSSEIIPKLAVDREILHIETETESAIY 378

Query: 257 IEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE----FGKSVVEKVWNLDTEQ 312
            ++D D AKH T ++R  +     +GE VI+ AAL+E        G S VE ++ L T++
Sbjct: 379 RDQDPDKAKHFTVVVRNAYEP--KEGETVIVVAALLEMGHGNVPAGVSAVEHLFGLHTQE 436

Query: 313 KRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHH 372
           KRI F DR++ +  +A LP +  NG +FEAH QNV+ARFD+ +G L+GF+ RD GG++  
Sbjct: 437 KRIAFLDRYIEVACRALLPALLQNGVAFEAHAQNVVARFDTATGRLLGFIYRDLGGLRID 496

Query: 373 QDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIV 432
              L ES G   + L      +    E     YHT +  ++ R  R L LH NGIGW+I+
Sbjct: 497 FKKLRESTGVDFEFLPGHCVLSDSIQEASTKFYHTFVHNHIQRLIRLLKLHSNGIGWEIL 556

Query: 433 RKHFKQIVPRDHLLYKTFL--EQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGERI 489
           RKH   ++PRDH L+  ++  E+ K   KCLM M+    YRD +Y P  N++ Y    I
Sbjct: 557 RKHMNAVIPRDHKLWDLWMNPERKKVESKCLMRMRMRDSYRDTVYSPYVNMVQYHPRAI 615



>gi|389750165|gb|EIM91336.1| hypothetical protein STEHIDRAFT_91418 [Stereum hirsutum FP-91666
           SS1]
          Length = 693

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 181/505 (35%), Positives = 269/505 (53%), Gaps = 43/505 (8%)

Query: 23  EEISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQ 82
           E +  V L   F   + ++  +   L  E ++S+ YQ++ Y     +L    S  +EWEQ
Sbjct: 186 ETLDPVHLWNKFAKIVGIDESLRTGLGEEFHNSLTYQKVVYDRLP-RLPSALSPPIEWEQ 244

Query: 83  SLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTI---- 138
           SL+EGH  HP H+AR  I P+    P ++D+  P++RF+ +P  ++ I G++E  I    
Sbjct: 245 SLIEGHPTHPSHRARRTIPPLPPTSPTTHDWYRPVVRFVLIPRQQLDIYGAFEDEISALV 304

Query: 139 ----EKITKLLXXXXXXXKNTILIPVHELQIPNIESKFP--FANILPEKYSIKAKSQASL 192
               E+  K         +  +L+P++ LQ+PNI  KF      IL + +S  A  QASL
Sbjct: 305 SSIAEQCGKQHIVSTANDEGKVLMPIYGLQLPNILEKFGDEGVEILDDDFSTPALGQASL 364

Query: 193 RTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFA 252
           RTV +P+   I +KL +GI V+SALRT++ ++ + GP L ++I  L ID+ +L V +E A
Sbjct: 365 RTVALPDYPSILLKLSVGITVSSALRTISHFTANIGPRLSNLIPMLGIDKEILYVEQEVA 424

Query: 253 GVYSI------EKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERD----EFGKSVV 302
               +      E   D+ KH T ++R  +      GE VI+ AALVE      + G SVV
Sbjct: 425 SAVCMRTKEGQEMPHDVVKHLTAVVRRPYE--TKPGEAVILTAALVEHGHEGAQPGVSVV 482

Query: 303 EKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSK-------- 354
           E ++ LDT+ KR+ FF+ +  +L  A LPP+  NG +FEAH QN L R   +        
Sbjct: 483 EHLFGLDTDLKRVTFFEDYTRLLMAAMLPPMLHNGLAFEAHPQNTLVRIAVRPPSEECPN 542

Query: 355 -SGELVGFVVRDFGGIKHHQDTLFESIGERV------DVLEESFTEAKDFPEVYKILYHT 407
            S  ++GFV+RD GGI+ H  TL  S+          + L E         E  K LYHT
Sbjct: 543 PSARVLGFVIRDLGGIRVHPPTLNASLASSSPSSPPFEFLPEHCIVTSTVQEAAKKLYHT 602

Query: 408 LILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRDHLLYKTFLEQ-----DKFNYKCLM 462
           LI   + R  R L LHY+G GW+IVR+  ++ V RD  L+K ++E      +    KCL+
Sbjct: 603 LIHNQLQRLIRVLGLHYDGRGWEIVRREVERNVGRDTWLWKVWMEGEGGRIESVQGKCLL 662

Query: 463 EMKCDGLYRDYLYIPKPNLMMYKGE 487
            MK  GLYRD +Y   PNL+ ++ E
Sbjct: 663 RMKMQGLYRDSVYEDFPNLIQFRPE 687



>gi|317145515|ref|XP_001820859.2| hypothetical protein AOR_1_500144 [Aspergillus oryzae RIB40]
          Length = 866

 Score =  221 bits (563), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 142/474 (29%), Positives = 243/474 (51%), Gaps = 26/474 (5%)

Query: 33  IFGVWMNLENDISN-----QLIAEINSSVQYQEITYKNYKHQLSLNFS-SSVEWEQSLLE 86
           IF V   L  D+++      ++ E+ +S   QE   +  + Q       +S +WE++L+ 
Sbjct: 386 IFAVLSALLKDVADGTVLEAIVRELRNSATNQEKWLEISQDQPVFGLGDTSAKWERALIN 445

Query: 87  GHAFHPMHKARHAISPIQEILPGSYDFM-NPLIRFIEVPLDKMVIRGSYEKTIEKITKLL 145
           GH  HP H+  +A  P++ + PG    M  P + F+ VP D + I G +E+ ++ + K L
Sbjct: 446 GHPSHPYHRLCYAQEPLKPVGPGDIPGMLTPTLAFVSVPCDNLRITGHFERELQPLLKRL 505

Query: 146 XXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVI-PELN-DI 203
                   + +++P    Q+P+I  +FP   IL +  +  A +QAS+RT+ I PEL    
Sbjct: 506 DIPQTT-SDRVIVPCLAQQLPSILQRFPDVVIL-KLAADCADAQASMRTITIRPELGFKY 563

Query: 204 AIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDI 263
            +KL L   +T ALRT+TPW+   GP    +++K   D   L V +E A V   +KDF+ 
Sbjct: 564 HLKLSLACHITGALRTITPWTACGGPVQTELLEKFLPDD--LWVFREVAAVSGSQKDFNE 621

Query: 264 AKHSTCIIREDFNELNSDGERVIICAALVERDEFG--KSVVEKVWNLDTEQKRIDFFDRF 321
           A+H  CI+R+         + V+I A  + +  +G  ++  E ++NL+T  ++ ++F R+
Sbjct: 622 ARHLACILRDTLESRAQANDEVLIMAMALTQKPYGDSRTYAEILYNLETVVQKKEWFQRY 681

Query: 322 VSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIG 381
           +++LF   LPP+   G   E H QN++ R   ++G++ GF VRDFGG++ H  TL  + G
Sbjct: 682 ITVLFSLVLPPLVQYGIGLEGHGQNLVVRVCRQTGQIKGFAVRDFGGVRMHVPTL-NNHG 740

Query: 382 ERVDVLEESFTEAKD-FPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIV 440
            + D L        D    V+  ++H+L+  +V     AL L  +G GW I  +    ++
Sbjct: 741 VKFDSLPPGGATLTDNLDNVWSKVHHSLLQNHVGFLLVALGLENHG-GWAITLETLSTVL 799

Query: 441 ------PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGER 488
                 P   LL   +  +D   +KC + M+ +  YRDY+    PN+++    R
Sbjct: 800 GGGQDSPGAKLL--EYFTKDTMPFKCFLRMRMESKYRDYIEREVPNVILMNSPR 851



>gi|255937085|ref|XP_002559569.1| Pc13g11520 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584189|emb|CAP92221.1| Pc13g11520 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 563

 Score =  216 bits (551), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 150/482 (31%), Positives = 246/482 (51%), Gaps = 26/482 (5%)

Query: 17  DSNDSIEEISAVELMRIFGVWM--NLENDISNQLIAEINSSVQYQE----ITYKNYKHQL 70
           ++ +S+EE     + R  G W+   +       LI E+ +SV  QE    I  K+    L
Sbjct: 91  ENTESVEEWDPGNIFRFIGDWLPGGITQHAQETLIEELQNSVANQEKWLEIARKSPTPSL 150

Query: 71  SLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSY-DFMNPLIRFIEVPLDKMV 129
              F   + WE+S+  GH  HP+H+   +  P+  + P    D   PLI F+ +P  K+ 
Sbjct: 151 DSPF---IAWERSIYFGHPTHPLHRTCLSQPPVILVHPDDLLDMTAPLICFVTLPRSKLR 207

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQ 189
           + G ++K I+ +   L       + T+  P    Q+P++   FP A +  +   ++A++Q
Sbjct: 208 VSGPFDKAIQPLLDKLGIPRSAERCTV--PCFVRQLPSVLLHFPDA-VQVKSVQLRAQAQ 264

Query: 190 ASLRTVVI-PELN-DIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDK-LEIDRNLLK 246
           AS+RTV + PEL     +KL L  ++TS+LRT+TPW+T  GP L +I+   L  D   L 
Sbjct: 265 ASMRTVSLEPELGFPYHLKLSLACQITSSLRTITPWTTALGPVLTNILKSVLPPD---LW 321

Query: 247 VCKEFAGVYSIEKDFDIAKHSTCIIREDFNE-LNSDGERVIICAALVERD-EFGKSVVEK 304
           +  E AGV   + +FD A+H +CI+R D  +    +GE +++ AAL ER  +  ++  E 
Sbjct: 322 IFDEVAGVSGGQDNFDEARHLSCILRHDLQDRARENGEALVVAAALFERPIDDHRTYAEI 381

Query: 305 VWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVR 364
           ++ L + ++   +F R++SILF+  L P+   G   EAH QNV+ R  S++  + GF  R
Sbjct: 382 LFGLRSLEEIRTWFRRYISILFQLILSPLVHYGIGLEAHGQNVVVRVCSRTKNIKGFAFR 441

Query: 365 DFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHY 424
           DFGG + H+ TL     +   +     T   D   V+  ++H+L+  +V     AL L  
Sbjct: 442 DFGGTRLHKPTLQTMHYDLSSIPSNGATITHDLKAVWNKVHHSLLQSHVGHSLHALGLET 501

Query: 425 NGIGWDIVRKHFKQIV---PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNL 481
              GW+IVR+   + +    R   +   FL ++   +KC + MK    YRDYL    PN+
Sbjct: 502 EA-GWEIVREELSKALCSHARGRTIRDYFL-RETMTFKCFIRMKLASKYRDYLERDVPNV 559

Query: 482 MM 483
            +
Sbjct: 560 AL 561



>gi|299749912|ref|XP_001836421.2| hypothetical protein CC1G_07068 [Coprinopsis cinerea okayama7#130]
 gi|298408654|gb|EAU85374.2| hypothetical protein CC1G_07068 [Coprinopsis cinerea okayama7#130]
          Length = 532

 Score =  213 bits (542), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/290 (39%), Positives = 173/290 (59%), Gaps = 11/290 (3%)

Query: 191 SLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS-IIDKLEIDRNLLKVCK 249
           S RTV++PEL   A+KL +G+K++SALRT++ ++   GP   + ++ KL ID  +  +  
Sbjct: 233 SHRTVIVPELPGYALKLSIGVKISSALRTISHFTADFGPRFSTEVVPKLRIDHTIFAIET 292

Query: 250 E-FAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEF----GKSVVEK 304
           E  +G+Y  E D +I KH T +IRE++    +  E VI+ AAL+E D      G   V  
Sbjct: 293 EPSSGIYRCE-DPEIRKHFTAVIREEYKA--APYENVILIAALLETDHANLPPGVPAVTH 349

Query: 305 VWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVR 364
           V+ L+TE+KRI F DR++ +  KA LP +  NG +FEAH QN+L R D ++G++ GFV+R
Sbjct: 350 VFGLNTERKRIQFLDRYIELSCKALLPALVYNGVAFEAHAQNLLLRVDRRTGKITGFVLR 409

Query: 365 DFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHY 424
           D GG++ H  TL  S+G   D L +     +   EVY   YHT +  ++ R  R L LH+
Sbjct: 410 DLGGLRIHPPTLRRSLGIDFDFLPKHAIATESLQEVYPKFYHTYVHNHLQRLIRLLGLHH 469

Query: 425 NGIGWDIVRKHFKQIVPRDHLLYKTFL--EQDKFNYKCLMEMKCDGLYRD 472
           NGIGW+++R+H   ++P DH L   +L  +      KCLM M+    YR+
Sbjct: 470 NGIGWELLREHMNAVIPIDHELRDLWLSPKSHTVESKCLMRMRLQDSYRE 519



>gi|317028923|ref|XP_001390749.2| hypothetical protein ANI_1_524044 [Aspergillus niger CBS 513.88]
          Length = 611

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/480 (28%), Positives = 249/480 (51%), Gaps = 30/480 (6%)

Query: 23  EEISAVELMRIFGVWM--NLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSV-E 79
           EE+    + RI  +W      +     L+ E+ +S   Q    +    Q +L+ +S + E
Sbjct: 138 EELDPGAICRIICLWQPEQFPSAAVETLVKEVQNSADNQAKWLEIASTQPTLHLNSPLYE 197

Query: 80  WEQSLLEGHAFHPMHKARHAISPIQEILPGSY-DFMNPLIRFIEVPLDKMVIRGSYEKTI 138
           WEQS++ GH  HP+H+A  A  P++ I P    + + P + F+ +P  +M   G +   +
Sbjct: 198 WEQSVVLGHPTHPLHRACLAYQPLKPITPDDIPELLEPELSFMSLPQSEMKAFGPFSSLL 257

Query: 139 EKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIK--AKSQASLRTV- 195
           + + + L        + +++P    Q+P+I   FP A +L    S++   ++Q S+RT+ 
Sbjct: 258 KPLLESLGIPSPESSDRVVVPCFTRQLPSILPLFPDARLL---GSVRKCCRAQISMRTIS 314

Query: 196 VIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLK----VCKE 250
            +P++  +  +KL L  ++TS  RT+TPW+    PAL + +      +NLL     + ++
Sbjct: 315 FLPDVGSLLHLKLSLNCQITSGPRTITPWTAALSPALSTAL------KNLLPPDLWIFED 368

Query: 251 FAGVYSIEKDFDIAKHSTCIIREDFNELNSD-GERVIICAALVERD-EFGKSVVEKVWNL 308
            A +   + DFD A+H TCIIR+   +   + GE +I  A L ++  +  ++ +E ++ L
Sbjct: 369 AAAITGGQDDFDKARHLTCIIRKSPEKQAEELGETIIPVAGLFQKPYKDDRTYMEIMFGL 428

Query: 309 DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGG 368
           D  +++  +  ++++ LF   LPP+  +G   E+H QNVL R ++ S E+ GFVVRDFGG
Sbjct: 429 DDSKQKQAWLRKYLAKLFSLLLPPLVRHGIGLESHAQNVLVRVNTTSKEITGFVVRDFGG 488

Query: 369 IKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIG 428
           +K H  T   +  +   +   +     D  +V+  +YH LI  +V      L+L  +G G
Sbjct: 489 MKIHSPTFSRTRIDLSSIPPGASAFVDDIHKVWHKVYHALIQMHVGHLLYMLDLESHG-G 547

Query: 429 WDIVRKHFKQIV-----PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMM 483
           W IVR+  ++++     P    +++ F  +    +KC MEM+   +YRDY     PN+++
Sbjct: 548 WPIVREELERVLDPLGDPDGRAVHEAFTNK-TMAFKCFMEMRLRNIYRDYYERELPNILL 606



>gi|134075200|emb|CAK96513.1| unnamed protein product [Aspergillus niger]
          Length = 605

 Score =  211 bits (536), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 138/480 (28%), Positives = 249/480 (51%), Gaps = 36/480 (7%)

Query: 23  EEISAVELMRIFGVWM--NLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSV-E 79
           EE+    + RI  +W      +     L+ E+ +S   Q  T      Q +L+ +S + E
Sbjct: 138 EELDPGAICRIICLWQPEQFPSAAVETLVKEVQNSADNQAST------QPTLHLNSPLYE 191

Query: 80  WEQSLLEGHAFHPMHKARHAISPIQEILPGSY-DFMNPLIRFIEVPLDKMVIRGSYEKTI 138
           WEQS++ GH  HP+H+A  A  P++ I P    + + P + F+ +P  +M   G +   +
Sbjct: 192 WEQSVVLGHPTHPLHRACLAYQPLKPITPDDIPELLEPELSFMSLPQSEMKAFGPFSSLL 251

Query: 139 EKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIK--AKSQASLRTV- 195
           + + + L        + +++P    Q+P+I   FP A +L    S++   ++Q S+RT+ 
Sbjct: 252 KPLLESLGIPSPESSDRVVVPCFTRQLPSILPLFPDARLL---GSVRKCCRAQISMRTIS 308

Query: 196 VIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLK----VCKE 250
            +P++  +  +KL L  ++TS  RT+TPW+    PAL + +      +NLL     + ++
Sbjct: 309 FLPDVGSLLHLKLSLNCQITSGPRTITPWTAALSPALSTAL------KNLLPPDLWIFED 362

Query: 251 FAGVYSIEKDFDIAKHSTCIIREDFNELNSD-GERVIICAALVERD-EFGKSVVEKVWNL 308
            A +   + DFD A+H TCIIR+   +   + GE +I  A L ++  +  ++ +E ++ L
Sbjct: 363 AAAITGGQDDFDKARHLTCIIRKSPEKQAEELGETIIPVAGLFQKPYKDDRTYMEIMFGL 422

Query: 309 DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGG 368
           D  +++  +  ++++ LF   LPP+  +G   E+H QNVL R ++ S E+ GFVVRDFGG
Sbjct: 423 DDSKQKQAWLRKYLAKLFSLLLPPLVRHGIGLESHAQNVLVRVNTTSKEITGFVVRDFGG 482

Query: 369 IKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIG 428
           +K H  T   +  +   +   +     D  +V+  +YH LI  +V      L+L  +G G
Sbjct: 483 MKIHSPTFSRTRIDLSSIPPGASAFVDDIHKVWHKVYHALIQMHVGHLLYMLDLESHG-G 541

Query: 429 WDIVRKHFKQIV-----PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMM 483
           W IVR+  ++++     P    +++ F  +    +KC MEM+   +YRDY     PN+++
Sbjct: 542 WPIVREELERVLDPLGDPDGRAVHEAFTNK-TMAFKCFMEMRLRNIYRDYYERELPNILL 600



>gi|452984231|gb|EME83988.1| hypothetical protein MYCFIDRAFT_162844 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 459

 Score =  205 bits (521), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 142/458 (31%), Positives = 224/458 (48%), Gaps = 50/458 (10%)

Query: 41  ENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSS-VEWEQSLLEGHAFHPMHKARHA 99
           + D  +Q+++++ ++ Q Q   ++    Q     +SS ++WEQ+L+ GH  HPMH++   
Sbjct: 39  DEDSWDQILSQVKNAAQNQVAWFRWAMKQPRPQITSSALDWEQALVTGHPAHPMHRS--- 95

Query: 100 ISPIQEILPGSYD-FMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILI 158
            S ++  L G +   + PL+   ++P                             N I+ 
Sbjct: 96  -SAVR--LSGPFRRLLEPLLANFDLP-------------------------AVGSNDIIF 127

Query: 159 PVHELQIPNIESKFPFANIL-PEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTS 215
           P    Q P I   FP A +L P+  +I+A++QAS+RTV IP        +K  L   +TS
Sbjct: 128 PCLSRQWPAIRDNFPSAYMLVPD--AIEAEAQASIRTVTIPSRYQFHWHLKTALACTITS 185

Query: 216 ALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDF 275
           ALRTVTPW+   GP L  ++  L  D   L +  E A +   + +FD AKH +CI+RED 
Sbjct: 186 ALRTVTPWTACVGPELSDVLKDLVPDD--LWIASEVASITGSQANFDEAKHISCILREDL 243

Query: 276 N-ELNSDGERVIICAALVERDEFGKSVVEKV--WNLDTEQKRIDFFDRFVSILFKAFLPP 332
                S  + +IICAAL E   +G S       ++L   + +I +   + S+L ++ L P
Sbjct: 244 EPRAESLNQSLIICAALAE-CPYGSSECNAALAFDLHDAETKIAWLAEYTSVLVESILSP 302

Query: 333 VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFT 392
              +G   EAH QN+L R D  S ++VGF VRD GGIK H  TL     + +  L  SF 
Sbjct: 303 ALDSGICLEAHGQNMLVRVDKTSKKIVGFAVRDVGGIKCHMPTLRSRGYDLLSALPGSFV 362

Query: 393 EAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRD-----HLLY 447
              D  E + I+ HTLI  ++H   R L +   G  W ++R   +    R         +
Sbjct: 363 VCDDEEEAWSIVQHTLINNHLHHLIRRLRVP-QGQAWQMIRDQIEGFFSRRPKSDVAQRF 421

Query: 448 KTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYK 485
           +  L + + + K  + MK  GLYRDY++   PN+++ +
Sbjct: 422 RESLFRPEVHSKAFLRMKMQGLYRDYVHTTVPNVLLTR 459



>gi|358372468|dbj|GAA89071.1| hypothetical protein AKAW_07185 [Aspergillus kawachii IFO 4308]
          Length = 612

 Score =  201 bits (510), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 137/494 (27%), Positives = 247/494 (50%), Gaps = 39/494 (7%)

Query: 23  EEISAVELMRIFGVWM--NLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSV-E 79
           EE+    +  I  +W   +  N     L+ E+ +S   Q    +   +Q +L+  S + +
Sbjct: 110 EELDPGAICHIICLWQREHFANAAVETLVKEVRNSTDNQAKWLEIASNQPTLHLKSPLCD 169

Query: 80  WEQSLLEGHAFHP-------------------MHKARHAISPIQEILPGSY-DFMNPLIR 119
           WEQS++ GH  HP                   +H+A  A  P++ I P    + + P + 
Sbjct: 170 WEQSVVLGHPTHPVSFPETILDPDCRSVNAVKLHRACLAQPPLKPITPDEIPELLEPELS 229

Query: 120 FIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILP 179
           F+ +P  +M   G Y   ++ I + L        + +++P    Q+P+I   FP A  + 
Sbjct: 230 FLSLPRSEMKTFGPYTSLLKPILEQLGISSPESPDRVVVPCFTRQLPSILPLFPDARHIG 289

Query: 180 EKYSIKAKSQASLRTV-VIPELND-IAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDK 237
                  ++Q S+RT+  +P++   + +KL L  ++TS  RT+TPW+    PAL + +  
Sbjct: 290 AVRRC-CRAQISMRTISFLPDVGSPLHLKLSLNCQITSGPRTITPWTAALSPALSTALRT 348

Query: 238 LEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSD--GERVIICAALVERD 295
           L + ++L  + ++ A +   + DFD A+H TCIIR+   E+ ++  GE +I  A L ++ 
Sbjct: 349 L-LPQDLW-IFEDAASITGGQDDFDKARHLTCIIRKS-PEMQAEELGETIIPVAGLFQKP 405

Query: 296 -EFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSK 354
            +  ++ +E ++ LD  QK+  +  ++++ LF   LPP+   G   EAH QN+  R ++ 
Sbjct: 406 YKDNRTYMEIMFGLDDPQKKQTWLRKYLAKLFSLLLPPLVRYGIGLEAHAQNICVRINTT 465

Query: 355 SGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVH 414
           S E+ GF VRDFGG + H+ T F +  E   +   +    +D  +V+  +YH LI  +V 
Sbjct: 466 SKEVTGFAVRDFGGARIHRPTFFRTRIELGTIPPGASAFVEDMHKVWHKVYHALIQMHVG 525

Query: 415 RFARALNLHYNGIGWDIVRKHFKQIV-----PRDHLLYKTFLEQDKFNYKCLMEMKCDGL 469
                L L  +G GW IVR+  ++++     P    +++ F+ +    +KC MEM+   +
Sbjct: 526 HLLYMLGLESHG-GWPIVREELERVLVSSCDPDAKAVHEAFMNK-TMAFKCFMEMRLRNI 583

Query: 470 YRDYLYIPKPNLMM 483
           YRDY     PN+++
Sbjct: 584 YRDYYERELPNVLL 597



>gi|238490692|ref|XP_002376583.1| conserved hypothetical protein [Aspergillus flavus NRRL3357]
 gi|220696996|gb|EED53337.1| conserved hypothetical protein [Aspergillus flavus NRRL3357]
          Length = 537

 Score =  193 bits (490), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 207/399 (51%), Gaps = 20/399 (5%)

Query: 102 PIQEILPGSYDFM-NPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPV 160
           P++ + PG    M  P + F+ VP D + I G +E+ ++ + K L        + +++P 
Sbjct: 132 PLKPVGPGDIPGMLTPTLAFVSVPCDNLRITGHFERELQPLLKRLDIPQTT-SDRVIVPC 190

Query: 161 HELQIPNIESKFPFANILPEKYSIKAKSQASLRTVVI-PELN-DIAIKLPLGIKVTSALR 218
              Q+P+I  +FP   IL +  +  A +QAS+RT+ I PEL     +KL L   +T ALR
Sbjct: 191 LAQQLPSILQRFPDVVIL-KLAADCADAQASMRTITIRPELGFKYHLKLSLACHITGALR 249

Query: 219 TVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNEL 278
           T+TPW+   GP    +++K   D   L V +E A V   +KDF+ A+H  CI+R+     
Sbjct: 250 TITPWTACGGPVQTELLEKFLPDD--LWVFREVAAVSGSQKDFNEARHLACILRDTLESR 307

Query: 279 NSDGERVIICAALVERDEFG--KSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVN 336
               + V+I A  + +  +G  ++  E ++NL+T  ++ ++F R++++LF   LPP+   
Sbjct: 308 AQANDEVLIMAMALTQKPYGDSRTYAEILYNLETVVQKKEWFQRYITVLFSLVLPPLVQY 367

Query: 337 GFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKD 396
           G   E H QN++ R   ++G++ GF VRDFGG++ H  TL  + G + D L        D
Sbjct: 368 GIGLEGHGQNLVVRVCRQTGQIKGFAVRDFGGVRMHVPTL-NNHGVKFDSLPPGGATLTD 426

Query: 397 -FPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIV------PRDHLLYKT 449
               V+  ++H+L+  +V     AL L  +G GW I  +    ++      P   LL   
Sbjct: 427 NLDNVWSKVHHSLLQNHVGFLLVALGLESHG-GWAITLETLSTVLGGGQDSPGAKLL--E 483

Query: 450 FLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGER 488
           +  +D   +KC + M+ +  YRDY+    PN+++    R
Sbjct: 484 YFTKDTMPFKCFLRMRMESKYRDYIEREVPNVILMDSPR 522



>gi|471870129|emb|CCO36989.1| hypothetical protein BN14_11139 [Rhizoctonia solani AG-1 IB]
          Length = 605

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 135/471 (28%), Positives = 229/471 (48%), Gaps = 30/471 (6%)

Query: 29  ELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNF----SSSVEWEQSL 84
           E+  + G W+  + ++  +L  E+ +S   QE   K  +  LS       +S +EWEQ  
Sbjct: 125 EVFDVVGPWICNDEEVLVKLRDELQNSADNQE---KWLEFALSCPLPVLGASLIEWEQRC 181

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIR----FIEVPLDKMVIRGSYEKTIEK 140
             GH  HPMH++  A  P + I     D +  L+      I VP  ++ + G +E +++ 
Sbjct: 182 FRGHPTHPMHRSFFASPPSEPI---QIDVIEKLLEAEVIIISVPRTRIHLDGPFEASMKP 238

Query: 141 ITKLLXXXXXXXKNTILIPVHELQIPNIESKFPF-ANILPEKYSIKAKSQASLRTVVIPE 199
           +   +        + +L+P    Q+P + + F   A  +  K  +  + Q S+RTV IP+
Sbjct: 239 LLDKIGIVPAP-ADRVLLPCFAEQLPAVHAYFGTDAEKVLSKTKLHGQRQVSMRTVSIPD 297

Query: 200 LNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEK 259
              + +K+ L   +TSA RT+TPW+      +  ++  +    +LL + ++ A   S + 
Sbjct: 298 FQ-LHVKMALSYTITSATRTMTPWTARMCIEVSQLLQDITSGSDLLWIARKMATACSADP 356

Query: 260 DFDIAKHSTCIIREDFNELNSD-GERVIICAALVE-RDEFGKSVVEKVWNLDTEQKRIDF 317
           DF+ AKH + ++RED      + G+ +++ A L E   E   + V +V++L T   R ++
Sbjct: 357 DFEKAKHLSVMLREDLEPKARELGQCLVLPATLFEIGGEDRVAYVLRVFDLFTIDARKNW 416

Query: 318 FDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTL- 376
           F  +     +  LPP+  +G   EAH+QN+LARFD KSG L GF+ RD GG++ H  T+ 
Sbjct: 417 FLNYTRTYLQTVLPPLLSHGICLEAHMQNMLARFDVKSGALRGFIYRDMGGLRMHVPTMA 476

Query: 377 FESIG-ERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKH 435
              +  E   ++        D   V+   YH  ++ ++    RA+ L + G GWDIVRK 
Sbjct: 477 LRGVTIESASLVPGGVILTDDLEAVWVNAYHNFVVNHLGGALRAMGLSWVG-GWDIVRKE 535

Query: 436 FKQIV-----PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRD--YLYIPKP 479
               +     P+   L + F+ Q K   K  + MK  G+YR   Y Y+  P
Sbjct: 536 LTDALTLSADPKSGELLQ-FMLQPKMKRKAFLRMKLAGVYRGRVYCYLQNP 585



>gi|115437856|ref|XP_001217917.1| predicted protein [Aspergillus terreus NIH2624]
 gi|114188732|gb|EAU30432.1| predicted protein [Aspergillus terreus NIH2624]
          Length = 554

 Score =  181 bits (459), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 141/445 (31%), Positives = 226/445 (50%), Gaps = 21/445 (4%)

Query: 55  SVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQ-EILPGSYDF 113
           S  ++++  +    ++S N  SS E  Q  +    FH    A+  + P++ E +P     
Sbjct: 109 SPWFKDLASQPVLEEISRNLQSSGE-NQGPISPKLFHRTCDAKPPLQPVKPEDIPA---M 164

Query: 114 MNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFP 173
           + P I F+ +    + + G +   ++ + +           TI +P    Q+P+I  +FP
Sbjct: 165 LTPGITFLSLAHSDLSVAGPFNHLLQPLLQTFEVPEAPEGWTI-VPCLTQQLPSIMQRFP 223

Query: 174 FANILPEKYSIKAKSQASLRTVVI-PELN-DIAIKLPLGIKVTSALRTVTPWSTHSGPAL 231
            A +L    +  A +QASLRT+ + PEL     +KL L  ++TSALRT+TPWS   GP +
Sbjct: 224 RAIML-LSVADCADAQASLRTLTLRPELKFPFHLKLSLACQITSALRTITPWSAQGGPIV 282

Query: 232 GSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAAL 291
             I+D        L   KE A V   + DFD AKH +CI+R+D  E       V++ AA 
Sbjct: 283 TEILDGFLPSE--LWTFKEVASVTGSQTDFDDAKHLSCILRDDLEERARANNEVLVLAAA 340

Query: 292 VERDEFGKS--VVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLA 349
           + +   G S    E ++NL T  ++ ++F  +V  L    LPP+  +G   EAH QN+LA
Sbjct: 341 LTQSPPGTSQPYAEILFNLRTISEKQEWFREYVGCLLNLLLPPLVHHGIGLEAHGQNILA 400

Query: 350 RFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFT-EAKDFPEVYKILYHTL 408
           R    +GE+ GF VRDFGGI+ H  TL +  G   D +   +    ++  +V+  ++H+L
Sbjct: 401 RVCHDTGEIKGFAVRDFGGIRLHTPTLRDQ-GVSFDGMFPGWAVMTENMNDVWGKVHHSL 459

Query: 409 ILCNVHRFARALNLHYNGIGWDIVRKHFK---QIVPRDHLLYKTFLEQDKFNYKCLMEMK 465
           +  +V     AL+L  +  GW IVR   +   + +P D+ LY+ F  +D    KC + M 
Sbjct: 460 LQNHVGFLLNALDLQRHH-GWSIVRDVLEGGLRGLP-DNGLYE-FCLKDTMPLKCFLRMS 516

Query: 466 CDGLYRDYLYIPKPNLMMYKGERIE 490
            +G YRDY+    PN+++   ER E
Sbjct: 517 MEGKYRDYVEREVPNILLMGSERWE 541



>gi|317038657|ref|XP_001401921.2| hypothetical protein ANI_1_1914184 [Aspergillus niger CBS 513.88]
          Length = 526

 Score =  174 bits (442), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 131/461 (28%), Positives = 235/461 (50%), Gaps = 25/461 (5%)

Query: 41  ENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSV-EWEQSLLEGHAFHPMHKARHA 99
           E+D    L+ E+ +S   QE   +       L+  SS+ +WEQS++ GH  HP+H+   A
Sbjct: 70  ESDAVEILVKEVRNSANNQEKWLEMASTLPILHLKSSLCDWEQSVVLGHPTHPLHRTCLA 129

Query: 100 ISPIQEILPGSYDFM-NPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXK-NTIL 157
             P+  I P    ++  P + F+ VP   M + G ++  ++ + + L         N I+
Sbjct: 130 QPPLVPIAPDDIPYLLEPELSFLCVPKSDMKVFGPFQSLLDPLLRSLGIPKPDDTVNEIV 189

Query: 158 IPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTV-VIPELND--IAIKLPLGIKVT 214
           +P    Q+P I   FP A IL      + ++Q S+RTV + P++    + IKL L  ++T
Sbjct: 190 VPCFSRQLPCITPLFPNARIL-GTVQNRCRAQLSMRTVSMTPDVGSSPLHIKLSLNCQIT 248

Query: 215 SALRTVTPWSTHSGPALGSII-DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIRE 273
           S LRT++P +     A+G+I+ D L  D   L + +E A +   ++DF  A   TCIIR+
Sbjct: 249 SRLRTISPNAAALATAVGNILRDLLPPD---LWIFEEAASITGAQEDFQKACQLTCIIRK 305

Query: 274 DFNELNSD-GERVIICAALVER--DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFL 330
                 +D GE +I  A L+++  +++ ++ +E ++ L + +++  +F +++  LF   L
Sbjct: 306 SPELRAADIGETLIPVAGLMQKPLNDY-RTYMEIMFGLHSLKEKQTWFRKYLIKLFSLIL 364

Query: 331 PPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLF---ESIGERVDVL 387
           PP+  +G   EAH QNVL R +  + E+ GF +RDF GI+ H  T     ++     D+ 
Sbjct: 365 PPLVRHGIRIEAHSQNVLVRVNITNKEIAGFAIRDFDGIRIHYPTFLRHPDNENALNDIP 424

Query: 388 EESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIV-----PR 442
             + T   D   ++  ++H+L+  +V      L L   G GW +VR+  ++ +     P 
Sbjct: 425 PGARTLTDDLHRMWHAVHHSLLQAHVGHLLYMLGLESKG-GWRVVREELERALNPSRDPD 483

Query: 443 DHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMM 483
             LLY  +L++   + +C +EM+    Y  +     PN+++
Sbjct: 484 GRLLYDFWLKETMLS-RCFLEMRLRDAYAKFYERELPNILL 523



>gi|119489900|ref|XP_001262910.1| hypothetical protein NFIA_061740 [Neosartorya fischeri NRRL 181]
 gi|119411070|gb|EAW21013.1| hypothetical protein NFIA_061740 [Neosartorya fischeri NRRL 181]
          Length = 396

 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 116/401 (28%), Positives = 199/401 (49%), Gaps = 42/401 (10%)

Query: 75  SSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSY 134
           S  ++WEQ+L EG + HP+H+ R+ I            F    + ++ +    +  +G Y
Sbjct: 3   SPPIDWEQALQEGRSLHPLHRCRYPIV---------SSFRTAKLYWVAIDSSIVHTQGEY 53

Query: 135 EKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRT 194
            + I+K    L       ++++L PVHELQ+  + S+FP A +LP      A+ Q SLRT
Sbjct: 54  MQWIKK----LAPDANIGQSSVLFPVHELQLAKVISEFPDARVLPGTID-NARPQISLRT 108

Query: 195 VVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGV 254
           + +P   ++ + L L  KV + +RT++ WS   G  L  ++  +E          EF G 
Sbjct: 109 LTLPNTTEVCVTLYL--KVQNLVRTMSEWSIMMGQQLRQVLPVIE------AASAEFGGS 160

Query: 255 YSIEKDFDIA----KHSTCIIREDF-NELNSDGERVIICAALVERDEFGKSVVEKVWNLD 309
             + +++  A    +H  CIIRE   ++    G+R+I+CA L E        V+ +W   
Sbjct: 161 LMMAREYAAAASPSQHLGCIIRESSESQAARTGDRIIVCATLSEN-------VDVIWGDR 213

Query: 310 TEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGI 369
            ++K I     + S   +A LPP+F  G     H QN L R D  S E+ GFV+RD G +
Sbjct: 214 PDKKAI--LREYASKFLRAVLPPLFKYGLGLAVHRQNALLRLDPLSKEIKGFVIRDLGFM 271

Query: 370 KHHQDTLFESIGERVDVLEES-FTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIG 428
           + H+ T  +     ++  + S +TE  +  EVY+ +++  I+ ++  F RA  LH    G
Sbjct: 272 RVHRPTFRKGTCFDIETPKTSIYTETLE--EVYQYMFNPAIIGHLSSFVRA--LHPGLAG 327

Query: 429 WDIVRKHFKQIVP-RDHLLYKTFLEQDKFNYKCLMEMKCDG 468
           W ++R+  ++I+P  D +    +L+  +F  K  + M+  G
Sbjct: 328 WKVIREELERIIPDNDSIARSVWLQSPEFPTKANITMEVHG 368



>gi|322712385|gb|EFZ03958.1| hypothetical protein MAA_01032 [Metarhizium anisopliae ARSEF 23]
          Length = 1040

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 194/398 (48%), Gaps = 31/398 (7%)

Query: 75  SSSVEWEQSLLEGHAFHPMHK---ARHAISPI-QEILPGSYDFMNPLIRFIEVPLDKMVI 130
           SS ++WE+S++ GH  HP H+   A   + P+  E LPG    +NP I F+ VP   +  
Sbjct: 165 SSFLDWERSVVTGHPTHPFHRTCIANRLLQPVGPENLPG---MLNPDISFVTVPRTSVRT 221

Query: 131 RGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQA 190
            G +++ IE + K         +    +P     +P +   FP A ++ +     A +QA
Sbjct: 222 AGPFDELIESMVKHFGISVASPQGNTTVPCLTQHLPALLHYFPEAELI-KTVPNCAVAQA 280

Query: 191 SLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKE 250
           ++RTV IP      +K  L   VTSALR +  WS  + P L  ++   EI    L +  E
Sbjct: 281 AMRTVSIPGFA-YDVKFSLACLVTSALRVLPCWSADAAPKLTCLLK--EISPPNLWIVGE 337

Query: 251 FAGVYSIEKDFDIAKHSTCIIREDF-NELNSDGERVIICAALVERDEFG-KSVVEKVWNL 308
            A V   ++D   A++ TCI+RE+  +    + E +I+ +AL+E+   G ++  E +++L
Sbjct: 338 VAAVTGNQQDMAEARYMTCILRENLESRAKENNEALILSSALMEKPMGGSRTYAEVLFDL 397

Query: 309 DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGG 368
            T   ++ +F  +V  L    L P+  +   FE H QN + R   ++  + GF +RD  G
Sbjct: 398 HTTADKVRWFKSYVQHLLTLALDPLVRHQVGFEFHGQNSIVRICKRTRAIKGFAIRDLAG 457

Query: 369 IKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIG 428
           +K H  +L E+ G  V  LE S T+  D  +V+  ++H LI  N+     AL L  +  G
Sbjct: 458 VKLHGASL-EAQGFDVTGLEASSTD--DSHQVWDRVHHALIQNNIGYMMYALELERDHDG 514

Query: 429 WDIVR---------------KHFKQIVPRDHLLYKTFL 451
           W IVR               +   Q   RD +L+K+F+
Sbjct: 515 WGIVRSALADSLDVENNALGRQIYQYFLRDTMLFKSFI 552



>gi|116191247|ref|XP_001221436.1| hypothetical protein CHGG_05341 [Chaetomium globosum CBS 148.51]
 gi|88181254|gb|EAQ88722.1| hypothetical protein CHGG_05341 [Chaetomium globosum CBS 148.51]
          Length = 403

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 163/300 (54%), Gaps = 14/300 (4%)

Query: 189 QASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVC 248
           QAS+RT+ IP+     +K+ L   +TSA RT+TPW+T     +  ++  +  D  LL + 
Sbjct: 69  QASMRTISIPDF-PFHVKMALSFTITSARRTMTPWTTRMCIEVSRLLQDIA-DPELLWIA 126

Query: 249 KEFAGVYSIEKDFDIAKHSTCIIREDFNELNSD-GERVIICAALVE-RDEFGKSVVEKVW 306
            + A   S  +DF+ AKH + ++RED      + G+ +++ AAL E R E   + V +++
Sbjct: 127 LKRAAACSANRDFEAAKHLSVMLREDPEPRARELGQCLVLPAALFELRSEDRVAPVVELF 186

Query: 307 NLD-TEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRD 365
           NL+ T + R ++F  +  +  +A LPP+   G   EAHLQNVLARFD ++G L GFV RD
Sbjct: 187 NLEPTLEARKNWFRNYARLYLQAVLPPLLSYGICLEAHLQNVLARFDVETGALRGFVYRD 246

Query: 366 FGGIKHHQDTL-FESIG-ERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLH 423
            GG++ H  T+    IG +  D++  + T   D   V+   YH L++ ++    R + L 
Sbjct: 247 MGGLRMHLPTMKARGIGIKSADLVPGAVTLTDDLEAVWINAYHNLVVNHMGGALRGMGLQ 306

Query: 424 YNGIGWDIVRKHFKQIV-----PRDHLL-YKTFLEQDKFNYKCLMEMKCDGLYRDYLYIP 477
           ++G GWDI+++  KQ +     P +       F+ +     K  + M+  G+YRD L  P
Sbjct: 307 WDG-GWDILKEELKQALEASPDPDNKTAELLEFMVRPTMKRKAFLRMQIAGIYRDSLRPP 365



>gi|398412270|ref|XP_003857461.1| hypothetical protein MYCGRDRAFT_23189, partial [Zymoseptoria
           tritici IPO323]
 gi|339477346|gb|EGP92437.1| hypothetical protein MYCGRDRAFT_23189 [Zymoseptoria tritici IPO323]
          Length = 335

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/330 (31%), Positives = 158/330 (47%), Gaps = 11/330 (3%)

Query: 112 DFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESK 171
             + P I FI V      I G +   ++ +            N +++P    Q+P I+  
Sbjct: 11  SLLQPSITFIAVDRGSTRITGPFRTLLKPLLDQFSLPRLL-PNEVVLPCLSQQLPAIQRH 69

Query: 172 FPFANILPEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGP 229
           FP   +L    +  A +QASLRTV IP     A  +K  L   ++S LRT+TPW+T  GP
Sbjct: 70  FPSTRVLLHD-AFTAHAQASLRTVNIPSEMRFAYNMKFALSCTISSVLRTITPWTTCLGP 128

Query: 230 ALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELN-SDGERVIIC 288
            + ++I+    +     VCKE A +   +KDF  AK+ +CI+RED      + G+ +I+ 
Sbjct: 129 EISAVIEDAVTENTW--VCKEVAAITGSQKDFSAAKNLSCILREDLEPRALALGQTLIVV 186

Query: 289 AALVERDEFGKS--VVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQN 346
           AAL E+   G S  +    + L +  ++  +   + S L  A L P   +G   EAH QN
Sbjct: 187 AALAEK-PVGSSECLAALTFGLRSSGQKKKWLRDYASKLIHAVLTPALESGVCLEAHGQN 245

Query: 347 VLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYH 406
            L R D ++  +VGF  RDFG +K H  TL     + + VL   + E     E +  L H
Sbjct: 246 SLVRVDKRTKAIVGFCFRDFGSVKCHTPTLRNRGHQLLTVLPACWIETDVEEEGWDTLQH 305

Query: 407 TLILCNVHRFARALNLHYNGIGWDIVRKHF 436
           T+I  ++    R LNLH     W ++R+  
Sbjct: 306 TMIHNHLQLLIRGLNLHPIE-AWPVIRRQL 334



>gi|350637317|gb|EHA25674.1| hypothetical protein ASPNIDRAFT_140614 [Aspergillus niger ATCC
           1015]
          Length = 367

 Score =  155 bits (392), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/411 (27%), Positives = 201/411 (48%), Gaps = 70/411 (17%)

Query: 69  QLSLNFSSSV-EWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDK 127
           Q +L+ +S + EWEQS++ GH  HP                       PL+  + +P   
Sbjct: 11  QPTLHLNSPLYEWEQSVVLGHPTHP-----------------------PLLESLGIP--- 44

Query: 128 MVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAK 187
                S E +                + +++P    Q+P+I   FP A +L        +
Sbjct: 45  -----SPESS----------------DRVVVPCFTRQLPSILPLFPDARLLGSVRKC-CR 82

Query: 188 SQASLRTV-VIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLL 245
           +Q S+RT+  +P++  +  +KL L  ++TS  RT+TPW+    PAL + +      +NLL
Sbjct: 83  AQISMRTISFLPDVGSLLHLKLSLNCQITSGPRTITPWTAALSPALSTAL------KNLL 136

Query: 246 K----VCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSD-GERVIICAALVERD-EFGK 299
                + ++ A +   + DFD A+H TCIIR+   +   + GE +I  A L ++  +  +
Sbjct: 137 PPDLWIFEDAAAITGGQDDFDKARHLTCIIRKSPEKQAEELGETIIPVAGLFQKPYKDDR 196

Query: 300 SVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELV 359
           + +E ++ LD  +++  +  ++++ LF   LPP+  +G   E+H QNVL R ++ S E+ 
Sbjct: 197 TYMEIMFGLDDSKQKQAWLRKYLAKLFSLLLPPLVRHGIGLESHAQNVLVRVNTTSKEIT 256

Query: 360 GFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARA 419
           GFVVRDFGG+K H  T   +  +   +   +     D  +V+  +YH LI  +V      
Sbjct: 257 GFVVRDFGGMKIHSPTFSRTRIDLSSIPPGASAFVDDIHKVWHKVYHALIQMHVGHLLYM 316

Query: 420 LNLHYNGIGWDIVRKHFKQIV-----PRDHLLYKTFLEQDKFNYKCLMEMK 465
           L+L  +G GW IVR+  ++++     P    +++ F  +    +KC MEM+
Sbjct: 317 LDLESHG-GWPIVREELERVLDPLGDPDGRAVHEAFTNK-TMAFKCFMEMR 365



>gi|134074525|emb|CAK38819.1| unnamed protein product [Aspergillus niger]
          Length = 581

 Score =  146 bits (369), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 207/408 (50%), Gaps = 24/408 (5%)

Query: 93  MHKARHAISPIQEILPGSYDFM-NPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXX 151
           +H+   A  P+  I P    ++  P + F+ VP   M + G ++  ++ + + L      
Sbjct: 178 LHRTCLAQPPLVPIAPDDIPYLLEPELSFLCVPKSDMKVFGPFQSLLDPLLRSLGIPKPD 237

Query: 152 XK-NTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRTV-VIPELND--IAIKL 207
              N I++P    Q+P I   FP A IL      + ++Q S+RTV + P++    + IKL
Sbjct: 238 DTVNEIVVPCFSRQLPCITPLFPNARIL-GTVQNRCRAQLSMRTVSMTPDVGSSPLHIKL 296

Query: 208 PLGIKVTSALRTVTPWSTHSGPALGSII-DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKH 266
            L  ++TS LRT++P +     A+G+I+ D L  D   L + +E A +   ++DF  A  
Sbjct: 297 SLNCQITSRLRTISPNAAALATAVGNILRDLLPPD---LWIFEEAASITGAQEDFQKACQ 353

Query: 267 STCIIREDFNELNSD-GERVIICAALVER--DEFGKSVVEKVWNLDTEQKRIDFFDRFVS 323
            TCIIR+      +D GE +I  A L+++  +++ ++ +E ++ L + +++  +F +++ 
Sbjct: 354 LTCIIRKSPELRAADIGETLIPVAGLMQKPLNDY-RTYMEIMFGLHSLKEKQTWFRKYLI 412

Query: 324 ILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLF---ESI 380
            LF   LPP+  +G   EAH QNVL R +  + E+ GF +RDF GI+ H  T     ++ 
Sbjct: 413 KLFSLILPPLVRHGIRIEAHSQNVLVRVNITNKEIAGFAIRDFDGIRIHYPTFLRHPDNE 472

Query: 381 GERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIV 440
               D+   + T   D   ++  ++H+L+  +V      L L   G GW +VR+  ++ +
Sbjct: 473 NALNDIPPGARTLTDDLHRMWHAVHHSLLQAHVGHLLYMLGLESKG-GWRVVREELERAL 531

Query: 441 -----PRDHLLYKTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPNLMM 483
                P   LLY  +L++   + +C +EM+    Y  +     PN+++
Sbjct: 532 NPSRDPDGRLLYDFWLKETMLS-RCFLEMRLRDAYAKFYERELPNILL 578



>gi|350632377|gb|EHA20745.1| hypothetical protein ASPNIDRAFT_193539 [Aspergillus niger ATCC
           1015]
          Length = 475

 Score =  146 bits (369), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 122/446 (27%), Positives = 216/446 (48%), Gaps = 65/446 (14%)

Query: 41  ENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSV-EWEQSLLEGHAFHPMHKARHA 99
           E+D    L+ E+ +S   QE   +       L+  SS+ +WEQS++ GH  HP       
Sbjct: 58  ESDAVEILVKEVRNSANNQEKWLEMASTLPILHLKSSLCDWEQSVVLGHPTHP------- 110

Query: 100 ISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIP 159
                         ++PL+R + +P          + T+               N I++P
Sbjct: 111 ------------SLLDPLLRSLGIP--------KPDDTV---------------NEIVVP 135

Query: 160 VHELQIPNIESKFPFANILPEKYSIKAKSQASLRTV-VIPELND--IAIKLPLGIKVTSA 216
               Q+P I   FP A IL    + + ++Q S+RTV + P++    + IKL L  ++TS 
Sbjct: 136 CFSRQLPCITPLFPNARILGTVQN-RCRAQLSMRTVSMTPDVGSSPLHIKLSLNCQITSR 194

Query: 217 LRTVTPWSTHSGPALGSII-DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDF 275
           LRT++P +     A+G+I+ D L  D   L + +E A +   ++DF  A   TCIIR+  
Sbjct: 195 LRTISPNAAALATAVGNILRDLLPPD---LWIFEEAASITGAQEDFQKACQLTCIIRKSP 251

Query: 276 NELNSD-GERVIICAALVER--DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPP 332
               +D GE +I  A L+++  +++ ++ +E ++ L + +++  +F +++  LF   LPP
Sbjct: 252 ELRAADIGETLIPVAGLMQKPLNDY-RTYMEIMFGLHSLKEKQTWFRKYLIKLFSLILPP 310

Query: 333 VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLF---ESIGERVDVLEE 389
           +  +G   EAH QNVL R +  + E+ GF +RDF GI+ H  T     ++     D+   
Sbjct: 311 LVRHGIRIEAHSQNVLVRVNITNKEIAGFAIRDFDGIRIHYPTFLRHPDNENALNDIPPG 370

Query: 390 SFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIV-----PRDH 444
           + T   D   ++  ++H+L+  +V      L L   G GW +VR+  ++ +     P   
Sbjct: 371 ARTLTDDLHRMWHAVHHSLLQAHVGHLLYMLGLESKG-GWRVVREELERALNPSRDPDGR 429

Query: 445 LLYKTFLEQDKFNYKCLMEMKCDGLY 470
           LLY  +L++   + +C +EM+    Y
Sbjct: 430 LLYDFWLKETMLS-RCFLEMRLRDAY 454



>gi|119489898|ref|XP_001262909.1| hypothetical protein NFIA_061730 [Neosartorya fischeri NRRL 181]
 gi|119411069|gb|EAW21012.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 402

 Score =  139 bits (351), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 101/379 (26%), Positives = 191/379 (50%), Gaps = 21/379 (5%)

Query: 100 ISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIP 159
           +SP++++     DF+ P +  + VP +K+ + G +E  +              ++ +++P
Sbjct: 1   MSPLEDM----SDFLVPKLSLVSVPREKLRVNGPFELLLRP-LLQKLNVPTVAEDRVIVP 55

Query: 160 VHELQIPNIESKFPFANILPEKYSI-KAKSQASLRTVVI-PELN-DIAIKLPLGIKVTSA 216
               Q+ +IE  FP A  +P    +  A +Q S+R+VV+ P L     +K+ L  ++TSA
Sbjct: 56  CFTKQLSSIERSFPEA--VPVASIVDGADAQVSMRSVVLRPHLGVTYTLKMSLAYRITSA 113

Query: 217 LRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDF- 275
           +RT+  W       +  ++++L        + +E AGV    +D + A+  +CIIRED  
Sbjct: 114 VRTIASWVIPEVIFMSQLLEELLPPELW--IYREVAGVTGAGEDLEDARQISCIIREDLV 171

Query: 276 NELNSDGERVIICAALVER-DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVF 334
               ++G  +I+ A+L +      K+  E ++ L+T +++I +F  +++ L  A LPP+ 
Sbjct: 172 PRAQANGLALIVAASLYQAPGGTSKTYAEILFGLNTWEEKIAWFRSYIASLCDAVLPPLV 231

Query: 335 VNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLE-ESFTE 393
           + G + EAH QN++ R   +S EL GF VRD+GG++ H+ TL +++G ++ +++ ES   
Sbjct: 232 MYGIALEAHPQNIVLRVCRQSSELRGFAVRDWGGVRLHKSTL-QNLGVQLPMVDTESPVI 290

Query: 394 AKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRDHLLYKT---- 449
             D   ++   +H  +  +V     AL L   G GW IVR    +++             
Sbjct: 291 TDDLDHIWSRFHHAFLQNHVASVLVALGLETEG-GWAIVRGELSRVLSDSRYAVSPSLLK 349

Query: 450 FLEQDKFNYKCLMEMKCDG 468
           +L  D    +C    + +G
Sbjct: 350 YLLADDMQMRCFFTARLEG 368



>gi|46139455|ref|XP_391418.1| hypothetical protein FG11242.1 [Fusarium graminearum PH-1]
          Length = 496

 Score =  138 bits (348), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 105/372 (28%), Positives = 180/372 (48%), Gaps = 57/372 (15%)

Query: 75  SSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSY 134
           SS ++WE+SL+ GH  HP                       PL++ I VP          
Sbjct: 139 SSFIDWERSLIAGHPTHP-----------------------PLLKLIGVP---------- 165

Query: 135 EKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSIKAKSQASLRT 194
                              +  ++P     +P +   FP A ++ +    +A +QAS+RT
Sbjct: 166 -------------PPSTHDDYTVVPCLSRHLPALLHFFPEATLV-KSVDGRALAQASIRT 211

Query: 195 VVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLKVCKEFAGV 254
           V +P   D  +KL L   +TS LR +  +S  + PA+  ++  L I ++L  +C E A V
Sbjct: 212 VSVPSF-DHDLKLSLACLITSGLRVLPCYSAEAAPAMTRLLKGL-IPQDLW-LCGEVAAV 268

Query: 255 YSIEKDFDIAKHSTCIIREDFNELNSD--GERVIICAALVERDEFG-KSVVEKVWNLDTE 311
              + + + A++ TCI+RE+  EL ++   E +I+ AAL+ER   G K+  E ++NL+T 
Sbjct: 269 TGSQPNTEEAQYITCILRENL-ELRAEENNESIILVAALLERPRCGTKTYAEILFNLETT 327

Query: 312 QKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKH 371
           + ++ +   ++  L    L PV  +G +FE H QN + R   ++ E+ GF +RD GG++ 
Sbjct: 328 EDKVVWLKSYLRKLLSVALDPVTRHGVAFEFHAQNAVVRVCRRTKEIKGFAIRDLGGVRM 387

Query: 372 HQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIGWDI 431
           H+ TL ES G  +  ++ES T+  D  +V+   +H LI  ++     +L L     GW +
Sbjct: 388 HRPTL-ESQGFDLKGMDESLTD--DVHQVWDRTHHVLIQNHIGYLIYSLRLEREYGGWQL 444

Query: 432 VRKHFKQIVPRD 443
           V    ++ +  D
Sbjct: 445 VFSELERALEGD 456



>gi|83768722|dbj|BAE58859.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 255

 Score =  109 bits (273), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 114/214 (53%), Gaps = 8/214 (3%)

Query: 113 FMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKF 172
            + P + F+ VP D + I G +E+ ++ + K L        + +++P    Q+P+I  +F
Sbjct: 1   MLTPTLAFVSVPCDNLRITGHFERELQPLLKRLDIPQTT-SDRVIVPCLAQQLPSILQRF 59

Query: 173 PFANILPEKYSIKAKSQASLRTVVI-PELN-DIAIKLPLGIKVTSALRTVTPWSTHSGPA 230
           P   IL       A +QAS+RT+ I PEL     +KL L   +T ALRT+TPW+   GP 
Sbjct: 60  PDVVILKLAADC-ADAQASMRTITIRPELGFKYHLKLSLACHITGALRTITPWTACGGPV 118

Query: 231 LGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAA 290
              +++K   D   L V +E A V   +KDF+ A+H  CI+R+         + V+I A 
Sbjct: 119 QTELLEKFLPDD--LWVFREVAAVSGSQKDFNEARHLACILRDTLESRAQANDEVLIMAM 176

Query: 291 LVERDEFG--KSVVEKVWNLDTEQKRIDFFDRFV 322
            + +  +G  ++  E ++NL+T  ++ ++F R+V
Sbjct: 177 ALTQKPYGDSRTYAEILYNLETVVQKKEWFQRYV 210



>gi|391865960|gb|EIT75239.1| hypothetical protein Ao3042_08871 [Aspergillus oryzae 3.042]
          Length = 248

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 113/214 (52%), Gaps = 15/214 (7%)

Query: 113 FMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKF 172
            + P + F+ VP D + I G +E+ ++ + K L        + +++P    Q+P+I  +F
Sbjct: 1   MLTPTLAFVSVPCDNLRITGHFERELQPLLKRLDIPQTT-SDRVIVPCLAQQLPSILQRF 59

Query: 173 PFANILPEKYSIKAKSQASLRTVVI-PELN-DIAIKLPLGIKVTSALRTVTPWSTHSGPA 230
           P   IL +  +  A +QAS+RT+ I PEL     +KL L   +T ALRT+TPW+   GP 
Sbjct: 60  PDVVIL-KLAADCADAQASMRTITIRPELGFKYHLKLSLACHITGALRTITPWTACGGPK 118

Query: 231 LGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAA 290
              + D L + R       E A V   +KDF+ A+H  CI+R+         + V+I A 
Sbjct: 119 F--LPDDLWVFR-------EVAAVSGSQKDFNEARHLACILRDTLESRAQANDEVLIMAM 169

Query: 291 LVERDEFG--KSVVEKVWNLDTEQKRIDFFDRFV 322
            + +  +G  ++  E ++NL+T  ++ ++F R+V
Sbjct: 170 ALTQKPYGDSRTYAEILYNLETVVQKKEWFQRYV 203



>gi|492905171|ref|WP_006035577.1| putative siderophore biosynthesis protein [Rickettsiella grylli]
 gi|159121265|gb|EDP46603.1| putative siderophore biosynthesis protein [Rickettsiella grylli]
          Length = 627

 Score =  102 bits (254), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 98/394 (24%), Positives = 174/394 (44%), Gaps = 38/394 (9%)

Query: 75  SSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMV----- 129
           ++S+++EQS+  GH +HP  K +   +  ++ +  S +F + +  +I       V     
Sbjct: 178 NNSLQFEQSVFNGHPYHPCAKTKLGFTN-EDTINYSPEFKSKVGIYITAVQKNYVHIESM 236

Query: 130 ---------IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFAN---- 176
                        Y K      + L       KN I  PVH  Q+       P       
Sbjct: 237 KKNTDFTEWFTECYPKAWSCWLEELKENNLDVKNYIPFPVHPWQVNYFTFISPLFKEYIE 296

Query: 177 ----ILPEKYSIKAKSQASLRTVV-IPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPAL 231
               ++ +K  I A    S RT+  +  +N   IKLP+ ++ TS +RT++P ST + P +
Sbjct: 297 NKIIVIFDKSKIMASPTLSFRTLSPLENINAPYIKLPVAVQATSIVRTLSPISTKNMPKI 356

Query: 232 GSIIDKLEIDRNL----LKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVII 287
            +I+ K+ +  N     L +  E  G++  + D D AKH T I RE+     +D E  I+
Sbjct: 357 SNILQKILLIENYFSNRLDLLPESYGLHLKKLDIDEAKHFTAIFRENITNHLADNEVAIV 416

Query: 288 CAALVERDEFGKSV----VEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAH 343
            AAL E+    ++     + ++      ++ + +F  +  ++  ++L    + G + E H
Sbjct: 417 VAALFEKSSKSETSLFIEIMQLAGCLNFREALTYFAHYTDLVLGSYLDLFLLYGIALEGH 476

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKI 403
            QN LA    K G++  F+ RDF GI+ H D+L ++ G  +D   E     K+   V   
Sbjct: 477 QQNTLAIL--KEGKIKRFIARDFDGIEIHADSL-KATGITLDSTTEHSPYLKNKDTVRNQ 533

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVRK 434
           L +T+   ++      L  ++N      W I+RK
Sbjct: 534 LLYTVYQLHLGEIVLLLANYFNCEEKPFWKIIRK 567



>gi|488402581|ref|WP_002471966.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           pettenkoferi]
 gi|365229344|gb|EHM70498.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           pettenkoferi VCU012]
          Length = 524

 Score =  102 bits (254), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 105/434 (24%), Positives = 205/434 (47%), Gaps = 52/434 (11%)

Query: 80  WEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMN-----PLIRFIEVPL----DKMVI 130
           +EQS+ EGH FHPM K +   +P ++++  S +F       P++   E+          I
Sbjct: 97  FEQSVTEGHPFHPMTKTKLGFNP-EQVITFSPEFRQQAQIIPVLCASELVTHIHPTHSTI 155

Query: 131 RGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN-IESKFP----FANILP-EKYSI 184
              Y +  E++   L           ++ +HE Q+ + ++ ++P       ++P  +++I
Sbjct: 156 SPEYTQWSEQLQNELSTQNINISRYEILFLHEWQLEHFVKQQYPELLQQEQLVPLYQHAI 215

Query: 185 KAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL--EIDR 242
            A+   S RT+ +P+ N I +K  + ++ TSA+R V+P S  +G AL   + ++  + D 
Sbjct: 216 SARPLLSFRTLDVPQFNAI-VKTAVNVQATSAVRNVSPASIRNGIALSEAVAQIYTKGDY 274

Query: 243 NLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGE-RVIICAALVERD------ 295
           +   + K+ AG + +  + + A   + +IRE   +     +   ++CA+L+ +       
Sbjct: 275 HRSAIQKDVAGAF-LNINAEHANKVSYLIRERLPKTTQASQTHHLVCASLITKSFITDQH 333

Query: 296 ---EFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFD 352
              E  + ++E+  NL  E     F +++ S+L +A    +   G S EAH+QN  +  +
Sbjct: 334 ILIECIERLMER-QNLSFETATTQFLEQYTSVLLEATYRLLLEEGISLEAHMQN--STIE 390

Query: 353 SKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCN 412
            + G      VRDFGG++     LF+     VD+   +     DF E+  +  H+++  +
Sbjct: 391 IQDGLPTKIYVRDFGGVR-----LFD---RDVDIDGSTGLITDDFDELLAVFSHSVLYNH 442

Query: 413 VHRFARALNLH-YN-GIGWDIVRKHFKQIVPRDHLLYKT---FLEQDKFNYKCLMEMKC- 466
           + +  R L  + Y   IG+ I+R+  ++   R    Y+     L+Q  F  K L++M+  
Sbjct: 443 LFQLIRVLEQYGYEPSIGYYIIREQLRKYNDR----YQPQIDLLQQPTFRIKSLLKMRIY 498

Query: 467 -DGLYRDYLYIPKP 479
            DG    + Y+  P
Sbjct: 499 EDGYDYQHTYVNNP 512



>gi|297528778|ref|YP_003670053.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
 gi|502909253|ref|WP_013144229.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
 gi|297252030|gb|ADI25476.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
          Length = 668

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 122/503 (24%), Positives = 222/503 (44%), Gaps = 78/503 (15%)

Query: 40  LENDISNQLIAEINSSVQYQEI--------TYKNYKHQLSLNFSSSVEWEQSLLEGHAFH 91
           LEN  SN  +A  +   + Q +        TY   + Q   +F  ++ +EQ  +EGH  H
Sbjct: 176 LENGTSNLALAYWHFEKECQTMRKEADNLFTYIE-QRQSDPSFCPALFFEQLCIEGHHLH 234

Query: 92  PMHKARHAISPIQEILPGSYDFMN-PLIRFIEVP------------------LDKM-VIR 131
           P  K +  +SP +++   S +F   P +R + V                   LD    +R
Sbjct: 235 PGAKTKLPMSP-KDVFAYSAEFGGQPQLRIVAVRRNLCDFHFDGYEDPNTFLLDHFPSLR 293

Query: 132 GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPNI-ESKFPFANI-LPEKYSIK 185
           G   +  ++  K L       ++ +L+PVH  Q    IPN+  ++     + L E   I 
Sbjct: 294 GPVAECFQQTKKKL-------EDYVLVPVHPWQYEHVIPNVYRAELRDGRLWLIEGAVIP 346

Query: 186 AKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDK-LEIDRNL 244
            ++ AS RTV+  E   + IK  +  ++TS +R+++P S ++G     ++   LE +R+L
Sbjct: 347 TQATASFRTVLAKE-APLYIKTAVHSQMTSTVRSISPQSANNGATYSRLLRAILERERDL 405

Query: 245 ----LKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEF-GK 299
               L VC E  G     +D + A++ + I RE  +    +GE  I   AL     F G+
Sbjct: 406 SAIFLPVC-EIGGCSFRSEDPNKARNLSVIYREGLDRFVDEGEIAIAGTALYASSPFSGQ 464

Query: 300 SVV--------EKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARF 351
            ++        + +    +++  + F   +V I  + FL  +   G   E HLQN +  F
Sbjct: 465 PIINDIIEAYAKGIGRPSSQETALSFLREYVGIAVRGFLTLLVKYGIGLEGHLQNTVPVF 524

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
             + G+ +  + RD+GGI+ ++  L E  G  +DV  +S T   D  E    +++T+   
Sbjct: 525 --RQGKPMKLLFRDWGGIRLYRPRL-ERQGFNIDVRPDSITITDDLREAQNKVFYTVFQN 581

Query: 412 NVHRFARALNLHYNGIG----WDIVRKHFKQI---VPRDHLLYKTFLEQDK-------FN 457
            +    R ++  + GI     W  VR+   ++   + +D  L K  +++D+         
Sbjct: 582 QLGEIIRHISRQW-GIAEEQCWICVRRQCDEVFAKLAKDPNL-KRAVDEDRQALYRPHIE 639

Query: 458 YKCLMEMKCDGLYRDYLYIPKPN 480
           +K L +M+     + Y ++  PN
Sbjct: 640 HKALAKMRLQPEAKTYCFVSVPN 662



>gi|494026733|ref|WP_006968920.1| hypothetical protein [Plesiocystis pacifica]
 gi|149822356|gb|EDM81745.1| hypothetical protein PPSIR1_04743 [Plesiocystis pacifica SIR-1]
          Length = 602

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 104/388 (26%), Positives = 163/388 (42%), Gaps = 54/388 (13%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEK 140
           E  + +GH +HPM + R  +     +           I  +EV   ++   G+++    +
Sbjct: 179 EHLVTDGHPWHPMTRTRVGLGAAANLRHAPELLGRAWISTVEVAASEVQRAGTWDALAVR 238

Query: 141 ITKLLXXXXXXXKNTILIPVHELQ---IPNIESKF------------PFANILPEKYSIK 185
                          + IPVH  Q   +P +  +             PF        ++ 
Sbjct: 239 C-----FGAPRDPGWVRIPVHPTQRRLLPRLFPELVARGALRTADGRPFRAPPDPSQALA 293

Query: 186 AKSQASLRTVVIPELNDIAI----KLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID 241
            +S  SLRTV    L D A+    KL   I  TSA R V+  S  +GP + +++++++  
Sbjct: 294 VRSLLSLRTVT---LEDRALPFHLKLATNIHTTSAKRVVSAMSVTNGPRVSALLERIQAQ 350

Query: 242 ---RNLLKVCKEFAGVYSIEKDFDIAKHS-----TCIIREDFNELNSDGERVIICAALVE 293
                 L++  E A         D A+HS       I+R   +   SDG +  +CAA+ E
Sbjct: 351 DPKTQSLEIMVEPAAA-----GLDPARHSRASSLGAILRRAPS--RSDGAQAWVCAAVAE 403

Query: 294 RDEFGKS--VVEKV---WNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVL 348
                 S  V+E++   +  D + +       ++++L    L  + V+G + E HLQN L
Sbjct: 404 PWPLDPSQRVLERLASGYPGDAKARLRALLGDWIALLVPPCLRLLTVHGVALEVHLQNTL 463

Query: 349 ARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTL 408
           AR     G LVGF VRD GGI+ H   L  + G  + +  ESF    D PEV   L HTL
Sbjct: 464 ARV--AQGRLVGFAVRDLGGIRIHTPRLTRA-GHTLSLAPESFIWTDDLPEVRGKLEHTL 520

Query: 409 I---LCNVHRFARALNLHYNGIGWDIVR 433
               L +V   A AL++   G  W   R
Sbjct: 521 FHAHLTHVFAVAEALSV-PAGESWARTR 547



>gi|493889364|ref|WP_006835426.1| hypothetical protein [Bacillus sp. SG-1]
 gi|148852575|gb|EDL66720.1| hypothetical protein BSG1_05170 [Bacillus sp. SG-1]
          Length = 660

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 214/488 (43%), Gaps = 59/488 (12%)

Query: 45  SNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQ 104
           +NQL  E         + Y   K +    +SS + +EQ  LEGH  HP  K +  +S  +
Sbjct: 187 ANQLRQEARKQDIKSTLEYNTAKKKEEPEWSSMLFYEQLALEGHHLHPGTKTKTGMSS-E 245

Query: 105 EILPGSYDFMNPL-IRFIEVPLDKMVIRGSYEKTIEKI--------TKLLXXXXXXXKNT 155
           ++   S +F     I F+ V  + +       KTIEK+         + L        + 
Sbjct: 246 DVRRYSPEFHGKFPIFFVAVHKEHLHKSELVPKTIEKLFNNQYLAFKRTLKDQGLEPASY 305

Query: 156 ILIPVHELQ----IPNIESKFPFANILPEKYSIKAKSQA--SLRTVVIPELNDIAIKLPL 209
            L+PVHE Q    + +I  +   ANI+    SI A+  A  S RTV+  E     IKL +
Sbjct: 306 QLLPVHEWQYHHSLFSIYREEIAANIIIPLPSITAQGTATSSFRTVLAAEGKSPFIKLAV 365

Query: 210 GIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLK---VCKEFAGVYSIEKDFDIAKH 266
             ++TS +R+++  +  +      + +K+      LK      E AG      D   +++
Sbjct: 366 NSQMTSTVRSISKNTALNATVFSEMTEKILEREPSLKHFIPLNETAGYAFKSNDNAKSRN 425

Query: 267 STCIIREDF-NELNSDGERVIICAALVERDEF-GKSVVEKV-------WNLDTEQKRIDF 317
            T +IRE+  N+L  D E  I  ++L  +  F  K+++ ++       ++L   +  I F
Sbjct: 426 LTVVIRENRENDLEED-EFPIAGSSLYNKSPFTNKTILRELLDEYVYFYDLPKREGGISF 484

Query: 318 FDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLF 377
           F +++SI    FL  +   G + E HLQN +  F  K+G+ V F  RD+GG + +   L 
Sbjct: 485 FKQYLSITLPGFLTLLTKYGVALEGHLQNSVPVF--KNGKPVKFYFRDWGGARIYTKRL- 541

Query: 378 ESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARAL----NLHYNGIGWDIVR 433
           ++ G + + L  S  +  D  E+Y   ++T+I  ++    R L     L+  G+ W  V+
Sbjct: 542 KAQGLKPNFLSGSLIQTSDPDEMYSKAHYTIIQSHIGEIIRQLVECSGLN-EGLFWREVK 600

Query: 434 KHFKQI-----------VPRDHLLYKTFLEQDKFNYKCLMEMK---CDGLYRDYLYIPKP 479
              + +           V  D +    F  Q+K  +K L +M+    DG    YLY    
Sbjct: 601 TAMENVFLSLSYSAGQNVKEDRI----FFYQEKMRHKALTKMRMSDSDG----YLYSSVT 652

Query: 480 NLMMYKGE 487
           N +  K E
Sbjct: 653 NPLAKKNE 660



>gi|496370958|ref|WP_009079948.1| predicted protein [Streptomyces sp. AA4]
 gi|302437122|gb|EFL08938.1| predicted protein [Streptomyces sp. AA4]
          Length = 1297

 Score = 95.9 bits (237), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 115/497 (23%), Positives = 202/497 (40%), Gaps = 58/497 (11%)

Query: 37   WMNLENDI--SNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMH 94
            W  L +D+  S + +A   + V+++       +  +S      ++ + +  EGH+ H   
Sbjct: 808  WTALRDDLVDSARNLALSRACVRHRTAAATTDERAVSDRV---LDLDAACSEGHSIHLAP 864

Query: 95   KARHAISPIQEI--LPGSYDFMNPLIRFIEVPLDKM-------------VIRGSYEKTIE 139
            + R   +P   +   P S D +   I F+ V  D +             ++   +  T  
Sbjct: 865  RVRRGFTPADSLAYCPESADTVG--ISFVAVRKDSVHSTPDPSGASVGTIVADHFPATAA 922

Query: 140  KITKLLXXXXXXXKNTILIPVHELQI-PNIESKFP----FANILP-EKYSIKAKSQASLR 193
            +    L           LIPVH  Q+   + +++P       ++P  +  +  +   S+R
Sbjct: 923  RAIDGLAARGHAPAEYELIPVHPWQLRSRLAAEYPEELATGTVVPLPEAQLACRPTVSVR 982

Query: 194  TVVIPELND----IAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID----RNLL 245
            T+V          + +K  L +++TS  RT++P +T +GP +  ++ +L  D    R  +
Sbjct: 983  TLVTAASGRHGRRLTVKTALDVQLTSRRRTISPATTDNGPRMSRLLQRLLADDPSTRGRV 1042

Query: 246  KVCKEFAGVYSIEKDFDIAKHS---TCIIREDFNELNSDGERVIICAALVERDEFGKSVV 302
                E AG+                + ++R D  +    GE V+   AL      G  + 
Sbjct: 1043 VCVPELAGIAFAPPPGSAPSRERGLSALLRADPADYAVPGETVLSACALRGAAPDGTVLA 1102

Query: 303  EKVWNLDTEQKR-IDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGF 361
            + + +   + K  + FFDR+  ++  A LP ++  G   EAHLQN L     + G  V  
Sbjct: 1103 QLIRDRSHQSKAALAFFDRYAELMLAAGLPLLWRYGIGLEAHLQNTL--LVVRDGLPVRV 1160

Query: 362  VVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCN----VHRFA 417
            +VRDFGGI+ HQ  L E+  E V     S T + D   V + + + L+  N    V  FA
Sbjct: 1161 LVRDFGGIRVHQGRLREAGLEFVP-HPGSITFSDDLDHVRRKVSYALLQANIAPVVTMFA 1219

Query: 418  RALNLHYNGIGWDIVRKHFKQIVP--RDHLLYK-----TFLEQDKFNYKCLMEMKCDGLY 470
                L    + W  VR     ++     HLL +      FL       K    M+   L 
Sbjct: 1220 TTWGLPVEQL-WATVRAAMTGLLADLPAHLLARASADVAFLRTSHLPQKAFGLMRL--LD 1276

Query: 471  RDY-LYIPKPNLMMYKG 486
             D+ +Y+P+ N +   G
Sbjct: 1277 ADHDIYLPQANPLHDAG 1293



>gi|495269046|ref|WP_007993801.1| siderophore synthetase [Pseudomonas sp. GM49]
 gi|398187431|gb|EJM74769.1| siderophore synthetase component [Pseudomonas sp. GM49]
          Length = 640

 Score = 95.5 bits (236), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 109/452 (24%), Positives = 192/452 (42%), Gaps = 80/452 (17%)

Query: 83  SLLE-----GHAFHPMHKARHAISPIQ--------------------------EILPGSY 111
           SLLE     GH +HP +K +  +S  Q                          E L G+ 
Sbjct: 191 SLLEQWGTLGHPWHPNYKTKLGLSAAQVIAFSPEFEASFPIVLCALHRQYTYVESLAGTA 250

Query: 112 DFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPN 167
           D+ +               +G + +  E++ + L        + + +P H  Q    +PN
Sbjct: 251 DYWD-------------WWQGHFPQAAEQLQRHLQQRGLEAADYLPLPSHPWQANEELPN 297

Query: 168 IESKFPFANIL--PEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPW 223
           + +     N+L   +  +       S RTVV PE + +A  +KLP+ +++TS  RTV+P 
Sbjct: 298 LFAGEIADNLLIITDIVAFTGHPTMSFRTVV-PEASRVAPMVKLPVALRLTSVQRTVSPR 356

Query: 224 STHSGPALGSIIDKL-----EIDRNLLKVCKEFAGVYSIEK--DFDIAKHSTCIIREDFN 276
           S   GP +  +I ++     +I R LL +  E  GV+   +  + + ++H+  + R++  
Sbjct: 357 SARMGPRISQLILQILDHEPQIQR-LLNIVPERIGVHYAPQPANDERSRHAAVLYRDNPL 415

Query: 277 ELNSDGERVIICAALVERDEFGKSV----VEKVWNLDTEQKRIDFFDRFVSILFKAFLPP 332
            L  +GE  +   +L   +EF + +    V+     D  +  + FFD ++SI   + L  
Sbjct: 416 TLLQEGELAVPVGSLFAVNEFEQPLLRDWVQLAQGRDDSEAMLAFFDDYLSIAVPSLLGI 475

Query: 333 VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFT 392
             + G +FEAH QN      +  G+L   ++RDFG I+  + TL  + G  + + +   T
Sbjct: 476 YLMYGVAFEAHQQNSFMVMGA-DGQLNRLLLRDFGDIRIDRKTL-HAKGLDIQLHDPKMT 533

Query: 393 EAKDFPEVYKILYHTLILCNVHRFARALNLHYN---GIGWDIVRKHFKQIVP--RDHL-- 445
              D   V   L HT  +C++         H+N    I W+ +  H +Q     R+H+  
Sbjct: 534 LYDDAGFVRDKLLHTTFMCHLGELTLLCARHWNVPENILWERLATHVEQCFESVREHVEP 593

Query: 446 -----LYKTFLEQDKFNYKCLMEMKCDGLYRD 472
                  +  LEQD +  K  M M+    + D
Sbjct: 594 ARWESERQALLEQD-WPAKSFMRMRLHDSHAD 624



>gi|495260062|ref|WP_007984817.1| siderophore synthetase [Pseudomonas sp. GM48]
 gi|398171521|gb|EJM59423.1| siderophore synthetase component [Pseudomonas sp. GM48]
          Length = 640

 Score = 94.7 bits (234), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 109/452 (24%), Positives = 191/452 (42%), Gaps = 80/452 (17%)

Query: 83  SLLE-----GHAFHPMHKARHAISPIQ--------------------------EILPGSY 111
           SLLE     GH +HP +K +  +S  Q                          E L G+ 
Sbjct: 191 SLLEQWGTLGHPWHPNYKTKLGLSAAQVIAFSPEFEASFPIVLCALHRQYTHVESLAGTA 250

Query: 112 DFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPN 167
           D+ +               +G + +  E++ + L        +   +P H  Q    +PN
Sbjct: 251 DYWD-------------WWQGHFPQAAEQLQRHLQQRGLEVTDYFPLPSHPWQANEELPN 297

Query: 168 IESKFPFANIL--PEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPW 223
           + +     N+L   +  +       S RTV +PE + +A  +KLP+ +++TS  RTV+P 
Sbjct: 298 LFAGEIADNLLIITDIVAFTGHPTMSFRTV-LPEASRVAPMVKLPVALRLTSVQRTVSPR 356

Query: 224 STHSGPALGSIIDKL-----EIDRNLLKVCKEFAGVYSIEK--DFDIAKHSTCIIREDFN 276
           S   GP +  +I ++     +I R LL +  E  GV+   +  + + ++H+  + R++  
Sbjct: 357 SARMGPRISQLILQILDHEPQIQR-LLNIVPERIGVHYAPQPANDERSRHAAVLYRDNPL 415

Query: 277 ELNSDGERVIICAALVERDEFGKSV----VEKVWNLDTEQKRIDFFDRFVSILFKAFLPP 332
            L  +GE  +   +L   +EF + +    V+     D  +  + FFD ++SI   + L  
Sbjct: 416 TLLQEGELAVPVGSLFAVNEFEQPLLRDWVQLAQGRDDSEAMLAFFDDYLSIAVPSLLGI 475

Query: 333 VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFT 392
             + G +FEAH QN      S  G+L   ++RDFG I+  + TL  + G  + + +   T
Sbjct: 476 YLMYGVAFEAHQQNSFMVMGS-DGQLNRLLLRDFGDIRIDRKTL-HARGLDIQLHDPKMT 533

Query: 393 EAKDFPEVYKILYHTLILCNVHRFARALNLHYN---GIGWDIVRKHFKQIVP--RDHL-- 445
              D   V   L HT  +C++         H+N    I W+ +  H +Q     R+H+  
Sbjct: 534 LYDDAGFVRDKLLHTTFMCHLGELTLLCARHWNVSENILWERLATHVEQCFESVREHVEP 593

Query: 446 -----LYKTFLEQDKFNYKCLMEMKCDGLYRD 472
                  +  LEQD +  K  M M+    + D
Sbjct: 594 ARWESERQALLEQD-WPAKSFMRMRLHDSHAD 624



>gi|495324436|ref|WP_008049181.1| siderophore synthetase [Pseudomonas sp. GM74]
 gi|398205883|gb|EJM92661.1| siderophore synthetase component [Pseudomonas sp. GM74]
          Length = 640

 Score = 94.4 bits (233), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 110/453 (24%), Positives = 189/453 (41%), Gaps = 82/453 (18%)

Query: 83  SLLE-----GHAFHPMHKARHAISPIQ--------------------------EILPGSY 111
           SLLE     GH +HP +K +  +S  Q                          E L G+ 
Sbjct: 191 SLLEQWGTLGHPWHPNYKTKLGLSAAQVIAFSPEFEASFPIVLCALHRQYTHVESLAGTA 250

Query: 112 DFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESK 171
           D+ +               +G + +  E++ + L        + + +P H  Q  N E  
Sbjct: 251 DYWD-------------WWQGHFPQAAEQLQRHLQQLGLEAADYLPLPSHPWQA-NEELP 296

Query: 172 FPFAN-------ILPEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTP 222
             FA        I+ +  +       S RTVV PE + +A  +KLP+ +++TS  RTV+P
Sbjct: 297 NSFAGEIADNLLIITDIVAFTGHPTMSFRTVV-PEASRVAPMVKLPVALRLTSVQRTVSP 355

Query: 223 WSTHSGPALGSIIDKL-----EIDRNLLKVCKEFAGVYSIEK--DFDIAKHSTCIIREDF 275
            S   GP +  +I ++     +I R LL +  E  GV+   +  + + ++H+  + R++ 
Sbjct: 356 RSARMGPRISQLILQILDHEPQIQR-LLNIVPERIGVHYAPQPANDERSRHAAVLYRDNP 414

Query: 276 NELNSDGERVIICAALVERDEFGKSV----VEKVWNLDTEQKRIDFFDRFVSILFKAFLP 331
             L  +GE  +   +L   +EF + +    V+     D  +  + FFD ++SI   + L 
Sbjct: 415 LTLLQEGELAVPVGSLFAVNEFEQPLLRDWVQLAQGRDDSEAMLAFFDDYLSIAVPSLLG 474

Query: 332 PVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESF 391
              + G +FEAH QN      +  G+L   ++RDFG I+  + TL  + G  + + +   
Sbjct: 475 IYLMYGVAFEAHQQNSFMVMGA-DGQLNRLLLRDFGDIRIDRKTL-HAKGLDIQLHDPKM 532

Query: 392 TEAKDFPEVYKILYHTLILCNVHRFARALNLHYN---GIGWDIVRKHFKQIVP--RDHL- 445
           T   D   V   L HT  +C++         H+N    I W  +  H +Q     R+H+ 
Sbjct: 533 TLYDDAGFVRDKLLHTTFMCHLGELTLLCARHWNVPENILWQRLATHVEQCFESVREHVE 592

Query: 446 ------LYKTFLEQDKFNYKCLMEMKCDGLYRD 472
                   +  LEQD +  K  M M+    + D
Sbjct: 593 PARWESERQALLEQD-WPAKSFMRMRLHDSHAD 624



>gi|512477241|ref|WP_016426391.1| hypothetical protein [Staphylococcus sp. HGB0015]
 gi|512048486|gb|EPD48145.1| hypothetical protein HMPREF1208_02186 [Staphylococcus sp. HGB0015]
          Length = 656

 Score = 91.7 bits (226), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 109/465 (23%), Positives = 185/465 (39%), Gaps = 63/465 (13%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEILPGS-YDFMNPLIRFIEVPLDKM----------- 128
           EQ ++EGH  HP  K R  ++  + I   S Y    P+ +FI +  D             
Sbjct: 197 EQLVIEGHPVHPGAKLRKGMTAKETICYSSEYQHGIPM-QFILIHRDYARTMSAHSNYAE 255

Query: 129 VIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANILPEKYS 183
           V+ G++E   E     L        N + + VH  Q  +I     +       I+P  Y 
Sbjct: 256 VVYGAFEGLKEIAQNQLEASSQSLNNYVPLIVHPWQYAHIITEEYQDAISQQIIVPLTYQ 315

Query: 184 IKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID 241
               +  S RT+ +PE  +    IKL   + +T  +RT++  +TH+GP + +I+  +  +
Sbjct: 316 QNYYAGLSFRTL-MPEKPEQTPHIKLSTNVHITGEIRTLSEQTTHNGPLMTNILTHIAHN 374

Query: 242 RNLLK-----VCKEFAGVYSIE-KDFDIAKHST------CIIREDFNELNSDGERVIICA 289
             L K        E AG +     D D A           + RE+  +L  D    +I +
Sbjct: 375 DPLFKDVATQAVPELAGAHFYHPNDEDSAYQEQRSEQLGTLYRENIYDLLDDNALALIPS 434

Query: 290 ALV--ERDEFGKSVVEKVWNLDTEQKRI--------DFFDRFVSILFKAFLPPVFVNGFS 339
           + V  +  E+   V+E +      Q R         D+F  +   L    +P +   G +
Sbjct: 435 SFVVNKPGEYRTLVIELIERFAAHQGRSVDMSQLCQDWFAPYARALIDYVVPLLVKYGIA 494

Query: 340 FEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPE 399
            EAHLQN +A FD ++G     ++RDF G++  Q  L     +  D  E+S    +    
Sbjct: 495 LEAHLQNTIAVFDDRTGAFQQMLIRDFEGLRIDQQQLSSMGYDTSDFHEKSRILTESQTS 554

Query: 400 VYKILYHTLILCNVHRFARALNLHYNGIG-----WDIVRKHFKQIVPRDHLLYKTFLEQD 454
           V+   +++ I  ++     A+  +Y         W IV+   +Q   R   + +T + Q+
Sbjct: 555 VFNKAFYSTIQNHLGEIVAAIAYYYKDEQLENKLWQIVQTQIQQCFDR---IKQTEMNQE 611

Query: 455 KFN------------YKCLMEMKCDGLYRDYLYIPKPNLMMYKGE 487
           + N            YKC+  M+       Y YI   N +    E
Sbjct: 612 RINTIYQTFFNPVIDYKCVTTMRLIDEAHHYTYIKVDNPLHMTSE 656



>gi|212219153|ref|YP_002305940.1| siderophore synthase [Coxiella burnetii CbuK_Q154]
 gi|492179568|ref|WP_005771943.1| siderophore biosynthesis protein, IucA/IucC family [Coxiella
           burnetii]
 gi|164601644|gb|EAX32925.2| siderophore biosynthesis protein, IucA/IucC family [Coxiella
           burnetii 'MSU Goat Q177']
 gi|212013415|gb|ACJ20795.1| siderophore synthase [Coxiella burnetii CbuK_Q154]
          Length = 588

 Score = 90.9 bits (224), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 157/359 (43%), Gaps = 74/359 (20%)

Query: 157 LIPVHELQIPNIESKFPFANILPEKYS---------------IKAKSQASLRTVVIPELN 201
           L+P H  Q         F N+LP+K+S               +      S RT+ IP L 
Sbjct: 234 LLPCHPWQ---------FKNVLPQKFSRLISENKLLLFDTVSLTVLPTLSFRTL-IPRLP 283

Query: 202 DIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL-EIDRNLLKV---CKEFAGVY 255
                +K+P+GI++TS  RT++P +    P +G+++ ++ E + +  K    C +  GV+
Sbjct: 284 TPKPHLKVPIGIRITSVARTISPGTCRMSPRVGNLLQRIFEKENHFSKSIYHCIDRIGVH 343

Query: 256 --SIEKDFDI-AKHSTCIIREDFNELNSDGERVIICAALVERDEFGKSV----VEKVWNL 308
             SI   +D   +H + +IR++   L+S+ E +I    L       +      V     +
Sbjct: 344 VQSIPDHYDDDQRHLSTLIRQNPLTLSSENETIIPLTCLFSPSPLSELPILIEVMHTQKI 403

Query: 309 DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGG 368
            + QK  D+F R V++   AFL    + G + EAH QN L  F  K G    F+ RD GG
Sbjct: 404 FSPQKAFDYFKRHVALTLNAFLDLYLMYGIALEAHTQNTLIVF--KEGCPTRFINRDLGG 461

Query: 369 IKHHQDTLFESIGERVDVLEESFTEAKDFPEV----------YKILYHTLILCNVHRFAR 418
           I  H  TL           ++ FT  +D P +          YKIL HT+   ++     
Sbjct: 462 IYIHMPTL----------QQQDFTLLQDAPTLILTSDPKVARYKIL-HTVYQTHLTSLIS 510

Query: 419 ALNLHYNGIG----WDIVRK--HFKQIVPRDHLLYKTFLE------QDKFNYKCLMEMK 465
            L+LHY GI     W  V +  H + +  + H+ +  + E      QD +  K L  M+
Sbjct: 511 CLHLHY-GIEPQALWHGVARLTHERFVQTKPHVSFMRWEEEYQGLFQDNWPLKALTRMR 568



>gi|495342827|ref|WP_008067559.1| siderophore synthetase [Pseudomonas sp. GM79]
 gi|398242352|gb|EJN27969.1| siderophore synthetase component [Pseudomonas sp. GM79]
          Length = 640

 Score = 90.9 bits (224), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 107/456 (23%), Positives = 186/456 (40%), Gaps = 80/456 (17%)

Query: 72  LNFSSSVEWEQSLLE-----GHAFHPMHKARHAISPIQ---------------------- 104
           L   SS +   SLLE     GH +HP +K +  +S  Q                      
Sbjct: 180 LKAGSSHQNPTSLLEQWGTLGHPWHPNYKTKLGLSAAQVIAFSPEFEASFPIVLCALHRQ 239

Query: 105 ----EILPGSYDFMNPLIRFIEVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPV 160
               E L G+ D+ +               +G + +  E++ + L       K+ + +P 
Sbjct: 240 YAHVEALAGTTDYWD-------------WWQGHFPQAAEQLQRHLQQLGLDAKDYLPLPS 286

Query: 161 HELQIPNIESKFPFAN-------ILPEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGI 211
           H  Q  + E    FAN       I+ +  +       S RTV +P+ +  A  +KLP+ +
Sbjct: 287 HPWQA-HEELPHSFANEIADNLLIVTDIVAFTGHPTMSFRTV-LPQASRTAPMVKLPVAL 344

Query: 212 KVTSALRTVTPWSTHSGPALGS----IIDKLEIDRNLLKVCKEFAGVY--SIEKDFDIAK 265
           ++TS  RTV+P S   GP +      I+D+    + LL +  E  GV+   +  D + ++
Sbjct: 345 RLTSVQRTVSPRSARMGPRISQLVLDILDREPQIQRLLNIVPERIGVHYAPLPSDDERSR 404

Query: 266 HSTCIIREDFNELNSDGERVIICAALVERDEFGKSVVEKVWNL----DTEQKRIDFFDRF 321
           H+  + R++   L  +GE  +   +L   +EF + ++     L    D  +  + FF+ +
Sbjct: 405 HAGVLYRDNPLTLLQEGELAVPVGSLFAVNEFEQPLLRDWVRLAQGSDDSEAMLAFFEDY 464

Query: 322 VSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIG 381
           +SI   + L    + G +FEAH QN      +  G+L   ++RDFG ++  + TL  + G
Sbjct: 465 LSIAVPSLLGIYLMYGVAFEAHQQNSFMVMGA-DGQLNRLLLRDFGDVRIDRKTL-HAKG 522

Query: 382 ERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYN---GIGWDIVRKHFKQ 438
             + + +   T   D   V   L HT  +C++         H+N      W+ +  H  Q
Sbjct: 523 LDIQLHDPKMTLYDDAGFVRDKLLHTTFMCHLGELTLLSARHWNVPESSLWERLASHVAQ 582

Query: 439 IV---------PRDHLLYKTFLEQDKFNYKCLMEMK 465
                       R     +  LEQD +  K  M M+
Sbjct: 583 CFETLRERVEPARWESERRALLEQD-WPAKSFMRMR 617



>gi|154707676|ref|YP_001424990.1| siderophore synthase [Coxiella burnetii Dugway 5J108-111]
 gi|500791622|ref|WP_011997199.1| siderophore synthase [Coxiella burnetii]
 gi|154356962|gb|ABS78424.1| siderophore synthase [Coxiella burnetii Dugway 5J108-111]
          Length = 588

 Score = 90.9 bits (224), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 157/359 (43%), Gaps = 74/359 (20%)

Query: 157 LIPVHELQIPNIESKFPFANILPEKYS---------------IKAKSQASLRTVVIPELN 201
           L+P H  Q         F N+LP+K+S               +      S RT+ IP L 
Sbjct: 234 LLPCHPWQ---------FKNVLPQKFSRLISENKLLLFDTVSLTVLPTLSFRTL-IPRLP 283

Query: 202 DIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL-EIDRNLLKV---CKEFAGVY 255
                +K+P+GI++TS  RT++P +    P +G+++ ++ E + +  K    C +  GV+
Sbjct: 284 TPKPHLKVPIGIRITSVARTISPGTCRMSPRVGNLLQRIFEKENHFSKSIYHCIDRIGVH 343

Query: 256 --SIEKDFDI-AKHSTCIIREDFNELNSDGERVIICAALVERDEFGKSV----VEKVWNL 308
             SI   +D   +H + +IR++   L+S+ E +I    L       +      V     +
Sbjct: 344 VQSIPDHYDDDQRHLSTLIRQNPLTLSSENETIIPLTCLFSPSPLSELPILIEVMHTQKI 403

Query: 309 DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGG 368
            + QK  D+F R V++   AFL    + G + EAH QN L  F  K G    F+ RD GG
Sbjct: 404 FSPQKAFDYFKRHVALTLNAFLDLYLMYGIALEAHTQNTLIVF--KEGCPTRFINRDLGG 461

Query: 369 IKHHQDTLFESIGERVDVLEESFTEAKDFPEV----------YKILYHTLILCNVHRFAR 418
           I  H  TL           ++ FT  +D P +          YKIL HT+   ++     
Sbjct: 462 IYIHMPTL----------QQQDFTLLQDAPTLILTSDPKVARYKIL-HTVYQTHLTSLIS 510

Query: 419 ALNLHYNGIG----WDIVRK--HFKQIVPRDHLLYKTFLE------QDKFNYKCLMEMK 465
            L+LHY GI     W  V +  H + +  + H+ +  + E      QD +  K L  M+
Sbjct: 511 CLHLHY-GIEPQALWHGVARLTHERFVQTKPHVSFMRWEEEYQGLFQDNWPLKALTRMR 568



>gi|495209335|ref|WP_007934115.1| siderophore synthetase [Pseudomonas sp. GM18]
 gi|398132192|gb|EJM21476.1| siderophore synthetase component [Pseudomonas sp. GM18]
          Length = 640

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 96/396 (24%), Positives = 172/396 (43%), Gaps = 44/396 (11%)

Query: 83  SLLE-----GHAFHPMHKARHAISPIQEI-LPGSYDFMNPLI--------RFIEVPLDKM 128
           SLLE     GH +HP +K +  +S  Q I     ++   P++          +E      
Sbjct: 191 SLLEQWGTLGHPWHPNYKTKLGLSAAQVIAFSPEFEASFPIVLCALHRQYAHVEALAGTT 250

Query: 129 VIR----GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFAN-------I 177
             R    G +    E++ + L        + + +P H  Q  + E    FAN       I
Sbjct: 251 DYRDWWQGHFPLAAEQLQRHLQQLGLDATDYLPLPSHPWQA-HEELPHSFANEVADNLLI 309

Query: 178 LPEKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGPALG--- 232
           + +  +       S RT V+P+ +  A  +KLP+ +++TS  RTV+P S   GP +    
Sbjct: 310 ITDIVAFTGHPTMSFRT-VLPQASRTAPMVKLPVALRLTSVQRTVSPRSARMGPRISQLI 368

Query: 233 -SIIDKLEIDRNLLKVCKEFAGVY--SIEKDFDIAKHSTCIIREDFNELNSDGERVIICA 289
            +I+D+    + LL +  E  GV+   +  D + ++H+  + R++   L  +GE  +   
Sbjct: 369 LNILDQEPQIQRLLNIVPERIGVHYAPLPADDERSRHAAVLYRDNPLTLLQEGELAVPVG 428

Query: 290 ALVERDEFGKSVVEKVWNL----DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           +L   +EF + ++     L    D  +  + FFD +++I   + L    + G +FEAH Q
Sbjct: 429 SLFAVNEFEQPLLRDWVRLAQGRDDSEAMLAFFDDYLAIAVPSLLGIYLMYGVAFEAHQQ 488

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILY 405
           N      +  G+L   ++RDFG ++  + TL  + G  + + +   T   D   V   L 
Sbjct: 489 NSFMVMGA-DGQLNRLLLRDFGDVRIDRKTL-HAKGLDIQLHDPKMTLYDDAGFVRDKLL 546

Query: 406 HTLILCNVHRFARALNLHYN---GIGWDIVRKHFKQ 438
           HT  +C++         H+N    I W+ +  H  Q
Sbjct: 547 HTTFMCHLGELTLLCARHWNVPENILWERLAAHVAQ 582



>gi|493889363|ref|WP_006835425.1| hypothetical protein [Bacillus sp. SG-1]
 gi|148852574|gb|EDL66719.1| hypothetical protein BSG1_05165 [Bacillus sp. SG-1]
          Length = 612

 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 116/456 (25%), Positives = 196/456 (42%), Gaps = 62/456 (13%)

Query: 74  FSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPL-IRFIEVPLDKMVIRG 132
           FS  V  EQS++EGH  HP  K R  +S I+E    + ++   + ++ + +  D +    
Sbjct: 158 FSPLVFLEQSVIEGHTLHPCSKTRMGLS-IEENQKYAPEWEAEVELKVLALHKDIVNTTS 216

Query: 133 SYEKTIEKITKLLXXXXXXXKNTI--------LIPVHELQIPNIESKFPFA-----NILP 179
             +KT+   T LL        N          LIPVH  Q  ++  K  ++     NI  
Sbjct: 217 MSKKTM---TDLLLSDYPDMVNDKNYDCTSYELIPVHPWQFEHVIEKHFYSDLSDGNITV 273

Query: 180 EKYSIKAKSQASLRTVVIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
               I  K   S R++   +   +  IK  + I++TSA R V+P S H+GP +  ++ K+
Sbjct: 274 LNQGIMVKPLMSFRSMAPEKGTKLHHIKTAVNIQMTSAKRLVSPASVHNGPVVSMLLKKV 333

Query: 239 EIDRNLLK----VCKEFAGVY---SIEKDFDIA-KHSTCIIREDFNELNSDGERVIICAA 290
           E D   +        E AG +   S++ D  +  K+ +C+IRE+     + GE  +  A+
Sbjct: 334 EQDDPFISGKAIFLAEVAGSHYSGSVQSDEIVPEKNLSCLIRENPEAYLAQGELAVPAAS 393

Query: 291 LVERDEFGKSVVEK--------VWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEA 342
           L+ R    K +V K           L  E+   +F   +  +L    +  +   G S EA
Sbjct: 394 LINRIPSSKKIVLKELIESFSETRKLTLEEGAAEFLGHYTKVLMPVLMHLLIKYGISLEA 453

Query: 343 HLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFE-----SIGERVDVLEESFTEAKDF 397
           HLQN +  F  K G  V  +VRD GG++ H+    E      I +  ++L        D 
Sbjct: 454 HLQNTIIIF--KEGIPVKLMVRDNGGVRIHKQLSAEWMDVNKINDSTNLL------TNDT 505

Query: 398 PEVYKILYHTLILCNVHRFARALNLHYNGIG----WD----IVRKHFKQIVPRDHLLYKT 449
            ++Y++  H +I  ++      L    NGI     WD    +V  +  +I   + L  + 
Sbjct: 506 RDLYQMFSHAVIHNHLGEMIVGL-ARENGIKEKVLWDKVKAVVCSYLTEIRVEERLQGRI 564

Query: 450 FLEQDK----FNY-KCLMEMKCDGLYRDYLYIPKPN 480
              +D     F Y K L++M+    + + +Y+   N
Sbjct: 565 AELEDHLFAPFTYLKALVKMRLSDSFTEGVYVNAGN 600



>gi|491682718|ref|WP_005538856.1| IucA/IucC family protein [Haloarcula argentinensis]
 gi|445766857|gb|EMA17972.1| IucA/IucC family protein [Haloarcula argentinensis DSM 12282]
          Length = 551

 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 106/457 (23%), Positives = 192/457 (42%), Gaps = 58/457 (12%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEILPGS-YDFMNPLIRFIEVPLD---KMVIRGSYEK 136
           E+ + EGH  HP  K R      + +   S YD + P IRF+ V  +    +   G    
Sbjct: 103 ERLITEGHPLHPGAKLRQGFCSSEVVSYASEYDGV-PEIRFVAVTNEYSSGVTTEGGLTL 161

Query: 137 TIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFP--FANILPEKY------------ 182
           + E++ +L+        + +    H+ +   +    P  + + LPE+Y            
Sbjct: 162 S-ERLYELVSGLRDAVADAVTDAGHDPESMTVLPVHPWQYRHELPERYGRELDRGVIVAI 220

Query: 183 ---SIKAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGSII 235
              ++ A +  SLRT+V P+    +    +KL LGI+ TS++RT+TP + H+GP +  ++
Sbjct: 221 PDCALPAAATVSLRTLV-PQGTKRSTPPHLKLSLGIQTTSSIRTITPQTVHNGPRITDVL 279

Query: 236 DKLEIDRNL--LKVCKEFAGV--------YSIEKDFDIAKHSTCIIREDFNELNSDGERV 285
           D++  D     L+   E AG         ++  +  D AKH + ++R +  +   DG+  
Sbjct: 280 DRVLDDGQFKSLRGLPETAGACFHDPGGPHTDGQSHDRAKHLSALVRHNPLKYVDDGKLP 339

Query: 286 IICAALVERDEF-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHL 344
           +  AAL+ R     + +++ +           F  R+   +    L  +   G   EAHL
Sbjct: 340 VTGAALLSRGPLEDRPLIDVLAPDGGPDMTASFLRRYAETIVPDALRLLVAYGIGLEAHL 399

Query: 345 QNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKIL 404
           QN +  FD    + V   +RD+GG++  +D L  +    + +   S T + +    Y  L
Sbjct: 400 QNCIIVFDDGFPDEV--FIRDYGGLRICRDRL-AAASHSISLYPGSVTVSDEMRPAYDKL 456

Query: 405 YHTLI---LCNVHRFARALNLHYNGIGWDIVRKHFKQIVPRDHLLY----KTFLE----- 452
            + L    L  V RF            W+IV     + +  ++L Y     T+++     
Sbjct: 457 TYALFQNHLAEVIRFLVRQGTISESRCWEIVSAVVGETL--ENLRYDGIPATWIDDAAEV 514

Query: 453 --QDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGE 487
             +  + YKCL  M+       Y++   PN +    E
Sbjct: 515 LFESTWEYKCLTRMRLTDKSHSYVHESVPNPLSRSSE 551



>gi|495867461|ref|WP_008592040.1| hypothetical protein [Salimicrobium sp. MJ3]
 gi|407017934|gb|EKE30688.1| hypothetical protein MJ3_12000 [Salimicrobium sp. MJ3]
          Length = 605

 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 97/423 (22%), Positives = 186/423 (43%), Gaps = 39/423 (9%)

Query: 80  WEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPL-IRFIEVPLDKMVIRGS----- 133
           +EQ + EGH  HP  K R  +S  ++    S +F +   +RF  V  ++   R       
Sbjct: 170 FEQQVTEGHHLHPGAKTRLGLS-YKDSFRYSPEFGHTFPVRFAAVRKERWTSREQSLLYT 228

Query: 134 -YEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPNIESK--FPFANILPEKYSIKA 186
            + +   K  + L        + +++PVHE Q    +P+I  K       +L E  S+  
Sbjct: 229 HFPECYRKSEEELKRSGYESSDFVIVPVHEWQFIHALPSIYEKEIIDGTVVLLEDVSLPV 288

Query: 187 KSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNLLK 246
           K+ +S RT+V       A+KL +  ++TS +R+++P +  +   +  ++  +    +   
Sbjct: 289 KATSSFRTLVPVSGEGPALKLAVNSQMTSTVRSISPQTAGNARVVSELLHSIFEQESFSG 348

Query: 247 VCKEFA-GVYSIEKDFDIAKHS-TCIIREDFNELNSDGERVIICAALVERDEFGK-SVVE 303
               +  G  S   D ++ K + T ++RE+      +GE  I   AL  ++  G+ ++++
Sbjct: 349 FTPLYELGGGSFASDDNLKKRNLTMLLRENITPYLEEGEEAIAGMALYAKEPGGEGTILQ 408

Query: 304 KVWNLDTEQKRID-------FFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSG 356
             +     +KR+        FF  +   +   +L  +   G + E HLQN +  F  K+G
Sbjct: 409 ARFRQYAAEKRLPECEAASAFFRDYARTVLPPYLTLMTKYGVALEGHLQNSVPVF--KNG 466

Query: 357 ELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCNVHRF 416
            +  F  RD+GG + ++  L +  G   + ++ S +  KD   ++  LY+++   ++   
Sbjct: 467 SITRFFFRDWGGSRFYEARLNDR-GLYPEFMKGSVSVTKDAASMHHKLYYSVFQNHLGEI 525

Query: 417 ARALNLHYNGIG----WDIVRK-------HFKQIVPRDHLLYKTFLEQDKFNYKCLMEMK 465
            R L +   G+G    W IVR+            VP      + FL+Q    +K L +M+
Sbjct: 526 IRQL-VEATGVGEMEFWSIVREICSETCGRLATEVPEQAETDRKFLKQKTVMHKSLTKMR 584

Query: 466 CDG 468
             G
Sbjct: 585 LYG 587



>gi|319893132|ref|YP_004150007.1| siderophore synthetase superfamily, group B [Staphylococcus
           pseudintermedius HKU10-03]
 gi|505962106|ref|WP_015729487.1| sialic acid synthase [Staphylococcus pseudintermedius]
 gi|317162828|gb|ADV06371.1| Siderophore synthetase superfamily, group B [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 655

 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 102/453 (22%), Positives = 191/453 (42%), Gaps = 55/453 (12%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNP-LIRFIEVPLD---KMVIRGSYEK 136
           EQ ++EGH  HP  K R  +S  QE +  S ++ +  L++FI V  D    M   G+YE+
Sbjct: 198 EQLVVEGHPLHPGAKLRKGMSA-QETIDYSSEYQHTMLMQFILVHHDVARTMAQHGTYEE 256

Query: 137 TI-------EKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANILPEKYSI 184
            +       + +           ++ + + VH  Q  +I     + +     I+P  Y+ 
Sbjct: 257 AVYHAFDGLKSVALQAIGSDAPLEDYMPLIVHPWQYEHIIRTEYQHELDTKAIIPLDYTK 316

Query: 185 KAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDR 242
              +  S RT+ +P+  D++  IKL   + +T  +RT++  +TH+GP + +I+  +    
Sbjct: 317 SYYAGLSFRTL-MPKKPDVSPHIKLSTNVHITGEIRTLSEQTTHNGPLMTNILTDISARD 375

Query: 243 NLL-----KVCKEFAGVY--------SIEKDFDIAKHSTCIIREDFNELNSDGERVIICA 289
            L          E AG +          E++    +  T   +  ++ ++S+   VI  +
Sbjct: 376 ALFNNVSTSPVPEIAGAHFYQPKDRHPDEQERRSEQLGTLFRQNIYDMIDSERLPVIPSS 435

Query: 290 ALVERDEFGK----SVVEKVWNLDTEQKRID----FFDRFVSILFKAFLPPVFVNGFSFE 341
            +V   E  +     +VE+    +     ID    +F  + + L    +P +   G + E
Sbjct: 436 LVVTHPETARPLIVELVERFRQTNDTTTDIDVRAQWFKTYAASLIDYVVPLLVKYGIALE 495

Query: 342 AHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVY 401
           AHLQN +A F+  +G     ++RDF G++   + L +   +     E+S    K    V+
Sbjct: 496 AHLQNTIAVFEPSTGAFSHMLIRDFEGLRIDAEQLAQMGYDTSHFHEKSRILTKSQTSVF 555

Query: 402 KILYHTLILCNVHRFARALNLHYNGIG-----WDIVRKHFKQ---------IVPRDHLLY 447
              +++ I  ++      L+  Y+ +      W IVR+  KQ         I P      
Sbjct: 556 NKAFYSTIQNHLGELVAVLSRFYDDVALENTLWSIVRQQIKQCFDKLEAADINPERLAHM 615

Query: 448 KTFLEQDKFNYKCLMEMKCDGLYRDYLYIPKPN 480
           +     +K +YKC+  M+      +Y YI   N
Sbjct: 616 QNVFFNEKIDYKCVTTMRLMDEAHEYTYIKVDN 648



>gi|241661803|ref|YP_002980163.1| IucA/IucC family protein [Ralstonia pickettii 12D]
 gi|502314388|ref|WP_012761004.1| IucA/IucC family protein [Ralstonia pickettii]
 gi|240863830|gb|ACS61491.1| IucA/IucC family protein [Ralstonia pickettii 12D]
          Length = 655

 Score = 87.8 bits (216), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 91/377 (24%), Positives = 160/377 (42%), Gaps = 41/377 (10%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEI-LPGSYDFMNPLIRFIEVPLDKMVIR-------- 131
           EQ    GH +HP +K R  ++P Q I L   ++   P I  + V   ++ +         
Sbjct: 207 EQWGTGGHPWHPAYKTRLGLAPDQVIALSPEFEAQVP-IGVVAVAAHRLQVTSMDGVQPY 265

Query: 132 -----GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANI--LP 179
                 ++ +T+    K L       +  + +PVH  Q          ++F    +  LP
Sbjct: 266 ANWFAATFPETMAAFRKALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLP 325

Query: 180 EKYSIKAKSQASLRTVVIPEL-NDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
           +  +I A+   S RTV   +      +KLP+ +++TS  RTV+P S   GP + ++++++
Sbjct: 326 D-INIAARPTMSFRTVAATDAPGGPMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERI 384

Query: 239 EID----RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
             +     ++L +  E  G++    D D A+H + I+R++     +  ER++   AL   
Sbjct: 385 LANDAALASVLSIVPERHGIHLACTDDDRARHLSMIVRDNPTARIAGNERLLPVGALFTP 444

Query: 295 DEFG-----------KSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAH 343
           D               +V+ +  +    ++   FFD ++ +   A +      G + EAH
Sbjct: 445 DFTADMTHAAAPLLLDTVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAH 504

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKI 403
            QN     D+ +G  V  VVRDFG +K    TL    G  +       T   D     K 
Sbjct: 505 QQNTFVVIDA-AGMPVRLVVRDFGDVKIALPTL-RGQGFSITPFRAGHTTYPDRDIPRKK 562

Query: 404 LYHTLILCNVHRFARAL 420
           L H  +LC++   A AL
Sbjct: 563 LIHAFLLCHIGELALAL 579



>gi|187927282|ref|YP_001897769.1| IucA/IucC family protein [Ralstonia pickettii 12J]
 gi|496532533|ref|WP_009239224.1| hypothetical protein [Ralstonia sp. 5_2_56FAA]
 gi|187724172|gb|ACD25337.1| IucA/IucC family protein [Ralstonia pickettii 12J]
 gi|348616692|gb|EGY66192.1| hypothetical protein HMPREF0989_01458 [Ralstonia sp. 5_2_56FAA]
          Length = 655

 Score = 87.8 bits (216), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 167/386 (43%), Gaps = 42/386 (10%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEI-LPGSYDFMNPLIRFIEVPLDKMVIR-------- 131
           EQ    GH +HP +K R  ++P Q I L   ++   PL   + V   ++ +         
Sbjct: 207 EQWGTGGHPWHPAYKTRLGLAPDQVIALSPEFEAQVPL-GVVAVAAHRLQVTTMDGVQPY 265

Query: 132 -----GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANI--LP 179
                 ++ +T+    K L       +  + +PVH  Q          ++F    +  LP
Sbjct: 266 ANWFAAAFPQTMAAFRKALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLP 325

Query: 180 EKYSIKAKSQASLRTVVIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
           +  +I A+   S RTV   +    A +KLP+ +++TS  RTV+P S   GP + ++++++
Sbjct: 326 D-INIAARPTMSFRTVAATDAPGGAMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERI 384

Query: 239 EID----RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
             +     ++L +  E  G++    D + A+H + I+R++     +   R++   AL   
Sbjct: 385 LANDAALASVLSIVPERHGIHLAGTDDERARHLSMIVRDNPTTRIAGNARLLPVGALFTP 444

Query: 295 DEFG-----------KSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAH 343
           D               +V+ +  +    ++   FFD ++ +   A +      G + EAH
Sbjct: 445 DFTADMTHAAAPLLLDTVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAH 504

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKI 403
            QN     D ++G  V  VVRDFG +K    TL ++ G  ++      T   D     K 
Sbjct: 505 QQNTFVVID-EAGMPVRLVVRDFGDVKIALPTL-QAQGFSIEPFRAGHTTYPDRDIPRKK 562

Query: 404 LYHTLILCNVHRFARAL-NLHYNGIG 428
           L H  +LC++   A AL   H + +G
Sbjct: 563 LIHAFLLCHIGELALALFPEHGSAVG 588



>gi|496576066|ref|WP_009277184.1| IucA/IucC family siderophore biosynthesis protein [Ralstonia sp.
           5_7_47FAA]
 gi|308921188|gb|EFP66832.1| siderophore biosynthesis protein, IucA/IucC family [Ralstonia sp.
           5_7_47FAA]
          Length = 625

 Score = 87.8 bits (216), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 167/386 (43%), Gaps = 42/386 (10%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEI-LPGSYDFMNPLIRFIEVPLDKMVIR-------- 131
           EQ    GH +HP +K R  ++P Q I L   ++   PL   + V   ++ +         
Sbjct: 177 EQWGTGGHPWHPAYKTRLGLAPDQVIALSPEFEAQVPL-GVVAVAAHRLQVTTMDGVQPY 235

Query: 132 -----GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANI--LP 179
                 ++ +T+    K L       +  + +PVH  Q          ++F    +  LP
Sbjct: 236 ANWFAAAFPQTMAAFRKALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLP 295

Query: 180 EKYSIKAKSQASLRTVVIPELNDIA-IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
           +  +I A+   S RTV   +    A +KLP+ +++TS  RTV+P S   GP + ++++++
Sbjct: 296 D-INIAARPTMSFRTVAATDAPGGAMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERI 354

Query: 239 EID----RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
             +     ++L +  E  G++    D + A+H + I+R++     +   R++   AL   
Sbjct: 355 LANDAALASVLSIVPERHGIHLAGTDDERARHLSMIVRDNPTTRIAGNARLLPVGALFTP 414

Query: 295 DEFG-----------KSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAH 343
           D               +V+ +  +    ++   FFD ++ +   A +      G + EAH
Sbjct: 415 DFTADMTHAAAPLLLDTVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAH 474

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKI 403
            QN     D ++G  V  VVRDFG +K    TL ++ G  ++      T   D     K 
Sbjct: 475 QQNTFVVID-EAGMPVRLVVRDFGDVKIALPTL-QAQGFSIEPFRAGHTTYPDRDIPRKK 532

Query: 404 LYHTLILCNVHRFARAL-NLHYNGIG 428
           L H  +LC++   A AL   H + +G
Sbjct: 533 LIHAFLLCHIGELALALFPEHGSAVG 558



>gi|495222011|ref|WP_007946785.1| siderophore synthetase [Pseudomonas sp. GM21]
 gi|398127231|gb|EJM16644.1| siderophore synthetase component [Pseudomonas sp. GM21]
          Length = 640

 Score = 87.8 bits (216), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 152/331 (45%), Gaps = 28/331 (8%)

Query: 131 RGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFAN-------ILPEKYS 183
           +G +    E++ + L       K+ + +P H  Q  + E    FAN       I+ +  +
Sbjct: 257 QGHFPLPAEQLQRHLQQLGLDVKDYLPLPSHPWQA-HEELPDSFANEIADNLLIVTDIVA 315

Query: 184 IKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL--- 238
                  S RTV +P+ + +A  +KLP+ +++TS  RTV+P S   GP +  +I K+   
Sbjct: 316 FTGHPTMSFRTV-LPDASRVAPMVKLPVALRLTSVQRTVSPRSARMGPRISQLILKILDQ 374

Query: 239 --EIDRNLLKVCKEFAGVYSIEK--DFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
             +I R LL +  E  GV+   +  D + ++H+  + R++   L  +GE  +   +L   
Sbjct: 375 EPQIQR-LLNIVPERIGVHYAPQPADDERSRHAAVLYRDNPLTLLQEGELAVPVGSLFAV 433

Query: 295 DEFGKSVVEKVWNL----DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLAR 350
           +EF + ++     L    D  +  + FFD ++SI   + L    + G +FEAH QN    
Sbjct: 434 NEFEQPLLRDWVRLAQGRDDSEAILAFFDDYLSIAVPSLLGIYLMYGVAFEAHQQNSFMV 493

Query: 351 FDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLIL 410
             +  G+L   ++RDFG ++  + TL  + G  + + +   T   +   V   L HT  +
Sbjct: 494 MGA-DGQLNRLLLRDFGDVRIDRKTL-HAKGLDIQLHDPEMTLYDNSGFVRDKLLHTTFM 551

Query: 411 CNVHRFARALNLHYN---GIGWDIVRKHFKQ 438
           C++         H++    I W+ +  H  Q
Sbjct: 552 CHLGELTLLCARHWSVPENILWERLATHVAQ 582



>gi|386716164|ref|YP_006182488.1| hypothetical protein HBHAL_4880 [Halobacillus halophilus DSM 2266]
 gi|504457999|ref|WP_014645101.1| hypothetical protein [Halobacillus halophilus]
 gi|384075721|emb|CCG47217.1| hypothetical protein HBHAL_4880 [Halobacillus halophilus DSM 2266]
          Length = 662

 Score = 87.4 bits (215), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 115/495 (23%), Positives = 212/495 (42%), Gaps = 70/495 (14%)

Query: 42  NDISNQLI----AEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKAR 97
           NDI   +I    ++++++  ++   Y   K + + +FS S+ +EQ +++GH  HP  K +
Sbjct: 186 NDIWKTVIKREASQLDAATTFE---YLEEKQKHTPDFSKSLFFEQLVVDGHHLHPGAKTK 242

Query: 98  HAISPIQEILPGSYDFMNPL-IRFIEVPLDKM--------VIRGSYEKTIEKITKLLXXX 148
             +S  Q++   S +F     +RF  V  D +        +++  + +      K L   
Sbjct: 243 LGLS-FQDVFQYSGEFHQSFGVRFAAVRRDYLRTTLEKGSILKRFFPREWHDAVKELNDR 301

Query: 149 XXXXKNTILIPVHELQ----IPNI--ESKFPFANILPEKYSIKAKSQASLRTVVIPELND 202
                   ++PVH  Q    +P+I  E  +    IL E   + A++ +S RTV   +   
Sbjct: 302 GYNADEFDVLPVHPWQFEHAVPSIYEEEIYREVMILLEDPKLSAQATSSFRTVAPMDNEA 361

Query: 203 IAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL---EIDRNLLKVCKEFAGVYSIEK 259
             +KL +  ++TS +R+++  +  +     S+I K+   E   N      E +G     +
Sbjct: 362 PVLKLAVNSQMTSTVRSISTQTAMNSTIFSSMIAKIMDQEEHLNGFVPLNELSGAAFRSE 421

Query: 260 DFDIAKHSTCIIREDFNELNSDGERVIICAAL-----VERDEFGKSVVEKVW---NLDTE 311
           D   +++ T +IRE+ +    + E  I   AL     V      K + E++    +L   
Sbjct: 422 DQLKSRNLTMLIRENIDAKIEEDEAAIAGMALYAESPVTETTMLKELAEQLRVEESLTKA 481

Query: 312 QKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKH 371
           Q   +FF+ ++  +  A++  +   G + E HLQN +  F  + G L  F  RD+GG + 
Sbjct: 482 QAAEEFFNDYIQTVIPAYVTLMVKYGVALEGHLQNSIPVF--RKGRLTRFFFRDWGGSRV 539

Query: 372 HQDTLFESIGERVDVLEESFTEA-----KDFPEVYKILYHTLILCNVHRFARALNLHYNG 426
           H+  +      R   L  SF         +  EV+  LY+T+   ++    R L L Y+G
Sbjct: 540 HEQRI------RKQNLNPSFATGSVSVTSELSEVHNKLYYTVFQNHLGEIIRQLVL-YSG 592

Query: 427 IG----WDIVR-------------KHFKQIVPRDHLLYKTFLEQDKFNYKCLMEMKCDGL 469
           +     W  V+              + K+ V  D    + FL Q    +K L +M+    
Sbjct: 593 LEEKDFWKQVKLTCEKTFETLREDPNLKKAVEED----RAFLYQSSVMHKSLTKMRLTD- 647

Query: 470 YRDYLYIPKPNLMMY 484
            ++Y Y   PN + Y
Sbjct: 648 SKEYGYNKVPNPLAY 662



>gi|493884199|ref|WP_006830393.1| hypothetical protein [Planococcus antarcticus]
 gi|388463970|gb|EIM06308.1| hypothetical protein A1A1_12117 [Planococcus antarcticus DSM 14505]
          Length = 662

 Score = 87.4 bits (215), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 187/424 (44%), Gaps = 55/424 (12%)

Query: 61  ITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNP-LIR 119
           I Y   K + +  +SSS+ +EQ   EGH  HP  K +  + P  ++   S +F    LI 
Sbjct: 205 IQYALSKKRSNPLWSSSLFFEQFSTEGHNLHPGSKTKEGLEP-GDVFSFSPEFRQSLLIY 263

Query: 120 FIEVPLDKMV--------IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESK 171
           F+ +  D +V        I   + +T +     +       K+  LIPVHE Q       
Sbjct: 264 FLAIRKDYLVSTEFHPDYIESKFPETAKLYEVQMKERGYKVKDYRLIPVHEWQ------- 316

Query: 172 FPFANILPEKY---------------SIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSA 216
             + N++P  Y               +I+  + +S RT+        A+KL +  ++TS 
Sbjct: 317 --YHNVIPSLYAEEIKMGIIVLFTGLAIEGAASSSFRTIWPKLFGKPALKLAVNSQMTST 374

Query: 217 LRTVTPW----STHSGPALGSIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIR 272
           +R+++P     S      + +I+++     N L +  E AG     +  + +++ T ++R
Sbjct: 375 IRSISPQTAMNSVEFSVMMQTIMEREPSLENFLPI-NEVAGYSFRSESIERSRNLTVVVR 433

Query: 273 EDFNELNSDGERVIICAALVERDEF-GKSVVEKV-------WNLDTEQKRIDFFDRFVSI 324
           E+F+   + GE  I   +L       GK+++ ++       +N +  +    F   ++S+
Sbjct: 434 ENFDSKLNPGEIAIPGCSLYNLSPISGKNLIAEIADEYCRYFNFNKAKGTDSFLTEYLSV 493

Query: 325 LFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV 384
           +   +L  +   G + E HLQN +  F  K+G+LV F  RD+GG + +++ L +  G ++
Sbjct: 494 VIPGYLILLVKYGVALEGHLQNSVPVF--KNGKLVRFYFRDWGGARIYENRLNQQ-GIKI 550

Query: 385 DVLEESFTEAKDFPEVYKILYHTLILCNVHRFARALNLHYNGIG----WDIVRKHFKQIV 440
           D   +S +   D  ++ +  ++T+   ++      L   Y+G      W  VR+   ++ 
Sbjct: 551 DFYPDSVSITSDEQKMREKAFYTVFQNHLGEIIMQL-CEYSGTQEKSLWKKVREACDKVF 609

Query: 441 PRDH 444
              H
Sbjct: 610 SELH 613



>gi|490771566|ref|WP_004633791.1| siderophore synthetase component [Ralstonia pickettii]
 gi|480892961|gb|ENZ76149.1| siderophore synthetase component [Ralstonia pickettii OR214]
          Length = 655

 Score = 87.4 bits (215), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 163/386 (42%), Gaps = 42/386 (10%)

Query: 81  EQSLLEGHAFHPMHKARHAISPIQEI-LPGSYDFMNPLIRFIEVPLDKMVIR-------- 131
           EQ    GH +HP +K R  ++P Q I L   ++   P I  + V   ++ +         
Sbjct: 207 EQWGTGGHPWHPAYKTRLGLAPDQVIALSPEFEAQVP-IGVVAVAAHRLQVTTMDGVQPY 265

Query: 132 -----GSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANI--LP 179
                 ++ +T+    K L       +  + +PVH  Q          ++F    +  LP
Sbjct: 266 ANWFAATFPQTMAAFRKALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLP 325

Query: 180 EKYSIKAKSQASLRTVVIPEL-NDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
           +  +I A+   S RTV   +      +KLP+ +++TS  RTV+P S   GP + ++++++
Sbjct: 326 D-INIAARPTMSFRTVAATDAPGGPMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERI 384

Query: 239 EID----RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
             +      +L +  E  G++      D A+H + I+R++     +  ER++   AL   
Sbjct: 385 LANDAALARVLSIVPERHGIHLAGTADDRARHLSMIVRDNPTARIAGNERLLPVGALFTP 444

Query: 295 D-------EFGKSVVEKVWNLDTEQKRID----FFDRFVSILFKAFLPPVFVNGFSFEAH 343
           D            ++E V     +  R +    FFD ++ +   A +      G + EAH
Sbjct: 445 DFTADMTHAAAPLLLETVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAH 504

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKI 403
            QN     D ++G  V  VVRDFG +K    TL    G  ++      T   D     K 
Sbjct: 505 QQNTFVVID-EAGMPVRLVVRDFGDVKIALPTL-RGQGFSIEPFRAGHTTYPDRDIPRKK 562

Query: 404 LYHTLILCNVHRFARAL-NLHYNGIG 428
           L H  +LC++   A AL   H + +G
Sbjct: 563 LIHAFLLCHIGELALALFPEHGSAVG 588



>gi|345568566|gb|EGX51459.1| hypothetical protein AOL_s00054g158 [Arthrobotrys oligospora ATCC
            24927]
          Length = 1206

 Score = 87.4 bits (215), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 99/387 (25%), Positives = 183/387 (47%), Gaps = 37/387 (9%)

Query: 86   EGHAFHPMHKARHAISPIQEIL--PGSYDFMNPLIRFIEVPLDKMVI---------RGSY 134
            EGH  HP  + R   SP   +   P S   ++   + + V  D++V+         R +Y
Sbjct: 759  EGHPTHPCRRTRLRFSPADSLAFAPDSGAIVSG--KIVAVRRDQLVLSEPSFSDVLRRNY 816

Query: 135  EKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPNI-ESKFPFANILP-EKYSIKAKS 188
                +  +  L           L+ VH  Q    +P I +S+  F  I+P  + +I  ++
Sbjct: 817  PFINDAASAALSRRGKKPDEFELVLVHPFQFETVLPRIYKSEINFGIIVPIPEVTIACRA 876

Query: 189  QASLRTVV--IPELND--IAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDRNL 244
             +S RT+V   P +    ++ K  + +++TS  RT++  S  +GP + +++ +L      
Sbjct: 877  TSSTRTLVSTAPGIQGKRLSFKTAIDVQITSTCRTISHESVRNGPYVSALLTRLLSSEPR 936

Query: 245  LKVCKEFAGV-YSIEKDFDIAKHS--TCIIREDFNELNSDGERVIICAALVERDEF-GKS 300
            +    E A V +S E +   ++    + ++R+D  +    GE +I CA L+ +    GK 
Sbjct: 937  ISCIAERASVAFSPEANCTASRQRGLSMLLRDDVADYIKPGEIIIGCAGLITKSPMSGKP 996

Query: 301  VVEKVWNL-----DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKS 355
            +V +V N      + E     F D++  +L  A LP ++ +G + EAHLQN L   D+ S
Sbjct: 997  LVVEVVNSLAQSDNHELTTRKFIDKYADLLLSAALPLLWRHGIALEAHLQNTLLVLDA-S 1055

Query: 356  GELVGFVVRDFGGIKHHQDTLFESIGERVDVL--EESFTEAKDFPEVYKILYHTLILCNV 413
               V  ++RDF G++ + D L ES GE +  +   ES T + D  +++    H++I  N+
Sbjct: 1056 RNPVRLLLRDFAGLRVNLDKLKES-GEDITKIPCPESRTMSADDEDIHCKFTHSVIFTNL 1114

Query: 414  HRFARALN-LHYNGIGWDIVRKHFKQI 439
               A AL+ +    + W+++R    ++
Sbjct: 1115 CPVADALSEIVSPSLLWEVIRARVTKV 1141



>gi|489295489|ref|WP_003203001.1| IucA/IucC [Bacillus mycoides]
 gi|228753217|gb|EEM02701.1| IucA/IucC [Bacillus mycoides Rock1-4]
 gi|228758501|gb|EEM07642.1| IucA/IucC [Bacillus mycoides Rock3-17]
          Length = 577

 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/369 (23%), Positives = 172/369 (46%), Gaps = 33/369 (8%)

Query: 69  QLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQ-EILPGSYDFMNPLIRFI------ 121
           Q  + F      E  ++EGH  HP  K +  +S  + ++    ++ + PL   +      
Sbjct: 135 QTCIPFDELTYTESLVIEGHPLHPSTKTKLGLSREEVKLYAPEFEHVVPLHVLLVHKEVA 194

Query: 122 EVPLDKMVIRGSYEKT---IEKITKLLXXXXXXXKNTILIPVHELQIPNI-----ESKFP 173
           EV  D M     YE +    E +  LL       ++     +H  Q  ++      S+  
Sbjct: 195 EVTGDYMQKPLIYENSPDLYEAVHTLLVNKEKRMEDYYPFLIHPWQYEHVLQEEYGSELE 254

Query: 174 FANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGS 233
              I+P  Y + +++  S RT+ + +L    +KLP+  + TSA+RTV+P  T +GP L +
Sbjct: 255 AGWIIPVPYQLSSRATLSFRTMNVLKL-PYHVKLPVRAQATSAVRTVSPEITINGPLLST 313

Query: 234 IIDKL-----EIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIIC 288
           ++D +     +++++++ V +     +S     D+ ++   I+RED N+   +GE + + 
Sbjct: 314 VLDGIYTKEQKLEQSIVVVRERVGAYFSKPNTRDLGRNLAFILREDPNQYRREGELLWVG 373

Query: 289 AALVERDEFGKS--VVEKVWNL-----DTEQKRIDFF-DRFVSILFKAFLPPVFVNGFSF 340
           A+L   +   ++  V+  +        D  +K I ++   +   +    L  V   G + 
Sbjct: 374 ASLTANNPLKENEPVILDIMRTYFDKEDIGKKEIFYYIAHYTEKVMLPLLELVLRYGIAL 433

Query: 341 EAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEV 400
           E H+QN +    +K+GE+   ++RD GG++ +++ L E I   + V++E     ++  EV
Sbjct: 434 EGHMQNSI--IVTKNGEVQRILIRDLGGVRIYKEKLAELID--LSVMKEVALFTENMTEV 489

Query: 401 YKILYHTLI 409
           Y    H+++
Sbjct: 490 YNKFIHSVL 498



>gi|493884198|ref|WP_006830392.1| hypothetical protein [Planococcus antarcticus]
 gi|388463969|gb|EIM06307.1| hypothetical protein A1A1_12112 [Planococcus antarcticus DSM 14505]
          Length = 632

 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 157/336 (46%), Gaps = 40/336 (11%)

Query: 74  FSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMV--IR 131
           FS  V  EQ +++GH  HP  K +  ++  QE++  S ++       I V + K +  + 
Sbjct: 171 FSPLVFGEQWVIDGHTLHPCTKTKLGLTA-QEVIKFSPEW-GANANLIPVAIHKNLASMN 228

Query: 132 GSYEKTIEKI---------TKLLXXXXXXXKNTILIPVHELQI-----PNIESKFPFANI 177
            + ++T+  I         T          K+  +IPVH  Q+     P +E +     I
Sbjct: 229 SNGKETMTDILLREYPNLSTVFKERLPNRGKDYEVIPVHPWQLKHTLKPYLEKEIAQTLI 288

Query: 178 LP-EKYSIKAKSQASLRTVVIPELNDIA--IKLPLGIKVTSALRTVTPWSTHSGPALGSI 234
           LP E   I A +  S+R++  P  +     IK  L +++TSA RTV+P S  +GP + +I
Sbjct: 289 LPLENVHIPASALLSVRSLA-PHGSKTLHHIKTALNVQMTSAKRTVSPASIKNGPVISAI 347

Query: 235 IDKLE-ID---RNLLKVCKEFAGVYSI----EKDFDIAKHSTCIIREDFNELNSDGERVI 286
           + K+E ID    N  +   E AG + +    +KD  + K+ + ++RE+  +  S+ E  +
Sbjct: 348 LKKIETIDPLVGNSYRFLSESAGGHYLSLQNDKDLFLKKNLSALLRENPEKNLSESEIAL 407

Query: 287 ICAALVERDEF-GKSVV-------EKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGF 338
             A L+ R  F GK ++        K   +D  +  + +   +  +L    +  +   G 
Sbjct: 408 PAAFLISRSPFTGKLILLELVENYSKTNEIDINKAAVKYICTYAELLLPGLITLISKYGI 467

Query: 339 SFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQD 374
           S EAHLQN +  F  K G  V F+ RD GGI+  +D
Sbjct: 468 SLEAHLQNTVPVF--KDGMPVRFLFRDNGGIRIKED 501



>gi|73662016|ref|YP_300797.1| hypothetical protein SSP0707 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|499621888|ref|WP_011302622.1| siderophore synthetase [Staphylococcus saprophyticus]
 gi|72494531|dbj|BAE17852.1| hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 585

 Score = 85.5 bits (210), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 102/383 (26%), Positives = 167/383 (43%), Gaps = 74/383 (19%)

Query: 44  ISNQLIAEINSSVQYQEITYKNYKHQLS-----LNFSSSVE------WEQSL-------- 84
           IS +L  E+ SS +   +TY+++ H+ S     L FS   E      W Q +        
Sbjct: 97  ISQRLTEELLSSREGFALTYEHFNHRQSLIHATLKFSKMPETINFFSWLQHMADTEQIND 156

Query: 85  --------LEGHAFHPMHKARHAIS--PIQEILPGSYDFMNPLIRFI------------- 121
                   +EGH  HP+ K +  +S   I++  P     +   I  I             
Sbjct: 157 LSYSESLVIEGHPTHPLSKTKLPLSEAEIKQYAPEFEKIIGLPIMLIHKQHCVITSMEND 216

Query: 122 -EVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPN-----IESK 171
            +  LD++V    Y     K+   L        +  L+ VH  Q    IP+     IESK
Sbjct: 217 TDFILDEIVPEYRY-----KLKAFLDVHDLELNDYSLMFVHPWQYEKVIPHQFAEWIESK 271

Query: 172 FPFANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPAL 231
           +    +LP  + ++AK+  S RT+ +       IKLP+ ++ TSA+RTV+  +T  GP L
Sbjct: 272 Y----LLPTPFEVEAKATLSFRTMQLIG-KPYHIKLPVDVQTTSAVRTVSSVTTVDGPKL 326

Query: 232 G-SIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAA 290
              + D L+I    L V  E  G+++ + + DIA+H  CI+R       +D    I+ A+
Sbjct: 327 SYELQDMLDIYPQ-LHVSMEPFGIHA-KTEPDIARHLACIVRH--QPYLADNGTTIVTAS 382

Query: 291 LVERDEFGKSV-VEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQ 345
           LV R+     + V+   N   ++   D   +F+S+  K  + P+       G + EAH+Q
Sbjct: 383 LVNRNPVDNQITVDSYLNWINDEITEDTIKKFLSVYTKTLIDPLVAYIQDYGIALEAHMQ 442

Query: 346 NVLARFDSKSGELVGFVVRDFGG 368
           N +          + F++RD GG
Sbjct: 443 NTIVNLGPNYQ--MQFIIRDLGG 463



>gi|494972604|ref|WP_007698630.1| IucA/IucC family protein [Halovivax asiaticus]
 gi|445659880|gb|ELZ12682.1| IucA/IucC family protein [Halovivax asiaticus JCM 14624]
          Length = 678

 Score = 84.7 bits (208), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 108/436 (24%), Positives = 182/436 (41%), Gaps = 54/436 (12%)

Query: 78  VEWEQSLLEGHAFHPMHKARHAISPIQEIL-PGSYDFMNPLIRFI----EVPLDKMVIRG 132
           V  E+ +++GH  HP  K R    P + +     YD + P +RF+    E      V  G
Sbjct: 227 VRSERLVVDGHPLHPGAKLRQGFRPSEVVAYAAEYDAV-PALRFVAIADEYAATAAVADG 285

Query: 133 -SYEKTIEKITKLLXXXXXXXKNT--------ILIPVHELQ-----IPNIESKFPFANIL 178
            ++ + + ++   L         T         ++PVH  Q           +     ++
Sbjct: 286 PTFTERLYRLVPGLRDAVADETTTAGRDPADVTVLPVHPWQYRHQLTNRYGRELDRGIVI 345

Query: 179 P-EKYSIKAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
           P    S+ A +  SLRT+V P+L+D      +K+ LGI+ TS++RT+TP +T +GP +  
Sbjct: 346 PVPDVSLPAGATLSLRTLV-PKLSDRQAPPHVKVSLGIRTTSSVRTITPQTTLNGPTVSD 404

Query: 234 IIDK-LEIDR-NLLKVCKEFAGV--------YSIEKDFDIAKHSTCIIREDFNELNSDGE 283
           +++  L  D    L    E AG         ++  +    AKH   ++R +  +   DGE
Sbjct: 405 VLETVLGADEFRTLSGLPETAGACFHDPDGPHTDGRGHVRAKHLAALLRRNPLDSVDDGE 464

Query: 284 RVIICAALVERDEF-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEA 342
             +  AAL+ R     + +++ +           F  R+   +    L  +   G   EA
Sbjct: 465 LPMTAAALLARGPLTDRPLIDSLVPEGGADAAAAFLRRYAEAIVPDALRLLVAYGVGLEA 524

Query: 343 HLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYK 402
           HLQN +  FD    + V  +VRD+GG++   D L E  G   +    S T        Y 
Sbjct: 525 HLQNCVVVFDEWKPKRV--LVRDYGGLRLCTDRLAEH-GYEFEPYPGSVTVDDGMEPAYD 581

Query: 403 ILYHTLILCNVHRFARALNLHYNGIG----W----DIVRKHFKQI----VPRDHLL-YKT 449
            L + L   ++    R L + Y  I     W    ++V   F ++    VP + +   +T
Sbjct: 582 KLTYALFQNHLAELVRVL-VRYRPIDESRCWALLSEVVADAFAELRRDGVPNEWVADAET 640

Query: 450 FLEQDKFNYKCLMEMK 465
            L    +NYKCL  M+
Sbjct: 641 VLYDATWNYKCLTTMR 656



>gi|488413269|ref|WP_002482654.1| siderophore synthetase [Staphylococcus saprophyticus]
 gi|379326119|gb|EHY93246.1| hypothetical protein SSME_07050 [Staphylococcus saprophyticus
           subsp. saprophyticus KACC 16562]
          Length = 585

 Score = 84.7 bits (208), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 102/383 (26%), Positives = 166/383 (43%), Gaps = 74/383 (19%)

Query: 44  ISNQLIAEINSSVQYQEITYKNYKHQLSL-----NFSSSVE------WEQSL-------- 84
           IS +L  E+ SS +   +TY+++ H+ SL      FS   E      W Q +        
Sbjct: 97  ISQRLTEELLSSREGFALTYEHFNHRQSLIHATLKFSKMPETINFFSWLQHMADTEQIND 156

Query: 85  --------LEGHAFHPMHKARHAISP--IQEILPGSYDFMNPLIRFI------------- 121
                   +EGH  HP+ K +  +S   I++  P     +   I  I             
Sbjct: 157 LSYSESLVIEGHPTHPLSKTKLPLSEAEIKQYAPEFEKIIGLPIMLIHKQHCVITSMEND 216

Query: 122 -EVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQ----IPN-----IESK 171
            +  LD++V    Y     K+   L        +  L+ VH  Q    IPN     IESK
Sbjct: 217 TDFILDEIVPEYRY-----KLKAFLDVHDLELNDYSLMFVHPWQYEKVIPNQFTEWIESK 271

Query: 172 FPFANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPAL 231
           +    +LP  + ++AK+  S RT+ +       IKLP+ ++ TSA+RTV+  +T  GP L
Sbjct: 272 Y----LLPTPFEVEAKATLSFRTMQLIG-KPYHIKLPVDVQATSAVRTVSSVTTVDGPKL 326

Query: 232 G-SIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAA 290
              + D L+I    L V  E  G+++ + + DIA+H  CI+R       +D    I+ A+
Sbjct: 327 SYELQDMLDIYPQ-LHVSMEPFGIHA-KTEPDIARHLACIVRH--QPYLADNGTTIVTAS 382

Query: 291 LVERDEFGKSV-VEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQ 345
           LV R+     + V+   N   ++       +F+S+  K  + P+       G + EAH+Q
Sbjct: 383 LVNRNPVDNQITVDSYLNWINDEITEGTIKKFLSVYTKTLIDPLVAYIQDYGIALEAHMQ 442

Query: 346 NVLARFDSKSGELVGFVVRDFGG 368
           N +          + F++RD GG
Sbjct: 443 NTIVNLGPNYQ--MQFIIRDLGG 463



>gi|491705331|ref|WP_005553745.1| IucA/IucC family protein [Natronococcus amylolyticus]
 gi|445606373|gb|ELY60277.1| IucA/IucC family protein [Natronococcus amylolyticus DSM 10524]
          Length = 704

 Score = 84.3 bits (207), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 174/386 (45%), Gaps = 64/386 (16%)

Query: 77  SVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPL-IRFIEVPLDKMVIRGSYE 135
           +  +E+ + +GH FHP  K R  ++   + L  + +F + + +RF+ V  D+     +  
Sbjct: 232 ATAFERIVTDGHPFHPSGKIRRGMN-AADGLAYAPEFTDRIDLRFVAV--DREYALETRA 288

Query: 136 KTIE--KITKLLXXXXXXXKNTI--------------LIPVHELQ----IP-----NIES 170
           + IE  ++T  L       +  +              ++PVH LQ    +P      IE 
Sbjct: 289 EAIEDGQLTDRLYTTFEGLEGALERAIPADRASEEYAVVPVHPLQYHRTVPERYADGIED 348

Query: 171 KFPFANILP-EKYSIKAKSQASLRTVVIPELNDIA------IKLPLGIKVTSALRTVTPW 223
                 ++P   Y+  A  Q +LRTVV    N  A      +KL + ++ T+ +RT++P 
Sbjct: 349 ----GRVVPIPDYTTPATPQLNLRTVVPYATNRTAEGPLPHLKLAIPVQTTNVVRTLSPH 404

Query: 224 STHSGPALGSIIDKLEIDRNL--LKVCKEFA--------GVYSIEKDFDIAKHSTCIIRE 273
           +  +GP +  ++  +E   +L  L +  E A        G +   + FD A+H + ++R+
Sbjct: 405 AVSNGPQVTDVVRAIEQREDLEQLGLLAEPAAACYYPPGGPHPEGEAFDDARHLSGLLRQ 464

Query: 274 DFNE---LNSDGERVIICAALVERDEFGKSVV--------EKVWNLDTEQKRIDFFDRFV 322
           +      +  DG  V+  + + +    G+ +V        ++     T +  + F +R+ 
Sbjct: 465 NPASHPLVPKDGVPVVASSLVADAPTTGRPLVCRVIERYGDRTGAPTTREAALSFLERYA 524

Query: 323 SILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGE 382
            ++    L  +   G + E+HLQN L  F+    E V  +VRD GGI+ H+D L E  G 
Sbjct: 525 DVVVPEQLALLSEYGVALESHLQNSLIVFE--DAEPVATLVRDLGGIRVHRDRLAER-GL 581

Query: 383 RVDVLEESFTEAKDFPEVYKILYHTL 408
            ++   +S  EA D  + Y+ L++ L
Sbjct: 582 SLEPYPDSDLEADDAADCYRKLHYAL 607



>gi|297528779|ref|YP_003670054.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
 gi|502909254|ref|WP_013144230.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
 gi|297252031|gb|ADI25477.1| IucA/IucC family protein [Geobacillus sp. C56-T3]
          Length = 643

 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 172/389 (44%), Gaps = 59/389 (15%)

Query: 37  WMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEW--------------EQ 82
           W     +I+N +I +  +    +    + ++      +SSS+EW              EQ
Sbjct: 131 WDEFCAEIANSVINDALAQAAAERRRCR-WRDTYGATYSSSLEWVRAQPRPFSPLTFYEQ 189

Query: 83  SLLEGHAFHPMHKARHAISPIQEILPGSYDFMN----PLI-------RFIEVPLDKMVIR 131
           ++++GH  HP  K R   S +Q+++  S ++      PL+       RF+     +M   
Sbjct: 190 TVIDGHTLHPCAKTRLGFS-VQDMIDYSPEWEAKVTLPLLAVRRSHCRFVSFSYGRMA-D 247

Query: 132 GSYE--KTIEKITK-LLXXXXXXXKNTILIPVHELQIPNI-----ESKFPFANILP-EKY 182
             YE  KT++ + +  L           +IPVH  Q  ++     +++     I+P +  
Sbjct: 248 WVYEQDKTLQSVVQNALRAYGLSECEYDVIPVHPWQWKHVIQQRFQNELAAQTIVPIDGG 307

Query: 183 SIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEIDR 242
            + A    S+RT +IP  +   +K P+ +++TSA+RTV+P +  +GP L   ++ + +  
Sbjct: 308 VLPAYPLVSVRTFMIPGASGDHLKTPINVQMTSAIRTVSPAAAANGPRLSLWLNDVLVKE 367

Query: 243 NL---LKVCKEFAGV------YSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVE 293
            L    +V  E AG+       +  +D  +AK  + I+R +     ++G+ +++ A  + 
Sbjct: 368 RLAPRFRVVSETAGISFSPQGRTDNEDAALAKQLSAIVRTNPERDLAEGD-IMMPAVTLL 426

Query: 294 RDEF--GKSVV-----EKVWNLDTEQKR---IDFFDRFVSILFKAFLPPVFVNGFSFEAH 343
              F  GK V      E   N      R   + FF ++  +L    L  +   G S EAH
Sbjct: 427 APSFLSGKPVAAELVEEYAANQGASSVREAAVWFFRQYAEMLVPPLLLLLCKYGISLEAH 486

Query: 344 LQNVLARFDSKSGELVGFVVRDFGGIKHH 372
           LQN L  F  +SG      VRD GGI+ H
Sbjct: 487 LQNSLPVF--RSGAPQSMHVRDLGGIRLH 513



>gi|496849119|ref|WP_009384844.1| hypothetical protein [Staphylococcus massiliensis]
 gi|425478655|gb|EKU45843.1| hypothetical protein C273_10647 [Staphylococcus massiliensis S46]
          Length = 586

 Score = 81.3 bits (199), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 114/448 (25%), Positives = 199/448 (44%), Gaps = 57/448 (12%)

Query: 71  SLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPL-IRFIEVPLDKMV 129
           S +F      E  + EGH  HP+ K +  ++   EI   + +F   + ++ + +  DK  
Sbjct: 151 STDFDPLTYSESLVFEGHTTHPLSKTKLPLTE-DEIRAYAPEFEKVIPLKLMLIAKDKAT 209

Query: 130 ---IRG-----------SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFA 175
              I G            Y+K +E     L        +  ++ VH  Q  ++     F+
Sbjct: 210 ETNIEGHESFILDQVLPEYKKPLE---TFLEPLQLELSDYHIVFVHPWQYEHVIID-AFS 265

Query: 176 N------ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGP 229
           N      ++P  +++ +K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP
Sbjct: 266 NWIKEKQLVPTPFTVDSKATLSFRTMDLIG-KPYHVKLPVKVQATSAIRTVSTVTTVDGP 324

Query: 230 ALG-SIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIIC 288
            L   + D L+I  N LKV  E  G+++ + + DIAK    IIR+   +L   G   ++ 
Sbjct: 325 HLSYQLQDMLDIYPN-LKVAMEPYGLHA-DAEEDIAKSLGYIIRKR-PDLGEAG-ITMVT 380

Query: 289 AALVERDEFGKSVVEKV---WNLDTEQKRIDFFDRFVSILFKAFLPPVF----VNGFSFE 341
           AALV  +   ++V       W  D   K  D    F+    +  +PP+       G + E
Sbjct: 381 AALVNENPIDEAVTVDSFIKWCEDALNK--DTIANFIQTYAETLIPPLISYIQTYGIALE 438

Query: 342 AHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTE--AKDFPE 399
           AH+QN +     ++G++  F+VRD GG + H  TL      RV  +E + T   ++D   
Sbjct: 439 AHMQNTIVNL-QQNGDMT-FIVRDLGGSRIHLPTL----QNRVPSIEITNTSLLSEDIEG 492

Query: 400 VYKILYHTLILCN----VHRFARALNLHYNGIGWDIVRKHFKQIVPRDHLLYKTF---LE 452
           V     H +I       +H F++  +++   + +DIVR   +Q +  D    +     L 
Sbjct: 493 VVHKFQHAVIQNQLGELIHHFSQYDDVNEQAL-FDIVRDVVEQSIDFDQQHAQALSDILF 551

Query: 453 QDKFNYKCLMEMKCDGLYRDYLYIPKPN 480
            D    K LM M+ +G  + Y+ +   N
Sbjct: 552 GDVITVKALMNMRMEGKVKKYITVDIAN 579



>gi|488381093|ref|WP_002450478.1| siderophore synthetase [Staphylococcus warneri]
 gi|239598193|gb|EEQ80686.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           warneri L37603]
          Length = 585

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 147/312 (47%), Gaps = 25/312 (8%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALG-SII 235
           ++P  +++++K+  S RT+ +   +   IKLP+ ++ TSA+RT++  +T  GP L  ++ 
Sbjct: 273 LIPTPFTVESKATLSFRTMELLH-HPFHIKLPVNVQATSAVRTISTVTTVDGPKLSYALQ 331

Query: 236 DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERD 295
           D L I    LKV  E  G Y ++ D D+A+   CI+RE    L  +G   I+ A+LV R+
Sbjct: 332 DMLNIYPE-LKVAAEPFGEY-VDVDPDLARQLACIVREK-PVLTQEGS-TIVSASLVNRN 387

Query: 296 EFGKSVV-----EKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLAR 350
                VV     +  +N  T +    F  ++ S L +  +  +   G + EAH+QN +  
Sbjct: 388 PVDNDVVVDSYIKWTYNELTSESIERFIRQYTSTLVRPLIAYIQDYGIALEAHMQNTIVN 447

Query: 351 FDSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLIL 410
                   + F+VRD GG +    TL   + + V++  ES   A     V     H ++ 
Sbjct: 448 LGPNYQ--MNFLVRDLGGSRIDLQTLKYKLPD-VEITNESLI-ADSIEAVIGKFQHAVVQ 503

Query: 411 CNVHRFARALNLHYNGIG----WDIVRKHFKQIVP--RDH--LLYKTFLEQDKFNYKCLM 462
             +       N  Y+ +     + IV++  +  +   ++H   L++    Q K + K L+
Sbjct: 504 NQLAELIHHFN-QYDMVNEQALFKIVQQEIETAIDDNKNHAEALHRVLFGQ-KISVKALL 561

Query: 463 EMKCDGLYRDYL 474
            M+ +   + YL
Sbjct: 562 SMRMENKVKKYL 573



>gi|319893130|ref|YP_004150005.1| siderophore synthetase superfamily, group B [Staphylococcus
           pseudintermedius HKU10-03]
 gi|505962104|ref|WP_015729485.1| siderophore synthetase [Staphylococcus pseudintermedius]
 gi|317162826|gb|ADV06369.1| Siderophore synthetase superfamily, group B [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 587

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 156/338 (46%), Gaps = 46/338 (13%)

Query: 72  LNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVIR 131
           L ++  + WE     GH  HP+ K +  ++  +EI   + +FM        +PL  +++R
Sbjct: 157 LGYTEGMVWE-----GHPSHPLTKTKLPLNA-EEIQQYAPEFMKI------IPLKMVLVR 204

Query: 132 GSYEKTI------------------EKITKLLXXXXXXXKNTILIPVHELQIPN-IESKF 172
            +  K+                    ++ + +        +  +I VH  Q  N I ++F
Sbjct: 205 KALLKSTTMTGEEDFVLRKMFPDKESQLRQWMQTYEGTLDDYRIILVHPWQYTNVITTRF 264

Query: 173 PFA----NILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSG 228
                  +++P  +++ +K+  S RT+ +       +KLP+ ++ TSA+RT++  +T  G
Sbjct: 265 KTMIAQHDVIPTPFTVDSKATLSFRTMRLLHY-PYHVKLPVNVQATSAVRTISTVTTVDG 323

Query: 229 PALG-SIIDKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVII 287
           P L   + D L+I    L V  E  G + I+ + D+A+    I+R    E+++     ++
Sbjct: 324 PKLSYQLQDMLDI-YPTLTVASEPYGAH-IDVEADLARQFAMIVRHS-PEVHTHDYTQLV 380

Query: 288 CAALVERDEF-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEA 342
            A L + +   G+ VV+ +          +   +F+    +A +PP+       G + EA
Sbjct: 381 TAVLTQVNPVDGQVVVDSLIEYLYGDMNGETIQQFMRQYMEALIPPLIAYIQQYGIALEA 440

Query: 343 HLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESI 380
           H QN + + D K  E + F+VRD GG + + +TL +++
Sbjct: 441 HQQNTILQMD-KENETLSFIVRDLGGSRIYPETLKQTV 477



>gi|488420744|ref|WP_002490129.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|374836511|gb|EHS00096.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU128]
          Length = 585

 Score = 79.3 bits (194), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  ++++AK+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVEAKATLSFRTMDLIH-KPYHVKLPVNVQATSAIRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KSTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
               +VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNHAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A +  EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADNIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKLLFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488406681|ref|WP_002476066.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|365230322|gb|EHM71427.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis 14.1.R1.SE]
 gi|374821816|gb|EHR85862.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU118]
 gi|374837057|gb|EHS00630.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU129]
 gi|394262919|gb|EJE07669.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM037]
 gi|394271287|gb|EJE15782.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM015]
          Length = 585

 Score = 79.0 bits (193), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  ++++AK+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVEAKATLSFRTMDLIH-KPYHVKLPVNVQATSAIRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
               +VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNHAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A +  EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADNIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKLLFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488426959|ref|WP_002496344.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394250964|gb|EJD96093.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM053]
 gi|394251353|gb|EJD96447.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM057]
          Length = 585

 Score = 79.0 bits (193), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  ++++AK+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVEAKATLSFRTMDLIH-KPYHVKLPVNVQATSAIRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
               +VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNHAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A +  EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADNIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKLLFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|495867462|ref|WP_008592041.1| hypothetical protein [Salimicrobium sp. MJ3]
 gi|407017935|gb|EKE30689.1| hypothetical protein MJ3_12005 [Salimicrobium sp. MJ3]
          Length = 577

 Score = 77.8 bits (190), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 102/457 (22%), Positives = 193/457 (42%), Gaps = 57/457 (12%)

Query: 73  NFSSSVEWEQSLLEGHAFHPMHKARHAISP--IQEILP--GSYDFMNPLIRFIEVPLDKM 128
           NFS  V +EQ +++GH  HP  + R  +SP  +++  P  G+   + PL     V  D++
Sbjct: 138 NFSPLVFFEQWVIDGHTTHPGTRTRLPMSPEDVRKYAPEWGASPELVPLA----VRTDRV 193

Query: 129 VIRGSYEKTIEKITKLLXXXXXXXKNTI-----LIPVHELQIPNI-----ESKFPFANIL 178
                +  T+                 +     LIP+H  Q  +      + +     ++
Sbjct: 194 RETAPFHTTMTGTLTETSPEVKEEFEVLSGSYRLIPLHPWQADHTLPVYYKKELEDGTMI 253

Query: 179 PEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKL 238
           P    + + +  S RT+ +       +K  + +++TSA+RTV+  ST + P +  ++ ++
Sbjct: 254 PLASRLPSYALMSFRTMALAGYGAPHLKTAMNVQMTSAVRTVSAASTRNAPVMAGLLTEI 313

Query: 239 E-IDRNLLKVC---KEFAGV-YSIEKDFDIA---KHSTCIIREDFNELNSDGERVIICAA 290
              D ++ +     ++ AG+ Y+ + D D +   K+   I+RE+      +GE  +  AA
Sbjct: 314 AGKDADIGETTTFSRDLAGIHYAPDDDRDRSFFEKNVASILRENPEAALQEGEIAMPAAA 373

Query: 291 LVERDEF-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLA 349
           L+      G  ++E++    TE+  I F + +  +L       +   G + EAHLQN + 
Sbjct: 374 LISTSPVTGSLLIEELAGETTEEAFISFLETYARVLLPGVTRLMSEYGIAMEAHLQNTVV 433

Query: 350 RFDSKSGELVGFVVRDFGGIKHHQDTLFESIGER-VDVLEESFTEA-KDFPEVYK-ILYH 406
               K    V   +RD GG++   + L     E  +D      T+  +D  +++   L+H
Sbjct: 434 IL--KDRHPVRIDIRDCGGVRILPERLNRHFEEAPIDPSTNLLTDKEEDLTDIFSHALFH 491

Query: 407 T------LILCNVHRFARALNLHYNGIGWDIVRKHFKQIV--------PRDHLLYKTFLE 452
                  +IL + H    A      G+ W  VR+  ++ +         RD    +  L 
Sbjct: 492 NHLGEIIMILASRHALPEA------GM-WAAVRRVLEESLHSSDTEQAARD----EERLT 540

Query: 453 QDKFNYKCLMEMKCDGLYRDYLYIPKPNLMMYKGERI 489
                 K L+ M+  G + DY ++  PN     GE +
Sbjct: 541 TRPARMKSLVRMRLSGQFTDYEFVDTPNPFQEGGEPV 577



>gi|488428284|ref|WP_002497669.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394248666|gb|EJD93897.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM049]
          Length = 585

 Score = 77.8 bits (190), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMTIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488441872|ref|WP_002511257.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|406656333|gb|EKC82740.1| hypothetical protein B440_06111 [Staphylococcus epidermidis
           AU12-03]
          Length = 585

 Score = 77.8 bits (190), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLSELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|487747655|ref|WP_001829766.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|251804433|gb|EES57090.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281296159|gb|EFA88680.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis SK135]
 gi|329736467|gb|EGG72735.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU028]
 gi|341656336|gb|EGS80055.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU109]
 gi|374410608|gb|EHQ81351.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU081]
 gi|383360254|gb|EID37657.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis IS-250]
 gi|383361270|gb|EID38648.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis IS-K]
 gi|394233626|gb|EJD79223.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM088]
 gi|394239933|gb|EJD85365.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM067]
 gi|394268739|gb|EJE13293.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM018]
          Length = 585

 Score = 77.8 bits (190), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLSELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488431213|ref|WP_002500598.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394264839|gb|EJE09508.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM020]
 gi|394275568|gb|EJE19941.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM008]
 gi|394294991|gb|EJE38651.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH05003]
          Length = 585

 Score = 77.8 bits (190), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLSELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488434304|ref|WP_002503689.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394279060|gb|EJE23370.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM001]
          Length = 585

 Score = 77.8 bits (190), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 137/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTVSDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+       ++  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIEDEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|57867701|ref|YP_189343.1| hypothetical protein SERP1779 [Staphylococcus epidermidis RP62A]
 gi|488387612|ref|WP_002456997.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|57638359|gb|AAW55147.1| conserved hypothetical protein [Staphylococcus epidermidis RP62A]
 gi|291317443|gb|EFE57865.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis M23864:W2(grey)]
 gi|329737056|gb|EGG73311.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU045]
 gi|341656249|gb|EGS79969.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU037]
 gi|374401994|gb|EHQ73040.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU041]
 gi|374817549|gb|EHR81728.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU117]
 gi|374817657|gb|EHR81835.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU120]
 gi|374831755|gb|EHR95487.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU127]
 gi|374835350|gb|EHR98965.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU126]
 gi|394239735|gb|EJD85168.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM070]
 gi|394263386|gb|EJE08117.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM021]
 gi|394277352|gb|EJE21676.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM003]
 gi|394283061|gb|EJE27238.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH05005]
 gi|394285259|gb|EJE29342.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH04008]
 gi|394287505|gb|EJE31465.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH08001]
 gi|394290759|gb|EJE34605.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH05001]
 gi|394296928|gb|EJE40542.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH06004]
 gi|394298406|gb|EJE41976.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH04003]
 gi|394301247|gb|EJE44709.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH051668]
 gi|394303649|gb|EJE47066.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIH051475]
 gi|477934109|gb|ENL47629.1| aerobactin biosynthesis protein [Staphylococcus epidermidis M0881]
          Length = 585

 Score = 77.4 bits (189), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488431303|ref|WP_002500688.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394273746|gb|EJE18176.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM031]
          Length = 585

 Score = 77.4 bits (189), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 135/309 (43%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  ++I++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTIESKATLSFRTMDLIH-KPYHVKLPVNVQATSAIRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    I+ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTIVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
               +VV+        +  +D    F+++  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNHAVVDSYLKWIENEITLDHIKHFIAVYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAGKLKKLLFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488377971|ref|WP_002447356.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|242232632|gb|EES34944.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis W23144]
 gi|394242697|gb|EJD88085.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM061]
 gi|394266309|gb|EJE10953.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM023]
          Length = 585

 Score = 77.4 bits (189), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  ++I++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L + + 
Sbjct: 273 LLPTPFTIESKATLSFRTMDLIH-KPYHVKLPVNVQATSAIRTVSSVTTVDGPKLSNALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
               +VV+        +  +D    F+++  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNHAVVDSYLKWIENEITLDHIKHFIAVYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKLLFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488416516|ref|WP_002485901.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|374403578|gb|EHQ74578.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU065]
          Length = 585

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RT++  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTISSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLSELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488398381|ref|WP_002467766.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|329731253|gb|EGG67623.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU144]
          Length = 585

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-MDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488419888|ref|WP_002489273.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|374829510|gb|EHR93310.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU125]
          Length = 585

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTVSDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|27468688|ref|NP_765325.1| hypothetical protein SE1770 [Staphylococcus epidermidis ATCC 12228]
 gi|488415990|ref|WP_002485375.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis]
 gi|27316236|gb|AAO05411.1|AE016750_16 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|374403050|gb|EHQ74059.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU057]
          Length = 585

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQILVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488401268|ref|WP_002470653.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|341650923|gb|EGS74732.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU105]
 gi|374828398|gb|EHR92233.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU123]
 gi|394255116|gb|EJE00075.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM039]
          Length = 585

 Score = 76.6 bits (187), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPYGAYA-HTVSDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488404721|ref|WP_002474106.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|365226206|gb|EHM67428.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis VCU071]
          Length = 585

 Score = 76.6 bits (187), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 137/310 (44%), Gaps = 21/310 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIV----PRDHLLYKTFLEQDKFNYKCLMEM 464
            +       N +   I    ++IVR+  +  +    P    L K  L       K L+ M
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNHKPHAEKL-KKILFGSTITVKALLSM 563

Query: 465 KCDGLYRDYL 474
           + +   + YL
Sbjct: 564 RMENKVKKYL 573



>gi|488385642|ref|WP_002455027.1| siderophore synthetase [Staphylococcus hominis]
 gi|313656447|gb|EFS20187.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           hominis subsp. hominis C80]
          Length = 585

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 182 YSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID 241
           + + +K+ +S RT+ +   +   +KLP+ ++ TSA+RTV+P +T  GP L   + +    
Sbjct: 277 FQVPSKATSSFRTMSLIN-HPYHVKLPVNVQATSAVRTVSPETTIDGPKLSQALHRELNQ 335

Query: 242 RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEFGKSV 301
              L V  E  G+++ + D D A+   CIIRE       D   +++  ALV ++     +
Sbjct: 336 YTQLDVALEPYGLFA-KTDSDDARQLACIIRE--KPFTKDDGILLVTGALVNKNVVDNEI 392

Query: 302 VEKVW----NLDTEQKRIDFFDR-FVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSG 356
               +    N D  Q  I  F R +   L    L  +   G + EAH+QN L     K  
Sbjct: 393 TVDSYLKWINDDINQHTIRQFMRNYTRQLVTPLLALIQDYGIALEAHMQNTLVHLGPKYQ 452

Query: 357 ELVGFVVRDFGG 368
             + F+VRD GG
Sbjct: 453 --IQFIVRDLGG 462



>gi|488419241|ref|WP_002488626.1| siderophore synthetase [Staphylococcus hominis]
 gi|374822929|gb|EHR86941.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           hominis VCU122]
          Length = 585

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 182 YSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID 241
           + + +K+ +S RT+ +   +   +KLP+ ++ TSA+RTV+P +T  GP L   + +    
Sbjct: 277 FQVPSKATSSFRTMSLIN-HPYHVKLPVNVQATSAVRTVSPETTIDGPKLSQALHRELNQ 335

Query: 242 RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEFGKSV 301
              L V  E  G+++ + D D A+   CIIRE       D   +++  ALV ++     +
Sbjct: 336 YTQLDVALEPYGLFA-KTDSDDARQLACIIRE--KPFTKDDGILLVTGALVNKNVVDNEI 392

Query: 302 VEKVW----NLDTEQKRIDFFDR-FVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSG 356
               +    N D  Q  I  F R +   L    L  +   G + EAH+QN L     K  
Sbjct: 393 TVDSYLKWINDDINQHTIRQFMRNYTRQLVTPLLALIQDYGIALEAHMQNTLVHLGPKYQ 452

Query: 357 ELVGFVVRDFGG 368
             + F+VRD GG
Sbjct: 453 --IQFIVRDLGG 462



>gi|488424773|ref|WP_002494158.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394231960|gb|EJD77581.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM095]
 gi|394231988|gb|EJD77608.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM087]
          Length = 585

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGMALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEIAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488408235|ref|WP_002477620.1| hypothetical protein [Staphylococcus epidermidis]
 gi|410879256|gb|EKS27106.1| hypothetical protein HMPREF9281_02015 [Staphylococcus epidermidis
           BVS058A4]
          Length = 585

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 19/309 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGMALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIVPRDHL---LYKTFLEQDKFNYKCLMEMK 465
            +       N +   I    ++IVR+  +  +  D       K  L       K L+ M+
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEIAIDNDKPHAEKLKKILFGSTITVKALLSMR 564

Query: 466 CDGLYRDYL 474
            +   + YL
Sbjct: 565 MENKVKKYL 573



>gi|488379023|ref|WP_002448408.1| siderophore synthetase [Staphylococcus hominis]
 gi|228271279|gb|EEK12647.1| siderophore biosynthesis protein, IucA/IucC family [Staphylococcus
           hominis SK119]
          Length = 585

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 182 YSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID 241
           + + +K+ +S RT+ +   +   +KLP+ ++ TSA+RTV+P +T  GP L   + +    
Sbjct: 277 FQVPSKATSSFRTMSLIN-HPYHVKLPVNVQATSAVRTVSPETTIDGPKLSQALHRELNQ 335

Query: 242 RNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDEFGKSV 301
              L V  E  G+++ + D D A+   CIIRE       D   +++  ALV ++     +
Sbjct: 336 YTQLDVALEPYGLFA-KTDSDDARQLACIIRE--KPFTKDDGILLVTGALVNKNVVDNEI 392

Query: 302 VEKVW----NLDTEQKRIDFFDR-FVSILFKAFLPPVFVNGFSFEAHLQNVLARFDSKSG 356
               +    N D  Q  I  F R +   L    L  +   G + EAH+QN L     K  
Sbjct: 393 TVDSYLKWINDDINQHTIRQFMRNYTRQLVTPLLALIQDYGIALEAHMQNTLVHLGPKYQ 452

Query: 357 ELVGFVVRDFGG 368
             + F+VRD GG
Sbjct: 453 --IQFIVRDLGG 462



>gi|488429198|ref|WP_002498583.1| siderophore synthetase [Staphylococcus epidermidis]
 gi|394253251|gb|EJD98264.1| aerobactin biosynthesis protein, IucA/IucC family [Staphylococcus
           epidermidis NIHLM040]
          Length = 596

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 137/310 (44%), Gaps = 21/310 (6%)

Query: 177 ILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIID 236
           +LP  +++++K+  S RT+ +       +KLP+ ++ TSA+RTV+  +T  GP L   + 
Sbjct: 273 LLPTPFTVESKATLSFRTMDLIH-TPYHVKLPVNVQATSAVRTVSSVTTVDGPKLSHALQ 331

Query: 237 KLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
            L  +   L+V  E  G Y+     D++K    IIR+       D    ++ A+LV  + 
Sbjct: 332 GLLQEFPELQVAMEPFGAYA-HTASDLSKQLALIIRQ--KPTIYDYGCTVVTASLVNPNP 388

Query: 297 F-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV----NGFSFEAHLQNVLARF 351
              ++VV+        +  +D    F++I  +  + P+       G + EAH+QN +   
Sbjct: 389 IDNQAVVDSYLKWIENEITLDHIKHFIAIYTQTLVTPLIAYIQNYGIALEAHMQNTIVNL 448

Query: 352 DSKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILC 411
                  + F+VRD GG +   +TL + + + +DV  ES   A    EV     H +I  
Sbjct: 449 GPNYK--MKFIVRDLGGSRIDLNTLKQKVPQ-IDVTNESLI-ADTIEEVIAKFQHAVIQN 504

Query: 412 NVHRFARALNLHYNGIG---WDIVRKHFKQIV----PRDHLLYKTFLEQDKFNYKCLMEM 464
            +       N +   I    ++IVR+  +  +    P    L K  L       K L+ M
Sbjct: 505 QLAELIHHFNQYDEVIEEELFEIVREEIEMAIDNHKPHAEKL-KKILFGSTITVKALLSM 563

Query: 465 KCDGLYRDYL 474
           + +   + YL
Sbjct: 564 RMENKVKKYL 573



>gi|447184552|ref|WP_001261808.1| siderophore biosynthesis protein [Bacillus cereus]
 gi|401658570|gb|EJS76066.1| hypothetical protein ICY_02817 [Bacillus cereus BAG2X1-3]
          Length = 612

 Score = 75.9 bits (185), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 175/410 (42%), Gaps = 71/410 (17%)

Query: 6   KSSMNFIFSSYDSN-----DSIEEISAVE--LMRIFGVWMNLENDISNQLIAEINSSVQY 58
           +  M F   S DS+     D  +E+ +V   L  +F V +N+E    +  I E+  ++  
Sbjct: 72  RVRMTFGRISLDSSIVRVQDEQQEVQSVSQFLEEVFRV-VNVEETKLDSFIYELEQTIFK 130

Query: 59  QEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLI 118
             I      ++      S  E+E  L++GH +HP +KAR           G Y+FM P I
Sbjct: 131 DTIAQYERNNKEEYTQKSYDEFESYLIDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-I 188

Query: 119 RFI---------------EVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHEL 163
           + I               EV  DK++I    E+ +E   +L+       K  + IPVH  
Sbjct: 189 KLIWIAAHKKYTSVGYENEVIYDKILIEEIGERKLEGFMELIHSAGCNPKQYVFIPVHPW 248

Query: 164 Q-----IPNIESKFPFANILPEK---YSIKAK----SQASLRTVV-IPELNDIAIKLPLG 210
           Q     IPN      +A+ + +K   Y  K++    +Q S+RT+  +  L    +KL L 
Sbjct: 249 QWENFIIPN------YADHIQDKCIIYLGKSEDDYCAQQSMRTLRNVTNLKKPYVKLSLN 302

Query: 211 IKVTSALRTVTPWSTHSGPALGSII------DKLEIDRNLLKVCKEFAGVYSIEKDFDIA 264
           I  TS LRT+ P+S  S PA+ + +      D    D + + +  EF+ V      +D  
Sbjct: 303 ILNTSTLRTLKPYSVVSAPAISNWLHDVVSHDPYLRDESRMILLHEFSSV-----TYDTN 357

Query: 265 KHST-----CIIREDFNELNSDGERVIICAALVERDEFGKSVVEKVWNLDTEQKRIDFFD 319
           K S      CI RE  ++     E  +    L  +++ G  +++   N      +    +
Sbjct: 358 KKSVYGSLGCIWRESVHKYLDTKEDAVPFNGLYAKEKDGTPIIDAWLN------KYGIEN 411

Query: 320 RFVSILFKAFLPP---VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDF 366
               ++ KA +P    V  +G + E+H QN++  F  + G  V   ++DF
Sbjct: 412 WLQLLIQKAIIPVLHLVVEHGIALESHGQNMI--FVHREGVPVRIALKDF 459



>gi|489354455|ref|WP_003261497.1| siderophore biosynthesis protein [Bacillus thuringiensis]
 gi|74489202|gb|EAO52673.1| Siderophore synthase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 439

 Score = 75.9 bits (185), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y      N  S  E+E  L
Sbjct: 41  VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEY------NQKSYDEFESHL 88

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 89  IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 146

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 147 IEEIGERKLEEFMERICNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 206

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 207 DEYCAQQSMRTVRNITNPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 264

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 265 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 324

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 325 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 376

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 377 VHKEGVPVRIALKDF 391



>gi|218896965|ref|YP_002445376.1| petrobactin biosynthesis protein AsbB [Bacillus cereus G9842]
 gi|447184562|ref|WP_001261818.1| siderophore biosynthesis protein [Bacillus cereus]
 gi|218545313|gb|ACK97707.1| petrobactin biosynthesis protein AsbB [Bacillus cereus G9842]
          Length = 612

 Score = 75.5 bits (184), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y      N  S  E+E  L
Sbjct: 109 VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEY------NQKSYDEFESHL 156

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 157 IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 214

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 215 IEEIGERKLEEFMERICNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 274

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 275 DEYCAQQSMRTVRNITNPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 332

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 333 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 392

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 393 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 444

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 445 VHKEGVPVRIALKDF 459



>gi|434374946|ref|YP_006609590.1| petrobactin biosynthesis protein AsbB [Bacillus thuringiensis
           HD-789]
 gi|504708121|ref|WP_014895223.1| petrobactin biosynthesis protein AsbB [Bacillus thuringiensis]
 gi|401873503|gb|AFQ25670.1| petrobactin biosynthesis protein AsbB [Bacillus thuringiensis
           HD-789]
          Length = 610

 Score = 75.5 bits (184), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y      N  S  E+E  L
Sbjct: 107 VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEY------NQKSYDEFESHL 154

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 155 IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 212

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 213 IEEIGERKLEEFMERICNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 272

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 273 DEYCAQQSMRTVRNITNPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 330

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 331 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 390

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 391 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 442

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 443 VHKEGVPVRIALKDF 457



>gi|447157737|ref|WP_001234993.1| siderophore biosynthesis protein [Bacillus thuringiensis]
          Length = 612

 Score = 75.1 bits (183), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 92/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y  +      S  E+E  L
Sbjct: 109 VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEYTQK------SYDEFESHL 156

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 157 IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 214

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 215 IEEIGERKLEEFMERIRNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 274

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 275 DEYCAQQSMRTVRNITSPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 332

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 333 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 392

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 393 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 444

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 445 VHKEGVPVRIALKDF 459



>gi|447184561|ref|WP_001261817.1| siderophore biosynthesis protein [Bacillus cereus]
 gi|228859021|gb|EEN03460.1| Siderophore biosynthesis protein [Bacillus thuringiensis IBL 4222]
 gi|401078907|gb|EJP87212.1| hypothetical protein IC1_03995 [Bacillus cereus VD022]
 gi|401198675|gb|EJR05591.1| hypothetical protein II5_03019 [Bacillus cereus MSX-A1]
 gi|500282373|gb|EOO07110.1| siderophore biosynthesis protein [Bacillus cereus str. Schrouff]
 gi|500368322|gb|EOO85030.1| siderophore biosynthesis protein [Bacillus cereus K-5975c]
 gi|500524550|gb|EOP89884.1| siderophore biosynthesis protein [Bacillus cereus HuB4-4]
 gi|500628677|gb|EOQ68377.1| siderophore biosynthesis protein [Bacillus cereus TIAC219]
          Length = 612

 Score = 75.1 bits (183), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y      N  S  E+E  L
Sbjct: 109 VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEY------NQKSYDEFESHL 156

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 157 IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 214

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 215 IEEIGERKLEEFMERICNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 274

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 275 DEYCAQQSMRTVRNITNPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 332

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 333 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 392

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 393 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 444

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 445 VHKEGVPVRIALKDF 459



>gi|489400410|ref|WP_003306819.1| siderophore biosynthesis protein [Bacillus thuringiensis]
 gi|228851900|gb|EEM96699.1| Siderophore biosynthesis protein [Bacillus thuringiensis IBL 200]
          Length = 608

 Score = 75.1 bits (183), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 92/375 (24%), Positives = 152/375 (40%), Gaps = 57/375 (15%)

Query: 25  ISAVELMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSSSVEWEQSL 84
           +++VE  ++      LE  I    IA      QY+    K Y  +      S  E+E  L
Sbjct: 105 VASVEQAKLDSFMHELEQTIFKDTIA------QYERNNKKEYTQK------SYDEFESHL 152

Query: 85  LEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI---------------EVPLDKMV 129
           ++GH +HP +KAR           G Y+FM P I+ I               EV  D+++
Sbjct: 153 IDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-IKLIWIAAHKKYSSVGYENEVIYDEIL 210

Query: 130 IRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPN---------IESKFPFANILPE 180
           I    E+ +E+  + +       K  + IPVH  Q  N         I+ KF       E
Sbjct: 211 IEEIGERKLEEFMERIRNRGCNPKQYVFIPVHPWQWENFIISNYADHIQGKFIIYLGTSE 270

Query: 181 KYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSII----- 235
                 +S  ++R +  P+     +KL + +  TS LRT+ P+S  S PA+ + +     
Sbjct: 271 DEYCAQQSMRTVRNITSPK--KPYVKLSMNLLNTSTLRTLKPYSVVSAPAISNWLSDVVS 328

Query: 236 -DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVER 294
            D    D   L + KEF+ V        I     CI RE  ++     E  I    L  +
Sbjct: 329 NDAYLSDEARLILLKEFSSVTYDTNKKAIYGSLGCIWRESVHKYLDAQEDAIPFNGLYAK 388

Query: 295 DEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NGFSFEAHLQNVLARF 351
           ++ G  +++   N      +    D    ++ KA +P + +   +G + E+H QN++   
Sbjct: 389 EKDGTPIIDAWLN------KYGMKDWLQLLIQKAIIPVIHLVVEHGIALESHGQNMI--L 440

Query: 352 DSKSGELVGFVVRDF 366
             K G  V   ++DF
Sbjct: 441 VHKEGVPVRIALKDF 455



>gi|52143438|ref|YP_083391.1| siderophore biosynthesis protein [Bacillus cereus E33L]
 gi|446289927|ref|WP_000367782.1| siderophore biosynthesis protein [Bacillus cereus]
 gi|51976907|gb|AAU18457.1| siderophore biosynthesis protein [Bacillus cereus E33L]
          Length = 610

 Score = 75.1 bits (183), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 96/389 (24%), Positives = 163/389 (41%), Gaps = 60/389 (15%)

Query: 19  NDSIEEISAVE--LMRIFGVWMNLENDISNQLIAEINSSVQYQEITYKNYKHQLSLNFSS 76
            D  +EI +V   L  +F V +N+E    +  I E+  ++    I      ++L     S
Sbjct: 88  QDGKQEIQSVAQFLEEVFRV-VNVEQTKLDSFIHELEQTIFKDTIAQYERCNKLKYTQKS 146

Query: 77  SVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFI--------------- 121
             EWE  L++GH +HP +KAR           G Y+FM P I+ I               
Sbjct: 147 YDEWESHLIDGHPYHPSYKARIGFQYRDNFRYG-YEFMRP-IKLIWIAAHKKNATVGYEN 204

Query: 122 EVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNI----------ESK 171
           EV  DK++     E+ +E   + +       K  + IPVH  Q  N           +  
Sbjct: 205 EVIYDKILKSEVGERKLEAYKERIHSMGCDPKQYLFIPVHPWQWENFIISNYAEDIQDKS 264

Query: 172 FPFANILPEKYSIKAKSQASLRTVVIPELNDIAIKLPLGIKVTSALRTVTPWSTHSGPAL 231
             +     + Y  + +S  +LR V  P+     +K+ L I  TS LRT+ P+S  S PA+
Sbjct: 265 IIYLGESADDYCAQ-QSMRTLRNVTNPKRP--YVKVSLNILNTSTLRTLKPYSVASAPAI 321

Query: 232 GSII------DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHST-----CIIREDFNELNS 280
            + +      D    D + + + KEF+ V      +D  K  T     CI RE  +    
Sbjct: 322 SNWLSNVVSQDSYLRDESRVILLKEFSSVM-----YDTNKKGTYGSLGCIWRESVHHYLG 376

Query: 281 DGERVIICAALVERDEFGKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFV---NG 337
           + E  +    L  +++ G  +++   N    +  I+ + R   ++ KA +P + +   +G
Sbjct: 377 EQEDAVPFNGLYAKEKDGTPIIDAWLN----KYGIENWLRL--LIQKAIIPVIHLVVEHG 430

Query: 338 FSFEAHLQNVLARFDSKSGELVGFVVRDF 366
            + E+H QN++     K G  V   ++DF
Sbjct: 431 IALESHGQNMI--LVHKEGLPVRIALKDF 457



>gi|490468479|ref|WP_004338999.1| hypothetical protein [Francisella novicida]
 gi|151571308|gb|EDN36962.1| hypothetical protein FTCG_01681 [Francisella novicida GA99-3549]
          Length = 639

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 185/466 (39%), Gaps = 80/466 (17%)

Query: 40  LENDISNQLIAEINSSVQYQEIT-------YKNYKHQLSLNFSSSVEW---EQSLLEGHA 89
           L+N   N+L   I   ++ +++        Y N    L+   S + +    EQ    GH 
Sbjct: 139 LDNSFENELSMNIYRGLRQKQLANTINSADYLNLWQWLTTTMSKNQQLAFLEQWGAVGHI 198

Query: 90  FHPMHKARHAISPIQEILPGSYDFMNPL-------------IRFIEVPLDK----MVIRG 132
           +HP  K +  +S  + IL  S +F N +             I  I+  +D     M+I  
Sbjct: 199 YHPSSKTKIGLSKFENIL-YSPEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMII-- 255

Query: 133 SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSI-------- 184
           +Y +  +     L        N ++IP+H  Q           +ILP K+          
Sbjct: 256 NYPEQYKIWYHELDNRGLDSNNYLMIPIHPWQA---------EHILPAKHKCLIDCQQLI 306

Query: 185 -------KAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
                    K   S RT++     D      IKLP+ I  TS  RTV+P S  +GP +  
Sbjct: 307 IINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKLPVAIHATSVTRTVSPESVKTGPRISK 366

Query: 234 IIDKLEIDRNLLK----VCKEFAGVYSIEK-DFDIAKHSTCIIREDFNELNSDGERVIIC 288
           I+ ++    N L     +  + AG+++ +    D  +  + I R +  EL    E     
Sbjct: 367 ILLEILAKENHLAKNMDILADIAGIHTTKACRKDDIRQLSAIFRTNPEELLDSDEVACPL 426

Query: 289 AALVERDEFGKSVVEKVWNL---DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           A+L  +    ++++  +  L   +   + + +F ++  I   A L    + G + EAH Q
Sbjct: 427 ASLFVKTPQNQALICDILELLDYNQPSQILAYFRKYTKITLTACLDLYLLYGIALEAHQQ 486

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV--DVLEESFTEAKDFPEVYKI 403
           N L  F     +    ++RD GG++ H  + FE+ G  +  D    +FT ++      + 
Sbjct: 487 NTLVVFKENMPQ--KLLIRDLGGMRLHLPS-FEASGFHLPKDTFSLTFTNSQTI--TRRK 541

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVR----KHFKQIVPR 442
             H  +  N+      L+ HY    G  W IV+    + F+ + PR
Sbjct: 542 FIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKDEIHQRFEYLKPR 587



>gi|118498243|ref|YP_899293.1| siderophore biosynthesis protein [Francisella novicida U112]
 gi|489131530|ref|WP_003041317.1| ribosomal L29e protein family protein, putative [Francisella
           novicida]
 gi|95045103|gb|ABF50968.1| FigA [Francisella novicida U112]
 gi|118424149|gb|ABK90539.1| siderophore biosynthesis protein [Francisella novicida U112]
 gi|194321492|gb|EDX18977.1| ribosomal L29e protein family protein, putative [Francisella
           tularensis subsp. novicida FTE]
          Length = 639

 Score = 74.7 bits (182), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 185/466 (39%), Gaps = 80/466 (17%)

Query: 40  LENDISNQLIAEINSSVQYQEIT-------YKNYKHQLSLNFSSSVEW---EQSLLEGHA 89
           L+N   N+L   I   ++ +++        Y N    L+   S + +    EQ    GH 
Sbjct: 139 LDNSFENELSMNIYRGLRQKQLANTINSADYLNLWQWLTTTMSKNQQLAFLEQWGAVGHI 198

Query: 90  FHPMHKARHAISPIQEILPGSYDFMNPL-------------IRFIEVPLDK----MVIRG 132
           +HP  K +  +S  + IL  S +F N +             I  I+  +D     M+I  
Sbjct: 199 YHPGSKTKIGLSKFENIL-YSPEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMII-- 255

Query: 133 SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSI-------- 184
           +Y +  +     L        N ++IP+H  Q           +ILP K+          
Sbjct: 256 NYPEQYKIWYHELDNRGLDSNNYLMIPIHPWQA---------EHILPAKHKCLIDCQQLI 306

Query: 185 -------KAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
                    K   S RT++     D      IKLP+ I  TS  RTV+P S  +GP +  
Sbjct: 307 IINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKLPVAIHATSVTRTVSPESVKTGPRISK 366

Query: 234 IIDKLEIDRNLLK----VCKEFAGVYSIEK-DFDIAKHSTCIIREDFNELNSDGERVIIC 288
           I+ ++    N L     +  + AG+++ +    D  +  + I R +  EL    E     
Sbjct: 367 ILLEILTKENHLAKNMDILADIAGIHTTKACRKDDIRQLSAIFRTNPEELLDSDEVACPL 426

Query: 289 AALVERDEFGKSVVEKVWNL---DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           A+L  +    ++++  +  L   +   + + +F ++  I   A L    + G + EAH Q
Sbjct: 427 ASLFVKTPQNQALICDILELLDYNQPSQILAYFRKYTKITLTACLDLYLLYGIALEAHQQ 486

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV--DVLEESFTEAKDFPEVYKI 403
           N L  F     +    ++RD GG++ H  + FE+ G  +  D    +FT ++      + 
Sbjct: 487 NTLVVFKENMPQ--KLLIRDLGGMRLHLPS-FEASGFHLPKDTFSLTFTNSQTI--TRRK 541

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVR----KHFKQIVPR 442
             H  +  N+      L+ HY    G  W IV+    + F+ + PR
Sbjct: 542 FIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKDEIHQRFEYLKPR 587



>gi|495913438|ref|WP_008638017.1| hypothetical protein [Halobacillus sp. BAB-2008]
 gi|432188456|gb|ELK45645.1| hypothetical protein D479_13927 [Halobacillus sp. BAB-2008]
          Length = 589

 Score = 74.7 bits (182), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 155/369 (42%), Gaps = 40/369 (10%)

Query: 71  SLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLIRFIEVPLDKMVI 130
           S  FS    +EQ +++GH  HP  + R  +S  +           P +  I V + K + 
Sbjct: 143 SKAFSPLTFFEQLVIQGHTIHPCARTRIGLSEKEARQYAPEWGGTPAV--IPVAVHKQLF 200

Query: 131 RGSY--EKTIEKI--------TKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPE 180
           R +    KT+++I         K          +  LIPVH  Q  +   K   A+I  E
Sbjct: 201 RETLMEGKTVKEILFAEYPEVEKAFLSEINHPDDYGLIPVHPWQWKHTIVKDYQADI--E 258

Query: 181 KYSIKAKSQASLRTVVIPELNDIA---------IKLPLGIKVTSALRTVTPWSTHSGPAL 231
              IK    A + T  +     +A         IK  + I++TSA+RTV+  ST++GP L
Sbjct: 259 AGRIKRVKGADIATAALISFRSLAPLNNQWKHHIKTAVNIQMTSAVRTVSAASTYNGPML 318

Query: 232 GSII-DKLEID---RNLLKVCKEFAGVY-----SIEKDFDIAKHSTCIIREDFNELNSDG 282
                D LE D   R+ L   KE A ++      +E      K+   I+RE+      D 
Sbjct: 319 SRFFKDLLESDEALRSHLSTMKEPAAIHYQPSTGVEDAHFFQKNLAAIVRENPEYALGDE 378

Query: 283 ERVIICAALVERDEF-GKSVVEKVWNLDTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFE 341
           E  I  A+L+      GK++ E+        +   F  R+   L    L  +   G + E
Sbjct: 379 EVAIPGASLLAPSPVSGKTIAEEASERAGSPR--AFIRRYAEALLPGVLHLLGEYGIAME 436

Query: 342 AHLQNVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGE-RVDVLEESFTEAKDFPEV 400
           AHLQN +  F  K G  +  ++RD GGI+  +  L E  G+  +D      T+  D  E+
Sbjct: 437 AHLQNAVVVF--KGGHPLRTILRDHGGIRVLEKRLAEHFGDVPIDASTNLLTD--DTEEL 492

Query: 401 YKILYHTLI 409
             I  H+++
Sbjct: 493 LDIFTHSVL 501



>gi|385793654|ref|YP_005826630.1| hypothetical protein [Francisella cf. novicida Fx1]
 gi|504363182|ref|WP_014550284.1| hypothetical protein [Francisella novicida]
 gi|332678979|gb|AEE88108.1| siderophore biosynthesis protein [Francisella cf. novicida Fx1]
          Length = 639

 Score = 74.7 bits (182), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 185/466 (39%), Gaps = 80/466 (17%)

Query: 40  LENDISNQLIAEINSSVQYQEIT-------YKNYKHQLSLNFSSSVEW---EQSLLEGHA 89
           L+N   N+L   I   ++ +++        Y N    L+   S + +    EQ    GH 
Sbjct: 139 LDNSFENELSMNIYRGLRQKQLANIINSANYLNLWQWLTTTMSKNQQLAFLEQWGAVGHI 198

Query: 90  FHPMHKARHAISPIQEILPGSYDFMNPL-------------IRFIEVPLDK----MVIRG 132
           +HP  K +  +S  + IL  S +F N +             I  I+  +D     M+I  
Sbjct: 199 YHPGSKTKIGLSKFENIL-YSPEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMII-- 255

Query: 133 SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSI-------- 184
           +Y +  +     L        N ++IP+H  Q           +ILP K+          
Sbjct: 256 NYPEQYKIWYHELDNRGLDSNNYLMIPIHPWQA---------EHILPAKHKCLIDCQQLI 306

Query: 185 -------KAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
                    K   S RT++     D      IKLP+ I  TS  RTV+P S  +GP +  
Sbjct: 307 IINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKLPVAIHATSVTRTVSPESVKTGPRISK 366

Query: 234 IIDKLEIDRNLLK----VCKEFAGVYSIEK-DFDIAKHSTCIIREDFNELNSDGERVIIC 288
           I+ ++    N L     +  + AG+++ +    D  +  + I R +  EL    E     
Sbjct: 367 ILLEILAKENHLAKNMDILADIAGIHTTKACRKDDIRQLSAIFRTNPEELLDSDEVACPL 426

Query: 289 AALVERDEFGKSVVEKVWNL---DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           A+L  +    ++++  +  L   +   + + +F ++  I   A L    + G + EAH Q
Sbjct: 427 ASLFVKTPQNQALICDILELLDYNQPSQILAYFRKYTQITLTACLDLYLLYGIALEAHQQ 486

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV--DVLEESFTEAKDFPEVYKI 403
           N L  F     +    ++RD GG++ H  + FE+ G  +  D    +FT ++      + 
Sbjct: 487 NTLVVFKENMPQ--KLLIRDLGGMRLHLPS-FEASGFHLPKDTFSLTFTNSQTI--TRRK 541

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVR----KHFKQIVPR 442
             H  +  N+      L+ HY    G  W IV+    + F+ + PR
Sbjct: 542 FIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKDEIHQRFEYLKPR 587



>gi|489285476|ref|WP_003193066.1| siderophore synthetase [Pseudomonas fluorescens]
 gi|388002722|gb|EIK64051.1| siderophore biosynthesis protein, IucA/IucC family [Pseudomonas
           fluorescens SS101]
          Length = 641

 Score = 74.7 bits (182), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 134/301 (44%), Gaps = 27/301 (8%)

Query: 134 YEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFP--FANILPEKY-------SI 184
           + +  +++T  L        + + +P H  Q      + P  FA+ + +K        + 
Sbjct: 261 FPQAAQQLTATLQAQGLEAGDYLPLPSHPWQA---RQELPQLFADAIGDKLLVLTDIVAF 317

Query: 185 KAKSQASLRTVVIPE--LNDIAIKLPLGIKVTSALRTVTPWSTHSGPALGSIIDKLEID- 241
            A    S RTV +PE   +   +KLP+ +++TS  RTV+P S   GP +  ++  +    
Sbjct: 318 TAHPTMSFRTV-LPEGRCDAPMVKLPVSLRLTSVQRTVSPRSARMGPRISLLLLSILERE 376

Query: 242 ---RNLLKVCKEFAGVY--SIEKDFDIAKHSTCIIREDFNELNSDGERVIICAALVERDE 296
              +N+L +  E  GV+   +  + + ++H   + R++       GE  +   +L   D+
Sbjct: 377 PAIQNILSIIPERIGVHFQPVPANDEHSRHLAVLYRDNPQSQLQPGEMAVPVGSLFAIDQ 436

Query: 297 FGKSVVEKVWNL----DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQNVLARFD 352
            G+ ++ +   L    D     + FF  + +I   A L      G +FEAH QN      
Sbjct: 437 HGQPLLRQWVRLSQGKDDAAAMLAFFHEYAAISVPALLGMYLRYGVAFEAHQQNSFMVM- 495

Query: 353 SKSGELVGFVVRDFGGIKHHQDTLFESIGERVDVLEESFTEAKDFPEVYKILYHTLILCN 412
           +  G+L   ++RDFG I+  + TL  + G  +++ +   T   D   V   L HT+ +C+
Sbjct: 496 AADGQLSRLLLRDFGDIRIDRKTL-HAHGLDIELHDPKMTLYDDAGFVRDKLLHTVFMCH 554

Query: 413 V 413
           +
Sbjct: 555 L 555



>gi|490469463|ref|WP_004339974.1| ribosomal L29e protein family, putative [Francisella novicida]
 gi|208743919|gb|EDZ90221.1| ribosomal L29e protein family, putative [Francisella novicida FTG]
          Length = 639

 Score = 74.7 bits (182), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 185/466 (39%), Gaps = 80/466 (17%)

Query: 40  LENDISNQLIAEINSSVQYQEIT-------YKNYKHQLSLNFSSSVEW---EQSLLEGHA 89
           L+N   N+L   I   ++ +++        Y N    L+   S + +    EQ    GH 
Sbjct: 139 LDNSFENELSMNIYRGLRQKQLANTINSADYLNLWQWLTTTMSKNQQLAFLEQWGAVGHI 198

Query: 90  FHPMHKARHAISPIQEILPGSYDFMNPL-------------IRFIEVPLDK----MVIRG 132
           +HP  K +  +S  + IL  S +F N +             I  I+  +D     M+I  
Sbjct: 199 YHPGSKTKIGLSKFENIL-YSPEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMII-- 255

Query: 133 SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSI-------- 184
           +Y +  +     L        N ++IP+H  Q           +ILP K+          
Sbjct: 256 NYPEQYKIWYHELDNRGLDSNNYLMIPIHPWQA---------EHILPAKHKCLIDCQQLI 306

Query: 185 -------KAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
                    K   S RT++     D      IKLP+ I  TS  RTV+P S  +GP +  
Sbjct: 307 IINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKLPVAIHATSVTRTVSPESVKTGPRISK 366

Query: 234 IIDKLEIDRNLLK----VCKEFAGVYSIEK-DFDIAKHSTCIIREDFNELNSDGERVIIC 288
           I+ ++    N L     +  + AG+++ +    D  +  + I R +  EL    E     
Sbjct: 367 ILLEILAKENHLAKNMDILADIAGIHTTKACRKDDIRQLSAIFRTNPEELLDSDEVACPL 426

Query: 289 AALVERDEFGKSVVEKVWNL---DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           A+L  +    ++++  +  L   +   + + +F ++  I   A L    + G + EAH Q
Sbjct: 427 ASLFVKTPQNQALICDILELLDYNQPSQILAYFRKYTKITLTACLDLYLLYGIALEAHQQ 486

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV--DVLEESFTEAKDFPEVYKI 403
           N L  F     +    ++RD GG++ H  + FE+ G  +  D    +FT ++      + 
Sbjct: 487 NTLVVFKENMPQ--KLLIRDLGGMRLHLPS-FEASGFHLPKDTFSLTFTNSQTI--TRRK 541

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVR----KHFKQIVPR 442
             H  +  N+      L+ HY    G  W IV+    + F+ + PR
Sbjct: 542 FIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKDEIHQRFEYLKPR 587



>gi|489127975|ref|WP_003037766.1| hypothetical protein [Francisella novicida]
 gi|151572769|gb|EDN38423.1| hypothetical protein FTDG_01239 [Francisella novicida GA99-3548]
          Length = 639

 Score = 74.7 bits (182), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 185/466 (39%), Gaps = 80/466 (17%)

Query: 40  LENDISNQLIAEINSSVQYQEIT-------YKNYKHQLSLNFSSSVEW---EQSLLEGHA 89
           L+N   N+L   I   ++ +++        Y N    L+   S + +    EQ    GH 
Sbjct: 139 LDNSFENELSMNIYRGLRQKQLANIINSANYLNLWQWLTTTMSKNQQLAFLEQWGAVGHI 198

Query: 90  FHPMHKARHAISPIQEILPGSYDFMNPL-------------IRFIEVPLDK----MVIRG 132
           +HP  K +  +S  + IL  S +F N +             I  I+  +D     M+I  
Sbjct: 199 YHPGSKTKIGLSKFENIL-YSPEFENEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMII-- 255

Query: 133 SYEKTIEKITKLLXXXXXXXKNTILIPVHELQIPNIESKFPFANILPEKYSI-------- 184
           +Y +  +     L        N ++IP+H  Q           +ILP K+          
Sbjct: 256 NYPEQYKIWYHELDNRGLDSNNYLMIPIHPWQA---------EHILPAKHKCLIDCQQLI 306

Query: 185 -------KAKSQASLRTVVIPELNDIA----IKLPLGIKVTSALRTVTPWSTHSGPALGS 233
                    K   S RT++     D      IKLP+ I  TS  RTV+P S  +GP +  
Sbjct: 307 IINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKLPVAIHATSVTRTVSPESVKTGPRISK 366

Query: 234 IIDKLEIDRNLLK----VCKEFAGVYSIEK-DFDIAKHSTCIIREDFNELNSDGERVIIC 288
           I+ ++    N L     +  + AG+++ +    D  +  + I R +  EL    E     
Sbjct: 367 ILLEILAKENHLAKNMDILADIAGIHTTKACRKDDIRQLSAIFRTNPEELLDSDEVACPL 426

Query: 289 AALVERDEFGKSVVEKVWNL---DTEQKRIDFFDRFVSILFKAFLPPVFVNGFSFEAHLQ 345
           A+L  +    ++++  +  L   +   + + +F ++  I   A L    + G + EAH Q
Sbjct: 427 ASLFVKTPQNQALICDILELLDYNQPSQILAYFRKYTKITLTACLDLYLLYGIALEAHQQ 486

Query: 346 NVLARFDSKSGELVGFVVRDFGGIKHHQDTLFESIGERV--DVLEESFTEAKDFPEVYKI 403
           N L  F     +    ++RD GG++ H  + FE+ G  +  D    +FT ++      + 
Sbjct: 487 NTLVVFKENMPQ--KLLIRDLGGMRLHLPS-FEASGFHLPKDTFSLTFTNSQTI--TRRK 541

Query: 404 LYHTLILCNVHRFARALNLHYN---GIGWDIVR----KHFKQIVPR 442
             H  +  N+      L+ HY    G  W IV+    + F+ + PR
Sbjct: 542 FIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKDEIHQRFEYLKPR 587



>gi|447184553|ref|WP_001261809.1| siderophore biosynthesis protein [Bacillus cereus]
 gi|401650187|gb|EJS67761.1| hypothetical protein ICU_02987 [Bacillus cereus BAG2X1-1]
          Length = 612

 Score = 74.7 bits (182), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 102/407 (25%), Positives = 171/407 (42%), Gaps = 65/407 (15%)

Query: 6   KSSMNFIFSSYDSN-----DSIEEISAVE--LMRIFGVWMNLENDISNQLIAEINSSVQY 58
           +  M F   S DS+     D  +E+ +V   L  +F V +N+E    +  I E+  ++  
Sbjct: 72  RVRMTFGRISLDSSIVRVQDEQQEVQSVSQFLEEVFRV-VNVEQTKLDSFIYELEQTIFK 130

Query: 59  QEITYKNYKHQLSLNFSSSVEWEQSLLEGHAFHPMHKARHAISPIQEILPGSYDFMNPLI 118
             I      ++      S  E+E  L++GH +HP +KAR           G Y+FM P I
Sbjct: 131 DTIAQYERNNKEEYTQKSYDEFESYLIDGHPYHPSYKARIGFQYRDNFQYG-YEFMQP-I 188

Query: 119 RFI---------------EVPLDKMVIRGSYEKTIEKITKLLXXXXXXXKNTILIPVHEL 163
           + I               EV  DK++I    ++ +E   +L+       K  + IPVH  
Sbjct: 189 KLIWIAAHKKYTSVGYENEVIYDKILIEEIGKRKLEGFMELIHSAGCNPKQYVFIPVHPW 248

Query: 164 Q-----IPNIESKFPFANILPEKYSIKAK----SQASLRTVV-IPELNDIAIKLPLGIKV 213
           Q     IPN         I+   Y  K++    +Q S+RT+  +  L    +KL L I  
Sbjct: 249 QWENFIIPNYADHIQGKCII---YLGKSEDDYCAQQSMRTLRNVTNLKKPYVKLSLNILN 305

Query: 214 TSALRTVTPWSTHSGPALGSII------DKLEIDRNLLKVCKEFAGVYSIEKDFDIAKHS 267
           TS LRT+ P+S  S PA+ + +      D    D + + +  EF+ V      +D  K S
Sbjct: 306 TSTLRTLKPYSVVSAPAISNWLHDVVSHDPYLRDESRMILLHEFSSV-----TYDTNKKS 360

Query: 268 T-----CIIREDFNELNSDGERVIICAALVERDEFGKSVVEKVWNLDTEQKRIDFFDRFV 322
                 CI RE  ++     E  +    L  +++ G  +++   N      +    +   
Sbjct: 361 VYGSLGCIWRESVHKYLDTKEDAVPFNGLYAKEKDGTPIIDAWLN------KYGIENWLQ 414

Query: 323 SILFKAFLPP---VFVNGFSFEAHLQNVLARFDSKSGELVGFVVRDF 366
            ++ KA +P    V  +G + E+H QN++  F  + G  V   ++DF
Sbjct: 415 LLIQKAIIPVLHLVVEHGIALESHGQNMI--FVHREGVPVRIALKDF 459