BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp1006_c0_seq2-m.28 complete 760-1779(-) 340 (-)
         (339 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|343426816|emb|CBQ70344.1| conserved hypothetical protein [Spo...   117   4e-24   Sporisorium reilianum SRZ2
gi|358055253|dbj|GAA98761.1| hypothetical protein E5Q_05449 [Mix...   110   6e-22   Mixia osmundae IAM 14324
gi|388851492|emb|CCF54894.1| uncharacterized protein [Ustilago h...   110   7e-22   Ustilago hordei
gi|443895486|dbj|GAC72832.1| N-acetyl-gamma-glutamyl-phosphate r...   109   9e-22   Moesziomyces antarcticus T-34
gi|71004850|ref|XP_757091.1| hypothetical protein UM00944.1 [Ust...   109   9e-22   
gi|393217055|gb|EJD02545.1| hypothetical protein FOMMEDRAFT_1577...   109   1e-21   Fomitiporia mediterranea MF3/22
gi|501308431|dbj|GAC97344.1| arg-6 protein, mitochondrial precur...   106   8e-21   Pseudozyma hubeiensis SY62
gi|393230183|gb|EJD37793.1| hypothetical protein AURDEDRAFT_1166...   105   2e-20   Auricularia subglabra TFB-10046 SS5
gi|392558708|gb|EIW51895.1| hypothetical protein TRAVEDRAFT_5431...   103   5e-20   Trametes versicolor FP-101664 SS1
gi|403158480|ref|XP_003307779.2| hypothetical protein PGTG_00729...   103   8e-20   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|402225198|gb|EJU05259.1| hypothetical protein DACRYDRAFT_9265...   102   1e-19   Dacryopinax primogenitus
gi|328862332|gb|EGG11433.1| hypothetical protein MELLADRAFT_1023...   102   1e-19   Melampsora larici-populina 98AG31
gi|392584654|gb|EIW73999.1| hypothetical protein CONPUDRAFT_8608...   102   1e-19   Coniophora puteana RWD-64-598 SS2
gi|336367440|gb|EGN95785.1| hypothetical protein SERLA73DRAFT_18...   102   2e-19   Serpula lacrymans var. lacrymans S7.3
gi|409045447|gb|EKM54927.1| hypothetical protein PHACADRAFT_2551...   101   3e-19   Phanerochaete carnosa HHB-10118-sp
gi|353243018|emb|CCA74607.1| hypothetical protein PIIN_08559 [Pi...   100   7e-19   Serendipita indica DSM 11827
gi|328771775|gb|EGF81814.1| hypothetical protein BATDEDRAFT_8687...   100   7e-19   Batrachochytrium dendrobatidis JAM81
gi|384486862|gb|EIE79042.1| hypothetical protein RO3G_03747 [Rhi...   100   1e-18   Rhizopus delemar RA 99-880
gi|242216372|ref|XP_002473994.1| predicted protein [Postia place...    98   3e-18   Postia placenta Mad-698-R
gi|389748325|gb|EIM89502.1| hypothetical protein STEHIDRAFT_1372...    97   5e-18   Stereum hirsutum FP-91666 SS1
gi|409081942|gb|EKM82300.1| hypothetical protein AGABI1DRAFT_117...    97   6e-18   Agaricus bisporus var. burnettii JB137-S8
gi|426199771|gb|EKV49695.1| hypothetical protein AGABI2DRAFT_182...    97   6e-18   Agaricus bisporus var. bisporus H97
gi|170103146|ref|XP_001882788.1| predicted protein [Laccaria bic...    96   1e-17   Laccaria bicolor S238N-H82
gi|510999496|gb|EPB81123.1| hypothetical protein HMPREF1544_1217...    94   4e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|395333992|gb|EJF66369.1| hypothetical protein DICSQDRAFT_9844...    93   1e-16   Dichomitus squalens LYAD-421 SS1
gi|384494575|gb|EIE85066.1| hypothetical protein RO3G_09776 [Rhi...    92   1e-16   Rhizopus delemar RA 99-880
gi|58270158|ref|XP_572235.1| hypothetical protein [Cryptococcus ...    92   2e-16   Cryptococcus neoformans var. neoformans JEC21
gi|511000269|gb|EPB81821.1| hypothetical protein HMPREF1544_1144...    91   3e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|302679150|ref|XP_003029257.1| expressed protein [Schizophyllu...    91   5e-16   Schizophyllum commune H4-8
gi|511002857|gb|EPB84279.1| hypothetical protein HMPREF1544_0893...    91   6e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|326521326|dbj|BAJ96866.1| predicted protein [Hordeum vulgare ...    90   7e-16   Hordeum vulgare subsp. vulgare [barley]
gi|321264354|ref|XP_003196894.1| hypothetical protein CGB_L0170W...    90   9e-16   Cryptococcus gattii WM276
gi|342321578|gb|EGU13511.1| Macrophage erythroblast attacher iso...    89   1e-15   Rhodotorula toruloides ATCC 204091
gi|392573391|gb|EIW66531.1| hypothetical protein TREMEDRAFT_7472...    89   2e-15   Tremella mesenterica DSM 1558
gi|405124040|gb|AFR98802.1| hypothetical protein CNAG_05375 [Cry...    89   2e-15   Cryptococcus neoformans var. grubii H99
gi|472588288|gb|EMS25760.1| Hlh domain containing protein, trans...    89   2e-15   Rhodotorula toruloides NP11
gi|511005290|gb|EPB86635.1| hypothetical protein HMPREF1544_0661...    89   2e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|401884282|gb|EJT48450.1| hypothetical protein A1Q1_02471 [Tri...    88   3e-15   Trichosporon asahii var. asahii CBS 2479
gi|384487152|gb|EIE79332.1| hypothetical protein RO3G_04037 [Rhi...    87   5e-15   Rhizopus delemar RA 99-880
gi|384491737|gb|EIE82933.1| hypothetical protein RO3G_07638 [Rhi...    87   5e-15   Rhizopus delemar RA 99-880
gi|302687867|ref|XP_003033613.1| expressed protein [Schizophyllu...    87   6e-15   Schizophyllum commune H4-8
gi|511004173|gb|EPB85550.1| hypothetical protein HMPREF1544_0763...    87   8e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|511011094|gb|EPB92308.1| hypothetical protein HMPREF1544_0087...    86   2e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|384491900|gb|EIE83096.1| hypothetical protein RO3G_07801 [Rhi...    86   2e-14   Rhizopus delemar RA 99-880
gi|384491114|gb|EIE82310.1| hypothetical protein RO3G_07015 [Rhi...    84   7e-14   Rhizopus delemar RA 99-880
gi|390597536|gb|EIN06935.1| hypothetical protein PUNSTDRAFT_4549...    83   1e-13   Punctularia strigosozonata HHB-11173 SS5
gi|302673188|ref|XP_003026281.1| hypothetical protein SCHCODRAFT...    79   2e-12   Schizophyllum commune H4-8
gi|384492013|gb|EIE83209.1| hypothetical protein RO3G_07914 [Rhi...    75   2e-11   Rhizopus delemar RA 99-880


>gi|343426816|emb|CBQ70344.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 373

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 78/109 (71%)

Query: 38  TFQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSII 97
            FQ P+ +    K   SAERRA HNA+ERARRE LN +F +LA +LP+++ VRRPSKS+I
Sbjct: 18  AFQRPAGSGGGNKKGTSAERRATHNAIERARRESLNGRFLQLAASLPAISDVRRPSKSLI 77

Query: 98  VQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIP 146
           V KSLDF+ +A  ++ ++  ++ ++R EN  LR+++NKL  + GLE +P
Sbjct: 78  VNKSLDFVADAMTRESIYRLKIDNMRQENMQLRQQLNKLLAQAGLETLP 126



>gi|358055253|dbj|GAA98761.1| hypothetical protein E5Q_05449 [Mixia osmundae IAM 14324]
          Length = 442

 Score =  110 bits (275), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (71%), Gaps = 7/103 (6%)

Query: 48  AKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYN 107
            KK   SAERRA HNA ERARRE LN++F +LA +LP++A+V+RPSKSIIV KSL+FI N
Sbjct: 64  GKKLPTSAERRATHNATERARRESLNSRFLQLAGSLPTMARVKRPSKSIIVSKSLEFINN 123

Query: 108 ARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREE 150
            R ++       R +   N  LRE+++ LRE+LGLE +PP +E
Sbjct: 124 VRSRE-------RYLLARNANLREQVDSLREQLGLEKLPPADE 159



>gi|388851492|emb|CCF54894.1| uncharacterized protein [Ustilago hordei]
          Length = 412

 Score =  110 bits (274), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 2/114 (1%)

Query: 39  FQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIV 98
           FQ PS +    K   SAERRA HNA+ERARR+ LN +F +LA  LPS++ +RRPSKSIIV
Sbjct: 19  FQRPSGSGGGNKKGTSAERRATHNAIERARRKSLNGRFLQLAATLPSISDMRRPSKSIIV 78

Query: 99  QKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPI--PPREE 150
            KSLDF+ +A  ++ ++  ++ ++R EN  LRE++NK   + GLEP+  PP +E
Sbjct: 79  NKSLDFVADAMNREVIYRLKIDNMRQENMQLREQLNKFLTQEGLEPLAQPPVDE 132



>gi|443895486|dbj|GAC72832.1| N-acetyl-gamma-glutamyl-phosphate reductase, partial [Pseudozyma
           antarctica T-34]
          Length = 1028

 Score =  109 bits (273), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 82/127 (64%)

Query: 21  INSRMPSHHHPNGCANFTFQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELA 80
           ++S    H      A   FQ PS +    K   SAERRA HNA+ERARRE LN +F +LA
Sbjct: 1   MDSSTAPHVEAQPAAVPAFQRPSGSGGGNKKGTSAERRATHNAIERARRESLNGRFLQLA 60

Query: 81  HALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKL 140
            +LPS++ VRRPSKS+IV KSLDF+ +A  ++ L+  ++ S R EN  LR+++NK   + 
Sbjct: 61  ASLPSISDVRRPSKSLIVNKSLDFVADALNRETLYRVKIDSARQENMQLRQQLNKFLAQA 120

Query: 141 GLEPIPP 147
           G+E +PP
Sbjct: 121 GMEQLPP 127



>gi|71004850|ref|XP_757091.1| hypothetical protein UM00944.1 [Ustilago maydis 521]
 gi|46096895|gb|EAK82128.1| hypothetical protein UM00944.1 [Ustilago maydis 521]
          Length = 380

 Score =  109 bits (273), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%)

Query: 39  FQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIV 98
           FQ PS +    K   SAERRA HNA+ERARRE LN +F +LA +LP+++ VRRPSKS+IV
Sbjct: 19  FQRPSGSGGGNKKGTSAERRATHNAIERARRESLNGRFLQLAASLPAISDVRRPSKSLIV 78

Query: 99  QKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIP 146
            KSLDF+ +A  ++ ++   + ++R EN  LR+++NK   + GLE +P
Sbjct: 79  NKSLDFVADAMNREAMYRLRIDNMRQENMQLRQQLNKFLSQAGLETLP 126



>gi|393217055|gb|EJD02545.1| hypothetical protein FOMMEDRAFT_157778 [Fomitiporia mediterranea
           MF3/22]
          Length = 623

 Score =  109 bits (273), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 77/119 (64%), Gaps = 3/119 (2%)

Query: 32  NGCANFTFQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRR 91
           NG A+    +P     A +  N+AERRA HNAVERARRE LN +F +LA  LP+LA VRR
Sbjct: 208 NGTASNNTSLPG-KRKANRRANTAERRATHNAVERARRETLNGRFLDLAALLPNLATVRR 266

Query: 92  PSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPI--PPR 148
           PSKS IV  S+  I+ +R+   L  +E+R +R E+D LR E+N+ R + GL  +  PPR
Sbjct: 267 PSKSAIVNSSIALIHQSRRTRLLASRELRLLRAESDALRRELNEWRARAGLPRVEEPPR 325



>gi|501308431|dbj|GAC97344.1| arg-6 protein, mitochondrial precursor [Pseudozyma hubeiensis SY62]
          Length = 1292

 Score =  106 bits (265), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 76/108 (70%)

Query: 39  FQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIV 98
           FQ P+ +    K   SAERRA HNA+ERARRE LN +F +LA +LP ++ VRRPSKS+IV
Sbjct: 19  FQRPAGSGGGNKKGTSAERRATHNAIERARRESLNGRFLQLAASLPVISDVRRPSKSLIV 78

Query: 99  QKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIP 146
            KSLDF+ +A  ++ ++  ++ ++R EN  LR+++N+   + GLE +P
Sbjct: 79  NKSLDFVADAMNREAMYRLKIENMRQENMSLRQQLNEFLAQAGLETLP 126



>gi|393230183|gb|EJD37793.1| hypothetical protein AURDEDRAFT_116684 [Auricularia delicata
           TFB-10046 SS5]
          Length = 407

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 84/147 (57%), Gaps = 23/147 (15%)

Query: 31  PNGCANFTFQIPSIANAAKKNT----NSAERRANHNAVERARRECLNTKFQELAHALPSL 86
           PNG A       S A  A++ T    N+AERRA HNAVER RRE LN +F +LA  LP+L
Sbjct: 38  PNGPAQ------SAAGPARRKTSRRANTAERRATHNAVERQRRETLNGRFLDLAALLPNL 91

Query: 87  AQVRRPSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIP 146
           A VRRPSKS IV  S+  I+  R+   L  +E+R ++ E D LR E+N+ R++  L    
Sbjct: 92  ASVRRPSKSAIVNSSIALIHTQRRARALAGRELRVLKAETDALRRELNEWRDRANL---- 147

Query: 147 PREESKPSTSQ---------ADEVKED 164
           PR +  P +++         ADE  ED
Sbjct: 148 PRVDEGPRSAEFQALMVLDDADEAGED 174



>gi|392558708|gb|EIW51895.1| hypothetical protein TRAVEDRAFT_54312 [Trametes versicolor
           FP-101664 SS1]
          Length = 471

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 68/93 (73%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVERARRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ AR
Sbjct: 68  RRANTAERRATHNAVERARRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHAAR 127

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL 142
           +   L  +E+R ++ E+D LR E+N+ R++ GL
Sbjct: 128 RHRLLAARELRIVKLESDALRRELNEWRDRSGL 160



>gi|403158480|ref|XP_003307779.2| hypothetical protein PGTG_00729 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163835|gb|EFP74773.2| hypothetical protein PGTG_00729 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 552

 Score =  103 bits (257), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%), Gaps = 7/115 (6%)

Query: 43  SIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSL 102
           S    +K    +AERRA HNA+ERARRE LN +F ELA ALP++  V+RPSKS+IV KSL
Sbjct: 101 SGGQGSKLKATTAERRATHNAIERARRESLNGRFLELARALPTMQSVKRPSKSVIVNKSL 160

Query: 103 DFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKPSTSQ 157
           ++I  ++ ++         +  EN  LR +IN+LR +L +EP+PP     P T Q
Sbjct: 161 EWICESQVRE-------YELARENAFLRNQINELRAQLQMEPLPPTRLLMPQTQQ 208



>gi|402225198|gb|EJU05259.1| hypothetical protein DACRYDRAFT_92650 [Dacryopinax sp. DJM-731 SS1]
          Length = 552

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
            +  N+AERRA HNAVER RRE LN +F +LA  LP+L  VRRPSKS IV  S+  I+  
Sbjct: 71  SRRANTAERRATHNAVERQRRETLNGRFLDLAAMLPNLQSVRRPSKSAIVNSSIALIHQQ 130

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPI 145
           R+   +  +E+R +++E+D+LR E+N+ RE+  + P+
Sbjct: 131 RRARGVAARELRLLKSESDILRREVNEWRERARMPPV 167



>gi|328862332|gb|EGG11433.1| hypothetical protein MELLADRAFT_102394 [Melampsora larici-populina
           98AG31]
          Length = 543

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 72/107 (67%), Gaps = 7/107 (6%)

Query: 47  AAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIY 106
           A++   ++AERRA HNA+ERARRE LN +F ELA ALP++  V+RPSKS+IV KSL++I 
Sbjct: 151 ASRLKNSTAERRATHNAIERARRESLNGRFLELARALPTMGNVKRPSKSVIVNKSLEWI- 209

Query: 107 NARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKP 153
                 E   +E   IR EN+ LR ++N+LR +L L P+PP     P
Sbjct: 210 -----SESQMREFHLIR-ENNYLRAQVNELRSQLRLSPLPPINYGDP 250



>gi|392584654|gb|EIW73999.1| hypothetical protein CONPUDRAFT_86084 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 498

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 4/100 (4%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 72  RRANTAERRATHNAVERQRRETLNGRFLDLAALLPNLSQIRRPSKSAIVNSSIAHIHASR 131

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL----EPI 145
           +   L  +E+R I+ E+D LR E+N+ R++ GL    EP+
Sbjct: 132 RHRILASRELRLIKLESDALRRELNEWRDRAGLPRVEEPV 171



>gi|336367440|gb|EGN95785.1| hypothetical protein SERLA73DRAFT_187008 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336380153|gb|EGO21307.1| hypothetical protein SERLADRAFT_452440 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 531

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 4/100 (4%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 78  RRANTAERRATHNAVERQRRETLNGRFLDLAALLPNLSQIRRPSKSAIVNSSIAHIHASR 137

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL----EPI 145
           +   L  +E+R I+ E+D LR E+N+ R++ GL    EP+
Sbjct: 138 RHRLLASRELRLIKLESDALRRELNEWRDRAGLPRVEEPV 177



>gi|409045447|gb|EKM54927.1| hypothetical protein PHACADRAFT_255141 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 478

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 4/100 (4%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVERARRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 68  RRANTAERRATHNAVERARRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASR 127

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL----EPI 145
           +   L  +E+R ++ E D LR E+N+ R++ GL    EP+
Sbjct: 128 RHRLLAARELRMLKLECDALRRELNEWRDRSGLPRVEEPV 167



>gi|353243018|emb|CCA74607.1| hypothetical protein PIIN_08559 [Piriformospora indica DSM 11827]
          Length = 458

 Score =  100 bits (249), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/102 (51%), Positives = 68/102 (66%), Gaps = 4/102 (3%)

Query: 48  AKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYN 107
           A +  N+AERRA HNAVERARRE LN +F +LA  LP+LA VRRPSKS IV  S+  I N
Sbjct: 31  ASRRANTAERRATHNAVERARRETLNGRFLDLAAILPNLAAVRRPSKSAIVNSSIALINN 90

Query: 108 ARKKDELHDKEMRSIRNENDLLREEINKLREKLGL----EPI 145
            R+   L  +E+R +  EN  LR+E+N+ R++  L    EPI
Sbjct: 91  QRRARILAAREVRLLNAENIALRQELNEWRQRNSLPRVEEPI 132



>gi|328771775|gb|EGF81814.1| hypothetical protein BATDEDRAFT_86871 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 485

 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (70%)

Query: 51  NTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARK 110
           N ++AE+RA HNAVERARRE LN +FQELA  +PSL  VR+PSK++I+Q+SL+ ++  R+
Sbjct: 47  NDHNAEKRATHNAVERARRESLNYRFQELAGVIPSLNSVRKPSKTVIIQRSLEHVHELRR 106

Query: 111 KDELHDKEMRSIRNENDLLREEINKLREKLGLEPI 145
           + E+ D+ +   R +   L+ EINK R   G  P+
Sbjct: 107 RIEIKDRTLAMFRQQISELKSEINKTRVHNGFAPL 141



>gi|384486862|gb|EIE79042.1| hypothetical protein RO3G_03747 [Rhizopus delemar RA 99-880]
          Length = 347

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 80/133 (60%), Gaps = 2/133 (1%)

Query: 53  NSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKD 112
           N AER+A HNA+ERARRECLN+KFQ+LA ALP+L   RRPSK  IV+K+LD++   + K+
Sbjct: 92  NKAERKAEHNAIERARRECLNSKFQQLADALPNLQTYRRPSKGQIVEKALDWVKQNQTKE 151

Query: 113 ELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKPSTSQAD--EVKEDAKISSG 170
           E + +++  ++NEN  L   I  +++      IP    S P+T  A+  +V  D  + + 
Sbjct: 152 EKYQQQITQLQNENKCLSAHIIMMKQHQSTTAIPTFSISTPTTYFANTRQVLSDHNMLTF 211

Query: 171 KNQNSPEIKNEAD 183
            N   P   +  D
Sbjct: 212 NNHKDPATNSIGD 224



>gi|242216372|ref|XP_002473994.1| predicted protein [Postia placenta Mad-698-R]
 gi|220726859|gb|EED80795.1| predicted protein [Postia placenta Mad-698-R]
          Length = 822

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 4/100 (4%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN++F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 444 RRANTAERRATHNAVERQRRETLNSRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASR 503

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL----EPI 145
           +   +  +E+R I+ E D LR E+N+ R++ GL    EP+
Sbjct: 504 RHRLMAARELRLIKCEADALRRELNEWRDRSGLPRVEEPV 543



>gi|389748325|gb|EIM89502.1| hypothetical protein STEHIDRAFT_137295 [Stereum hirsutum FP-91666
           SS1]
          Length = 457

 Score = 97.4 bits (241), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 70/101 (69%), Gaps = 4/101 (3%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN++F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 66  RRANTAERRATHNAVERQRRETLNSRFLDLAALLPNLSQIRRPSKSAIVNSSIAHIHASR 125

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREE 150
           +   L  +E+R ++ E+D LR E+N+ R++  L    PR E
Sbjct: 126 RHRLLASREVRLLKLESDALRRELNEWRDRANL----PRVE 162



>gi|409081942|gb|EKM82300.1| hypothetical protein AGABI1DRAFT_117821 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 532

 Score = 97.4 bits (241), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 65/90 (72%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 61  RRANTAERRATHNAVERQRRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASR 120

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREK 139
           +   L  +E+R +++E D LR E+N+ R++
Sbjct: 121 RHRFLAARELRMLKHEADALRREVNEWRDR 150



>gi|426199771|gb|EKV49695.1| hypothetical protein AGABI2DRAFT_182895 [Agaricus bisporus var.
           bisporus H97]
          Length = 529

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 65/90 (72%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 61  RRANTAERRATHNAVERQRRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASR 120

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREK 139
           +   L  +E+R +++E D LR E+N+ R++
Sbjct: 121 RHRFLAARELRMLKHEADALRREVNEWRDR 150



>gi|170103146|ref|XP_001882788.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164642159|gb|EDR06416.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 631

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 65/94 (69%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
            +  N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I  +
Sbjct: 57  SRRANTAERRATHNAVERQRRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHINAS 116

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLGL 142
           R+   L  +E+R ++ E+D LR E+N+ R++  L
Sbjct: 117 RRHRLLAARELRLVKLESDALRRELNEWRDRAAL 150



>gi|510999496|gb|EPB81123.1| hypothetical protein HMPREF1544_12176 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 422

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 80/132 (60%), Gaps = 24/132 (18%)

Query: 56  ERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELH 115
           +RR+ HNA+ER RRE LN KFQ+LAHALPSL  VRRPSK++IV KSL+F+ ++ K++  +
Sbjct: 49  DRRSAHNALERQRREHLNVKFQQLAHALPSLQTVRRPSKTMIVAKSLEFVSSSLKRETTY 108

Query: 116 DKEMRSIRNENDLLREEI----NKLREKLGLEPIPPREESKPSTSQADEVKEDAKISSGK 171
             E++ +R EN+ LR++     N+L+++L                      +DAK++   
Sbjct: 109 TSEIQKLRLENEKLRKQAEASSNQLKKQLA--------------------DQDAKLTGSD 148

Query: 172 NQNSPEIKNEAD 183
           +  +P  K  AD
Sbjct: 149 SSAAPSPKKAAD 160



>gi|395333992|gb|EJF66369.1| hypothetical protein DICSQDRAFT_98444 [Dichomitus squalens LYAD-421
           SS1]
          Length = 479

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 68/93 (73%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVERARRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I+ +R
Sbjct: 68  RRANTAERRATHNAVERARRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASR 127

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGL 142
           +   L  +E+R ++ E+D LR E+N+ R++ GL
Sbjct: 128 RHRLLAARELRLLKLESDALRRELNEWRDRSGL 160



>gi|384494575|gb|EIE85066.1| hypothetical protein RO3G_09776 [Rhizopus delemar RA 99-880]
          Length = 280

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 102/164 (62%), Gaps = 13/164 (7%)

Query: 22  NSRMPSHHHPNGCANFTFQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAH 81
           ++R  +  +PNG + F+    S+  +  +     E+R+ HNA+ER RRE LN+K+QELAH
Sbjct: 3   STRQRTSSYPNGIS-FS---NSMDESQHRELAYMEKRSAHNALERQRREGLNSKYQELAH 58

Query: 82  ALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREE--INKLR-- 137
            LP+L +V+RPSK++IV KSL+F+  A+++++ +  E+++++ E+  L+ +  + K R  
Sbjct: 59  VLPTLQEVKRPSKNMIVTKSLEFVSKAKEREDEYKDELKALQKEHAQLQRQAKLTKSRKD 118

Query: 138 ----EKLGLEPIPPREESKPSTSQADEVKEDAKISSGKNQNSPE 177
               +K GL+PI P   S  S+    +V++ + + S K Q  PE
Sbjct: 119 KQRQKKSGLQPILPVNASS-SSGLKPQVRDLSPVLSQKRQREPE 161



>gi|58270158|ref|XP_572235.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134117580|ref|XP_772561.1| hypothetical protein CNBL0410 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255176|gb|EAL17914.1| hypothetical protein CNBL0410 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228493|gb|AAW44928.1| expressed protein [Cryptococcus neoformans var. neoformans JEC21]
          Length = 420

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           +K  N+AE+R+ HNA+ERARRE LN+KF +LA  LPSLA  RRPSKS IV  S+  +   
Sbjct: 58  RKRVNTAEKRSQHNAIERARRETLNSKFLDLARLLPSLASSRRPSKSAIVNGSISHLTYQ 117

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKPSTSQADEV 161
           RK+  L  K ++ +R E D L  E+N+ R   G       +E    T + DEV
Sbjct: 118 RKQRLLAAKLLKQVRIERDELLREVNEWRSVSGCA----LKECSAWTEEMDEV 166



>gi|511000269|gb|EPB81821.1| hypothetical protein HMPREF1544_11442 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 355

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 63/87 (72%)

Query: 53  NSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKD 112
           N AERRA HNA+ERARRECLN+KFQ+LA ALP+L   RRPSK  IV+K+LD++     K+
Sbjct: 90  NKAERRAEHNAIERARRECLNSKFQQLAEALPNLQNHRRPSKGQIVEKALDWVKQNMSKE 149

Query: 113 ELHDKEMRSIRNENDLLREEINKLREK 139
           + +  ++  ++NEN  L  +I+  +E+
Sbjct: 150 DRYQYQIIQLQNENKRLMTQISIAQEQ 176



>gi|302679150|ref|XP_003029257.1| expressed protein [Schizophyllum commune H4-8]
 gi|300102947|gb|EFI94354.1| expressed protein [Schizophyllum commune H4-8]
          Length = 377

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 48  AKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYN 107
           A + +N+AERRA HNAVER RRE LN +F +LA  LP+L+Q+RRPSKS IV  S+  I  
Sbjct: 38  ASRRSNTAERRATHNAVERQRRETLNGRFLDLAGLLPNLSQIRRPSKSAIVNSSIAHITA 97

Query: 108 ARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPI--PPREES 151
           AR+   L  +E+R ++ E D LR E+N+ R +  L  +  PPR E+
Sbjct: 98  ARRHRLLAARELRLLKLEADALRRELNEWRHRQNLPTVEEPPRSEA 143



>gi|511002857|gb|EPB84279.1| hypothetical protein HMPREF1544_08939 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 429

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 67/90 (74%), Gaps = 2/90 (2%)

Query: 56  ERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELH 115
           E+R  HNA+ER RRE LNTKFQELAH LP+L Q+RRPSKS+IV KSL+F+ +A +++   
Sbjct: 37  EKRTAHNALERQRREGLNTKFQELAHVLPALQQIRRPSKSMIVAKSLEFVSSAGERENEF 96

Query: 116 DKEMRSIRNEND-LLRE-EINKLREKLGLE 143
             ++ ++R EN+ L+R+  ++K R K  L+
Sbjct: 97  QGQIHALRKENEQLMRQASLSKKRMKKRLD 126



>gi|326521326|dbj|BAJ96866.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 454

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 68/117 (58%), Gaps = 3/117 (2%)

Query: 45  ANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDF 104
           A   +K  N+AE+R  HNA+ER RRE LN KF  LA  LPSLA  RRPSKS IV  S+  
Sbjct: 42  AKKPRKRVNTAEKRHQHNAIERQRRETLNGKFIVLARLLPSLANHRRPSKSAIVNGSIAH 101

Query: 105 IYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKPSTSQADEV 161
           +   R +  L  K +R I +E+D L  E+N+ R+  G     P+E S   T+  DEV
Sbjct: 102 LTYQRDQRLLAAKLLRQIASEHDALLNEVNEWRKTSGYA---PKESSCAWTAGIDEV 155



>gi|321264354|ref|XP_003196894.1| hypothetical protein CGB_L0170W [Cryptococcus gattii WM276]
 gi|317463372|gb|ADV25107.1| Hypothetical Protein CGB_L0170W [Cryptococcus gattii WM276]
          Length = 411

 Score = 90.1 bits (222), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 45  ANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDF 104
           A+  +K  N+AE+R+ HNA+ERARRE LN+KF +LA  LPSLA  RRPSKS IV  S+  
Sbjct: 46  ASKPRKRVNTAEKRSQHNAIERARRETLNSKFLDLARLLPSLASSRRPSKSAIVNGSISH 105

Query: 105 IYNARKKDELHDKEMRSIRNENDLLREEINKLREKLG 141
           +   RK+  L  K ++ +  E D L  E+N+ R   G
Sbjct: 106 LTYQRKQRLLAAKLLKQVLVERDELLREVNEWRSVSG 142



>gi|342321578|gb|EGU13511.1| Macrophage erythroblast attacher isoform 1 [Rhodotorula glutinis
           ATCC 204091]
          Length = 898

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 66/91 (72%), Gaps = 7/91 (7%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           +K  ++A++RA HNAVER RRE LNT+F +LA ALP++  ++RPSK++IV K+LD++Y++
Sbjct: 552 RKGPHNADKRATHNAVERKRRESLNTRFLDLAKALPTMQHIKRPSKAVIVTKALDYVYDS 611

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREK 139
             ++       R++  EN+ LR E++ LR K
Sbjct: 612 LLRE-------RALVEENNQLRVEVDALRAK 635



>gi|392573391|gb|EIW66531.1| hypothetical protein TREMEDRAFT_74726 [Tremella mesenterica DSM
           1558]
          Length = 466

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 68/119 (57%), Gaps = 5/119 (4%)

Query: 35  ANFTFQIPSIANAAK--KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRP 92
           +N    +PS  + +K  K  N+AE+R  HNA+ERARRE LN KF  LA  LP+LA  RRP
Sbjct: 31  SNIKSSVPSNTSKSKPRKRVNTAEKRNQHNAIERARRETLNGKFHSLARLLPALASSRRP 90

Query: 93  SKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREES 151
           SK+ IV  S++ +  +R       K +R++  E D L  E N  R+  G    PPRE S
Sbjct: 91  SKAAIVNGSINHLTRSRDDRLFAAKILRAVIAERDQLLAENNTFRKAAG---CPPREAS 146



>gi|405124040|gb|AFR98802.1| hypothetical protein CNAG_05375 [Cryptococcus neoformans var.
           grubii H99]
          Length = 411

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (64%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           +K  N+AE+R+ HNA+ERARRE LN+KF +LA  LPSLA  RRPSKS IV  S+  +   
Sbjct: 50  RKRVNTAEKRSQHNAIERARRETLNSKFLDLARLLPSLASSRRPSKSAIVNGSISHLTYQ 109

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLG 141
           RK+  L  K ++ +  E D L  E+N+ R   G
Sbjct: 110 RKQRLLASKLLKQVCVERDELLREVNEWRSVSG 142



>gi|472588288|gb|EMS25760.1| Hlh domain containing protein, transcription regulator
           [Rhodosporidium toruloides NP11]
          Length = 390

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 66/91 (72%), Gaps = 7/91 (7%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           +K  ++A++RA HNAVER RRE LNT+F +LA ALP++  ++RPSK++IV K+LD++Y++
Sbjct: 80  RKGPHNADKRATHNAVERKRRESLNTRFLDLAKALPTMQHIKRPSKAVIVTKALDYVYDS 139

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREK 139
             ++       R++  EN+ LR E++ LR K
Sbjct: 140 LLRE-------RALVEENNQLRVEVDALRAK 163



>gi|511005290|gb|EPB86635.1| hypothetical protein HMPREF1544_06611 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 294

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 58/79 (73%)

Query: 51  NTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARK 110
            +N A++RA HNA+ERARRECLNTKFQ+LAH+LP+L   RRPSK  I++++L+++    +
Sbjct: 135 GSNKAQKRAEHNAIERARRECLNTKFQQLAHSLPNLQNDRRPSKGTIIERTLEYVKQTVQ 194

Query: 111 KDELHDKEMRSIRNENDLL 129
           K+E    E+  +R  N+ L
Sbjct: 195 KEERFQSEIDQLRQANENL 213



>gi|401884282|gb|EJT48450.1| hypothetical protein A1Q1_02471 [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406695808|gb|EKC99108.1| hypothetical protein A1Q2_06649 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 423

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 74/127 (58%), Gaps = 4/127 (3%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           +K  N+AE+R  HNA+ER RRE LN+KF  LA  LPSLA  RRPSKS IV  S+  + + 
Sbjct: 38  RKRVNTAEKRHQHNAIERQRRETLNSKFLVLARLLPSLAACRRPSKSAIVNGSITHLTHQ 97

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLGLEPIPPREESKPS-TSQADEVKEDAKI 167
           R +  L  K +R +  E D L  E+N+ R+  G    PP+  +  S TS+ +E+ +  K 
Sbjct: 98  RNQRLLAAKLLRQLTAERDELFAEVNEWRKANGF---PPKAGAAASWTSEMEEICQVEKE 154

Query: 168 SSGKNQN 174
           + G   N
Sbjct: 155 TFGSFAN 161



>gi|384487152|gb|EIE79332.1| hypothetical protein RO3G_04037 [Rhizopus delemar RA 99-880]
          Length = 259

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 73/113 (64%), Gaps = 6/113 (5%)

Query: 23  SRMPSHHHPNGCANFTFQIPS-IANAAKKNTNSAERRANHNAVERARRECLNTKFQELAH 81
           SR  +  +PN  A      P+ I  + +K+     +R+ HNA+ER RRE LN+KFQELAH
Sbjct: 24  SRQRTPSYPNSAA-----YPAEINESQEKDLTYLAKRSAHNALERQRREGLNSKFQELAH 78

Query: 82  ALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEIN 134
            LP+L QV+RPSKS+IV KSL+F+  A +++  +  ++ ++R EN+ L  + N
Sbjct: 79  VLPALQQVKRPSKSMIVAKSLEFVSTAEQRELEYKDQLSALRQENERLLRQAN 131



>gi|384491737|gb|EIE82933.1| hypothetical protein RO3G_07638 [Rhizopus delemar RA 99-880]
          Length = 272

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 59/77 (76%)

Query: 56  ERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELH 115
           +RR+ HNA+ER RRE LN KFQ+LAHALPSL  VRRPSK+ IV KSL+F+ ++ K++   
Sbjct: 44  DRRSAHNALERQRREHLNLKFQQLAHALPSLQSVRRPSKATIVTKSLEFVSSSLKRETEF 103

Query: 116 DKEMRSIRNENDLLREE 132
             E+ S+R EN+ LR++
Sbjct: 104 MSEIESLRLENERLRKQ 120



>gi|302687867|ref|XP_003033613.1| expressed protein [Schizophyllum commune H4-8]
 gi|300107308|gb|EFI98710.1| expressed protein [Schizophyllum commune H4-8]
          Length = 384

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 66/98 (67%), Gaps = 2/98 (2%)

Query: 56  ERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNARKKDELH 115
           E+RA+HNAVE+ARRE LN +F ELA  LP+L+ +RRPSKS IV  S+  +  A++     
Sbjct: 65  EKRASHNAVEKARRETLNGRFLELAALLPNLSPIRRPSKSAIVNGSIAHVQAAQRHRASA 124

Query: 116 DKEMRSIRNENDLLREEINKLREKLGLEPI--PPREES 151
            +E+R ++ E D LR E+N+ R + G+  I  PPR ++
Sbjct: 125 ARELRLLKLETDALRRELNEWRVRKGISLIEEPPRSDT 162



>gi|511004173|gb|EPB85550.1| hypothetical protein HMPREF1544_07639 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 354

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 60/85 (70%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           KK  + AERRA HNA+ERARRE LNTKFQ LA ALP+L   RRPSKS IV+K+LD++  +
Sbjct: 78  KKPLSKAERRAEHNAIERARRENLNTKFQSLAQALPNLINYRRPSKSQIVEKALDWVKQS 137

Query: 109 RKKDELHDKEMRSIRNENDLLREEI 133
             ++E +  ++  ++ EN  L  ++
Sbjct: 138 ISREERYRYQVMQLQRENKRLLAQL 162



>gi|511011094|gb|EPB92308.1| hypothetical protein HMPREF1544_00877 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 414

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%)

Query: 43  SIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSL 102
           S     K++   AERRA HNA+ERARRE LN KFQ+LA  LP+L    RPSKS I+ ++L
Sbjct: 87  STGGNGKQHQTKAERRAEHNAIERARRESLNVKFQQLAFTLPNLQNDTRPSKSTIIDRTL 146

Query: 103 DFIYNARKKDELHDKEMRSIRNENDLLREEINK 135
           DF+ NA +K+E + + +  +   N  L  E +K
Sbjct: 147 DFVKNAIQKEERYLRRISELEKFNSYLLSESDK 179



>gi|384491900|gb|EIE83096.1| hypothetical protein RO3G_07801 [Rhizopus delemar RA 99-880]
          Length = 246

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 62/93 (66%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           KK     ERRA HNA+ERARRECLNTKFQ LA ALP+L   RRPSK  IV+K+LD+I  +
Sbjct: 24  KKPLTRDERRAEHNAIERARRECLNTKFQSLAQALPNLINYRRPSKGQIVEKALDWIKQS 83

Query: 109 RKKDELHDKEMRSIRNENDLLREEINKLREKLG 141
             ++E +  ++  ++ EN  L  +   +++++ 
Sbjct: 84  IVREERYRYQILQLQRENKELMAQCMSVQQQIS 116



>gi|384491114|gb|EIE82310.1| hypothetical protein RO3G_07015 [Rhizopus delemar RA 99-880]
          Length = 186

 Score = 83.6 bits (205), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 4/104 (3%)

Query: 30  HPNGCANFTFQIPSIANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQV 89
           H N C  +++ I  I + A+K    A++RA HNA+ERARRE LNTK Q+LA +LP++   
Sbjct: 39  HNNNCHQYSYAIDQIPDKAEK----AQKRAEHNAIERARRESLNTKLQQLALSLPNIQND 94

Query: 90  RRPSKSIIVQKSLDFIYNARKKDELHDKEMRSIRNENDLLREEI 133
           RRPSK  I++++L++I    +K+E    ++  +R  N+ L  ++
Sbjct: 95  RRPSKGTIIERTLEYIKQTVQKEEEFKYQIEQLRKANETLYSQM 138



>gi|390597536|gb|EIN06935.1| hypothetical protein PUNSTDRAFT_45499 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 468

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (59%), Gaps = 14/117 (11%)

Query: 50  KNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNAR 109
           +  N+AERRA HNAVER RRE LN +F            +RRPSKS IV  S+  ++ +R
Sbjct: 81  RRANTAERRATHNAVERQRRETLNGRFL-----------IRRPSKSAIVNSSIAHVHASR 129

Query: 110 KKDELHDKEMRSIRNENDLLREEINKLREKLGLEPI--PPREESKPSTSQADEVKED 164
           +   +  +E+R ++ E+D LR E+N+ R++ GL     PPR E+  +T  + E++ D
Sbjct: 130 RHRLMAARELRLLKLESDALRRELNEWRDRAGLPRCDEPPRSEAF-ATVMSGEIELD 185



>gi|302673188|ref|XP_003026281.1| hypothetical protein SCHCODRAFT_114761 [Schizophyllum commune H4-8]
 gi|300099962|gb|EFI91378.1| hypothetical protein SCHCODRAFT_114761 [Schizophyllum commune H4-8]
          Length = 544

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 77/142 (54%), Gaps = 5/142 (3%)

Query: 45  ANAAKKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDF 104
           A+  ++ T +A+ RA H  +E+ RRE LN KF +LA  LP+LA VRR SK +IV  S+  
Sbjct: 33  ASKKRRRTFTADDRAQHRVIEKQRREALNEKFIDLARLLPNLAHVRRLSKGLIVDASIAH 92

Query: 105 IYNARKKDELHDKEMRSIRNENDLLREEINKLREKLGLEP---IPPREESKPSTSQADEV 161
               R +  L  +E+R +  E + L +E++ LRE+L   P    P R + +P T Q   V
Sbjct: 93  HKRQRAQRLLASQEVRVLLEEREGLYKELDALRERLKEPPANAAPKRPDLRPETKQILAV 152

Query: 162 KED--AKISSGKNQNSPEIKNE 181
           +E+      +G   N PE   E
Sbjct: 153 EEEVCGTFPAGFGDNGPEDGQE 174



>gi|384492013|gb|EIE83209.1| hypothetical protein RO3G_07914 [Rhizopus delemar RA 99-880]
          Length = 219

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 49  KKNTNSAERRANHNAVERARRECLNTKFQELAHALPSLAQVRRPSKSIIVQKSLDFIYNA 108
           KK    AERRA  NA ERARRECLN KF+ LA  LP+L   RRPSKS IV+K+LD++  +
Sbjct: 25  KKPLTKAERRAEQNATERARRECLNAKFRCLAQTLPNLIHHRRPSKSQIVEKALDWVKQS 84

Query: 109 RKKDELHDKEMRSIRNENDLL 129
             ++E + +++  ++ E + L
Sbjct: 85  IAREEHYRRQILLLQREKERL 105