BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10085_c0_seq1-m.30 complete 3-590(+) 196 (+)
         (195 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|169619006|ref|XP_001802916.1| hypothetical protein SNOG_12696...   157   1e-36   Parastagonospora nodorum SN15
gi|330921886|ref|XP_003299604.1| hypothetical protein PTT_10637 ...   157   1e-36   Pyrenophora teres f. teres 0-1
gi|189210583|ref|XP_001941623.1| mitochondrial import inner memb...   156   2e-36   Pyrenophora tritici-repentis Pt-1C-BFP
gi|482806733|gb|EOA83785.1| hypothetical protein SETTUDRAFT_1642...   154   8e-36   Setosphaeria turcica Et28A
gi|396458929|ref|XP_003834077.1| similar to mitochondrial import...   154   9e-36   Leptosphaeria maculans JN3
gi|485921126|gb|EOD46926.1| putative mitochondrial import inner ...   151   7e-35   Neofusicoccum parvum UCRNP2
gi|451995812|gb|EMD88280.1| hypothetical protein COCHEDRAFT_1144...   151   9e-35   Bipolaris maydis C5
gi|451851412|gb|EMD64710.1| hypothetical protein COCSADRAFT_3609...   151   1e-34   Bipolaris sorokiniana ND90Pr
gi|326471812|gb|EGD95821.1| mitochondrial import inner membrane ...   150   2e-34   Trichophyton tonsurans CBS 112818
gi|255933265|ref|XP_002558103.1| Pc12g12950 [Penicillium chrysog...   150   2e-34   Penicillium rubens Wisconsin 54-1255
gi|303315331|ref|XP_003067673.1| Mitochondrial import inner memb...   149   2e-34   Coccidioides posadasii C735 delta SOWgp
gi|302502302|ref|XP_003013142.1| hypothetical protein ARB_00687 ...   149   3e-34   Arthroderma benhamiae CBS 112371
gi|119190879|ref|XP_001246046.1| hypothetical protein CIMG_05487...   149   4e-34   Coccidioides immitis RS
gi|407917595|gb|EKG10899.1| Mitochondrial inner membrane translo...   149   4e-34   Macrophomina phaseolina MS6
gi|320035494|gb|EFW17435.1| mitochondrial import inner membrane ...   149   5e-34   Coccidioides posadasii str. Silveira
gi|315051298|ref|XP_003175023.1| mitochondrial import inner memb...   148   6e-34   Microsporum gypseum CBS 118893
gi|213409133|ref|XP_002175337.1| TIM23 translocase complex subun...   148   7e-34   Schizosaccharomyces japonicus yFS275
gi|512199882|gb|EPE28715.1| hypothetical protein GLAREA_09836 [G...   147   1e-33   Glarea lozoyensis ATCC 20868
gi|296811967|ref|XP_002846321.1| mitochondrial import inner memb...   147   2e-33   Arthroderma otae CBS 113480
gi|378731402|gb|EHY57861.1| hypothetical protein HMPREF1120_0588...   144   1e-32   Exophiala dermatitidis NIH/UT8656
gi|425768027|gb|EKV06573.1| Mitochondrial import inner membrane ...   144   1e-32   Penicillium digitatum Pd1
gi|406864521|gb|EKD17566.1| hypothetical protein MBM_04427 [Mars...   144   2e-32   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|154294142|ref|XP_001547514.1| hypothetical protein BC1G_14141...   143   2e-32   Botrytis cinerea B05.10
gi|212527410|ref|XP_002143862.1| Mitochondrial import inner memb...   143   2e-32   Talaromyces marneffei ATCC 18224
gi|242783676|ref|XP_002480234.1| Mitochondrial import inner memb...   143   3e-32   Talaromyces stipitatus ATCC 10500
gi|327304130|ref|XP_003236757.1| mitochondrial import inner memb...   142   4e-32   Trichophyton rubrum CBS 118892
gi|156033253|ref|XP_001585463.1| hypothetical protein SS1G_13702...   142   4e-32   Sclerotinia sclerotiorum 1980 UF-70
gi|85084169|ref|XP_957257.1| mitochondrial import inner membrane...   142   5e-32   
gi|342873550|gb|EGU75714.1| hypothetical protein FOXB_13733 [Fus...   141   7e-32   Fusarium oxysporum Fo5176
gi|302653229|ref|XP_003018444.1| hypothetical protein TRV_07544 ...   141   8e-32   Trichophyton verrucosum HKI 0517
gi|261195696|ref|XP_002624252.1| mitochondrial import inner memb...   141   9e-32   Blastomyces gilchristii SLH14081
gi|116207336|ref|XP_001229477.1| hypothetical protein CHGG_02961...   141   9e-32   Chaetomium globosum CBS 148.51
gi|452843650|gb|EME45585.1| hypothetical protein DOTSEDRAFT_1710...   140   1e-31   Dothistroma septosporum NZE10
gi|477529386|gb|ENH81150.1| mitochondrial import inner membrane ...   140   1e-31   Colletotrichum orbiculare MAFF 240422
gi|440639020|gb|ELR08939.1| hypothetical protein GMDG_03606 [Geo...   140   2e-31   Pseudogymnoascus destructans 20631-21
gi|453082298|gb|EMF10345.1| mitochondrial import inner membrane ...   139   3e-31   Sphaerulina musiva SO2202
gi|367027460|ref|XP_003663014.1| hypothetical protein MYCTH_2079...   139   3e-31   Myceliophthora thermophila ATCC 42464
gi|19075496|ref|NP_587996.1| TIM23 translocase complex subunit T...   139   3e-31   Schizosaccharomyces pombe 972h-
gi|336469913|gb|EGO58075.1| mitochondrial import inner membrane ...   138   6e-31   Neurospora tetrasperma FGSC 2508
gi|336258890|ref|XP_003344251.1| hypothetical protein SMAC_06454...   138   6e-31   Sordaria macrospora k-hell
gi|452984767|gb|EME84524.1| hypothetical protein MYCFIDRAFT_1527...   138   6e-31   Cercospora fijiensis CIRAD86
gi|346971269|gb|EGY14721.1| mitochondrial import inner membrane ...   138   8e-31   Verticillium dahliae VdLs.17
gi|345571466|gb|EGX54280.1| hypothetical protein AOL_s00004g313 ...   138   9e-31   Arthrobotrys oligospora ATCC 24927
gi|296420978|ref|XP_002840044.1| hypothetical protein [Tuber mel...   137   1e-30   Tuber melanosporum Mel28
gi|115384460|ref|XP_001208777.1| hypothetical protein ATEG_01412...   137   2e-30   Aspergillus terreus NIH2624
gi|171685892|ref|XP_001907887.1| hypothetical protein [Podospora...   137   2e-30   Podospora anserina S mat+
gi|367050354|ref|XP_003655556.1| hypothetical protein THITE_2080...   136   2e-30   Thielavia terrestris NRRL 8126
gi|402086906|gb|EJT81804.1| mitochondrial import inner membrane ...   136   2e-30   Gaeumannomyces graminis var. tritici R3-111a-1
gi|225563460|gb|EEH11739.1| mitochondrial import inner membrane ...   136   3e-30   Histoplasma capsulatum G186AR
gi|325093423|gb|EGC46733.1| mitochondrial import inner membrane ...   136   3e-30   Histoplasma capsulatum H88
gi|154282189|ref|XP_001541907.1| mitochondrial import inner memb...   136   3e-30   Histoplasma capsulatum NAm1
gi|310798429|gb|EFQ33322.1| hypothetical protein GLRG_08466 [Glo...   135   3e-30   Colletotrichum graminicola M1.001
gi|398405424|ref|XP_003854178.1| hypothetical protein MYCGRDRAFT...   135   4e-30   Zymoseptoria tritici IPO323
gi|429863451|gb|ELA37902.1| mitochondrial import inner membrane ...   135   5e-30   Colletotrichum gloeosporioides Nara gc5
gi|121716248|ref|XP_001275733.1| Mitochondrial import inner memb...   135   5e-30   Aspergillus clavatus NRRL 1
gi|67540356|ref|XP_663952.1| hypothetical protein AN6348.2 [Aspe...   135   6e-30   Aspergillus nidulans FGSC A4
gi|50290119|ref|XP_447491.1| hypothetical protein [Candida glabr...   134   1e-29   Candida glabrata CBS 138
gi|340516373|gb|EGR46622.1| predicted protein [Trichoderma reese...   134   1e-29   Trichoderma reesei QM6a
gi|302903759|ref|XP_003048927.1| hypothetical protein NECHADRAFT...   134   1e-29   Nectria haematococca mpVI 77-13-4
gi|238490402|ref|XP_002376438.1| mitochondrial import inner memb...   134   2e-29   Aspergillus flavus NRRL3357
gi|389632517|ref|XP_003713911.1| mitochondrial import inner memb...   133   2e-29   Magnaporthe oryzae 70-15
gi|119481693|ref|XP_001260875.1| Mitochondrial import inner memb...   133   3e-29   Aspergillus fischeri NRRL 181
gi|449303383|gb|EMC99391.1| hypothetical protein BAUCODRAFT_1375...   132   3e-29   Baudoinia panamericana UAMH 10762
gi|358379404|gb|EHK17084.1| hypothetical protein TRIVIDRAFT_8838...   132   3e-29   Trichoderma virens Gv29-8
gi|512187748|gb|EPE03525.1| mitochondrial import inner membrane ...   132   4e-29   Ophiostoma piceae UAMH 11346
gi|410080468|ref|XP_003957814.1| hypothetical protein KAFR_0F008...   132   4e-29   Kazachstania africana CBS 2517
gi|470319476|gb|EMR11095.1| hypothetical protein PNEG_00694 [Pne...   132   6e-29   Pneumocystis murina B123
gi|358398207|gb|EHK47565.1| hypothetical protein TRIATDRAFT_2986...   131   7e-29   Trichoderma atroviride IMI 206040
gi|393222079|gb|EJD07563.1| Tim17-domain-containing protein [Fom...   131   7e-29   Fomitiporia mediterranea MF3/22
gi|380492259|emb|CCF34736.1| hypothetical protein CH063_06670 [C...   131   7e-29   Colletotrichum higginsianum
gi|260944246|ref|XP_002616421.1| hypothetical protein CLUG_03662...   131   7e-29   Clavispora lusitaniae ATCC 42720
gi|400595141|gb|EJP62951.1| mitochondrial import inner membrane ...   130   1e-28   Beauveria bassiana ARSEF 2860
gi|430811196|emb|CCJ31371.1| unnamed protein product [Pneumocyst...   130   1e-28   Pneumocystis jirovecii
gi|83768574|dbj|BAE58711.1| unnamed protein product [Aspergillus...   130   2e-28   Aspergillus oryzae RIB40
gi|50413121|ref|XP_457210.1| DEHA2B05742p [Debaryomyces hansenii...   129   3e-28   Debaryomyces hansenii CBS767
gi|295673869|ref|XP_002797480.1| mitochondrial import inner memb...   129   3e-28   Paracoccidioides lutzii Pb01
gi|46122401|ref|XP_385754.1| hypothetical protein FG05578.1 [Fus...   129   3e-28   
gi|322709258|gb|EFZ00834.1| mitochondrial import inner membrane ...   129   3e-28   Metarhizium robertsii ARSEF 23
gi|513030016|gb|AGO10060.1| AaceriAAR070Cp [Saccharomycetaceae s...   129   4e-28   Saccharomycetaceae sp. 'Ashbya aceri'
gi|511006494|gb|EPB87804.1| hypothetical protein HMPREF1544_0533...   129   4e-28   Mucor circinelloides f. circinelloides 1006PhL
gi|408394341|gb|EKJ73549.1| hypothetical protein FPSE_06167 [Fus...   129   4e-28   Fusarium pseudograminearum CS3096
gi|226286907|gb|EEH42420.1| mitochondrial import inner membrane ...   129   4e-28   
gi|349580951|dbj|GAA26110.1| K7_Mas6p [Saccharomyces cerevisiae ...   129   4e-28   Saccharomyces cerevisiae Kyokai no. 7
gi|323303210|gb|EGA57009.1| Tim23p [Saccharomyces cerevisiae Fos...   129   4e-28   Saccharomyces cerevisiae FostersB
gi|398365641|ref|NP_014414.3| Tim23p [Saccharomyces cerevisiae S...   129   4e-28   Saccharomyces cerevisiae S288c
gi|323307399|gb|EGA60675.1| Tim23p [Saccharomyces cerevisiae Fos...   129   5e-28   Saccharomyces cerevisiae FostersO
gi|225684562|gb|EEH22846.1| mitochondrial import inner membrane ...   128   6e-28   
gi|406606723|emb|CCH41947.1| Mitochondrial import inner membrane...   128   6e-28   Wickerhamomyces ciferrii
gi|71002142|ref|XP_755752.1| Mitochondrial import inner membrane...   128   7e-28   Aspergillus fumigatus Af293
gi|471573847|gb|EMR71884.1| putative mitochondrial import inner ...   128   8e-28   Eutypa lata UCREL1
gi|323331767|gb|EGA73180.1| Tim23p [Saccharomyces cerevisiae AWR...   128   9e-28   Saccharomyces cerevisiae AWRI796
gi|156848913|ref|XP_001647337.1| hypothetical protein Kpol_1018p...   128   9e-28   Vanderwaltozyma polyspora DSM 70294
gi|258565045|ref|XP_002583267.1| mitochondrial import inner memb...   127   1e-27   Uncinocarpus reesii 1704
gi|255710879|ref|XP_002551723.1| KLTH0A06072p [Lachancea thermot...   127   2e-27   Lachancea thermotolerans CBS 6340
gi|45184893|ref|NP_982611.1| AAR070Cp [Ashbya gossypii ATCC 1089...   127   2e-27   Eremothecium gossypii ATCC 10895
gi|390596715|gb|EIN06116.1| Tim17-domain-containing protein [Pun...   127   2e-27   Punctularia strigosozonata HHB-11173 SS5
gi|346319505|gb|EGX89106.1| mitochondrial import inner membrane ...   126   2e-27   Cordyceps militaris CM01
gi|321263201|ref|XP_003196319.1| mitochondrial import inner memb...   125   6e-27   Cryptococcus gattii WM276
gi|302687080|ref|XP_003033220.1| hypothetical protein SCHCODRAFT...   125   6e-27   Schizophyllum commune H4-8
gi|320592295|gb|EFX04734.1| mitochondrial import inner membrane ...   124   1e-26   Grosmannia clavigera kw1407
gi|367004250|ref|XP_003686858.1| hypothetical protein TPHA_0H022...   124   1e-26   Tetrapisispora phaffii CBS 4417
gi|494827526|gb|EON64476.1| hypothetical protein W97_03708 [Coni...   124   1e-26   Coniosporium apollinis CBS 100218
gi|367009538|ref|XP_003679270.1| hypothetical protein TDEL_0A072...   124   1e-26   Torulaspora delbrueckii
gi|405119974|gb|AFR94745.1| mitochondrial import inner membrane ...   124   1e-26   Cryptococcus neoformans var. grubii H99
gi|58265812|ref|XP_570062.1| mitochondrial import inner membrane...   124   1e-26   Cryptococcus neoformans var. neoformans JEC21
gi|336363824|gb|EGN92195.1| hypothetical protein SERLA73DRAFT_19...   124   2e-26   Serpula lacrymans var. lacrymans S7.3
gi|365758631|gb|EHN00465.1| Tim23p [Saccharomyces cerevisiae x S...   123   2e-26   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|401840942|gb|EJT43552.1| TIM23-like protein [Saccharomyces ku...   123   2e-26   Saccharomyces kudriavzevii IFO 1802
gi|395331757|gb|EJF64137.1| Tim17-domain-containing protein [Dic...   123   3e-26   Dichomitus squalens LYAD-421 SS1
gi|392589867|gb|EIW79197.1| Tim17-domain-containing protein [Con...   123   3e-26   Coniophora puteana RWD-64-598 SS2
gi|169849935|ref|XP_001831666.1| mitochondrial import inner memb...   122   3e-26   Coprinopsis cinerea okayama7#130
gi|241952300|ref|XP_002418872.1| membrane import machinery prote...   122   4e-26   Candida dubliniensis CD36
gi|254581666|ref|XP_002496818.1| ZYRO0D08844p [Zygosaccharomyces...   122   5e-26   Zygosaccharomyces rouxii CBS 732
gi|322699579|gb|EFY91339.1| mitochondrial import inner membrane ...   121   8e-26   Metarhizium acridum CQMa 102
gi|402216502|gb|EJT96589.1| Tim17-domain-containing protein [Dac...   121   1e-25   Dacryopinax primogenitus
gi|340959433|gb|EGS20614.1| hypothetical protein CTHT_0024480 [C...   120   1e-25   Chaetomium thermophilum var. thermophilum DSM 1495
gi|68482810|ref|XP_714631.1| hypothetical protein CaO19.8941 [Ca...   120   2e-25   Candida albicans SC5314
gi|358365876|dbj|GAA82498.1| mitochondrial import inner membrane...   120   2e-25   Aspergillus kawachii IFO 4308
gi|317027421|ref|XP_001399276.2| import inner membrane transloca...   120   2e-25   Aspergillus niger CBS 513.88
gi|50310665|ref|XP_455354.1| hypothetical protein [Kluyveromyces...   120   2e-25   Kluyveromyces lactis NRRL Y-1140
gi|186703661|emb|CAQ43270.1| Mitochondrial import inner membrane...   119   3e-25   Zygosaccharomyces rouxii
gi|392565580|gb|EIW58757.1| mitochondrial import inner membrane ...   119   3e-25   Trametes versicolor FP-101664 SS1
gi|344230306|gb|EGV62191.1| mitochondrial import i [Candida tenu...   119   4e-25   Candida tenuis ATCC 10573
gi|71020811|ref|XP_760636.1| hypothetical protein UM04489.1 [Ust...   119   4e-25   
gi|501305814|dbj|GAC94936.1| hypothetical protein PHSY_002509 [P...   119   5e-25   Pseudozyma hubeiensis SY62
gi|409081578|gb|EKM81937.1| hypothetical protein AGABI1DRAFT_112...   119   5e-25   Agaricus bisporus var. burnettii JB137-S8
gi|146422995|ref|XP_001487431.1| hypothetical protein PGUG_00808...   119   5e-25   Meyerozyma guilliermondii ATCC 6260
gi|392575491|gb|EIW68624.1| hypothetical protein TREMEDRAFT_2345...   118   6e-25   Tremella mesenterica DSM 1558
gi|444321586|ref|XP_004181449.1| hypothetical protein TBLA_0F039...   118   6e-25   Tetrapisispora blattae CBS 6284
gi|409040929|gb|EKM50415.1| hypothetical protein PHACADRAFT_2636...   117   1e-24   Phanerochaete carnosa HHB-10118-sp
gi|134056178|emb|CAK96353.1| unnamed protein product [Aspergillu...   117   1e-24   Aspergillus niger
gi|363748917|ref|XP_003644676.1| hypothetical protein Ecym_2106 ...   117   1e-24   Eremothecium cymbalariae DBVPG#7215
gi|459371641|gb|EMG49361.1| Mitochondrial import inner membrane ...   117   2e-24   Candida maltosa Xu316
gi|393240514|gb|EJD48040.1| Tim17-domain-containing protein [Aur...   116   2e-24   Auricularia subglabra TFB-10046 SS5
gi|399172309|emb|CCE26994.1| probable TIM23 translocase [Clavice...   116   3e-24   Claviceps purpurea 20.1
gi|170105098|ref|XP_001883762.1| predicted protein [Laccaria bic...   116   3e-24   Laccaria bicolor S238N-H82
gi|388583708|gb|EIM24009.1| Tim17-domain-containing protein [Wal...   115   5e-24   Wallemia mellicola CBS 633.66
gi|403413659|emb|CCM00359.1| predicted protein [Fibroporia radic...   115   7e-24   Fibroporia radiculosa
gi|365991543|ref|XP_003672600.1| hypothetical protein NDAI_0K016...   114   9e-24   Naumovozyma dairenensis CBS 421
gi|343425378|emb|CBQ68913.1| probable MAS6-mitochondrial inner m...   114   1e-23   Sporisorium reilianum SRZ2
gi|511004272|gb|EPB85647.1| hypothetical protein HMPREF1544_0755...   114   1e-23   Mucor circinelloides f. circinelloides 1006PhL
gi|366987277|ref|XP_003673405.1| hypothetical protein NCAS_0A046...   114   1e-23   Naumovozyma castellii CBS 4309
gi|465795795|emb|CCV00228.1| unnamed protein product [Malassezia...   114   1e-23   Malassezia sympodialis ATCC 42132
gi|255725492|ref|XP_002547675.1| mitochondrial import inner memb...   112   4e-23   Candida tropicalis MYA-3404
gi|344302498|gb|EGW32772.1| hypothetical protein SPAPADRAFT_5479...   111   1e-22   Spathaspora passalidarum NRRL Y-27907
gi|126135390|ref|XP_001384219.1| mitochondrial import inner memb...   111   1e-22   Scheffersomyces stipitis CBS 6054
gi|449547923|gb|EMD38890.1| hypothetical protein CERSUDRAFT_4785...   110   1e-22   Gelatoporia subvermispora B
gi|448080824|ref|XP_004194735.1| Piso0_005248 [Millerozyma farin...   110   1e-22   Millerozyma farinosa CBS 7064
gi|448524117|ref|XP_003868926.1| Tim23 protein [Candida orthopsi...   109   4e-22   Candida orthopsilosis Co 90-125
gi|448085314|ref|XP_004195827.1| Piso0_005248 [Millerozyma farin...   108   5e-22   Millerozyma farinosa CBS 7064
gi|403215305|emb|CCK69804.1| hypothetical protein KNAG_0D00520 [...   108   7e-22   Kazachstania naganishii CBS 8797
gi|384499340|gb|EIE89831.1| hypothetical protein RO3G_14542 [Rhi...   108   9e-22   Rhizopus delemar RA 99-880
gi|323346748|gb|EGA81029.1| Tim23p [Saccharomyces cerevisiae Lal...   108   1e-21   Saccharomyces cerevisiae Lalvin QA23
gi|254566507|ref|XP_002490364.1| Essential protein of the mitoch...   106   3e-21   Komagataella phaffii GS115
gi|320580213|gb|EFW94436.1| mitochondrial import inner membrane ...   105   5e-21   
gi|406695202|gb|EKC98514.1| import inner membrane translocase su...   103   2e-20   Trichosporon asahii var. asahii CBS 8904
gi|354548174|emb|CCE44910.1| hypothetical protein CPAR2_407120 [...   102   5e-20   Candida parapsilosis
gi|443900222|dbj|GAC77548.1| mitochondrial import inner membrane...   102   5e-20   Moesziomyces antarcticus T-34
gi|207341584|gb|EDZ69597.1| YNR017Wp-like protein [Saccharomyces...   102   6e-20   Saccharomyces cerevisiae AWRI1631
gi|353239449|emb|CCA71360.1| probable MAS6-mitochondrial inner m...   102   7e-20   Serendipita indica DSM 11827
gi|164655112|ref|XP_001728687.1| hypothetical protein MGL_4166 [...   100   2e-19   Malassezia globosa CBS 7966
gi|401887125|gb|EJT51130.1| import inner membrane translocase su...   100   2e-19   Trichosporon asahii var. asahii CBS 2479
gi|50557202|ref|XP_506009.1| YALI0F29183p [Yarrowia lipolytica] ...    99   4e-19   Yarrowia lipolytica CLIB122
gi|388857694|emb|CCF48588.1| probable MAS6-mitochondrial inner m...    99   6e-19   Ustilago hordei
gi|149239921|ref|XP_001525836.1| mitochondrial import inner memb...    98   1e-18   Lodderomyces elongisporus NRRL YB-4239
gi|358060850|dbj|GAA93468.1| hypothetical protein E5Q_00109 [Mix...    97   2e-18   Mixia osmundae IAM 14324
gi|385302072|gb|EIF46221.1| mitochondrial import inner membrane ...    96   6e-18   Brettanomyces bruxellensis AWRI1499
gi|505757048|gb|EOR01182.1| hypothetical protein J056_004503 [Wa...    94   1e-17   Wallemia ichthyophaga EXF-994
gi|340385810|ref|XP_003391401.1| PREDICTED: mitochondrial import...    94   2e-17   Amphimedon queenslandica
gi|340374126|ref|XP_003385589.1| PREDICTED: mitochondrial import...    94   2e-17   Amphimedon queenslandica
gi|328857189|gb|EGG06307.1| hypothetical protein MELLADRAFT_4357...    90   3e-16   Melampsora larici-populina 98AG31
gi|328767736|gb|EGF77785.1| hypothetical protein BATDEDRAFT_9147...    89   5e-16   Batrachochytrium dendrobatidis JAM81
gi|331228220|ref|XP_003326777.1| hypothetical protein PGTG_08314...    88   9e-16   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|156363539|ref|XP_001626100.1| predicted protein [Nematostella...    87   2e-15   Nematostella vectensis
gi|449665172|ref|XP_002158574.2| PREDICTED: mitochondrial import...    86   7e-15   
gi|196012802|ref|XP_002116263.1| hypothetical protein TRIADDRAFT...    75   1e-11   Trichoplax adhaerens
gi|342319315|gb|EGU11264.1| Mitochondrial import inner membrane ...    74   2e-11   Rhodotorula toruloides ATCC 204091
gi|472586893|gb|EMS24392.1| mitochondrial import inner membrane ...    74   2e-11   Rhodotorula toruloides NP11
gi|326426837|gb|EGD72407.1| hypothetical protein PTSG_00427 [Sal...    73   3e-11   Salpingoeca rosetta
gi|485620853|gb|EOD17364.1| hypothetical protein EMIHUDRAFT_4160...    73   4e-11   Emiliania huxleyi CCMP1516


>gi|169619006|ref|XP_001802916.1| hypothetical protein SNOG_12696 [Phaeosphaeria nodorum SN15]
 gi|111058874|gb|EAT79994.1| hypothetical protein SNOG_12696 [Phaeosphaeria nodorum SN15]
          Length = 221

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 114/190 (60%), Gaps = 11/190 (5%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG--AVDYLRLDEQVVTPGA---LPS 65
           +Q++P    T     SDF+    L P QL  +AGL    +DYL L++ V   GA   LPS
Sbjct: 31  FQATPFDPNTAIQNPSDFI----LDPSQLHPLAGLNQDTLDYLSLEDSVADLGAASALPS 86

Query: 66  RGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGN 123
           RG  DDLC                WGL EGL  + P+   +LRLN +LN+VTRRGPF+GN
Sbjct: 87  RGWSDDLCYGTGVSYLTALTIGGAWGLAEGLQKNPPSMPPRLRLNGVLNAVTRRGPFLGN 146

Query: 124 SCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAG 183
           S G++AM YN +N TIG  RGKHD+ NSIA+GAL G LFKST G R    ++ ICA+ AG
Sbjct: 147 SAGVIAMVYNGMNSTIGYYRGKHDATNSIAAGALSGALFKSTRGTRPMAISAGICASVAG 206

Query: 184 TWTLAKKYFF 193
            W L +K FF
Sbjct: 207 GWALTRKVFF 216



>gi|330921886|ref|XP_003299604.1| hypothetical protein PTT_10637 [Pyrenophora teres f. teres 0-1]
 gi|311326652|gb|EFQ92309.1| hypothetical protein PTT_10637 [Pyrenophora teres f. teres 0-1]
          Length = 226

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 117/193 (60%), Gaps = 13/193 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGL--GAVDYLRLDEQVVT--PGA---L 63
           +Q +P    T     S+FL    + P QL  +AGL  G +DYL L++ V++  PGA   L
Sbjct: 31  FQPTPFDPNTAIQNPSEFL----VDPSQLHPLAGLNQGTLDYLSLEDSVLSDLPGAQSAL 86

Query: 64  PSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFI 121
           PSRG  DDLC               VWGL EGL  + P+   +LR+N +LN+VTRRGPF+
Sbjct: 87  PSRGWSDDLCYGTGVSYLSALTIGGVWGLAEGLQKNPPSMPPRLRINGVLNAVTRRGPFL 146

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++AM YN IN TIG  RGKH++ NSI +GAL G LFKST G R    +S ICA  
Sbjct: 147 GNSAGVIAMVYNGINSTIGHYRGKHETSNSIVAGALSGALFKSTRGTRQMAISSGICATV 206

Query: 182 AGTWTLAKKYFFK 194
           AG W + +K FF+
Sbjct: 207 AGGWAITRKVFFE 219



>gi|189210583|ref|XP_001941623.1| mitochondrial import inner membrane translocase subunit tim23
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187977716|gb|EDU44342.1| mitochondrial import inner membrane translocase subunit tim23
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 226

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 116/193 (60%), Gaps = 13/193 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGL--GAVDYLRLDEQVVT--PGA---L 63
           +Q +P    T     S+FL    L P QL  +AGL  G +DYL L++ V++  PGA   L
Sbjct: 31  FQPTPFDPNTAIQNPSEFL----LDPSQLHPLAGLNQGTLDYLSLEDSVLSDLPGAQSAL 86

Query: 64  PSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFI 121
           PSRG  DDLC                WGL EGL  + P+   +LR+N +LN+VTRRGPF+
Sbjct: 87  PSRGWSDDLCYGTGVSYLSALTIGGAWGLAEGLQKNPPSMPPRLRINGVLNAVTRRGPFL 146

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++AM YN IN TIG  RGKH++ NSI +GAL G LFKST G R    +S ICA  
Sbjct: 147 GNSAGVIAMVYNGINSTIGHYRGKHETSNSIVAGALSGALFKSTRGTRQMAISSGICATV 206

Query: 182 AGTWTLAKKYFFK 194
           AG W + +K FF+
Sbjct: 207 AGGWAITRKVFFE 219



>gi|482806733|gb|EOA83785.1| hypothetical protein SETTUDRAFT_164209 [Setosphaeria turcica Et28A]
          Length = 225

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 116/193 (60%), Gaps = 13/193 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGL--GAVDYLRLDEQVVT--PGA---L 63
           +Q +P    T     S+FL    L P QL  +AGL  G +DYL L++Q+ +  PGA   L
Sbjct: 31  FQPTPFDPTTAIQNPSEFL----LDPSQLHPLAGLNQGTLDYLSLEDQLPSDLPGAQSAL 86

Query: 64  PSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFI 121
           PSRG  DDLC                WGL EGL  + P+   +LRLN +LN++TRRGPF+
Sbjct: 87  PSRGWSDDLCYGTGVCYLSALTIGGAWGLAEGLQKNPPSMPPRLRLNGVLNAITRRGPFL 146

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++AM YN IN TIG  RGKH+  NSI +GAL G LFKST G R    +S ICA  
Sbjct: 147 GNSAGVIAMVYNGINSTIGYYRGKHEMSNSIVAGALSGALFKSTRGTRQMAISSGICATV 206

Query: 182 AGTWTLAKKYFFK 194
           AG+W + ++ FF+
Sbjct: 207 AGSWAITRRVFFE 219



>gi|396458929|ref|XP_003834077.1| similar to mitochondrial import inner membrane translocase subunit
           tim23 [Leptosphaeria maculans JN3]
 gi|312210626|emb|CBX90712.1| similar to mitochondrial import inner membrane translocase subunit
           tim23 [Leptosphaeria maculans JN3]
          Length = 225

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 111/180 (61%), Gaps = 7/180 (3%)

Query: 21  DPVAVSDFLARVNLGPGQLREIAGL--GAVDYLRLDEQVVT--PGALPSRGGFDDLCXXX 76
           DP  + + L +V   P QL  +AGL    ++YL L++ V++    ALPSRG  DDLC   
Sbjct: 39  DPSTIQNPL-QVTYDPVQLHPLAGLTQDTLEYLSLEDSVLSDNQSALPSRGWSDDLCYGT 97

Query: 77  XXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL EGL  + P+   +LRLN +LN++TRRGPF+GNS G++AM YN 
Sbjct: 98  GVSYLTALSIGGAWGLAEGLKKNPPSMPPRLRLNGVLNAITRRGPFLGNSAGVIAMVYNG 157

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           IN TIG  RGKHD  NS+ +GAL G +FKST G R    +S ICAA AG+W + +K FF+
Sbjct: 158 INSTIGYYRGKHDMTNSVVAGALSGAIFKSTRGTRQMAISSGICAAVAGSWAITRKVFFE 217



>gi|485921126|gb|EOD46926.1| putative mitochondrial import inner membrane translocase subunit
           tim23 protein [Neofusicoccum parvum UCRNP2]
          Length = 224

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 115/203 (56%), Gaps = 15/203 (7%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLG--AVDYLRLDEQVV 58
           +S+T      P  F  DP   +D  + +N        QL  +AGL    +DYL L+E  +
Sbjct: 24  ASDTQTDSFQPAAF--DPSTATDVSSFLNSSTAFDATQLHPLAGLDKDTLDYLTLEEGAL 81

Query: 59  T--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTIL 111
           +  PGA   LPSRG  DDLC                WGL EGL+  +P    +LRLN +L
Sbjct: 82  SDLPGARSALPSRGWSDDLCYGTGTTYLTALSLGGAWGLAEGLNKTTPQMQPRLRLNAVL 141

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N+VTRRGPF+GNS GI+AM YN  N TIG  RGKHDS NSI +GAL G LFKST GLR  
Sbjct: 142 NAVTRRGPFLGNSAGIVAMVYNIFNSTIGYYRGKHDSTNSIVAGALSGALFKSTRGLRPM 201

Query: 172 GTASVICAATAGTWTLAKKYFFK 194
             +S + A  AGTW + +K  F+
Sbjct: 202 AISSALVAGAAGTWAMVRKVVFE 224



>gi|451995812|gb|EMD88280.1| hypothetical protein COCHEDRAFT_1144438 [Bipolaris maydis C5]
 gi|477585060|gb|ENI02149.1| hypothetical protein COCC4DRAFT_201941 [Bipolaris maydis ATCC
           48331]
          Length = 225

 Score =  151 bits (381), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 115/193 (59%), Gaps = 13/193 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG--AVDYLRLDEQVVT--PG---AL 63
           +Q +P    T     S+F+    L P QL  +AGL    ++YL L++Q+ +  PG   AL
Sbjct: 31  FQPTPFDPSTAIQNPSEFI----LDPTQLHPLAGLNQQTLEYLSLEDQLPSDLPGSQSAL 86

Query: 64  PSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFI 121
           PSRG  DDLC                WGL EGL  + P+   +LRLN +LN++TRRGPF+
Sbjct: 87  PSRGWSDDLCYGTGVSYLTALTIGGAWGLAEGLQKNPPSMPPRLRLNGVLNAITRRGPFL 146

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++AM YN IN TIG  RGKH+  NSI +GAL G +FKST G R    +S ICA  
Sbjct: 147 GNSAGVIAMVYNGINSTIGYYRGKHEMSNSIVAGALSGAIFKSTRGTRQMAISSGICATV 206

Query: 182 AGTWTLAKKYFFK 194
           AG+W + +K FF+
Sbjct: 207 AGSWAITRKVFFE 219



>gi|451851412|gb|EMD64710.1| hypothetical protein COCSADRAFT_36090 [Bipolaris sorokiniana
           ND90Pr]
          Length = 225

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 115/193 (59%), Gaps = 13/193 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG--AVDYLRLDEQVVT--PG---AL 63
           +Q +P    T     S+F+    L P QL  +AGL    ++YL L++Q+ +  PG   AL
Sbjct: 31  FQPTPFDPSTAIQNPSEFI----LDPTQLHPLAGLNQQTLEYLSLEDQLPSDLPGSQSAL 86

Query: 64  PSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFI 121
           PSRG  DDLC                WGL EGL  + P+   +LRLN +LN++TRRGPF+
Sbjct: 87  PSRGWSDDLCYGTGVSYLTALTIGGAWGLAEGLQKNPPSMPPRLRLNGVLNAITRRGPFL 146

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++AM YN IN TIG  RGKH+  NSI +GAL G +FKST G R    +S ICA  
Sbjct: 147 GNSAGVIAMVYNGINSTIGYYRGKHEMSNSIVAGALSGAIFKSTRGTRQMAISSGICATV 206

Query: 182 AGTWTLAKKYFFK 194
           AG+W + +K FF+
Sbjct: 207 AGSWAITRKVFFE 219



>gi|326471812|gb|EGD95821.1| mitochondrial import inner membrane translocase subunit Tim23
           [Trichophyton tonsurans CBS 112818]
 gi|326483728|gb|EGE07738.1| mitochondrial import inner membrane translocase subunit tim23
           [Trichophyton equinum CBS 127.97]
          Length = 206

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 114/179 (63%), Gaps = 10/179 (5%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  DDL    
Sbjct: 27  VSSFLSSTAIPDPSELHPLAGLNKDTLDYLTLEDSALSDLPGSQSALPSRGWSDDLSYGT 86

Query: 77  XXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL+EGL     S + KLRLN++LNSVTRRGPF+GNS G++A+ YN 
Sbjct: 87  GTTYLIALTTGGAWGLIEGLKRSPASASPKLRLNSVLNSVTRRGPFLGNSAGVVALVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +N TIG++RGKHD+ NSI +GAL G+LFKST G+R    +  I A+ AG WTL+++ FF
Sbjct: 147 VNSTIGNVRGKHDAANSIVAGALSGMLFKSTRGVRPMMISGAIVASIAGAWTLSRRVFF 205



>gi|255933265|ref|XP_002558103.1| Pc12g12950 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582722|emb|CAP80922.1| Pc12g12950 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 204

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 15/206 (7%)

Query: 1   MSSFSSNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLD 54
           MS + S +   Q+ P+ F  DP    D   FL+ V +  P +L  +AGL   A+DYL LD
Sbjct: 1   MSIWDSLSGRKQTGPDAF--DPSTAQDATSFLSEVAIPDPSRLHPLAGLNQDALDYLSLD 58

Query: 55  EQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRL 107
           +  +   PG+   LPSRG  DDLC               VWGL+EGL    P    K+RL
Sbjct: 59  DTALDELPGSRSVLPSRGWSDDLCYGAGTTYLVALTTGGVWGLVEGLKKTPPTAAPKIRL 118

Query: 108 NTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAG 167
           N +LNSVTRRGPF+GNS G++AM YN  N ++G +RGKHD+ NSI +GAL G++FKST G
Sbjct: 119 NGVLNSVTRRGPFLGNSAGVVAMVYNGFNSSLGYVRGKHDASNSIVAGALSGMVFKSTRG 178

Query: 168 LRAAGTASVICAATAGTWTLAKKYFF 193
           ++    +  I A+ AG W + +K FF
Sbjct: 179 IKPMMISGGIVASIAGAWAVTRKAFF 204



>gi|303315331|ref|XP_003067673.1| Mitochondrial import inner membrane translocase subunit tim23,
           putative [Coccidioides posadasii C735 delta SOWgp]
 gi|240107343|gb|EER25528.1| Mitochondrial import inner membrane translocase subunit tim23,
           putative [Coccidioides posadasii C735 delta SOWgp]
          Length = 208

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 114/195 (58%), Gaps = 13/195 (6%)

Query: 12  QSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG-- 61
            +SP     DP +  D   FL+   +  P +L  +AGL    +DYL L++  +   PG  
Sbjct: 13  STSPAPAAFDPSSAHDVTSFLSSTAIPDPSELHPLAGLNRETLDYLTLEDSTLNELPGSQ 72

Query: 62  -ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRG 118
            ALPSRG  DDL                +WGL EGL    P+   KLRLN +LNSVTRRG
Sbjct: 73  SALPSRGWSDDLSYGTGTTYLTALSIGGLWGLTEGLRKAPPSAPPKLRLNAVLNSVTRRG 132

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LAM YN IN T+G  RGKHD+ NSI +GAL G+LFKST GLR    +  I 
Sbjct: 133 PFLGNSAGVLAMTYNGINSTLGYARGKHDAANSIVAGALSGMLFKSTRGLRPMMISGGIV 192

Query: 179 AATAGTWTLAKKYFF 193
           A+ A  WT+A++ FF
Sbjct: 193 ASVAAAWTVARRVFF 207



>gi|302502302|ref|XP_003013142.1| hypothetical protein ARB_00687 [Arthroderma benhamiae CBS 112371]
 gi|291176704|gb|EFE32502.1| hypothetical protein ARB_00687 [Arthroderma benhamiae CBS 112371]
          Length = 206

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 10/179 (5%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  DDL    
Sbjct: 27  VSSFLSSTAIPDPSELHPLAGLNKDTLDYLTLEDSALSDLPGSQSALPSRGWSDDLSYGT 86

Query: 77  XXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL+EGL     S + KLRLN++LNSVTRRGPF+GNS G++A+ YN 
Sbjct: 87  GTTYLIALTTGGAWGLIEGLKRSPVSASPKLRLNSVLNSVTRRGPFLGNSAGVVALVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +N TIG +RGKHD+ NSI +GAL G+LFKST G+R    +  I A+ AG WTL+++ FF
Sbjct: 147 VNSTIGHVRGKHDAANSIVAGALSGMLFKSTRGVRPMMISGAIVASIAGAWTLSRRVFF 205



>gi|119190879|ref|XP_001246046.1| hypothetical protein CIMG_05487 [Coccidioides immitis RS]
 gi|392868890|gb|EAS30241.2| mitochondrial import inner membrane translocase subunit
           [Coccidioides immitis RS]
          Length = 208

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 114/195 (58%), Gaps = 13/195 (6%)

Query: 12  QSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG-- 61
            +SP     DP +  D   FL+   +  P +L  +AGL    +DYL L++  +   PG  
Sbjct: 13  STSPAPAAFDPSSAHDVTSFLSSTAIPDPSELHPLAGLNRETLDYLTLEDSTLNELPGSQ 72

Query: 62  -ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRG 118
            ALPSRG  DDL                +WGL EGL    P+   KLRLN +LNSVTRRG
Sbjct: 73  SALPSRGWSDDLSYGTGTTYLTALSIGGLWGLTEGLRKAPPSAPPKLRLNAVLNSVTRRG 132

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LAM YN IN T+G  RGKHD+ NSI +GAL G+LFKST GLR    +  I 
Sbjct: 133 PFLGNSAGVLAMTYNGINSTLGYARGKHDAANSIIAGALSGMLFKSTRGLRPMMISGGIV 192

Query: 179 AATAGTWTLAKKYFF 193
           A+ A  WT+A++ FF
Sbjct: 193 ASVAAAWTVARRVFF 207



>gi|407917595|gb|EKG10899.1| Mitochondrial inner membrane translocase complex subunit Tim17/22
           [Macrophomina phaseolina MS6]
          Length = 223

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 116/202 (57%), Gaps = 18/202 (8%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSDFL-ARVNLGPGQLREIAGLG--AVDYLRLDEQVVT 59
           SF S  +D    P+Q       VS FL +       QL  +AGL    +DYL L+E  ++
Sbjct: 30  SFQSQAFD----PSQ----AQDVSSFLNSSTAFDASQLHPLAGLDKDTLDYLTLEEGALS 81

Query: 60  --PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILN 112
             PGA   LPSRG  DDLC                WGL EGL+  +P    +LRLN +LN
Sbjct: 82  DLPGARSALPSRGWSDDLCYGTGTTYLTALTLGGAWGLAEGLNKTNPQMPPRLRLNAVLN 141

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
           SVTRRGPF+GNS GI+AM YN  N TIG  RGKHD+ NSI +GAL G LFKST GL+   
Sbjct: 142 SVTRRGPFLGNSAGIVAMVYNIFNSTIGYYRGKHDATNSIVAGALSGALFKSTRGLKPMA 201

Query: 173 TASVICAATAGTWTLAKKYFFK 194
            +S + AA AG+W + +K  F+
Sbjct: 202 ISSGLVAAAAGSWAMIRKIVFE 223



>gi|320035494|gb|EFW17435.1| mitochondrial import inner membrane translocase subunit tim23
           [Coccidioides posadasii str. Silveira]
          Length = 208

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 113/195 (57%), Gaps = 13/195 (6%)

Query: 12  QSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG-- 61
            +SP     DP +  D   FL+   +  P +L  +AGL    +DYL L++  +   PG  
Sbjct: 13  STSPAPAAFDPSSAHDVTSFLSSTAIPDPSELHPLAGLNRETLDYLTLEDSTLNELPGSQ 72

Query: 62  -ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRG 118
            ALPSRG  DDL                +WGL EGL    P+   KLRLN +LNSVTRRG
Sbjct: 73  SALPSRGWSDDLSYGTGTTYLTALSIGGLWGLTEGLRKAPPSAPPKLRLNAVLNSVTRRG 132

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LAM YN IN T+G  RGKHD+ NSI +GAL G+LFKST GLR    +  I 
Sbjct: 133 PFLGNSAGVLAMTYNGINSTLGYARGKHDAANSIVAGALSGMLFKSTRGLRPMMISGGIV 192

Query: 179 AATAGTWTLAKKYFF 193
           A  A  WT+A++ FF
Sbjct: 193 AGVAAAWTVARRVFF 207



>gi|315051298|ref|XP_003175023.1| mitochondrial import inner membrane translocase subunit tim23
           [Arthroderma gypseum CBS 118893]
 gi|311340338|gb|EFQ99540.1| mitochondrial import inner membrane translocase subunit tim23
           [Arthroderma gypseum CBS 118893]
          Length = 206

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 117/187 (62%), Gaps = 15/187 (8%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP + +D   FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  
Sbjct: 20  DPTSATDVTSFLSNTAIPDPSELHPLAGLNQDTLDYLTLEDSALSDLPGSQSALPSRGWS 79

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP---NFKLRLNTILNSVTRRGPFIGNSCG 126
           DDL                 WGL+EGL   SP   + KLRLN++LNSVTRRGPF+GNS G
Sbjct: 80  DDLSYGTGTTYLVALTAGGAWGLIEGLK-RSPAAASPKLRLNSVLNSVTRRGPFLGNSAG 138

Query: 127 ILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           ++A+ YN +N TIG +RGKHD+ NSI +GAL G+LFKST G+R    +  I A+ AG WT
Sbjct: 139 VVALVYNGVNSTIGHVRGKHDAANSIVAGALSGMLFKSTRGVRPMMISGAIVASIAGAWT 198

Query: 187 LAKKYFF 193
           ++++ FF
Sbjct: 199 VSRRVFF 205



>gi|213409133|ref|XP_002175337.1| TIM23 translocase complex subunit Tim23 [Schizosaccharomyces
           japonicus yFS275]
 gi|212003384|gb|EEB09044.1| TIM23 translocase complex subunit Tim23 [Schizosaccharomyces
           japonicus yFS275]
          Length = 199

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 116/201 (57%), Gaps = 12/201 (5%)

Query: 1   MSSFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT 59
           MS   +   + +  P+  G      S+ L+     P  L  +A LG ++DYL ++E  ++
Sbjct: 1   MSWLFTRKSEEKQKPD--GEHEATASELLSGTEFDPAVLHPLANLGGSLDYLNIEEDTLS 58

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF---KLRLNTIL 111
             PG   A+PSRG  DDLC               +WGL EGL   + N    KLR+N IL
Sbjct: 59  NLPGDSHAIPSRGWQDDLCYGTGTMYLGGLAVGGLWGLKEGLK-KTENLQVKKLRVNGIL 117

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           NSVTRRGPF+GNS GILAM YN+IN  IG  RGKHD  NS+A+GA+ G +FKST G+RA 
Sbjct: 118 NSVTRRGPFVGNSAGILAMMYNSINSFIGYKRGKHDWTNSVAAGAITGAVFKSTRGVRAM 177

Query: 172 GTASVICAATAGTWTLAKKYF 192
           G +S + A  AG W L K+ F
Sbjct: 178 GISSAMIAGAAGAWCLLKRAF 198



>gi|512199882|gb|EPE28715.1| hypothetical protein GLAREA_09836 [Glarea lozoyensis ATCC 20868]
          Length = 221

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 114/200 (57%), Gaps = 17/200 (8%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT 59
           SF    +D Q + +        VS FL   +L  P QL  +AGL    +DYL L++  ++
Sbjct: 30  SFQPTPFDPQEAQD--------VSSFLTGPSLADPSQLHPLAGLNQQTLDYLSLEDSALS 81

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH-GHSPNFKLRLNTILNS 113
             PG   ALPSRG  DDLC                WGL EGL   H+   KLRLN++LN+
Sbjct: 82  DLPGSQSALPSRGWSDDLCYGTGVTYLTALTVGGAWGLQEGLRRSHAQPPKLRLNSVLNA 141

Query: 114 VTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGT 173
           VTRRGPF+GNS G++AM YN  N  IG  RGKHDS NSI +GAL G+LFKST G+R    
Sbjct: 142 VTRRGPFLGNSAGVIAMVYNGFNSFIGYTRGKHDSANSIVAGALSGMLFKSTRGIRPMMI 201

Query: 174 ASVICAATAGTWTLAKKYFF 193
           +  I A+ AG W + +K  F
Sbjct: 202 SGGIVASVAGAWAVTRKAIF 221



>gi|296811967|ref|XP_002846321.1| mitochondrial import inner membrane translocase subunit tim23
           [Arthroderma otae CBS 113480]
 gi|238841577|gb|EEQ31239.1| mitochondrial import inner membrane translocase subunit tim23
           [Arthroderma otae CBS 113480]
          Length = 206

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 116/187 (62%), Gaps = 15/187 (8%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP + +D   FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  
Sbjct: 20  DPTSATDVTSFLSNTAIPDPSELHPLAGLNQDTLDYLTLEDSALSELPGSQSALPSRGWS 79

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF---KLRLNTILNSVTRRGPFIGNSCG 126
           DDL                 WGL+EGL   SP     KLRLN++LNSVTRRGPF+GNS G
Sbjct: 80  DDLSYGTGTTYLIALSVGGAWGLIEGLK-RSPAAAAPKLRLNSVLNSVTRRGPFLGNSAG 138

Query: 127 ILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           ++A+ YN +N TIG +RGKHD+ NSI +GAL G+LFKST G+R    +  + A+ AG WT
Sbjct: 139 VVALVYNGVNSTIGHVRGKHDAANSIVAGALSGMLFKSTRGVRPMMISGAVVASIAGAWT 198

Query: 187 LAKKYFF 193
           ++++ FF
Sbjct: 199 VSRRVFF 205



>gi|378731402|gb|EHY57861.1| hypothetical protein HMPREF1120_05884 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 235

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 109/183 (59%), Gaps = 10/183 (5%)

Query: 22  PVAVSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLC 73
           P  VS FL   +L    +L  +AGL    +DYL LDE  ++  PG+   LPSRG  DDLC
Sbjct: 41  PTDVSSFLGSASLPDASKLHPLAGLNQQTLDYLTLDESQLSELPGSRSILPSRGWSDDLC 100

Query: 74  XXXXXXXXXXXXXXXVWGLMEGLH--GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMG 131
                          +WGL+EGL+    S   KLRLN++LNS+TRRGPF+GNS G++AM 
Sbjct: 101 YGTGVVYLTALTTGGLWGLIEGLNRTPASAPPKLRLNSVLNSITRRGPFLGNSAGVVAMM 160

Query: 132 YNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKY 191
           YN IN TIG  RGKHD+ NSI +G L G++FK T GL+    +  I  + AG W L +K 
Sbjct: 161 YNGINSTIGYYRGKHDAANSILAGTLSGMIFKCTRGLKPMAISGAIVGSIAGAWALTRKI 220

Query: 192 FFK 194
            F+
Sbjct: 221 LFE 223



>gi|425768027|gb|EKV06573.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Penicillium digitatum Pd1]
 gi|425769848|gb|EKV08330.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Penicillium digitatum PHI26]
          Length = 204

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 119/206 (57%), Gaps = 15/206 (7%)

Query: 1   MSSFSSNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLD 54
           MS + S +   Q+ P+ F  DP    D   FL+ V +  P +L  +AGL    +DYL LD
Sbjct: 1   MSIWDSLSGRKQTVPDAF--DPSTAQDATSFLSEVAIPDPSRLHPLAGLNQDTLDYLSLD 58

Query: 55  EQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRL 107
           +  +   PG+   LPSRG  DDLC                WGL+EGL         K+RL
Sbjct: 59  DSALDQLPGSRSVLPSRGWSDDLCYGAGTTYLVALTTGGAWGLVEGLKKTPATAAPKIRL 118

Query: 108 NTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAG 167
           N++LNSVTRRGPF+GNS G++AM YN  N  +G +RGKHD+ NSI +GAL G++FKST G
Sbjct: 119 NSVLNSVTRRGPFLGNSAGVVAMVYNGFNSGLGYVRGKHDASNSIVAGALSGMVFKSTRG 178

Query: 168 LRAAGTASVICAATAGTWTLAKKYFF 193
           L+    +  I A+ AG W + +K FF
Sbjct: 179 LKPMMISGGIVASIAGAWAVTRKAFF 204



>gi|406864521|gb|EKD17566.1| hypothetical protein MBM_04427 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 221

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 113/192 (58%), Gaps = 14/192 (7%)

Query: 14  SPNQFG-TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALP 64
           +P  F   D   V+ FL+  +L  P QL  +AGL    +DYL L++  ++  PG   ALP
Sbjct: 32  TPTPFNPQDAQDVTSFLSGTSLADPSQLHPLAGLNQQTLDYLSLEDSALSDLPGSQSALP 91

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGL---HGHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL   +G  P  KLRLN++LN+VTRRGPF+
Sbjct: 92  SRGWSDDLCYGTGVTYLSALTVGGAWGLQEGLRRSNGQPP--KLRLNSVLNAVTRRGPFL 149

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS  ++AM YN  N  IG +RGKHDS NSI +GAL G++FKST G+R    +  I A+ 
Sbjct: 150 GNSAAVIAMVYNGFNSYIGYVRGKHDSANSIFAGALSGMIFKSTKGVRPMMISGGIVASV 209

Query: 182 AGTWTLAKKYFF 193
           AG W + +K  F
Sbjct: 210 AGAWAVTRKALF 221



>gi|154294142|ref|XP_001547514.1| hypothetical protein BC1G_14141 [Botryotinia fuckeliana B05.10]
 gi|347840126|emb|CCD54698.1| similar to mitochondrial import inner membrane translocase subunit
           tim23 [Botryotinia fuckeliana T4]
 gi|472245810|gb|EMR90370.1| putative mitochondrial import inner membrane translocase subunit
           tim23 protein [Botryotinia fuckeliana BcDW1]
          Length = 221

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 110/186 (59%), Gaps = 12/186 (6%)

Query: 17  QFGTDPVAVSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGG 68
           Q G D   VS FL    L  P QL  +AGL    +DYL L+E  ++  PG   ALPSRG 
Sbjct: 39  QEGQD---VSSFLTGPELVDPSQLHPMAGLNQQTLDYLSLEESTLSDLPGSQSALPSRGW 95

Query: 69  FDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF-KLRLNTILNSVTRRGPFIGNSCGI 127
            DDLC                WGL EGL   +    KLRLN++LN+VTRRGPF+GNS G+
Sbjct: 96  SDDLCYGTGVTYLTALTVGGAWGLQEGLRRSATQPPKLRLNSVLNAVTRRGPFLGNSAGV 155

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +AM YN  N  IG +RG+HDS NS+ +GAL G++FKST G+R    +  I A+ AG W +
Sbjct: 156 IAMVYNGFNSFIGHMRGRHDSANSVLAGALSGMIFKSTRGVRPMMISGGIVASVAGAWAV 215

Query: 188 AKKYFF 193
           A+K  F
Sbjct: 216 ARKAVF 221



>gi|212527410|ref|XP_002143862.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces marneffei ATCC 18224]
 gi|210073260|gb|EEA27347.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces marneffei ATCC 18224]
          Length = 206

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 106/180 (58%), Gaps = 10/180 (5%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQV--VTPG---ALPSRGGFDDLCXXX 76
           VS FL +     P QL  +AGL    +DYL L++    V PG   ALPSRG  DDLC   
Sbjct: 27  VSSFLGQAAFPDPSQLHPLAGLNQDTLDYLSLEDSALDVLPGSRSALPSRGWSDDLCYGA 86

Query: 77  XXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL+EGL     N   KLRLN +LNS+TRRGPF+GNS G++AM YN 
Sbjct: 87  GSTYLAGLTIGGAWGLVEGLQRTPANAPPKLRLNGVLNSITRRGPFLGNSAGVVAMVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           IN  IG  RGKHD+ NSI +GAL G++FKST G R    +  I A+ AG WT+ +K  F+
Sbjct: 147 INSMIGYTRGKHDAANSIVAGALSGMIFKSTRGTRPMLISGGIVASIAGAWTVIRKAVFE 206



>gi|242783676|ref|XP_002480234.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces stipitatus ATCC 10500]
 gi|242783681|ref|XP_002480235.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces stipitatus ATCC 10500]
 gi|218720381|gb|EED19800.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces stipitatus ATCC 10500]
 gi|218720382|gb|EED19801.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Talaromyces stipitatus ATCC 10500]
          Length = 206

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 114/196 (58%), Gaps = 13/196 (6%)

Query: 12  QSSPNQFGTDPVA---VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG-- 61
           +++ NQ   DP +   VS FL + +   P QL  +AGL    +DYL L++  +   PG  
Sbjct: 11  KATTNQDTFDPSSAQDVSSFLGQASFPDPSQLHPLAGLNQDTLDYLTLEDSTLDELPGSR 70

Query: 62  -ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH--GHSPNFKLRLNTILNSVTRRG 118
            ALPSRG  DDLC                WGL EGL     S   KLRLN +LNS+TRRG
Sbjct: 71  SALPSRGWSDDLCYGTGSTYLAGLLIGGTWGLAEGLQRTPASAPPKLRLNGVLNSITRRG 130

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G++AM YN IN  IG  RGKHD+ NSI +GAL G++FKST G R    +  I 
Sbjct: 131 PFLGNSAGVVAMVYNGINSMIGYTRGKHDAANSIVAGALSGMIFKSTRGTRPMLISGGIV 190

Query: 179 AATAGTWTLAKKYFFK 194
           A+ AG WT+ +K  F+
Sbjct: 191 ASIAGAWTVTRKALFE 206



>gi|327304130|ref|XP_003236757.1| mitochondrial import inner membrane translocase subunit Tim23
           [Trichophyton rubrum CBS 118892]
 gi|326462099|gb|EGD87552.1| mitochondrial import inner membrane translocase subunit Tim23
           [Trichophyton rubrum CBS 118892]
          Length = 232

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  DDL    
Sbjct: 27  VSSFLSSTAIPDPSELHPLAGLNKDTLDYLTLEDSALSDLPGSQSALPSRGWSDDLSYGT 86

Query: 77  XXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL+EGL     S + KLRLN++LNSVTRRGPF+GNS G++A+ YN 
Sbjct: 87  GTTYLIALTTGGAWGLIEGLKRSPASASPKLRLNSVLNSVTRRGPFLGNSAGVVALVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           +N TIG +RGKHD+ NSIA+GAL G+LFKST G+R    +  I A+ AG WT+  +
Sbjct: 147 VNSTIGHMRGKHDAANSIAAGALSGMLFKSTRGVRPMMISGAIVASIAGAWTVCSR 202



>gi|156033253|ref|XP_001585463.1| hypothetical protein SS1G_13702 [Sclerotinia sclerotiorum 1980]
 gi|154699105|gb|EDN98843.1| hypothetical protein SS1G_13702 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 221

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 109/185 (58%), Gaps = 12/185 (6%)

Query: 17  QFGTDPVAVSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGG 68
           Q G D   V+ FL    L  P QL  +AGL    +DYL L+E  ++  PG   ALPSRG 
Sbjct: 39  QEGQD---VNSFLTGPELIDPSQLHPLAGLNQQTLDYLSLEESTLSDLPGSQSALPSRGW 95

Query: 69  FDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF-KLRLNTILNSVTRRGPFIGNSCGI 127
            DDLC                WGL EGL   +    KLRLN++LN+VTRRGPF+GNS G+
Sbjct: 96  SDDLCYGTGVTYLTALTVGGAWGLQEGLRRSATQPPKLRLNSVLNAVTRRGPFLGNSAGV 155

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +AM YN  N  IG +RG+HDS NS+ +GAL G++FKST G+R    +  I A+ AG W  
Sbjct: 156 IAMVYNGFNSFIGHMRGRHDSANSVLAGALSGMIFKSTRGVRPMMISGGIVASVAGAWAQ 215

Query: 188 AKKYF 192
            K+YF
Sbjct: 216 EKQYF 220



>gi|85084169|ref|XP_957257.1| mitochondrial import inner membrane translocase subunit tim23
           [Neurospora crassa OR74A]
 gi|13447149|gb|AAK26640.1|AF343071_1 TIM23 [Neurospora crassa]
 gi|13447157|gb|AAK26644.1|AF343075_1 TIM23 [Neurospora crassa]
 gi|28918346|gb|EAA28021.1| mitochondrial import inner membrane translocase subunit tim23
           [Neurospora crassa OR74A]
          Length = 238

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 112/192 (58%), Gaps = 13/192 (6%)

Query: 13  SSPNQF-GTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVTPGA----LP 64
           S P+ F  + P  V  FL   +   P QL  +AGL    ++Y+ L++  +   A    LP
Sbjct: 40  SYPSPFDASQPQGVEAFLGSSSFADPTQLHPLAGLNKETLEYISLEDTPLPDAAGASVLP 99

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL    G  P  KLRLN++LN+VTRRGP++
Sbjct: 100 SRGFTDDLCYGTGITYLTALTIGGAWGLKEGLQRSAGQPP--KLRLNSVLNAVTRRGPYL 157

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++A+ YN IN  IG +RGKHD+ NSI +GAL G+LFKST GL+    +  I A  
Sbjct: 158 GNSAGVVAICYNLINAGIGYVRGKHDAANSILAGALSGMLFKSTRGLKPMMISGGIVATI 217

Query: 182 AGTWTLAKKYFF 193
           AGTW +A++ FF
Sbjct: 218 AGTWAVARRTFF 229



>gi|342873550|gb|EGU75714.1| hypothetical protein FOXB_13733 [Fusarium oxysporum Fo5176]
 gi|475673009|gb|EMT70132.1| Mitochondrial import inner membrane translocase subunit tim23
           [Fusarium oxysporum f. sp. cubense race 4]
 gi|477518433|gb|ENH70658.1| Mitochondrial import inner membrane translocase subunit tim23
           [Fusarium oxysporum f. sp. cubense race 1]
          Length = 239

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 110/194 (56%), Gaps = 16/194 (8%)

Query: 14  SPNQFGTDPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---A 62
            P  +  DP     V  FL       P QL  +AGL    ++Y+ L++  ++  PG    
Sbjct: 33  EPAHYAYDPTEGQGVESFLQSSAFADPSQLHPLAGLNRDTLEYISLEDSALSELPGGQSV 92

Query: 63  LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGP 119
           LPSRG  DDLC                WGL EGL    G  P  KLRLN +LNSVTRRGP
Sbjct: 93  LPSRGFTDDLCYGTGITYLAGLGIGGAWGLQEGLRRSAGQPP--KLRLNAVLNSVTRRGP 150

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GNS G++A+ YN IN  IGS+RGKHD+ N++ +GAL G+LFKST GLR    +  I A
Sbjct: 151 FLGNSLGVVAIIYNCINSLIGSVRGKHDAGNTVLAGALSGMLFKSTRGLRPMAISGGIVA 210

Query: 180 ATAGTWTLAKKYFF 193
           + AG W + ++ FF
Sbjct: 211 SVAGAWAIVRRSFF 224



>gi|302653229|ref|XP_003018444.1| hypothetical protein TRV_07544 [Trichophyton verrucosum HKI 0517]
 gi|291182090|gb|EFE37799.1| hypothetical protein TRV_07544 [Trichophyton verrucosum HKI 0517]
          Length = 232

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 109/176 (61%), Gaps = 10/176 (5%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL+   +  P +L  +AGL    +DYL L++  ++  PG   ALPSRG  DDL    
Sbjct: 27  VSSFLSSTAIPDPSELHPLAGLNKDTLDYLTLEDSALSDLPGSQSALPSRGWSDDLSYGT 86

Query: 77  XXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL+EGL     S + KLRLN++LNSVTRRGPF+GNS G++A+ YN 
Sbjct: 87  GTTYLIALTTGGAWGLIEGLKRSPASASPKLRLNSVLNSVTRRGPFLGNSAGVVALVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           +N TIG +RGKHD+ NSI +GAL G+LFKST G+R    +  I A+ AG WT+  +
Sbjct: 147 VNSTIGHVRGKHDAANSIVAGALSGMLFKSTRGVRPMMISGAIVASIAGAWTVCSR 202



>gi|261195696|ref|XP_002624252.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces dermatitidis SLH14081]
 gi|239588124|gb|EEQ70767.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces dermatitidis SLH14081]
 gi|239610387|gb|EEQ87374.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces dermatitidis ER-3]
 gi|327349185|gb|EGE78042.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces dermatitidis ATCC 18188]
          Length = 214

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 114/201 (56%), Gaps = 13/201 (6%)

Query: 6   SNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT 59
           S+T    S P+    DP +  D   FL+   +  P  L  +AGL    +DYL L++  + 
Sbjct: 13  SSTSSAPSGPSHSTFDPASAEDASSFLSGSAMPDPSLLHPLAGLNQETLDYLSLEDSALD 72

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILN 112
             PG   ALPSRG  DDL                 WGL+EGL     +   KLRLN +LN
Sbjct: 73  DLPGSRSALPSRGWSDDLSYGTGTTYLTALSIGGTWGLIEGLRKTPVTAPPKLRLNGVLN 132

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
           S+TRRGPF+GNS G+LAM YN IN T+G  RGKHD+ NSI +GAL G+LFKST GLR   
Sbjct: 133 SITRRGPFLGNSAGVLAMVYNGINSTLGHFRGKHDAANSILAGALSGMLFKSTRGLRPMM 192

Query: 173 TASVICAATAGTWTLAKKYFF 193
            +  I A+ AG W + ++ FF
Sbjct: 193 ISGGIVASVAGVWAVTRRAFF 213



>gi|116207336|ref|XP_001229477.1| hypothetical protein CHGG_02961 [Chaetomium globosum CBS 148.51]
 gi|88183558|gb|EAQ91026.1| hypothetical protein CHGG_02961 [Chaetomium globosum CBS 148.51]
          Length = 242

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 104/168 (61%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    +DYL L++  ++  PG   ALPSRG  DDLC               
Sbjct: 63  PSQLHPLAGLNKDTLDYLSLEDSALSDLPGSQSALPSRGFTDDLCYGTGTTYLAGLSLGG 122

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL    G SP  KLRLN++LNS+TRRGPF+GNS G++A+ YN IN  IG +RGK
Sbjct: 123 AWGLQEGLRKSAGESP--KLRLNSVLNSITRRGPFLGNSAGVVAVCYNCINSYIGYLRGK 180

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +D+ N+I +GAL G+LFKST GLR    +  I A+ AG W + ++  F
Sbjct: 181 NDAANTIVAGALSGMLFKSTRGLRPMAISGGIVASVAGAWAIVRRTIF 228



>gi|452843650|gb|EME45585.1| hypothetical protein DOTSEDRAFT_171083 [Dothistroma septosporum
           NZE10]
          Length = 225

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 103/167 (61%), Gaps = 9/167 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P  L  +AGL    +DYL LD+ V++  PG+   LPSRG  DDLC               
Sbjct: 57  PAALHPLAGLNKDTLDYLTLDDDVLSDLPGSRSLLPSRGWSDDLCYGTGVTYLTALSIGG 116

Query: 89  VWGLMEGLHG--HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
            WGL+EGL     +   KLRLN+ LNS+TRRGPF+GNS G++AM YN +N TIG  RGKH
Sbjct: 117 AWGLVEGLSKVPSTAPPKLRLNSALNSITRRGPFLGNSAGVVAMMYNGVNSTIGYYRGKH 176

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           D+ NSIA+G + G +FKS+ G+R A  +S I A+ AG W L +K  F
Sbjct: 177 DAFNSIAAGGISGFIFKSSRGVRPAMISSGIVASVAGAWALTRKVVF 223



>gi|477529386|gb|ENH81150.1| mitochondrial import inner membrane translocase subunit
           [Colletotrichum orbiculare MAFF 240422]
          Length = 236

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 109/192 (56%), Gaps = 14/192 (7%)

Query: 12  QSSPNQFGTDPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQ-VVTPGALP 64
           Q++P  F  DP A   V  FL       P  L  +AGL    ++YL L+E  VV    LP
Sbjct: 36  QTTPTSF--DPSAGSGVESFLQSSAFADPSHLHPLAGLNKDTLEYLSLEEAAVVDASVLP 93

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL       P  KLRLN++LN+VTRRGPF+
Sbjct: 94  SRGFTDDLCYGTGMTYLAALSIGGAWGLQEGLRRSVNQPP--KLRLNSVLNAVTRRGPFL 151

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++A+ YN  N +IG  RGKHD+ N+I +GAL G++FKST G+R    +  I A+ 
Sbjct: 152 GNSAGVVAITYNLFNASIGYFRGKHDAANTIVAGALSGMVFKSTRGVRPMLISGGIVASV 211

Query: 182 AGTWTLAKKYFF 193
           AG W + ++ FF
Sbjct: 212 AGAWAVVRRTFF 223



>gi|440639020|gb|ELR08939.1| hypothetical protein GMDG_03606 [Geomyces destructans 20631-21]
          Length = 222

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 108/180 (60%), Gaps = 13/180 (7%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL       P QL  +AGL    +DY+ L++  ++  PG   ALPSRG  DDLC   
Sbjct: 45  VSSFLGGAAFPDPSQLHPLAGLNQQTLDYISLEDSQLSDLPGSQSALPSRGWSDDLCYGT 104

Query: 77  XXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYN 133
                        WG+ EGL    G  P  KLRLN++LN+VTRRGPF+GNS G++A+ YN
Sbjct: 105 GVTYLSALTLGGAWGMQEGLRRSSGQPP--KLRLNSVLNAVTRRGPFLGNSAGVIALVYN 162

Query: 134 TINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
            IN  IG  RGKHD+ NSIA+GAL G++FKST GLR    +  + A+ AG W +A+K  F
Sbjct: 163 GINSFIGHQRGKHDAANSIAAGALSGMIFKSTRGLRPMLISGGVVASVAGGWAVARKALF 222



>gi|453082298|gb|EMF10345.1| mitochondrial import inner membrane translocase subunit TIM23
           [Mycosphaerella populorum SO2202]
          Length = 226

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 112/188 (59%), Gaps = 13/188 (6%)

Query: 20  TDPVA--VSDFLARVNLG--PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGG 68
           T P A  V  F+   + G  P  L  +AGL    +DYL LDE +++  PG+   LPSRG 
Sbjct: 38  TTPTAEDVGSFITSPSAGFDPAALHPLAGLNQDTLDYLTLDEDILSDLPGSQSLLPSRGW 97

Query: 69  FDDLCXXXXXXXXXXXXXXXVWGLMEGLHG--HSPNFKLRLNTILNSVTRRGPFIGNSCG 126
            DDLC                WGL EGL     +   KLRLN+ LNS+TRRGPF+GNS G
Sbjct: 98  SDDLCYGTGVTYLSGLVIGGAWGLREGLSKLPSTAPPKLRLNSALNSITRRGPFLGNSAG 157

Query: 127 ILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           ++AM YN IN TIG  RGKHD++NSIA+G++ G +FK+T G+R    +S I  + AG+W 
Sbjct: 158 VVAMMYNGINSTIGYYRGKHDALNSIAAGSISGAVFKATRGVRPMMISSAIVGSMAGSWA 217

Query: 187 LAKKYFFK 194
           LA+K   +
Sbjct: 218 LARKALLE 225



>gi|367027460|ref|XP_003663014.1| hypothetical protein MYCTH_2079864 [Myceliophthora thermophila ATCC
           42464]
 gi|347010283|gb|AEO57769.1| hypothetical protein MYCTH_2079864 [Myceliophthora thermophila ATCC
           42464]
          Length = 242

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 114/200 (57%), Gaps = 13/200 (6%)

Query: 6   SNTYDYQSSPNQFGTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--P 60
           ++T  YQ +     T    V  FL   +   P  L  +AGL    ++YL L++  ++  P
Sbjct: 32  TSTSTYQPTATFDPTSAQGVESFLGTSSFADPSSLHPLAGLNKDTLEYLTLEDSALSDLP 91

Query: 61  G---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSV 114
           G   ALPSRG  DDLC                WGL EGL    G  P  +LRLN++LNSV
Sbjct: 92  GSQSALPSRGFTDDLCYGTGTTYLAGLTIGGAWGLQEGLRKSVGEPP--RLRLNSVLNSV 149

Query: 115 TRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTA 174
           TRRGPF+GNS G++A+ YN IN  IG +RGK+D+ N+I +GAL G+LFKST GLR    +
Sbjct: 150 TRRGPFLGNSAGVVAICYNCINSYIGYLRGKNDAANTIVAGALSGMLFKSTRGLRQMAIS 209

Query: 175 SVICAATAGTWTLAKKYFFK 194
             I A  AG W +A++  F+
Sbjct: 210 GGIVATVAGCWAIARRTLFQ 229



>gi|19075496|ref|NP_587996.1| TIM23 translocase complex subunit Tim23 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|18203510|sp|Q9USM7.1|TIM23_SCHPO RecName: Full=Mitochondrial import inner membrane translocase
           subunit tim23
 gi|5748689|emb|CAB53081.1| TIM23 translocase complex subunit Tim23 (predicted)
           [Schizosaccharomyces pombe]
          Length = 210

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 111/195 (56%), Gaps = 9/195 (4%)

Query: 8   TYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLGA-VDYLRLDEQVVT--PG--- 61
           T    SS  Q  T+  A SD L+     P +L  +A L   +DYL ++E  ++  PG   
Sbjct: 14  TSKIDSSELQVPTEATA-SDILSGSEFDPAKLHPLADLDKPLDYLLIEEDALSTLPGDSM 72

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP--NFKLRLNTILNSVTRRGP 119
           A+PSRG  DDLC               +WGL EG+       + +LRLN ILN VTRRGP
Sbjct: 73  AIPSRGWQDDLCYGTGTSYLSGLAIGGLWGLNEGMKKTKDITSTRLRLNGILNGVTRRGP 132

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GNS G+LA+ YN IN  IG  R KH   NS+A+GAL G L+KST GLRA   +S + A
Sbjct: 133 FVGNSLGVLALVYNGINSLIGYKRQKHGWENSVAAGALTGALYKSTRGLRAMAISSSLVA 192

Query: 180 ATAGTWTLAKKYFFK 194
             AG WTLAK+ F K
Sbjct: 193 TAAGIWTLAKRSFTK 207



>gi|336469913|gb|EGO58075.1| mitochondrial import inner membrane translocase subunit tim23
           [Neurospora tetrasperma FGSC 2508]
          Length = 236

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 110/192 (57%), Gaps = 13/192 (6%)

Query: 13  SSPNQF-GTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVTPGA----LP 64
           S P+ F  + P  V  FL   +   P QL  +AGL    ++Y+ L++  +   A    LP
Sbjct: 38  SYPSPFDASQPQGVEAFLGSSSFADPTQLHPLAGLNKETLEYISLEDTPLPDAASASVLP 97

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL    G  P  KLRLN++LN+VTRRGP++
Sbjct: 98  SRGFTDDLCYGTGITYLTALTIGGAWGLKEGLQRSAGQPP--KLRLNSVLNAVTRRGPYL 155

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++A+ YN IN  IG +RGKHD+ NSI +GAL G+LFKST GL+    +  I A  
Sbjct: 156 GNSAGVVAICYNLINAGIGYVRGKHDAANSILAGALSGMLFKSTRGLKPMMISGGIVATI 215

Query: 182 AGTWTLAKKYFF 193
           AG W + ++ FF
Sbjct: 216 AGAWAVTRRTFF 227



>gi|336258890|ref|XP_003344251.1| hypothetical protein SMAC_06454 [Sordaria macrospora k-hell]
 gi|380091876|emb|CCC10605.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 238

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 111/192 (57%), Gaps = 13/192 (6%)

Query: 13  SSPNQF-GTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVTPGA----LP 64
           S P+ F  + P  V  FL   +   P QL  +AGL    ++Y+ L++  +   A    LP
Sbjct: 40  SYPSPFDASQPQGVEAFLGSSSFADPTQLHPLAGLNKETLEYISLEDTPLPDAAAGSALP 99

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL    G  P  KLRLN++LN+VTRRGPF+
Sbjct: 100 SRGFTDDLCYGTGITYLTALTLGGAWGLNEGLKRSAGQPP--KLRLNSVLNAVTRRGPFL 157

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++A+ YN +N +IG +RGKHD+ N+I +GAL G+LFKST GL+    +  + A  
Sbjct: 158 GNSAGVVAICYNLVNASIGYVRGKHDAANTILAGALSGMLFKSTKGLKPMMISGGVVATI 217

Query: 182 AGTWTLAKKYFF 193
           AG W + ++ FF
Sbjct: 218 AGAWAITRRTFF 229



>gi|452984767|gb|EME84524.1| hypothetical protein MYCFIDRAFT_152743 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 227

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (59%), Gaps = 11/179 (6%)

Query: 25  VSDFLARVNLGPGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXX 77
           V  F+      P  L  +AGL    +DYL LD+ V++  PG+   LPSRG  DDLC    
Sbjct: 46  VGSFITPGAFDPSSLHPLAGLNKDTLDYLTLDDDVLSDLPGSKSLLPSRGWSDDLCYGTG 105

Query: 78  XXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                       WGL EGL      +P  KL+LN+ LN++TRRGPF+GNS G++AM YN 
Sbjct: 106 VTYLTALTIGGAWGLAEGLSRVPAAAPP-KLKLNSALNAITRRGPFLGNSAGVVAMMYNG 164

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           IN TIG  RGKHD++NS+A+G + G++FKS+ G+R    +  I A+ AGTW + +K F 
Sbjct: 165 INSTIGYYRGKHDALNSVAAGGISGMIFKSSRGVRPMAISGGIVASLAGTWAIVRKAFL 223



>gi|346971269|gb|EGY14721.1| mitochondrial import inner membrane translocase subunit TIM23
           [Verticillium dahliae VdLs.17]
          Length = 240

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 101/168 (60%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  ++GL    ++YL L++  ++  PG    LPSRG  DDLC               
Sbjct: 60  PSQLHPLSGLNKDTLEYLSLEDAALSDVPGGQSVLPSRGFTDDLCYGAGVTYLTALGLGG 119

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL       P  KLRLN++LN+VTRRGPF+GNS G++A+ YN  NG IG  RGK
Sbjct: 120 AWGLQEGLRRSVNQPP--KLRLNSVLNAVTRRGPFLGNSAGVVAITYNCFNGAIGYFRGK 177

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N+IA+GAL G+LFKST GLR    +  I A  AG W + ++ FF
Sbjct: 178 HDAANTIAAGALSGMLFKSTRGLRPMLISGGIVAGVAGAWAVTRRTFF 225



>gi|345571466|gb|EGX54280.1| hypothetical protein AOL_s00004g313 [Arthrobotrys oligospora ATCC
           24927]
          Length = 218

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 105/177 (59%), Gaps = 8/177 (4%)

Query: 25  VSDFLARVNLGPGQLREIAGLGA-VDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXX 78
           VS FL      P  L  +AGL   ++YL+L+++ ++  PG    LPSRG  DDLC     
Sbjct: 42  VSSFLNTSAFDPSTLHPLAGLDEGLEYLKLEDEALSDLPGTNSFLPSRGWSDDLCYGTGT 101

Query: 79  XXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTIN 136
                      WG +EG+    P    KL+LN+ILN +TRRGPF+GNS G++AM YN IN
Sbjct: 102 TYLAALSIGGAWGFVEGVSRSPPMAPPKLKLNSILNGMTRRGPFMGNSAGVIAMVYNGIN 161

Query: 137 GTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
            TIG  RG+HD+ NS+ +GAL G +FKST G+R    AS I  + AG W +++K F 
Sbjct: 162 STIGYARGRHDTANSVVAGALSGAIFKSTRGVRPMLIASGITGSAAGIWAVSRKAFL 218



>gi|296420978|ref|XP_002840044.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636254|emb|CAZ84235.1| unnamed protein product [Tuber melanosporum]
          Length = 231

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 112/201 (55%), Gaps = 17/201 (8%)

Query: 2   SSFSS-NTYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT 59
           SSF+  NT+D         T   +VS FLA     P  L  +AGL   + YL L+E  ++
Sbjct: 39  SSFTQQNTFDP--------TGITSVSSFLAPAVADPAVLHPLAGLDKGLSYLDLEETALS 90

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILN 112
             PG   ALPSRG  DDLC                WG  EGL    PN   +LRLN +LN
Sbjct: 91  TLPGSQTALPSRGFGDDLCYGTGTTYLLALSLGGAWGFAEGLSRSPPNAPPRLRLNAVLN 150

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
           ++TRRGPF+GNS G+LA+ YN +N T+GS+RGKHD+ NSI SG + G +FKST G+R   
Sbjct: 151 AMTRRGPFLGNSAGVLALVYNGVNYTVGSLRGKHDAANSIISGVVAGAIFKSTRGVRPML 210

Query: 173 TASVICAATAGTWTLAKKYFF 193
            +S I  A AG W +  K   
Sbjct: 211 ISSGIVGAAAGVWAIGLKALL 231



>gi|115384460|ref|XP_001208777.1| hypothetical protein ATEG_01412 [Aspergillus terreus NIH2624]
 gi|114196469|gb|EAU38169.1| hypothetical protein ATEG_01412 [Aspergillus terreus NIH2624]
          Length = 205

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 118/207 (57%), Gaps = 16/207 (7%)

Query: 1   MSSFSSNTYDYQSS-PNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRL 53
           MS + S +   QS  P+ F  DP    D   FL+ V +  P QL  +AGL    +DY+ L
Sbjct: 1   MSIWDSFSGRKQSKGPDAF--DPSTAQDATSFLSEVAIPDPTQLHPLAGLNQDTLDYITL 58

Query: 54  DEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLR 106
           ++  +   PG+   LPSRG  DDLC               VWGL EGL     +   K+R
Sbjct: 59  EDSALDELPGSRSVLPSRGWSDDLCYGTGTTYLAALTLGGVWGLSEGLRKTPVTAPPKIR 118

Query: 107 LNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTA 166
           LN +LNS+TRRGPF+GNS G++AM YN  N  +G  RGKHDS NSIA+GAL G++FKST 
Sbjct: 119 LNGVLNSITRRGPFLGNSAGVVAMVYNCFNSGLGYARGKHDSANSIAAGALSGMIFKSTR 178

Query: 167 GLRAAGTASVICAATAGTWTLAKKYFF 193
           GL+    +  I A+ AG W + +K F 
Sbjct: 179 GLKPMMISGGIVASIAGGWAVVRKAFL 205



>gi|171685892|ref|XP_001907887.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942907|emb|CAP68560.1| unnamed protein product [Podospora anserina S mat+]
          Length = 240

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 11  YQSSPNQFG-TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG--- 61
           Y SSP  F  T    V  FL   +   P QL   AG+    +DYL L++  +T  PG   
Sbjct: 35  YASSPAPFDPTQAQGVEQFLGTSSFADPTQLHAFAGIDKDTLDYLSLEDSALTDLPGGQS 94

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF-KLRLNTILNSVTRRGPF 120
            LPSRG  DDLC                WGL EGL   +    KLRLNT+LNS+TRRGPF
Sbjct: 95  VLPSRGFTDDLCYGTGVTYLAGLTLGGAWGLQEGLRRSADQPPKLRLNTVLNSITRRGPF 154

Query: 121 IGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAA 180
           +GNS G++A+ YN +N  IG +RGKHD+ N I +G + G +FKST GLR    +  + A+
Sbjct: 155 LGNSAGVVAIVYNCVNSYIGYVRGKHDAANMILAGGISGAIFKSTRGLRPMMISGGLVAS 214

Query: 181 TAGTWTLAKKYFF 193
            AG W + ++ FF
Sbjct: 215 VAGLWAITRRTFF 227



>gi|367050354|ref|XP_003655556.1| hypothetical protein THITE_2080212 [Thielavia terrestris NRRL 8126]
 gi|347002820|gb|AEO69220.1| hypothetical protein THITE_2080212 [Thielavia terrestris NRRL 8126]
          Length = 237

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 103/168 (61%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++YL L++  ++  PG+   LPSRG  DDLC               
Sbjct: 59  PSQLHPLAGLNKDTLEYLTLEDSALSELPGSQSVLPSRGFTDDLCYGTGTTYLAGLTIGG 118

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL    G  P  KLRLN +LNSVTRRGPF+GNS G++A+ YN IN  IG +RGK
Sbjct: 119 AWGLQEGLRKSVGAPP--KLRLNAVLNSVTRRGPFLGNSAGVVAICYNCINSYIGYLRGK 176

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +D+ N+I +GAL G+LFKST GLR    +  I A+ AG W + ++ FF
Sbjct: 177 NDAANTIVAGALSGMLFKSTRGLRQMMISGGIVASVAGVWAIVRRAFF 224



>gi|402086906|gb|EJT81804.1| mitochondrial import inner membrane translocase subunit tim23
           [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 233

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 108/184 (58%), Gaps = 13/184 (7%)

Query: 20  TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDD 71
           + P  V  F+   +   P QL  +AGL   A+DY+ L++ V++  PG+   +PSRG  DD
Sbjct: 41  SQPQGVDAFIGSSSFADPSQLHPLAGLNKDALDYITLEDSVLSDLPGSQSVIPSRGWSDD 100

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGIL 128
           LC                WG+ EGL    G  P  KLRLN++LN+VTRRGPF+GNS G++
Sbjct: 101 LCYGTGITYLSSLGVGGAWGMQEGLRRSAGQPP--KLRLNSVLNAVTRRGPFLGNSGGVV 158

Query: 129 AMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLA 188
           A+ YN  N   G +RGKHD+ NSIA+G L G+LFKST GLR    +  I  + A  W +A
Sbjct: 159 AIVYNLFNSYFGYLRGKHDAANSIAAGTLSGMLFKSTRGLRPMMISGGIVGSVAAVWAVA 218

Query: 189 KKYF 192
           +K F
Sbjct: 219 RKTF 222



>gi|225563460|gb|EEH11739.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces capsulatus G186AR]
          Length = 213

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (58%), Gaps = 13/186 (6%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP +  D   FL+   +  P  L  +AGL    +DYL L++  +   PG   ALPSRG  
Sbjct: 27  DPTSAQDASSFLSGTAMPDPSLLHPLAGLNKDTLDYLSLEDSALDDLPGSRSALPSRGWS 86

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGI 127
           DDL                 WGL+EGL     +   KLRLN +LNS+TRRGPF+GNS G+
Sbjct: 87  DDLSYGAGITYLTALSIGGTWGLIEGLRKTPVTAPPKLRLNGVLNSITRRGPFLGNSAGV 146

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +A+ YN IN T+G IRGKHD+ NSI +GAL G+LFKST GLR    +  I A+ AG W +
Sbjct: 147 IAVVYNGINSTMGHIRGKHDAANSILAGALSGMLFKSTRGLRPMMISGGIVASVAGAWAV 206

Query: 188 AKKYFF 193
            ++ FF
Sbjct: 207 TRRAFF 212



>gi|325093423|gb|EGC46733.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces capsulatus H88]
          Length = 213

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (58%), Gaps = 13/186 (6%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP +  D   FL+   +  P  L  +AGL    +DYL L++  +   PG   ALPSRG  
Sbjct: 27  DPTSAQDASSFLSGAAMPDPSLLHPLAGLNKDTLDYLSLEDSALDDLPGSRSALPSRGWS 86

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGI 127
           DDL                 WGL+EGL     +   KLRLN +LNS+TRRGPF+GNS G+
Sbjct: 87  DDLSYGAGITYLTALSIGGTWGLIEGLRKTPVTAPPKLRLNGVLNSITRRGPFLGNSAGV 146

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +A+ YN IN T+G IRGKHD+ NSI +GAL G+LFKST GLR    +  I A+ AG W +
Sbjct: 147 IAVVYNGINSTMGHIRGKHDAANSILAGALSGMLFKSTRGLRPMMISGGIVASVAGAWAV 206

Query: 188 AKKYFF 193
            ++ FF
Sbjct: 207 TRRAFF 212



>gi|154282189|ref|XP_001541907.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces capsulatus NAm1]
 gi|150412086|gb|EDN07474.1| mitochondrial import inner membrane translocase subunit tim23
           [Ajellomyces capsulatus NAm1]
          Length = 213

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (58%), Gaps = 13/186 (6%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP +  D   FL+   +  P  L  +AGL    +DYL L++  +   PG   ALPSRG  
Sbjct: 27  DPTSAQDASSFLSGAAMPDPSLLHPLAGLNKDTLDYLSLEDSALDDLPGSRSALPSRGWS 86

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGI 127
           DDL                 WGL+EGL     +   KLRLN +LNS+TRRGPF+GNS G+
Sbjct: 87  DDLSYGTGITYLTALSIGGTWGLIEGLRKTPVTAPPKLRLNGVLNSITRRGPFLGNSAGV 146

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +A+ YN IN T+G IRGKHD+ NSI +GAL G+LFKST GLR    +  I A+ AG W +
Sbjct: 147 IAVVYNGINSTMGHIRGKHDAANSILAGALSGMLFKSTRGLRPMMISGGIVASVAGAWAV 206

Query: 188 AKKYFF 193
            ++ FF
Sbjct: 207 TRRAFF 212



>gi|310798429|gb|EFQ33322.1| hypothetical protein GLRG_08466 [Glomerella graminicola M1.001]
          Length = 241

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 106/186 (56%), Gaps = 15/186 (8%)

Query: 21  DPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG--ALPSRGGFD 70
           DP A   V  FL   +   P QL  ++GL    ++YL LD+  +   PG   LPSRG  D
Sbjct: 45  DPSAGSGVESFLQSSSFADPSQLHPLSGLNKDTLEYLSLDDATLADAPGQSVLPSRGFTD 104

Query: 71  DLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGI 127
           DLC                WGL EGL       P  KLRLN++LN+VTRRGPF+GNS G+
Sbjct: 105 DLCYGTGVTYLAALSIGGAWGLQEGLRRSVNQPP--KLRLNSVLNAVTRRGPFLGNSAGV 162

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           +A+ YN  N  IG  RGKHD+ N+I +GAL G++FKST GLR    +  I A+ AGTW +
Sbjct: 163 VAITYNLFNAGIGYFRGKHDAANTILAGALSGMVFKSTRGLRPMLISGGIVASVAGTWAV 222

Query: 188 AKKYFF 193
            +  FF
Sbjct: 223 IRSTFF 228



>gi|398405424|ref|XP_003854178.1| hypothetical protein MYCGRDRAFT_108883 [Zymoseptoria tritici
           IPO323]
 gi|339474061|gb|EGP89154.1| hypothetical protein MYCGRDRAFT_108883 [Zymoseptoria tritici
           IPO323]
          Length = 226

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 102/169 (60%), Gaps = 11/169 (6%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P  L  +AGL    +DYL LD+ V+T  PG    LPSRG  DDLC               
Sbjct: 58  PSALHPLAGLNQDTLDYLTLDDDVLTDLPGGKSLLPSRGWSDDLCYGTGVTYLAALSVGG 117

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL      +P  KLRLN+ LN++TRRGPF+GNS G++AM YN IN T+G  RGK
Sbjct: 118 AWGLTEGLSRLPATAPP-KLRLNSALNAITRRGPFLGNSAGVVAMMYNGINSTLGYYRGK 176

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           HDS NS+A+G + G++F+ST G+R    +  I A+ AG W +A+K   +
Sbjct: 177 HDSFNSVAAGGISGMIFRSTHGVRPMMISGGIVASVAGAWAVARKVLIE 225



>gi|429863451|gb|ELA37902.1| mitochondrial import inner membrane translocase subunit tim23
           [Colletotrichum gloeosporioides Nara gc5]
          Length = 238

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/195 (42%), Positives = 111/195 (56%), Gaps = 16/195 (8%)

Query: 12  QSSPNQFGTDPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVV--TPG-- 61
           Q++P  F  DP A   V  FL       P QL  ++GL    ++YL L++  +   PG  
Sbjct: 34  QTAPTHF--DPSAGSGVESFLQSSAFADPAQLHPLSGLNKDTLEYLSLEDAALNDVPGGQ 91

Query: 62  -ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH--GHSPNFKLRLNTILNSVTRRG 118
             LPSRG  DDLC                WGL EGL    + P  KLRLN++LN+VTRRG
Sbjct: 92  SVLPSRGFTDDLCYGTGVTYLAALSIGGAWGLQEGLRRSANQPP-KLRLNSVLNAVTRRG 150

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G++A+ YN  N +IG  RGKHD+ NSI +G L G++FKST G+R    +  I 
Sbjct: 151 PFLGNSAGVVAITYNLFNSSIGYFRGKHDAANSILAGGLSGMVFKSTRGVRPMLISGGIV 210

Query: 179 AATAGTWTLAKKYFF 193
           A+ AG W + ++ FF
Sbjct: 211 ASVAGAWAVIRRTFF 225



>gi|121716248|ref|XP_001275733.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus clavatus NRRL 1]
 gi|119403890|gb|EAW14307.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus clavatus NRRL 1]
          Length = 205

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 111/198 (56%), Gaps = 11/198 (5%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG--AVDYLRLDEQVVT- 59
           SFS       S      T P A S     +   P QL  +AGL    +DYL L++  +  
Sbjct: 6   SFSGRKQAQGSEVFDPSTAPDATSFLTESLIPDPTQLHPLAGLNQETLDYLTLEDTSLDE 65

Query: 60  -PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF---KLRLNTILN 112
            PG+   LPSRG  DDLC                WGL+EGL   +P     K+RLNT+LN
Sbjct: 66  LPGSRSVLPSRGWSDDLCYGAGTTYLAGLTVGGAWGLVEGLR-RTPATAPPKIRLNTVLN 124

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
           S+TRRGPF+GNS G++AM YN  N  +G +RGKHD+ NSI +GAL G+LFKST G++   
Sbjct: 125 SITRRGPFLGNSAGVVAMVYNGFNSGLGYVRGKHDATNSIVAGALSGMLFKSTRGIKPMM 184

Query: 173 TASVICAATAGTWTLAKK 190
            +  I A  AGTWT+ ++
Sbjct: 185 ISGGIVAGIAGTWTVVRR 202



>gi|67540356|ref|XP_663952.1| hypothetical protein AN6348.2 [Aspergillus nidulans FGSC A4]
 gi|40739542|gb|EAA58732.1| hypothetical protein AN6348.2 [Aspergillus nidulans FGSC A4]
 gi|259479433|tpe|CBF69649.1| TPA: Mitochondrial import inner membrane translocase subunit TIM23,
           putative (AFU_orthologue; AFUA_2G14190) [Aspergillus
           nidulans FGSC A4]
          Length = 205

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 107/179 (59%), Gaps = 12/179 (6%)

Query: 26  SDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXX 77
           S FL+ V L  P QL  +AGL    +DY+ L++  +   PG+   LPSRG  DDLC    
Sbjct: 28  SSFLSEVALPDPSQLHPLAGLNQDTLDYITLEDSALDQLPGSQSVLPSRGWSDDLCYGTG 87

Query: 78  XXXXXXXXXXXVWGLMEGLHGHSP---NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                       WGL EGL   +P     K+RLN +LNS+TRRGPF+GNS G++AM YN 
Sbjct: 88  TTYVTALAIGGAWGLAEGLK-RTPVTAPPKIRLNGVLNSITRRGPFLGNSAGVVAMVYNG 146

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +N   G  RGKHD+ NSIA+GA+ G++FKST GL+    +  I A  AGTW++AKK   
Sbjct: 147 LNSFAGYARGKHDAANSIAAGAVSGMVFKSTRGLKPMLISGGIVATIAGTWSVAKKALL 205



>gi|50290119|ref|XP_447491.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526801|emb|CAG60428.1| unnamed protein product [Candida glabrata]
          Length = 212

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 111/195 (56%), Gaps = 12/195 (6%)

Query: 12  QSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLG-AVDYLRLDEQVVT-----PG 61
           +   ++ G D   ++D    ++    L P +L  +AGL   V+YL L+E+ ++      G
Sbjct: 18  EQKDDKLGFDSSQLTDISTLISAPGALDPARLHPLAGLERGVEYLDLEEEQLSTMEGSQG 77

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGP 119
            +PSRG  DDLC               V G ++G+    PN   KL+LNTILN VT+RGP
Sbjct: 78  LIPSRGWTDDLCYGTGAVYLIALGIGGVSGFIQGVKNIPPNSPGKLQLNTILNHVTKRGP 137

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GN+ G+LA+ YN IN +I + RGKHD+  SI +GAL G LFKS+ GL+    AS I A
Sbjct: 138 FLGNNAGVLALSYNLINSSIDAFRGKHDTPGSIVAGALTGALFKSSKGLKPMAYASAIVA 197

Query: 180 ATAGTWTLAKKYFFK 194
            TAG W+ AK    +
Sbjct: 198 TTAGAWSAAKHKVLE 212



>gi|340516373|gb|EGR46622.1| predicted protein [Trichoderma reesei QM6a]
          Length = 243

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 107/185 (57%), Gaps = 13/185 (7%)

Query: 20  TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDD 71
           T    V  FL   +   P QL  +AGL    ++YL L++  ++  PG    LPSRG  DD
Sbjct: 46  TQGAGVESFLQSSSFADPSQLHPLAGLNRDTLEYLTLEDSTLSDLPGGQSVLPSRGFTDD 105

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGIL 128
           LC                WG  EGL    G  P  KLRLN +LN++TRRGPF+GN+ G++
Sbjct: 106 LCYGTGITYLTALSIGGAWGFQEGLRKSVGQPP--KLRLNAVLNAMTRRGPFLGNNAGVV 163

Query: 129 AMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLA 188
           A+ YN IN  IG +RG+HD+ N+IA+GAL G++FKST GLR    +  + A+ AG W + 
Sbjct: 164 AITYNCINSLIGYLRGEHDAFNTIAAGALSGMVFKSTKGLRPMMISGGLVASAAGVWAIV 223

Query: 189 KKYFF 193
           ++ FF
Sbjct: 224 RRSFF 228



>gi|302903759|ref|XP_003048927.1| hypothetical protein NECHADRAFT_8467 [Nectria haematococca mpVI
           77-13-4]
 gi|256729861|gb|EEU43214.1| hypothetical protein NECHADRAFT_8467 [Nectria haematococca mpVI
           77-13-4]
          Length = 226

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/194 (42%), Positives = 108/194 (55%), Gaps = 16/194 (8%)

Query: 14  SPNQFGTDPV---AVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---A 62
            P     DP     V  FL       P QL  +AGL    ++Y+ L++  ++  PG    
Sbjct: 31  EPAHLSFDPTEGQGVESFLQSSAFADPSQLHPLAGLNRDTLEYISLEDSALSELPGGQSV 90

Query: 63  LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGP 119
           LPSRG  DDLC                WGL EGL    G  P  KLRLN +LNSVTRRGP
Sbjct: 91  LPSRGFTDDLCYGTGVTYLAGLGIGGAWGLQEGLRRSPGQPP--KLRLNAVLNSVTRRGP 148

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GNS G++A+ YN IN  IGS+RGKHD+ N++ +GAL G+LFKST G+R    +  I A
Sbjct: 149 FLGNSLGVVAIIYNCINSLIGSLRGKHDAGNTVLAGALSGMLFKSTRGIRPMMISGGIVA 208

Query: 180 ATAGTWTLAKKYFF 193
           + A  W + ++ FF
Sbjct: 209 SVAAGWAVVRRSFF 222



>gi|238490402|ref|XP_002376438.1| mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus flavus NRRL3357]
 gi|317145351|ref|XP_001820713.2| import inner membrane translocase subunit tim23 [Aspergillus oryzae
           RIB40]
 gi|220696851|gb|EED53192.1| mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus flavus NRRL3357]
 gi|391865873|gb|EIT75152.1| import inner membrane translocase, subunit TIM23 [Aspergillus
           oryzae 3.042]
          Length = 204

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 116/204 (56%), Gaps = 17/204 (8%)

Query: 1   MSSFSSNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLD 54
           MS + S +   QS   +F  DP    D   FL+ V +  P  L  +AGL    +DY+ L+
Sbjct: 1   MSFWDSLSGRKQSKGPEF--DPSTAQDATSFLSEVAIPDPTSLHPLAGLNQDTLDYITLE 58

Query: 55  EQVV--TPGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLR 106
           +  +  TPG+   LPSRG  DDLC                WGL EG+      +P  K+R
Sbjct: 59  DSALDETPGSRSLLPSRGWSDDLCYGAGTTYLAGLTIGGAWGLAEGMKKVPATAPP-KIR 117

Query: 107 LNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTA 166
           LN +LN++TRRGPF+GNS G++AM YN  N  IG +RGKHDS NS+ +GAL G+LFKST 
Sbjct: 118 LNGVLNAITRRGPFLGNSAGVVAMVYNGFNSGIGYVRGKHDSANSVVAGALSGMLFKSTR 177

Query: 167 GLRAAGTASVICAATAGTWTLAKK 190
           GL+    +  I A+ AG W L +K
Sbjct: 178 GLKPMMISGGIVASIAGGWALVRK 201



>gi|389632517|ref|XP_003713911.1| mitochondrial import inner membrane translocase subunit tim23
           [Magnaporthe oryzae 70-15]
 gi|351646244|gb|EHA54104.1| mitochondrial import inner membrane translocase subunit tim23
           [Magnaporthe oryzae 70-15]
 gi|440473241|gb|ELQ42056.1| mitochondrial import inner membrane translocase subunit tim23
           [Magnaporthe oryzae Y34]
 gi|440480219|gb|ELQ60894.1| mitochondrial import inner membrane translocase subunit tim23
           [Magnaporthe oryzae P131]
          Length = 232

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 106/186 (56%), Gaps = 13/186 (6%)

Query: 20  TDPVAVSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDD 71
           + P  V  FL       P  L  +AGL   A++Y+ L++  ++  PG+   +PSRG  DD
Sbjct: 41  SQPQGVDAFLGSSAFTDPSALHPLAGLNKDALEYITLEDSTLSDLPGSQSVIPSRGWSDD 100

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGIL 128
           LC                WG  EGL    G  P  KLRLN++LN+VTRRGPF+GNS G++
Sbjct: 101 LCYGTGITYLAALGVGGAWGAQEGLRRSVGQPP--KLRLNSVLNAVTRRGPFLGNSGGVV 158

Query: 129 AMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLA 188
           A+ YN  N   G +RGKHD+ NSIA+G L G+LFKST GLR    +  I  + AG W +A
Sbjct: 159 AIVYNLANSYFGYLRGKHDAANSIAAGTLSGMLFKSTRGLRPMMVSGAIVGSVAGVWAVA 218

Query: 189 KKYFFK 194
           +K F K
Sbjct: 219 RKTFEK 224



>gi|119481693|ref|XP_001260875.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Neosartorya fischeri NRRL 181]
 gi|119409029|gb|EAW18978.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Neosartorya fischeri NRRL 181]
          Length = 205

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 107/187 (57%), Gaps = 15/187 (8%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVV--TPGA---LPSRGGF 69
           DP    D   FL+   +  P QL  +AGL    +DYL L++  +   PG+   LPSRG  
Sbjct: 20  DPSTAQDATSFLSEALIPDPTQLHPLAGLNQDTLDYLTLEDSALDEIPGSRSVLPSRGWS 79

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF---KLRLNTILNSVTRRGPFIGNSCG 126
           DDLC                WGL EGL   +P     K+RLN +LNS+TRRGPF+GNS G
Sbjct: 80  DDLCYGTGTTYLTALTIGGAWGLAEGLQ-RTPATAPPKIRLNGVLNSITRRGPFLGNSAG 138

Query: 127 ILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           ++AM YN  N  +G  RGKHD+ NSI +GAL G+LFKST GL+    +  I A+ AGTW 
Sbjct: 139 VVAMVYNGFNSGLGYARGKHDAANSIVAGALSGMLFKSTRGLKPMMISGGIVASIAGTWA 198

Query: 187 LAKKYFF 193
           + ++ F 
Sbjct: 199 VIRRAFL 205



>gi|449303383|gb|EMC99391.1| hypothetical protein BAUCODRAFT_137574 [Baudoinia compniacensis
           UAMH 10762]
          Length = 228

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 104/180 (57%), Gaps = 10/180 (5%)

Query: 25  VSDFLARVN-LGPGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXX 76
           VS FL       P  L  +AGL    +DYL LD+  ++  PG+   LPSRG  DDLC   
Sbjct: 48  VSSFLHNPGAFDPAALHPLAGLNQDTLDYLSLDDSALSELPGSRSILPSRGWSDDLCYGT 107

Query: 77  XXXXXXXXXXXXVWGLMEGLH--GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                        WGL EGL     +   KLRLN+ LN++TRRGPF+GNS G++AM YN 
Sbjct: 108 GVTYLSALSIGGAWGLAEGLTRLPSTAPPKLRLNSALNAITRRGPFLGNSAGVIAMMYNG 167

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           IN TIG  RGKHD+  S+A+GA+ G +FKST GLR    +S + A  AG+W L +K   +
Sbjct: 168 INSTIGYYRGKHDTFGSVAAGAISGAIFKSTGGLRPMLISSGLVAGAAGSWALLRKIVLE 227



>gi|358379404|gb|EHK17084.1| hypothetical protein TRIVIDRAFT_88386 [Trichoderma virens Gv29-8]
          Length = 233

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 102/168 (60%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++YL L++  ++  PG    LPSRG  DDLC               
Sbjct: 56  PSQLHPLAGLNRDTLEYLTLEDSTLSDLPGGQSVLPSRGFTDDLCYGTGITYLTALSIGG 115

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WG  EGL    G  P  KLRLN +LN++TRRGPF+GN+ G++A+ YN IN  IG +RG+
Sbjct: 116 AWGFQEGLRKSTGQPP--KLRLNAVLNAMTRRGPFLGNNAGVVAITYNCINSLIGYLRGE 173

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N++A+GAL G++FKST G+R    +  + A+ AG W + ++ FF
Sbjct: 174 HDAFNTVAAGALSGMVFKSTKGVRPMMISGGLVASAAGAWAIVRRSFF 221



>gi|512187748|gb|EPE03525.1| mitochondrial import inner membrane translocase subunit tim23
           [Ophiostoma piceae UAMH 11346]
          Length = 270

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (60%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++Y+ +++  ++  PG   ALPSRG  DDLC               
Sbjct: 93  PTQLHPLAGLNRETLEYISMEDSALSDLPGSQSALPSRGFTDDLCYGTGITYLTALTLGG 152

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WG+ EGL    G  P  KLRLN++LN+VTRRGPF+GNS G++A+ YN IN  IG +RGK
Sbjct: 153 AWGVQEGLRRSAGQPP--KLRLNSVLNAVTRRGPFLGNSAGVVAITYNCINSYIGYVRGK 210

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N++ +G L G+LFKST GLR    +  I A+ A  WT+ ++  F
Sbjct: 211 HDAANAVIAGGLGGMLFKSTRGLRPMLISGGIVASVAAAWTVTRRTLF 258



>gi|410080468|ref|XP_003957814.1| hypothetical protein KAFR_0F00820 [Kazachstania africana CBS 2517]
 gi|372464401|emb|CCF58679.1| hypothetical protein KAFR_0F00820 [Kazachstania africana CBS 2517]
          Length = 199

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 101/165 (61%), Gaps = 8/165 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+Y+ L+E+ ++      G LPSRG  DDLC               V G
Sbjct: 35  KLHPLAGLDKGVEYMDLEEEQLSTMEGSQGLLPSRGWTDDLCYGTGTVYLLGLGIGGVSG 94

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           L  GL    PN   KL+LNT+LNS+T+RGPF+GNS GILA+ YN IN +I SIRGKH+++
Sbjct: 95  LFHGLQNLPPNSPGKLKLNTVLNSITKRGPFLGNSAGILALSYNIINSSIDSIRGKHNTM 154

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           NS+A+GAL G +FKS+ GL+    AS + A TA  W   KK   +
Sbjct: 155 NSVAAGALTGAIFKSSKGLKPMAYASGLMAGTAAIWCGFKKSVLE 199



>gi|470319476|gb|EMR11095.1| hypothetical protein PNEG_00694 [Pneumocystis murina B123]
          Length = 214

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 19/193 (9%)

Query: 8   TYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT--PG--- 61
           +Y    +P  F  D            + P +L  +AGLG  +DY  L++  +   PG   
Sbjct: 32  SYSLPETPEIFDKDA-----------MDPSRLHPLAGLGKTLDYFSLEDAKLANLPGGKT 80

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP--NFKLRLNTILNSVTRRGP 119
           A PSRG  DDL                 WG+ EGL   S   + ++R+N+ILN++TRRGP
Sbjct: 81  AFPSRGWSDDLTYGTGTVYLSALGIGGTWGIFEGLSKVSKAISIRVRINSILNAMTRRGP 140

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+ NS G++A+GYNT N T+G  RGKHD +NSI SGAL G ++KST G+++    S IC+
Sbjct: 141 FLANSAGVIALGYNTANSTLGYYRGKHDDLNSILSGALAGAVYKSTRGIKSIVIVSGICS 200

Query: 180 ATAGTWTLAKKYF 192
             AG W  +K+ F
Sbjct: 201 GIAGIWCFSKRLF 213



>gi|358398207|gb|EHK47565.1| hypothetical protein TRIATDRAFT_298638 [Trichoderma atroviride IMI
           206040]
          Length = 234

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++YL L++  ++  PG    LPSRG  DDLC               
Sbjct: 57  PSQLHPLAGLNRDTLEYLSLEDSTLSDLPGGQSVLPSRGFTDDLCYGTGITYLTALSIGG 116

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WG  EGL    G  P  KLRLN +LN++TRRGPF+GN+ G++A+ YN IN  IG +RG+
Sbjct: 117 AWGFQEGLRRSAGQPP--KLRLNAVLNAMTRRGPFLGNNAGVVAITYNCINSLIGFLRGE 174

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N+IA+G L G++FKST G+R    +  + A+ AG W +A++ FF
Sbjct: 175 HDAFNTIAAGGLSGMVFKSTRGVRPMMISGGLVASLAGVWAIARQSFF 222



>gi|393222079|gb|EJD07563.1| Tim17-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 214

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 113/197 (57%), Gaps = 13/197 (6%)

Query: 2   SSFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGL-GAVDYLRLDEQVVT- 59
           ++FS+ + +  +  N    + +  SD LA     P +L  +AGL   ++YL+LD+  V  
Sbjct: 21  ATFSTGSSNASTGDN----NALTASDLLAG-GFDPARLHPMAGLKDQLEYLQLDDDKVND 75

Query: 60  -PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHG--HSPNFKLRLNTILNS 113
            PGA   LPSRG  DDLC               +WGL EG        N +LR+N ILNS
Sbjct: 76  LPGASTALPSRGWSDDLCYGTGTTYLSGLAIGGLWGLREGAKRPLAVSNARLRINAILNS 135

Query: 114 VTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGT 173
           VTRRG FIGNS G++A+ YN IN TI  +RGKHD   S+A+G L G ++KSTAG+R A  
Sbjct: 136 VTRRGTFIGNSAGVVALVYNAINSTIDGVRGKHDVWGSMAAGGLSGAIYKSTAGVRPALV 195

Query: 174 ASVICAATAGTWTLAKK 190
           A+ +    AGTW+  KK
Sbjct: 196 AATLMTGLAGTWSYVKK 212



>gi|380492259|emb|CCF34736.1| hypothetical protein CH063_06670 [Colletotrichum higginsianum]
          Length = 242

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 110/201 (54%), Gaps = 17/201 (8%)

Query: 8   TYDYQSSPNQFGT--DPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT 59
           T  + S P    T  DP A   V  FL       P QL  ++GL    ++YL L++  + 
Sbjct: 31  TTTFNSPPATTTTKFDPSAGSGVESFLQSSAFADPAQLHPLSGLNKDTLEYLSLEDATLA 90

Query: 60  --PG--ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILN 112
             PG   LPSRG  DDLC                WGL EGL       P  KLRLN++LN
Sbjct: 91  DAPGQSVLPSRGFTDDLCYGTGVTYLAALSIGGAWGLQEGLRRSVNQPP--KLRLNSVLN 148

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
           +VTRRGPF+GNS G++A+ YN +N  IG  RGKHD+ N+I +GAL G++FKST G+R   
Sbjct: 149 AVTRRGPFLGNSAGVVAITYNLLNSGIGYFRGKHDAANTILAGALSGMVFKSTRGVRPML 208

Query: 173 TASVICAATAGTWTLAKKYFF 193
            +  I A+ AG W + +  FF
Sbjct: 209 ISGGIVASVAGAWAVVRSTFF 229



>gi|260944246|ref|XP_002616421.1| hypothetical protein CLUG_03662 [Clavispora lusitaniae ATCC 42720]
 gi|238850070|gb|EEQ39534.1| hypothetical protein CLUG_03662 [Clavispora lusitaniae ATCC 42720]
          Length = 209

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 112/201 (55%), Gaps = 14/201 (6%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPG-----QLREIAGL-GAVDYLRLDEQVV 58
           S    + +S     G DP  VSD ++ +   PG     +L  +AGL   V+YL L+E+ +
Sbjct: 9   SQEEKNQESLKQSLGFDPAQVSD-VSSILQAPGVLDSTKLHPLAGLEKGVEYLDLEEERL 67

Query: 59  TP-----GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTIL 111
           +      G L SR   DDLC                +G+ EGL+    N   KL+LNT+L
Sbjct: 68  SDMEGAHGLLASRSWTDDLCYGTGTVYLLGLGLGGAYGMQEGLNNLPANATPKLKLNTVL 127

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N +T+RGPF+GNS G+LA+ YN I+ +I  +RGKHD  NS+ASGAL G LF+S+AG+R  
Sbjct: 128 NHITKRGPFMGNSAGVLALMYNLIDSSIDHLRGKHDDYNSLASGALTGALFRSSAGVRPM 187

Query: 172 GTASVICAATAGTWTLAKKYF 192
             ++ I  A AG W   K++ 
Sbjct: 188 AYSTAIMTAAAGAWCGLKRFL 208



>gi|400595141|gb|EJP62951.1| mitochondrial import inner membrane translocase subunit tim23
           [Beauveria bassiana ARSEF 2860]
          Length = 237

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 104/192 (54%), Gaps = 13/192 (6%)

Query: 13  SSPNQFGTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALP 64
           SSP    T+   V  FL       P QL  +AGL    ++YL L++  ++  PG    +P
Sbjct: 32  SSPIYDPTEGQGVESFLQSSAFADPSQLHPLAGLNKDTLEYLSLEDSALSDLPGGQSVIP 91

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFI 121
           SRG  DDLC                WGL EGL    G  P  KLRLN  LN++TRRGPF+
Sbjct: 92  SRGFTDDLCYGTGTTYVSGLAIGGAWGLQEGLRKSAGQPP--KLRLNATLNAITRRGPFL 149

Query: 122 GNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAAT 181
           GNS G++A+ YN  N  IG  RGKHD+ NSIA+G   G+LFKST GLR    +  I  + 
Sbjct: 150 GNSAGVVAIIYNMFNSLIGYYRGKHDAANSIAAGVFSGMLFKSTRGLRPMMISGGIVGSV 209

Query: 182 AGTWTLAKKYFF 193
           A  W +A++  F
Sbjct: 210 AAAWAIARRSIF 221



>gi|430811196|emb|CCJ31371.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 209

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 99/168 (58%), Gaps = 8/168 (4%)

Query: 34  LGPGQLREIAGLG-AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXX 87
           L P +L  +AGLG A+DYL L++  +   PG   A PSRG  DDL               
Sbjct: 42  LDPSRLHPLAGLGKALDYLSLEDAQLANLPGGKTAFPSRGWSDDLTYGTGTVYVSALGIG 101

Query: 88  XVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
             WG  EGL     N   ++R N+ILN++T RGPF+ NS G++A+GYN  N T+G  RGK
Sbjct: 102 GAWGFFEGLSKAKKNVSTRVRFNSILNAMTSRGPFLANSVGVIALGYNAANSTLGYYRGK 161

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD +NSI SGAL G ++KST G+++    S IC+  AG W L+K+ F 
Sbjct: 162 HDDMNSIISGALAGTVYKSTRGIKSIVIFSGICSGMAGIWCLSKRLFI 209



>gi|83768574|dbj|BAE58711.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 214

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 116/207 (56%), Gaps = 17/207 (8%)

Query: 1   MSSFSSNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLD 54
           MS + S +   QS   +F  DP    D   FL+ V +  P  L  +AGL    +DY+ L+
Sbjct: 1   MSFWDSLSGRKQSKGPEF--DPSTAQDATSFLSEVAIPDPTSLHPLAGLNQDTLDYITLE 58

Query: 55  EQVV--TPGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLR 106
           +  +  TPG+   LPSRG  DDLC                WGL EG+      +P  K+R
Sbjct: 59  DSALDETPGSRSLLPSRGWSDDLCYGAGTTYLAGLTIGGAWGLAEGMKKVPATAPP-KIR 117

Query: 107 LNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTA 166
           LN +LN++TRRGPF+GNS G++AM YN  N  IG +RGKHDS NS+ +GAL G+LFKST 
Sbjct: 118 LNGVLNAITRRGPFLGNSAGVVAMVYNGFNSGIGYVRGKHDSANSVVAGALSGMLFKSTR 177

Query: 167 GLRAAGTASVICAATAGTWTLAKKYFF 193
           GL+    +  I A+ AG W +   + F
Sbjct: 178 GLKPMMISGGIVASIAGGWAVCGIHSF 204



>gi|50413121|ref|XP_457210.1| DEHA2B05742p [Debaryomyces hansenii CBS767]
 gi|49652875|emb|CAG85205.1| DEHA2B05742p [Debaryomyces hansenii CBS767]
          Length = 209

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 109/190 (57%), Gaps = 14/190 (7%)

Query: 16  NQFGTDPVAVSDFLARVNLGPG-----QLREIAGL-GAVDYLRLDEQVVT-----PGALP 64
           N  G DP  VSD ++ +   PG     +L  +AGL   V+YL L+E+ +       G +P
Sbjct: 20  NSLGFDPSQVSD-VSSILQAPGVLDSTRLHPLAGLEKGVEYLDLEEEQLNDIEGAKGLIP 78

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIG 122
           SR   DDLC                +G  EG++    N   KL+LNT+LN +T+RGPF+G
Sbjct: 79  SRSWTDDLCYGTGAVYLLGLGIGGTYGFQEGINNLPKNASSKLQLNTVLNHITKRGPFLG 138

Query: 123 NSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATA 182
           NS G+LA+ YN I+ T+ ++RGKHD +NSI +G L G LF+S+AG+R  G ++ + A  A
Sbjct: 139 NSAGVLALTYNLIDSTLDAVRGKHDDINSIVAGGLAGALFRSSAGIRPMGYSTALMAGAA 198

Query: 183 GTWTLAKKYF 192
           G W   K++ 
Sbjct: 199 GAWCGIKRFL 208



>gi|295673869|ref|XP_002797480.1| mitochondrial import inner membrane translocase subunit tim23
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226280130|gb|EEH35696.1| mitochondrial import inner membrane translocase subunit tim23
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 202

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 111/198 (56%), Gaps = 15/198 (7%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQ 56
           + S     +  +P  F  DP +  D   FL+   +  P  L  +AGL    +DYL L++ 
Sbjct: 6   TLSGRKTSHPPAPAHF--DPSSAQDASSFLSGPAMPDPSLLHPLAGLNQNTLDYLSLEDS 63

Query: 57  VVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNT 109
            +   PG   ALPSRG  DDL                +WGL+EGL     +   KLRLN 
Sbjct: 64  ALDDLPGSRSALPSRGWSDDLSYGTGTTYLTALSLGGLWGLVEGLKKTPVTAPPKLRLNG 123

Query: 110 ILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLR 169
           +LNS+TRRGPF+GNS G++AM YN IN T+G  RGKHD+ NSI +GA+ G+LFKST GLR
Sbjct: 124 VLNSITRRGPFLGNSAGVIAMVYNGINSTLGHFRGKHDAANSILAGAMSGMLFKSTRGLR 183

Query: 170 AAGTASVICAATAGTWTL 187
               +  I A+ AG W +
Sbjct: 184 PMMISGGIVASIAGAWAV 201



>gi|46122401|ref|XP_385754.1| hypothetical protein FG05578.1 [Fusarium graminearum PH-1]
          Length = 241

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 107/185 (57%), Gaps = 13/185 (7%)

Query: 20  TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDD 71
           T+   V  FL       P QL  +AGL    ++Y+ L++  ++  PG    LPSRG  DD
Sbjct: 44  TEGQGVESFLQSSTFADPSQLHPLAGLNRDTLEYISLEDSALSELPGGQSVLPSRGFTDD 103

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGIL 128
           LC                WGL EGL    G  P  KLRLN +LNSVTRRGPF+GNS G++
Sbjct: 104 LCYGAGVTYLGGLGVGGAWGLQEGLRRSAGQPP--KLRLNAVLNSVTRRGPFLGNSLGVV 161

Query: 129 AMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLA 188
           A+ YN  N  IGS+RGKHD+ N+I +GAL G+LFKST GLR    +  I A+ AG W + 
Sbjct: 162 AIIYNCTNSLIGSLRGKHDAGNTILAGALSGMLFKSTRGLRPMAISGGIVASVAGVWAIV 221

Query: 189 KKYFF 193
           ++ FF
Sbjct: 222 RRSFF 226



>gi|322709258|gb|EFZ00834.1| mitochondrial import inner membrane translocase subunit tim23
           [Metarhizium anisopliae ARSEF 23]
          Length = 233

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 114/202 (56%), Gaps = 16/202 (7%)

Query: 6   SNTYDYQSSPNQFGTDPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT 59
           ++ +D  +  +Q   DP     V  FL       P QL  +AGL    ++YL L++  ++
Sbjct: 22  THAFDAPAPSSQTSFDPSQGQGVEAFLQSSTFADPSQLHPLAGLNKDTLEYLTLEDSALS 81

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTIL 111
             PG    LPSRG  DDLC               VWGL +GL    G  P  KLR+N IL
Sbjct: 82  ELPGGQSVLPSRGFTDDLCYGTGITYLAALSIGGVWGLQDGLKKSVGQPP--KLRMNAIL 139

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N +TRRGPF+GNS G++A+ YN IN  IGS+RGKHDS N++ SG L G++FKST G+R+ 
Sbjct: 140 NGMTRRGPFLGNSAGVVAIVYNCINSLIGSLRGKHDSANTVISGFLSGVVFKSTRGVRSM 199

Query: 172 GTASVICAATAGTWTLAKKYFF 193
             +  +  + AG W + ++ FF
Sbjct: 200 MISGGVVGSVAGVWAIVRRSFF 221



>gi|513030016|gb|AGO10060.1| AaceriAAR070Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 210

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 106/189 (56%), Gaps = 14/189 (7%)

Query: 10  DYQSSPNQFGTDPVAVSDFLARVNLGPG-----QLREIAGL-GAVDYLRLDEQVVT---- 59
           D +      G DP  V++ +A +   PG     +L  +AGL   V+YL LDE+ ++    
Sbjct: 15  DDRKLQETLGFDPQQVTN-VANIIATPGALDVSRLHPLAGLEQGVEYLDLDEEKLSSVEG 73

Query: 60  -PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTR 116
             G +PSRG  DDLC                +G  EGL    PN   KL+LNT+LN +TR
Sbjct: 74  SQGLIPSRGWTDDLCYGTGSVYLTGLGLGGAYGFFEGLRNIPPNAPGKLQLNTVLNHITR 133

Query: 117 RGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASV 176
           RGPF+GN+ G+LA+ YN IN TI  +RGKHD+  SIASGAL G LFKS+ GL+  G AS 
Sbjct: 134 RGPFLGNNAGVLALTYNLINSTIEGLRGKHDAAGSIASGALAGALFKSSKGLKPMGYASG 193

Query: 177 ICAATAGTW 185
             A  A  W
Sbjct: 194 TMALVAAGW 202



>gi|511006494|gb|EPB87804.1| hypothetical protein HMPREF1544_05333 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 217

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 104/187 (55%), Gaps = 8/187 (4%)

Query: 14  SPNQFGTDPVA-VSDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPGA-----LPSRG 67
           S   FG +    + DF++ V     +L+ +A  G +D+L+++ +    G       PSRG
Sbjct: 28  SEENFGDNSFEKIPDFMSSVTYDANRLQPVALQGGLDFLQVEGEATGSGMGGASLAPSRG 87

Query: 68  GFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHS--PNFKLRLNTILNSVTRRGPFIGNSC 125
             DDLC                +G+ EGL   S  PN K+RLNT LNS+TRRGP IGNS 
Sbjct: 88  WSDDLCYGTGTTYLAGLTLGGAFGMAEGLKKSSGAPNMKVRLNTTLNSITRRGPGIGNSL 147

Query: 126 GILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           G++AM YN     I + RG+HD  NS+A GA+ G +FKSTAG RAA  ++ +CA  AG W
Sbjct: 148 GVIAMIYNGTTAMIDAQRGQHDVFNSLAGGAVSGAIFKSTAGPRAALVSAGVCAGVAGAW 207

Query: 186 TLAKKYF 192
           +L    F
Sbjct: 208 SLLVSTF 214



>gi|408394341|gb|EKJ73549.1| hypothetical protein FPSE_06167 [Fusarium pseudograminearum CS3096]
          Length = 241

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 107/185 (57%), Gaps = 13/185 (7%)

Query: 20  TDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDD 71
           T+   V  FL       P QL  +AGL    ++Y+ L++  ++  PG    LPSRG  DD
Sbjct: 44  TEGQGVESFLQSSTFADPSQLHPLAGLNRDTLEYISLEDSALSELPGGQSVLPSRGFTDD 103

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGIL 128
           LC                WGL EGL    G  P  KLRLN +LNSVTRRGPF+GNS G++
Sbjct: 104 LCYGAGVTYLGGLGVGGAWGLQEGLRRSAGQPP--KLRLNAVLNSVTRRGPFLGNSLGVV 161

Query: 129 AMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLA 188
           A+ YN  N  IGS+RGKHD+ N++ +GAL G+LFKST GLR    +  I A+ AG W + 
Sbjct: 162 AIIYNCTNSLIGSLRGKHDAGNTVLAGALSGMLFKSTRGLRPMAISGGIVASVAGVWAIV 221

Query: 189 KKYFF 193
           ++ FF
Sbjct: 222 RRSFF 226



>gi|226286907|gb|EEH42420.1| mitochondrial import inner membrane translocase subunit tim23
           [Paracoccidioides brasiliensis Pb18]
          Length = 1351

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 97/161 (60%), Gaps = 9/161 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P  L  +AGL    +DYL L++  +   PG   ALPSRG  DDL                
Sbjct: 41  PSLLHPLAGLNQDTLDYLSLEDSALDDLPGSRSALPSRGWSDDLSYGTGTTYLTALSLGG 100

Query: 89  VWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           +WGL+EGL     +   KLRLN +LNS+TRRGPF+GNS G++AM YN IN T+G  RGKH
Sbjct: 101 LWGLVEGLKKTPVTAPPKLRLNGVLNSITRRGPFLGNSAGVIAMVYNGINSTLGHFRGKH 160

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           D+ NSI +GA+ G+LFKST GLR    +  I A+ AG W L
Sbjct: 161 DAANSILAGAMSGMLFKSTRGLRPMMISGGIVASIAGAWAL 201



>gi|349580951|dbj|GAA26110.1| K7_Mas6p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 222

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
            SI +GAL G LFKS+ GL+  G +S + AA    W   KK   +
Sbjct: 177 GSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLE 221



>gi|323303210|gb|EGA57009.1| Tim23p [Saccharomyces cerevisiae FostersB]
          Length = 222

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
            SI +GAL G LFKS+ GL+  G +S + AA    W   KK   +
Sbjct: 177 GSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLE 221



>gi|398365641|ref|NP_014414.3| Tim23p [Saccharomyces cerevisiae S288c]
 gi|417274|sp|P32897.1|TIM23_YEAST RecName: Full=Mitochondrial import inner membrane translocase
           subunit TIM23; AltName: Full=Membrane import machinery
           protein MIM23; AltName: Full=Mitochondrial protein
           import protein 3; AltName: Full=Mitochondrial protein
           import protein MAS6
 gi|297118|emb|CAA50640.1| MAS6 [Saccharomyces cerevisiae]
 gi|402785|emb|CAA52274.1| MIM23 [Saccharomyces cerevisiae]
 gi|1302500|emb|CAA96296.1| TIM23 [Saccharomyces cerevisiae]
 gi|151944545|gb|EDN62823.1| mitochondrial assembly-related protein [Saccharomyces cerevisiae
           YJM789]
 gi|190408984|gb|EDV12249.1| 23 kDa mitochondrial inner membrane protein [Saccharomyces
           cerevisiae RM11-1a]
 gi|256273361|gb|EEU08299.1| Tim23p [Saccharomyces cerevisiae JAY291]
 gi|259148966|emb|CAY82210.1| Tim23p [Saccharomyces cerevisiae EC1118]
 gi|285814664|tpg|DAA10558.1| TPA: Tim23p [Saccharomyces cerevisiae S288c]
 gi|323335735|gb|EGA77016.1| Tim23p [Saccharomyces cerevisiae Vin13]
 gi|323352466|gb|EGA84967.1| Tim23p [Saccharomyces cerevisiae VL3]
 gi|365763404|gb|EHN04933.1| Tim23p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392297006|gb|EIW08107.1| Tim23p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 222

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
            SI +GAL G LFKS+ GL+  G +S + AA    W   KK   +
Sbjct: 177 GSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLE 221



>gi|323307399|gb|EGA60675.1| Tim23p [Saccharomyces cerevisiae FostersO]
          Length = 222

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
            SI +GAL G LFKS+ GL+  G +S + AA    W   KK   +
Sbjct: 177 GSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLE 221



>gi|225684562|gb|EEH22846.1| mitochondrial import inner membrane translocase subunit tim23
           [Paracoccidioides brasiliensis Pb03]
          Length = 202

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 97/161 (60%), Gaps = 9/161 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P  L  +AGL    +DYL L++  +   PG   ALPSRG  DDL                
Sbjct: 41  PSLLHPLAGLNQDTLDYLSLEDSALDDLPGSRSALPSRGWSDDLSYGTGTTYLTALSLGG 100

Query: 89  VWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           +WGL+EGL     +   KLRLN +LNS+TRRGPF+GNS G++AM YN IN T+G  RGKH
Sbjct: 101 LWGLVEGLKKTPVTAPPKLRLNGVLNSITRRGPFLGNSAGVIAMVYNGINSTLGHFRGKH 160

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           D+ NSI +GA+ G+LFKST GLR    +  I A+ AG W +
Sbjct: 161 DAANSILAGAMSGMLFKSTRGLRPMMISGGIVASIAGAWAV 201



>gi|406606723|emb|CCH41947.1| Mitochondrial import inner membrane translocase subunit TIM23
           [Wickerhamomyces ciferrii]
          Length = 214

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 10/157 (6%)

Query: 38  QLREIAGL-GAVDYLRLDEQVVTP-----GALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+++ +T      G +PSRG  DDLC                +G
Sbjct: 51  RLHPLAGLEKGVEYLDLEDENLTQLEGAQGLIPSRGWTDDLCYGTGAVYLLGLGLGGSYG 110

Query: 92  LMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
             EGL     +SP  +LRLNT+LN VT+RGPF+GN+ G+LA+ YN I+ TI  +RGKHD+
Sbjct: 111 FFEGLRNIPANSPG-RLRLNTVLNHVTKRGPFLGNTAGVLALTYNLIDSTIDGLRGKHDA 169

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           +NSIA+GA+ G LFKST GL+ AG AS + A  A TW
Sbjct: 170 INSIAAGAISGALFKSTKGLKPAGIASGLMAGAAATW 206



>gi|71002142|ref|XP_755752.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus fumigatus Af293]
 gi|66853390|gb|EAL93714.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus fumigatus Af293]
 gi|159129807|gb|EDP54921.1| Mitochondrial import inner membrane translocase subunit TIM23,
           putative [Aspergillus fumigatus A1163]
          Length = 212

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 105/187 (56%), Gaps = 15/187 (8%)

Query: 21  DPVAVSD---FLARVNL-GPGQLREIAGLG--AVDYLRLDEQVV--TPGA---LPSRGGF 69
           DP    D   FL+   +  P QL  +AGL    +DYL L++  +   PG+   LPSRG  
Sbjct: 20  DPSTAQDATSFLSEALIPDPTQLHPLAGLNQDTLDYLTLEDSALDEIPGSRSVLPSRGWS 79

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF---KLRLNTILNSVTRRGPFIGNSCG 126
           DDLC                WGL EGL   +P     K+RLN +LNS+TRRGPF+GNS G
Sbjct: 80  DDLCYGTGTTYLTALTIGGAWGLAEGLK-RTPVTAPPKIRLNGVLNSITRRGPFLGNSAG 138

Query: 127 ILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           ++AM YN  N  +G  RGKHD+ NSI +GAL G+LFKST GL+    +  I A+ AGTW 
Sbjct: 139 VVAMVYNGFNSGLGYARGKHDAANSIVAGALSGMLFKSTRGLKPMMISGGIVASIAGTWA 198

Query: 187 LAKKYFF 193
           +    F 
Sbjct: 199 VRTFSFL 205



>gi|471573847|gb|EMR71884.1| putative mitochondrial import inner membrane translocase subunit
           tim23 protein [Eutypa lata UCREL1]
          Length = 246

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 98/168 (58%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL   +++YL L++  ++  PG   A+PSRG  DDLC               
Sbjct: 70  PSQLHPLAGLNRESLEYLTLEDSALSDLPGSQSAIPSRGFSDDLCYGTGITYLTALSLGG 129

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL    G  P  KLRLN+ LN+VTRRGPF+GNS G++A+ YN  N  IG  RGK
Sbjct: 130 AWGLQEGLRRSVGQPP--KLRLNSTLNAVTRRGPFLGNSAGVVAITYNCFNSGIGYFRGK 187

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N+I +G L G++FKST G+R    +  +  + AG W + KK   
Sbjct: 188 HDAANTILAGTLSGMVFKSTRGVRQMMISGGVVGSAAGVWAITKKIIL 235



>gi|323331767|gb|EGA73180.1| Tim23p [Saccharomyces cerevisiae AWRI796]
          Length = 220

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 97/161 (60%), Gaps = 8/161 (4%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
            SI +GAL G LFKS+ GL+  G +S + AA    W   KK
Sbjct: 177 GSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKK 217



>gi|156848913|ref|XP_001647337.1| hypothetical protein Kpol_1018p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156118023|gb|EDO19479.1| hypothetical protein Kpol_1018p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 212

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 80/196 (40%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 10  DYQSSPNQFGTDP---VAVSDFLARVNLGPGQLREIAGL-GAVDYLRLDEQVVT-----P 60
           D +S     G DP     VS+ +   +L P +L  +AGL   V+YL L+E+ ++      
Sbjct: 17  DDKSLEKNLGFDPSQLTNVSNIIGTSSLDPSRLHPLAGLEKGVEYLDLEEEQLSTLEGSQ 76

Query: 61  GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRG 118
           G +PSRG  DDLC                +G +EGL   +PN   KL+LNT+LN +TRRG
Sbjct: 77  GLIPSRGWTDDLCYGTGAVYLLGLGIGGSYGFIEGLKNITPNSSGKLQLNTVLNHITRRG 136

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LA+ YN IN +I S RGKHD+  +I +G L G +FKS+ GL+    AS + 
Sbjct: 137 PFLGNSAGVLALTYNIINSSIDSFRGKHDTPGAILAGGLTGAIFKSSKGLKPMAYASGMT 196

Query: 179 AATAGTWTLAKKYFFK 194
           AA A  W+ AK    +
Sbjct: 197 AAAAALWSGAKDTVLE 212



>gi|258565045|ref|XP_002583267.1| mitochondrial import inner membrane translocase subunit tim23
           [Uncinocarpus reesii 1704]
 gi|237906968|gb|EEP81369.1| mitochondrial import inner membrane translocase subunit tim23
           [Uncinocarpus reesii 1704]
          Length = 227

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 93/150 (62%), Gaps = 10/150 (6%)

Query: 25  VSDFLARVNL-GPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXX 76
           VS FL+   +  P +L  +AGL    +DYL L++  +   PG   ALPSRG  DDL    
Sbjct: 30  VSSFLSSTAIPDPSELHPLAGLNRETLDYLTLEDSTLNELPGSQSALPSRGWSDDLSYGT 89

Query: 77  XXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                       +WGL EGL    P+   KLRLN +LNSVTRRGPF+GNS G+LAM YN 
Sbjct: 90  GTTYLTALSAGGLWGLTEGLKKTPPSAPPKLRLNAVLNSVTRRGPFLGNSAGVLAMAYNG 149

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKS 164
           IN T+G  RGKHD+VNSI +GAL G+LFKS
Sbjct: 150 INSTLGYARGKHDAVNSIVAGALSGMLFKS 179



>gi|255710879|ref|XP_002551723.1| KLTH0A06072p [Lachancea thermotolerans]
 gi|238933100|emb|CAR21281.1| KLTH0A06072p [Lachancea thermotolerans CBS 6340]
          Length = 216

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 106/188 (56%), Gaps = 12/188 (6%)

Query: 10  DYQSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLG-AVDYLRLDEQVVTP---- 60
           D     +  G DP  V++  + ++    L P +L  +AGL   V+YL L+E+ ++     
Sbjct: 21  DESKLQSTLGFDPSQVTNVSSIISTPGALDPARLHPLAGLERGVEYLDLEEEQLSTMEGS 80

Query: 61  -GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRR 117
              +PSRG  DDLC                +G  EGL    PN   KL+LNT+LN +TRR
Sbjct: 81  RSLIPSRGWTDDLCYGTGAVYLIGLGLGGSYGFFEGLRNIPPNSPGKLQLNTVLNHITRR 140

Query: 118 GPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           GPF+GN+ G+L + YN +N TI  +RGKH+S NS+A+GAL G +FKS+ GL+  G AS +
Sbjct: 141 GPFLGNNAGVLTLTYNLVNSTIDGLRGKHESANSVAAGALTGAIFKSSKGLKPMGYASGM 200

Query: 178 CAATAGTW 185
            A  A  W
Sbjct: 201 MAVAAAGW 208



>gi|45184893|ref|NP_982611.1| AAR070Cp [Ashbya gossypii ATCC 10895]
 gi|44980502|gb|AAS50435.1| AAR070Cp [Ashbya gossypii ATCC 10895]
 gi|374105810|gb|AEY94721.1| FAAR070Cp [Ashbya gossypii FDAG1]
          Length = 267

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 107/186 (57%), Gaps = 16/186 (8%)

Query: 18  FGTDPVAVSDFLARVN----LGPGQLREIAGLG-AVDYLRLDEQVVT-----PGALPSRG 67
            G DP  V++    +     L P +L  +AGL   V+YL LDE+ ++      G +PSRG
Sbjct: 80  LGFDPQQVTNVANIIATPGALDPSRLHPLAGLERGVEYLDLDEEKLSSVEGSQGLIPSRG 139

Query: 68  GFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSC 125
             DDLC                +G  EGL    PN   KL+LNT+LN +TRRGPF+GN+ 
Sbjct: 140 WTDDLCYGTGSVYLTGLGLGGAYGFFEGLRNIPPNAPGKLQLNTVLNHITRRGPFLGNNA 199

Query: 126 GILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLR----AAGTASVICAAT 181
           G+LA+ YN IN TI  +RGKHD+  SIASGA+ G LFKS+ GL+    A+G+ +++ A  
Sbjct: 200 GVLALTYNLINSTIEGLRGKHDAAGSIASGAIAGALFKSSKGLKPMYYASGSMALVAAGW 259

Query: 182 AGTWTL 187
            G  TL
Sbjct: 260 CGLKTL 265



>gi|390596715|gb|EIN06116.1| Tim17-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 215

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 105/179 (58%), Gaps = 13/179 (7%)

Query: 21  DPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT--PGA---LPSRGGFDDLCX 74
           + V  SD L +    P +L  +AGL   +DYL LD++     PGA   +PSRG  DDLC 
Sbjct: 37  EAVTASDLL-QGAFDPARLHPLAGLSDKLDYLVLDDEKTNDLPGAGTAIPSRGWSDDLCY 95

Query: 75  XXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAM 130
                          WG+ EG     P    N +LRLN+ILNSVTRRG FIGNS G+LA+
Sbjct: 96  GTGTMYLSGLALGGAWGIREG--ARRPLAVSNARLRLNSILNSVTRRGTFIGNSAGVLAL 153

Query: 131 GYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
            YN IN +I  +RGKHD++ S+++GA  G L+K TAG++ A  A+ + +A AG W+  K
Sbjct: 154 TYNAINSSIDGLRGKHDTLGSMSAGAFTGALYKCTAGVKPALAAATMVSAGAGIWSYIK 212



>gi|346319505|gb|EGX89106.1| mitochondrial import inner membrane translocase subunit tim23
           [Cordyceps militaris CM01]
          Length = 304

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 110/202 (54%), Gaps = 21/202 (10%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT 59
           S S+ TYD         T+   V  FL       P QL  +AGL    ++YL L++  ++
Sbjct: 29  SSSAVTYD--------PTEGQGVESFLQSTAFADPSQLHPLAGLNRDTLEYLSLEDSALS 80

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTIL 111
             PG    +PSRG  DDLC                WGL EG+    G  P  KLRLN  L
Sbjct: 81  DLPGGQSVIPSRGFTDDLCYGTGTTYVAGLGLGGAWGLQEGMRKSAGQPP--KLRLNATL 138

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N++TRRGPF+GNS G++A+ YN  N  IG  RGKHD+ NSIA+G L G+LFKST GLR  
Sbjct: 139 NAITRRGPFLGNSAGVVAIAYNMTNSLIGYARGKHDAANSIAAGVLSGMLFKSTRGLRPM 198

Query: 172 GTASVICAATAGTWTLAKKYFF 193
             +  I  + A TWT+A++  F
Sbjct: 199 LISGGIVGSVAATWTIARRSLF 220



>gi|321263201|ref|XP_003196319.1| mitochondrial import inner membrane translocase subunit tim23
           [Cryptococcus gattii WM276]
 gi|317462794|gb|ADV24532.1| Mitochondrial import inner membrane translocase subunit tim23,
           putative [Cryptococcus gattii WM276]
          Length = 241

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 99/165 (60%), Gaps = 9/165 (5%)

Query: 36  PGQLREIAGLGA-VDYLRLDEQVVTP-----GALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AGL   +D+L+LDE+ +         LPSRG  DDLC                
Sbjct: 76  PAKLHPLAGLSENLDFLQLDEEKLNELEGAASVLPSRGWTDDLCVGTGTTYLSGLAIGGT 135

Query: 90  WGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           WGL EG+    G++P+FKLRLN+ILN  TRRG F+GNS G+LA+ YN  N +  +IRGKH
Sbjct: 136 WGLKEGMSRPLGNNPSFKLRLNSILNGCTRRGSFMGNSLGVLAIFYNLSNSSFDAIRGKH 195

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKY 191
           D++N++A+  L G ++KSTAGLR A   + I  A A  W+  K +
Sbjct: 196 DALNAMAAAGLSGAIYKSTAGLRPALVGAGIGTAAAAGWSAFKNF 240



>gi|302687080|ref|XP_003033220.1| hypothetical protein SCHCODRAFT_10954 [Schizophyllum commune H4-8]
 gi|300106914|gb|EFI98317.1| hypothetical protein SCHCODRAFT_10954 [Schizophyllum commune H4-8]
          Length = 216

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 108/195 (55%), Gaps = 11/195 (5%)

Query: 3   SFSSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT-- 59
           +  + ++  +  P   G   V  SD L      P +L  +A LG  +DYL L++  VT  
Sbjct: 22  TLRTASFARRDGPEADGA--VTASDLL-NAAYDPTRLHPMAELGDKLDYLLLEDDKVTDL 78

Query: 60  PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHG--HSPNFKLRLNTILNSV 114
           PGA   +PSRG  DDLC               +WG+ EG        N +LR+N+ILNSV
Sbjct: 79  PGAGTAIPSRGWSDDLCYGTGTMYLGGLTLGGIWGVREGARRPLAVSNARLRINSILNSV 138

Query: 115 TRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTA 174
           TRRG FIGNS G+LA+ YN +N  I  IRGKHD + S+A+GA+ G LFK TAGL+    A
Sbjct: 139 TRRGTFIGNSAGVLALLYNGVNSAIDGIRGKHDPLGSMAAGAITGGLFKCTAGLKPTIVA 198

Query: 175 SVICAATAGTWTLAK 189
           + + +  AG W+  K
Sbjct: 199 ATVVSGAAGVWSFVK 213



>gi|320592295|gb|EFX04734.1| mitochondrial import inner membrane translocase subunit [Grosmannia
           clavigera kw1407]
          Length = 275

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/162 (43%), Positives = 98/162 (60%), Gaps = 12/162 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++Y+ +++  ++  PG   ALPSRG  DDLC               
Sbjct: 82  PTQLHPLAGLNRETLEYITMEDSALSDLPGSQSALPSRGFTDDLCYGTGITYLAALSLGG 141

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL    G  P  KLRLN++LN+VTRRGPF+GNS G++A+ YN  N  IG +RG+
Sbjct: 142 AWGLQEGLRRSAGQPP--KLRLNSVLNAVTRRGPFLGNSAGVVAIVYNCTNSYIGYLRGR 199

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           HD+ NS+ +GAL G++FKST G+R    +  I A+ A  W +
Sbjct: 200 HDAANSVLAGALSGIVFKSTRGVRPMLISGGIVASVAAAWAM 241



>gi|367004250|ref|XP_003686858.1| hypothetical protein TPHA_0H02200 [Tetrapisispora phaffii CBS 4417]
 gi|357525160|emb|CCE64424.1| hypothetical protein TPHA_0H02200 [Tetrapisispora phaffii CBS 4417]
          Length = 211

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 108/191 (56%), Gaps = 12/191 (6%)

Query: 11  YQSSPNQFGTDPVAVSDFLARVNLG----PGQLREIAGL-GAVDYLRLDEQVVTP----- 60
           ++   ++ G DP  VS+    ++ G      +L  +AGL   V+YL L+E+ ++      
Sbjct: 16  HEKETSKLGFDPEQVSNVSNIISSGTSFDASRLHPLAGLEKGVEYLDLEEEQLSAIEGSQ 75

Query: 61  GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRG 118
           G +PSRG  DDLC                +G +EG+   +P    KL+LNTILN +T+RG
Sbjct: 76  GLIPSRGWSDDLCYGTGAVYLLGLGTGGAYGFIEGVRNITPGSPGKLKLNTILNHITKRG 135

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LA+ YN IN TI S+RGKHD+  +I +GA+ G +FKS+ G +    AS + 
Sbjct: 136 PFMGNSAGVLALTYNIINSTIDSVRGKHDASGAIVAGAVTGAIFKSSKGFKPMAYASGLT 195

Query: 179 AATAGTWTLAK 189
           A  A  W+  K
Sbjct: 196 AGAAALWSGVK 206



>gi|494827526|gb|EON64476.1| hypothetical protein W97_03708 [Coniosporium apollinis CBS 100218]
          Length = 225

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 96/162 (59%), Gaps = 13/162 (8%)

Query: 21  DPVAVSDFLARVN----LGPGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGF 69
           DP    D  + +N      P  L  +AGL    +DYL L+E  ++  PG   ALPSRG  
Sbjct: 39  DPSTAQDVSSFLNDTAAFDPSALHPLAGLNQDTLDYLSLEESTLSDLPGSRSALPSRGWS 98

Query: 70  DDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP--NFKLRLNTILNSVTRRGPFIGNSCGI 127
           DDLC                WGL EGL+  S   + +LRLN +LN+VTRRGPF+GNS G+
Sbjct: 99  DDLCYGTGVSYLSALTLGGAWGLAEGLNKTSATQSPRLRLNAVLNAVTRRGPFLGNSAGV 158

Query: 128 LAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLR 169
           +A+ YN IN TIG  RGKHD+ NS+ +GA+ G +FKST G++
Sbjct: 159 IALVYNGINSTIGYYRGKHDAANSVVAGAISGAIFKSTRGIK 200



>gi|367009538|ref|XP_003679270.1| hypothetical protein TDEL_0A07270 [Torulaspora delbrueckii]
 gi|359746927|emb|CCE90059.1| hypothetical protein TDEL_0A07270 [Torulaspora delbrueckii]
          Length = 208

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 108/195 (55%), Gaps = 12/195 (6%)

Query: 12  QSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGL-GAVDYLRLDEQVVT-----PG 61
           Q      G DP  VS+    ++    L P +L  +AGL   V+YL L+E+ ++      G
Sbjct: 14  QEDNTALGFDPAQVSNVSNIISAPGVLDPSRLHPLAGLEKGVEYLDLEEEQLSTLEGSQG 73

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGP 119
            +PSRG  DDLC                +G  EGL    PN   KL+LNT+LN VTRRGP
Sbjct: 74  LIPSRGWTDDLCYGTGAVYLIGLGLGGSYGFFEGLRNIPPNSPGKLQLNTVLNHVTRRGP 133

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GN+ G+LA+ YN +N +I + RGKHD   SI +GAL G +FKS+ GL+A G +S + A
Sbjct: 134 FLGNNMGVLALTYNLVNSSIDAFRGKHDVPGSIVAGALTGAIFKSSRGLKAIGYSSAMMA 193

Query: 180 ATAGTWTLAKKYFFK 194
             A TW   KK   +
Sbjct: 194 GAAATWCGVKKTILE 208



>gi|405119974|gb|AFR94745.1| mitochondrial import inner membrane translocase subunit
           [Cryptococcus neoformans var. grubii H99]
          Length = 241

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 98/165 (59%), Gaps = 9/165 (5%)

Query: 36  PGQLREIAGLGA-VDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AGL   +D+L+LDE+ +         LPSRG  DDLC                
Sbjct: 76  PAKLHPLAGLSENLDFLQLDEEKLNDLEGAASVLPSRGWTDDLCVGTGTTYLSGLAIGGT 135

Query: 90  WGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           WG  EG+    G++P+FKLRLN+ILN  TRRG F+GNS G+LA+ YN  N +  +IRGKH
Sbjct: 136 WGFKEGMSRPLGNNPSFKLRLNSILNGCTRRGSFMGNSLGVLAIFYNISNSSFDAIRGKH 195

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKY 191
           D++N++A+  L G ++KSTAGLR A   + +  A A  W+  K +
Sbjct: 196 DALNAMAAAGLSGAIYKSTAGLRPALVGAGLGTAAAAGWSAFKNF 240



>gi|58265812|ref|XP_570062.1| mitochondrial import inner membrane translocase subunit
           [Cryptococcus neoformans var. neoformans JEC21]
 gi|134110502|ref|XP_776078.1| hypothetical protein CNBD1260 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258746|gb|EAL21431.1| hypothetical protein CNBD1260 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226295|gb|AAW42755.1| mitochondrial import inner membrane translocase subunit tim23,
           putative [Cryptococcus neoformans var. neoformans JEC21]
          Length = 241

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 98/165 (59%), Gaps = 9/165 (5%)

Query: 36  PGQLREIAGLGA-VDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AGL   +D+L+LDE+ +         LPSRG  DDLC                
Sbjct: 76  PARLHPLAGLSENLDFLQLDEEKLNDLEGAASVLPSRGWTDDLCVGTGTTYLSGLAIGGT 135

Query: 90  WGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           WGL EG+    G++P+FKLRLN+ILN  TRRG F+GNS G+LA+ YN  N +  +IRGKH
Sbjct: 136 WGLKEGMSRPLGNNPSFKLRLNSILNGCTRRGSFMGNSLGVLAIFYNISNSSFDAIRGKH 195

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKY 191
           D +N++A+  L G ++KSTAGLR A   + +  A A  W+  K +
Sbjct: 196 DVLNAMAAAGLSGAIYKSTAGLRPALVGAGLGTAAAAGWSAFKNF 240



>gi|336363824|gb|EGN92195.1| hypothetical protein SERLA73DRAFT_191443 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336380969|gb|EGO22121.1| hypothetical protein SERLADRAFT_472479 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 213

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 85/133 (63%), Gaps = 6/133 (4%)

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRR 117
           A+PSRG  DDLC               VWG+ EG     P    N +LR+N++LN+VTRR
Sbjct: 81  AIPSRGWSDDLCYGTGTMYLSGLALGGVWGVSEG--ARRPLAVSNARLRINSVLNAVTRR 138

Query: 118 GPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           G FIGNS G+LA+ YN IN TI S+RGKHD++ S+A+GAL G LFKSTAG++ A  A+  
Sbjct: 139 GTFIGNSAGVLALAYNGINSTIDSVRGKHDTIGSMAAGALTGGLFKSTAGVKPAIAAATF 198

Query: 178 CAATAGTWTLAKK 190
            +  AG W+  KK
Sbjct: 199 ISGLAGVWSYVKK 211



>gi|365758631|gb|EHN00465.1| Tim23p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 223

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 101/166 (60%), Gaps = 10/166 (6%)

Query: 38  QLREIAGLG-AVDYLRL-DEQVVT----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L DEQ+ +     G +PSRG  DDLC               V G
Sbjct: 57  RLHPLAGLDKGVEYLDLEDEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGVGGVSG 116

Query: 92  LMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
           +M+GL     +SP  KL+LNT+LN +T+RGPF+GN+ GILA+ YN +N TI ++RGKHD+
Sbjct: 117 MMQGLQNIPANSPG-KLQLNTVLNHITKRGPFLGNNAGILALSYNIVNSTIDTLRGKHDT 175

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
             S+ +GAL G LFKS+ GL+  G +SV+ AA    W   KK   +
Sbjct: 176 AGSVGAGALTGALFKSSKGLKPMGYSSVMVAAACAVWCGVKKRLLQ 221



>gi|401840942|gb|EJT43552.1| TIM23-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 223

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 101/166 (60%), Gaps = 10/166 (6%)

Query: 38  QLREIAGLG-AVDYLRL-DEQVVT----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L DEQ+ +     G +PSRG  DDLC               V G
Sbjct: 57  RLHPLAGLDKGVEYLDLEDEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGVGGVSG 116

Query: 92  LMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
           +M+GL     +SP  KL+LNT+LN +T+RGPF+GN+ GILA+ YN +N TI ++RGKHD+
Sbjct: 117 MMQGLQNIPANSPG-KLQLNTVLNHITKRGPFLGNNAGILALSYNIVNSTIDTLRGKHDA 175

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
             S+ +GAL G LFKS+ GL+  G +SV+ AA    W   KK   +
Sbjct: 176 AGSVGAGALTGALFKSSKGLKPMGYSSVMVAAACAVWCGVKKRLLQ 221



>gi|395331757|gb|EJF64137.1| Tim17-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 179

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 95/164 (57%), Gaps = 12/164 (7%)

Query: 36  PGQLREIAGL-GAVDYLRLDEQVVTP-----GALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AG+   +DYL+LD+   +      GA+PSRG  DDLC               V
Sbjct: 15  PSKLHPLAGIEDKLDYLQLDDDKTSDLPGAGGAIPSRGWSDDLCYGTGTMYLSGLALGGV 74

Query: 90  WGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
           WGL EG     P    N +LR+N+ILNSVTRRG FIGNS G LA+ YN  N +I   RG 
Sbjct: 75  WGLREG--ARRPLAVSNARLRINSILNSVTRRGTFIGNSAGCLALVYNAFNSSIDHFRGM 132

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
           HD+  S+A+GAL G L+KSTAG++ A  A+   +  AG W+  K
Sbjct: 133 HDTYGSMAAGALTGALYKSTAGVKPALAAATFISGLAGLWSYVK 176



>gi|392589867|gb|EIW79197.1| Tim17-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 215

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 100/165 (60%), Gaps = 12/165 (7%)

Query: 36  PGQLREIAGLG-AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +A LG  +DYL LD+  V   PGA   +PSRG  DDLC                
Sbjct: 51  PAKLHPMAQLGDQLDYLVLDDDKVNDLPGADTAIPSRGWSDDLCYGTGTMYLGGLALGGA 110

Query: 90  WGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
           WG+ EG     P    N +LRLN++LN+VTRRG FIGNS G+LA+ YN +N +I + RGK
Sbjct: 111 WGVSEG--ARRPLAVSNARLRLNSVLNAVTRRGTFIGNSAGVLALVYNGVNSSIDAWRGK 168

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           HD+  S+A+GA+ G LFKSTAG++ A  A+ + +  AG W+  KK
Sbjct: 169 HDTAGSMAAGAVTGALFKSTAGVKPAFVAATVVSGMAGLWSYVKK 213



>gi|169849935|ref|XP_001831666.1| mitochondrial import inner membrane translocase subunit tim23
           [Coprinopsis cinerea okayama7#130]
 gi|116507304|gb|EAU90199.1| mitochondrial import inner membrane translocase subunit tim23
           [Coprinopsis cinerea okayama7#130]
          Length = 209

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 102/179 (56%), Gaps = 13/179 (7%)

Query: 22  PVAVSDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVT---PG---ALPSRGGFDDLCXX 75
           PV  +D L      P +L  +A +G      L +   T   PG   A+PSRG  DDLC  
Sbjct: 32  PVTSADLLMAA-YDPTKLHPLAEIGDKLDYLLLDDEKTNELPGSGTAIPSRGWSDDLCYG 90

Query: 76  XXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAMG 131
                        +WG+ EG     P    N +LR+N+ILNSVTRRG FIGNS G++A+ 
Sbjct: 91  TGTMYLSGLALGGIWGVREG--ARRPLAVSNARLRINSILNSVTRRGTFIGNSAGVMALM 148

Query: 132 YNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           YN IN +I + RGKHD+  S+ +GAL GLLFKST+G+R A  ++ + +  AG W+L KK
Sbjct: 149 YNGINSSIDAFRGKHDTAGSMTAGALTGLLFKSTSGVRPAIVSASVVSGMAGIWSLVKK 207



>gi|241952300|ref|XP_002418872.1| membrane import machinery protein, putative; mitochondrial import
           inner membrane translocase subunit, putative;
           mitochondrial inner membrane protein, putative;
           mitochondrial protein import protein, putative [Candida
           dubliniensis CD36]
 gi|223642211|emb|CAX44178.1| membrane import machinery protein, putative [Candida dubliniensis
           CD36]
          Length = 222

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 110/199 (55%), Gaps = 13/199 (6%)

Query: 7   NTYDYQSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLGA-VDYLRLDEQVV--- 58
           N  D  +     G DP  V+D    ++    +   +L  +AGL   ++YL L+E+ +   
Sbjct: 22  NNNDQSTIKQTLGFDPKEVTDVNTIISTPGAISASRLHPLAGLDKGIEYLDLEEEQLNTV 81

Query: 59  --TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTILNS 113
             + G +PSR   DDLC               ++G  +GL      S  FK++LN ILN+
Sbjct: 82  EGSKGLIPSRSWTDDLCYGTGAIYLLGLGIGGLYGFQQGLKTLPNSSIPFKVKLNHILNN 141

Query: 114 VTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGT 173
           +T+RGPF+GN+ G+LA+ YN I+ TI  IR KHD +NS+ SGAL G LFKS+AGL+    
Sbjct: 142 ITKRGPFLGNNAGVLALTYNLIDSTIDGIREKHDDLNSVISGALAGALFKSSAGLKPMTY 201

Query: 174 ASVICAATAGTWTLAKKYF 192
           +SV+ A  AG W   K++ 
Sbjct: 202 SSVMMAGVAGIWCGLKRFL 220



>gi|254581666|ref|XP_002496818.1| ZYRO0D08844p [Zygosaccharomyces rouxii]
 gi|186703676|emb|CAQ43284.1| Mitochondrial import inner membrane translocase subunit TIM23
           [Zygosaccharomyces rouxii]
 gi|186703887|emb|CAQ43572.1| Mitochondrial import inner membrane translocase subunit TIM23
           [Zygosaccharomyces rouxii]
 gi|238939710|emb|CAR27885.1| ZYRO0D08844p [Zygosaccharomyces rouxii]
          Length = 214

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 117/200 (58%), Gaps = 15/200 (7%)

Query: 5   SSNTYDYQSSPNQ-FGTDPVAVSDFLARVNLGPG-----QLREIAGLG-AVDYLRLDEQV 57
             N+ +  S+  Q  G DP  +++ ++ V   PG     +L  +AGL   V++L L+E+ 
Sbjct: 12  QKNSQEQDSNLEQTLGFDPSQLTN-VSNVIQTPGALDVNKLHPLAGLDKGVEFLDLEEEQ 70

Query: 58  VT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTI 110
           ++      G +PSRG  DDLC                +G  EGL    PN   KL+LNT+
Sbjct: 71  LSTMEGSQGLIPSRGWGDDLCYGTGAVYLIGLGSGGAYGFFEGLRNIPPNSPGKLQLNTV 130

Query: 111 LNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRA 170
           LN VTRRGPF+GN+ G+LAM YN IN +I S RGKHD+V SI +GA+ G +F+S+ GL+ 
Sbjct: 131 LNHVTRRGPFLGNNMGVLAMMYNLINSSIDSYRGKHDTVGSIGAGAITGAIFRSSRGLKP 190

Query: 171 AGTASVICAATAGTWTLAKK 190
            G AS + A  AG+W+L KK
Sbjct: 191 MGYASAMMAGAAGSWSLVKK 210



>gi|322699579|gb|EFY91339.1| mitochondrial import inner membrane translocase subunit tim23
           [Metarhizium acridum CQMa 102]
          Length = 228

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 111/198 (56%), Gaps = 16/198 (8%)

Query: 6   SNTYDYQSSPNQFGTDPVA---VSDFLARVNLG-PGQLREIAGLG--AVDYLRLDEQVVT 59
           ++ +D  +  +Q   DP     V  FL       P QL  +AGL    ++YL L++  ++
Sbjct: 22  THAFDAPAPSSQTSFDPSQGQGVEAFLQSSTFADPSQLHPLAGLNKDTLEYLTLEDSALS 81

Query: 60  --PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH---GHSPNFKLRLNTIL 111
             PG    LPSRG  DDLC                WGL +GL    G  P  KLR+N IL
Sbjct: 82  ELPGGQSVLPSRGFTDDLCYGTGITYLTALSIGGAWGLQDGLKKSVGQPP--KLRMNAIL 139

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N +TRRGPF+GNS G++A+ YN IN  IGS+RGKHD+ N++ SG L G++FKST G+R+ 
Sbjct: 140 NGMTRRGPFLGNSAGVVAIVYNCINSLIGSLRGKHDAANTVVSGFLSGVVFKSTRGVRSM 199

Query: 172 GTASVICAATAGTWTLAK 189
             +  +  + AG W +++
Sbjct: 200 MISGGVVGSVAGVWAVSQ 217



>gi|402216502|gb|EJT96589.1| Tim17-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 224

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 99/178 (55%), Gaps = 8/178 (4%)

Query: 20  TDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT--PG---ALPSRGGFDDLC 73
           ++ +  +D L+  +    +L  +A LG  +DYL L++  V   PG   ALPSRG  DDLC
Sbjct: 43  SEALTATDLLSAGSFDAARLHPMAQLGDKLDYLLLEDDKVNQLPGSGTALPSRGWSDDLC 102

Query: 74  XXXXXXXXXXXXXXXVWGLMEGLHG--HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMG 131
                          +WG  EG        N +LR+N+ILNSVTRRG FIGNS G++A+ 
Sbjct: 103 YGTGTTYLSGLAIGGLWGFREGAIRPLAVSNTRLRINSILNSVTRRGTFIGNSAGVMALA 162

Query: 132 YNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
           YN IN  I   RGKHD+  S+A+G L G L+KSTAG+R A   + +    AG W   K
Sbjct: 163 YNAINSCIDGYRGKHDTWGSLAAGGLTGALYKSTAGVRPALAGAAVMTGVAGIWCYIK 220



>gi|340959433|gb|EGS20614.1| hypothetical protein CTHT_0024480 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 239

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 97/167 (58%), Gaps = 12/167 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++Y+ L++  ++  PG+   LPSRG  DDLC               
Sbjct: 62  PTQLHPLAGLNKDTLEYITLEDSALSDLPGSQSVLPSRGFTDDLCYGTGTTYLIGLTIGG 121

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            WGL EGL       P  KLRLN++LNSVTRRGPF+GNS G++A+ YN IN  +G +RGK
Sbjct: 122 AWGLQEGLKRSVDQPP--KLRLNSVLNSVTRRGPFLGNSAGVVAIVYNCINSYLGHLRGK 179

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYF 192
           +D+ N+I +G L G++FKST G R    +  I    AG W + +  F
Sbjct: 180 NDAANTILAGVLSGIIFKSTKGPRQMLISGGIVGTVAGCWAIFRSAF 226



>gi|68482810|ref|XP_714631.1| hypothetical protein CaO19.8941 [Candida albicans SC5314]
 gi|68483002|ref|XP_714535.1| hypothetical protein CaO19.1361 [Candida albicans SC5314]
 gi|46436112|gb|EAK95480.1| hypothetical protein CaO19.1361 [Candida albicans SC5314]
 gi|46436215|gb|EAK95581.1| hypothetical protein CaO19.8941 [Candida albicans SC5314]
 gi|238883847|gb|EEQ47485.1| mitochondrial import inner membrane translocase subunit TIM23
           [Candida albicans WO-1]
          Length = 218

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 110/194 (56%), Gaps = 13/194 (6%)

Query: 12  QSSPNQ-FGTDPVAVSDFLARVN----LGPGQLREIAGLGA-VDYLRLDEQVV-----TP 60
           QSS  Q  G DP  V+D    ++    +   +L  +AGL   ++YL L+E+ +     + 
Sbjct: 23  QSSIKQTLGFDPKEVADVNTIISTPGAISASRLHPLAGLDKGIEYLDLEEEQLNTVEGSK 82

Query: 61  GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHG--HSPNFKLRLNTILNSVTRRG 118
           G +PSR   DDLC               ++G  +G+     S   K++LN ILN++T+RG
Sbjct: 83  GLIPSRSWTDDLCYGTGAVYLLGLGIGGLYGFQQGIKTLPESAPSKVKLNHILNNITKRG 142

Query: 119 PFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVIC 178
           PF+GNS G+LA+ YN I+ TI  IR KHD +NS+ +GAL G LFKS+AGL+    +SV+ 
Sbjct: 143 PFLGNSAGVLALTYNLIDSTIDGIREKHDDLNSVTAGALAGALFKSSAGLKPMAYSSVMM 202

Query: 179 AATAGTWTLAKKYF 192
           A  AG W   K++ 
Sbjct: 203 AGAAGIWCGLKRFL 216



>gi|358365876|dbj|GAA82498.1| mitochondrial import inner membrane translocase subunit TIM23
           [Aspergillus kawachii IFO 4308]
          Length = 202

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 96/167 (57%), Gaps = 9/167 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVV--TPGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    +DY+ L++  +  TPG+   LPSRG  DDLC               
Sbjct: 36  PSQLHPLAGLNQDTLDYITLEDSALDQTPGSRSVLPSRGWSDDLCYGTGTTYLAGLTLGG 95

Query: 89  VWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
            WGL EGL     +   K+RLN  LNS+TRRGPF+GNS G++AM YN  N  +G  RGKH
Sbjct: 96  AWGLAEGLKKTPVTAPPKIRLNGALNSITRRGPFLGNSAGVVAMVYNGFNSGLGYARGKH 155

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           D+ NSI +GAL G++FKST GL+    +  I A  AG WT+  K   
Sbjct: 156 DAANSIVAGALSGMVFKSTRGLKPMVISGGIVAGIAGGWTVLSKALL 202



>gi|317027421|ref|XP_001399276.2| import inner membrane translocase subunit tim23 [Aspergillus niger
           CBS 513.88]
 gi|350634279|gb|EHA22641.1| hypothetical protein ASPNIDRAFT_52123 [Aspergillus niger ATCC 1015]
          Length = 202

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 96/167 (57%), Gaps = 9/167 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVV--TPGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    +DY+ L++  +  TPG+   LPSRG  DDLC               
Sbjct: 36  PSQLHPLAGLNQDTLDYITLEDSALDQTPGSRSVLPSRGWSDDLCYGTGTTYLAGLTLGG 95

Query: 89  VWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
            WGL EGL     +   K+RLN  LNS+TRRGPF+GNS G++AM YN  N  +G  RGKH
Sbjct: 96  AWGLAEGLKKTPVTAPPKIRLNGALNSITRRGPFLGNSAGVVAMVYNGFNSGLGYARGKH 155

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           D+ NSI +GAL G++FKST GL+    +  I A  AG WT+  K   
Sbjct: 156 DAANSIVAGALSGMVFKSTRGLKPMVISGGIVAGIAGGWTVLSKAIL 202



>gi|50310665|ref|XP_455354.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644490|emb|CAG98062.1| KLLA0F06050p [Kluyveromyces lactis]
          Length = 219

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 105/180 (58%), Gaps = 12/180 (6%)

Query: 18  FGTDPVAVSDFLARVN----LGPGQLREIAGLG-AVDYLRLDEQVVT-----PGALPSRG 67
            G DP ++S+    ++    L P QL  +AGL   V+Y+ L+E+ ++      G +PSRG
Sbjct: 32  LGFDPSSISNVSNVISVPGGLSPSQLHPLAGLERGVEYMDLEEEQLSSMEGSQGLIPSRG 91

Query: 68  GFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSC 125
             DDLC                +G +EGL    PN   KL+LNT+LN +TRRGPF+GN+ 
Sbjct: 92  WTDDLCYGTGAVYLVGLGLGGSYGFIEGLKNIPPNSPGKLQLNTVLNHITRRGPFLGNNA 151

Query: 126 GILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           G+LA+ YN IN  I S RGKHD   S+A+GAL G +F+S+ GL+  G AS + AA A  W
Sbjct: 152 GVLALTYNLINSVIDSFRGKHDVAGSVAAGALTGAIFRSSRGLKPMGYASALMAAAAAGW 211



>gi|186703661|emb|CAQ43270.1| Mitochondrial import inner membrane translocase subunit TIM23
           [Zygosaccharomyces rouxii]
          Length = 215

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 115/200 (57%), Gaps = 15/200 (7%)

Query: 5   SSNTYDYQSSPNQ-FGTDPVAVSDFLARVNLGPG-----QLREIAGLG-AVDYLRLDEQV 57
             N+ +  S   Q  G DP  +++ ++ V   PG     +L  +AGL   V++L L+E+ 
Sbjct: 13  QKNSQEQDSKWEQTLGFDPSQLTN-VSNVIQTPGALDVNKLHPLAGLDKGVEFLDLEEEQ 71

Query: 58  VT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTI 110
           ++      G +PSRG  DDLC                +G  EGL    PN   KL+LNT+
Sbjct: 72  LSTMEGSQGLIPSRGWGDDLCYGTGAVYLIGLGSGGAYGFFEGLRNIPPNSPGKLQLNTV 131

Query: 111 LNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRA 170
           LN VTRRGPF+GN+ G+LAM YN IN +I S RGKHD+  S+ +GA+ G +F+S+ GL+ 
Sbjct: 132 LNHVTRRGPFLGNNMGVLAMMYNLINSSIDSYRGKHDTAGSVGAGAITGAIFRSSRGLKP 191

Query: 171 AGTASVICAATAGTWTLAKK 190
            G AS + A  AG+W+L KK
Sbjct: 192 MGYASAMMAGAAGSWSLVKK 211



>gi|392565580|gb|EIW58757.1| mitochondrial import inner membrane translocase subunit tim23
           [Trametes versicolor FP-101664 SS1]
          Length = 199

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 83/133 (62%), Gaps = 6/133 (4%)

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRR 117
           A+PSRG  DDLC               VWGL EG     P    N +LR+N+ILNSVTRR
Sbjct: 67  AIPSRGWSDDLCYGTGTMYLSGLALGGVWGLREG--ARRPLAVSNARLRINSILNSVTRR 124

Query: 118 GPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           G FIGNS G LA+ YN  N +I + RGKHD+  S+A+GAL G L+KSTAG++ A  A+ +
Sbjct: 125 GTFIGNSAGCLALAYNAFNSSIDAFRGKHDTYGSMAAGALTGALYKSTAGVKPALAAASV 184

Query: 178 CAATAGTWTLAKK 190
            A +AG W+  K+
Sbjct: 185 IAGSAGLWSYVKR 197



>gi|344230306|gb|EGV62191.1| mitochondrial import i [Candida tenuis ATCC 10573]
          Length = 208

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 114/200 (57%), Gaps = 12/200 (6%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSD---FLARVNLGPGQ-LREIAGLG-AVDYLRLDEQVVT 59
           S  T ++Q   +  G D   VS+   FL +  L   Q L  +AGL   ++YL L+E+ + 
Sbjct: 8   SPQTQEHQGESSTLGFDAKEVSNISSFLGQPGLFDSQKLHPLAGLDRGIEYLDLEEEQLN 67

Query: 60  -----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILN 112
                 G +PSR   DDLC                +G  EGL     N   +L+LNT+LN
Sbjct: 68  TVEGAQGLIPSRNWTDDLCYGTGAVYLLGLGVGGAYGFQEGLQNLPANSSSRLKLNTVLN 127

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
            +T+RGPF+GNS G+LA+ YN I+ ++ ++RGKHD +NS+A+GAL G LF+S+AG+R  G
Sbjct: 128 HITKRGPFLGNSAGVLALTYNLIDSSLDAVRGKHDDLNSVAAGALAGALFRSSAGVRPMG 187

Query: 173 TASVICAATAGTWTLAKKYF 192
            ++VI AA AG W   K+  
Sbjct: 188 YSTVIMAAAAGAWCGIKRVL 207



>gi|71020811|ref|XP_760636.1| hypothetical protein UM04489.1 [Ustilago maydis 521]
 gi|46100138|gb|EAK85371.1| hypothetical protein UM04489.1 [Ustilago maydis 521]
          Length = 254

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 93/179 (51%), Gaps = 11/179 (6%)

Query: 26  SDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPG-------ALPSRGGFDDLCXXXXX 78
           +  L   +L  G L  +AGLG  D   LD     P        A+PSRG  DDLC     
Sbjct: 76  ASLLGDTSLDLGSLSPLAGLGKDDLEYLDLTDGAPSSMEGARTAVPSRGWSDDLCYGTGT 135

Query: 79  XXXXXXXXXXVWGLMEGLHG----HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                     + G  EGL       +P F+LRLN +LN VTRRG F GNS G++A+ YN 
Sbjct: 136 TYLSGLAIGGLLGAREGLFRPLGIDNPTFRLRLNAVLNQVTRRGSFFGNSAGVIALIYNL 195

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           ++ +I  +RGKHD   ++A+G + G LFK TAG+R    AS I    A TWTLAK+   
Sbjct: 196 VDASIDGVRGKHDIYGAVAAGGVSGALFKCTAGVRLMAVASTIMMGAAATWTLAKQSLL 254



>gi|501305814|dbj|GAC94936.1| hypothetical protein PHSY_002509 [Pseudozyma hubeiensis SY62]
          Length = 261

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 93/176 (52%), Gaps = 11/176 (6%)

Query: 26  SDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPG-------ALPSRGGFDDLCXXXXX 78
           +  L   +L  G L  +AGLG  D   LD     P        A+PSRG  DDLC     
Sbjct: 83  ASLLGDTSLNLGALSPLAGLGKDDLEYLDLTDGAPSSMEGARTAVPSRGWSDDLCYGTGT 142

Query: 79  XXXXXXXXXXVWGLMEG----LHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                     + G  EG    L   +P F+LRLN +LN VTRRG F GNS G++A+ YN 
Sbjct: 143 TYLSGLAIGGLLGAREGFFRPLGVDNPTFRLRLNAVLNQVTRRGAFFGNSAGVVALIYNL 202

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           ++ +I  +RGKHD   ++A+G L G LFK TAG+R    AS I    A TWT+AK+
Sbjct: 203 VDASIDGVRGKHDIYGAVAAGGLSGALFKCTAGVRPMAVASTIMMGAAATWTMAKQ 258



>gi|409081578|gb|EKM81937.1| hypothetical protein AGABI1DRAFT_112126 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426196816|gb|EKV46744.1| hypothetical protein AGABI2DRAFT_193372 [Agaricus bisporus var.
           bisporus H97]
          Length = 213

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 109/194 (56%), Gaps = 17/194 (8%)

Query: 10  DYQS---SPNQFGTDPVAVSDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVT---PGA- 62
           DY S   +P+     P A    +A  +  P +L  +AGLG      L +   T   PGA 
Sbjct: 22  DYASPGDAPSNLEHAPTANDLLMAAYD--PAKLHPLAGLGDKLDYLLLDDDKTSDLPGAG 79

Query: 63  --LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTR 116
             +PSRG  DDLC               +WGL EG     P    N +LR+N++LNS+TR
Sbjct: 80  TAIPSRGWSDDLCYGTGTMYLSGLAVGGLWGLREG--ARRPLAVSNTRLRINSVLNSITR 137

Query: 117 RGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASV 176
           RG FIGNS G++A+ YN IN +I + RGKHD++ S+A+GA+ G L+KSTAG++    A+ 
Sbjct: 138 RGTFIGNSAGVMALVYNAINSSIDAARGKHDTLGSMAAGAVTGALYKSTAGVKPTIVAAT 197

Query: 177 ICAATAGTWTLAKK 190
           + +  AG W++ KK
Sbjct: 198 VVSGMAGVWSIVKK 211



>gi|146422995|ref|XP_001487431.1| hypothetical protein PGUG_00808 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146388552|gb|EDK36710.1| hypothetical protein PGUG_00808 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 208

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 109/192 (56%), Gaps = 12/192 (6%)

Query: 13  SSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLG-AVDYLRLDEQVVT-----PGA 62
           ++ N  G DP  VSD  + +     L   QL  +AGL   ++YL L+E+ +T      G 
Sbjct: 16  AASNTLGFDPAQVSDVSSIIQTPGVLNTAQLHPLAGLDKGIEYLDLEEEQLTTVQGAQGL 75

Query: 63  LPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPF 120
           +PSR   DDLC                +G+ EGL    P    +L+LNT+LN +T+RGPF
Sbjct: 76  IPSRNWTDDLCYGTGAVYLLGLGIGGAYGMQEGLRNLPPQATPRLQLNTVLNHITKRGPF 135

Query: 121 IGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAA 180
           +GNS G+LA+ YN I+ ++ ++R KHD  NSIA+GAL G LF+S+AGL+  G ++ + A 
Sbjct: 136 LGNSAGVLALTYNLIDSSLDALREKHDDANSIAAGALAGALFRSSAGLKPMGYSTALMAG 195

Query: 181 TAGTWTLAKKYF 192
            AG W   K+  
Sbjct: 196 AAGAWCGLKRLL 207



>gi|392575491|gb|EIW68624.1| hypothetical protein TREMEDRAFT_23453, partial [Tremella
           mesenterica DSM 1558]
          Length = 167

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 95/163 (58%), Gaps = 9/163 (5%)

Query: 36  PGQLREIAGLGA-VDYLRLDEQVVTP-----GALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +A LG  +D+L L+E  +         LPSRG  DDLC               +
Sbjct: 5   PKKLHPLAELGDNLDFLTLEEDKLQDLGGGISVLPSRGWTDDLCVGTGTTYLSGLALGGM 64

Query: 90  WGLMEGL---HGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
           WG  EGL    G+ P+FKLRLN++LN  TRRG F+GNS G+LA+ YN  N ++ +IRGKH
Sbjct: 65  WGFREGLVRPLGNKPSFKLRLNSVLNGCTRRGSFMGNSLGVLAIFYNLSNSSLDAIRGKH 124

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
           D  N++ + AL G ++K+TAG+R A   + +  A AG W+  K
Sbjct: 125 DVFNALGAAALSGGIYKATAGVRPAMVGAGLMTAAAGAWSFFK 167



>gi|444321586|ref|XP_004181449.1| hypothetical protein TBLA_0F03960 [Tetrapisispora blattae CBS 6284]
 gi|387514493|emb|CCH61930.1| hypothetical protein TBLA_0F03960 [Tetrapisispora blattae CBS 6284]
          Length = 203

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 92/154 (59%), Gaps = 7/154 (4%)

Query: 48  VDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPN 102
           ++YL LD++ ++      G +PSRG  DDLC                 GL++GL   + N
Sbjct: 50  IEYLDLDDEKLSTVQGSQGIIPSRGWSDDLCYGTGSVYLLGLGFGGAMGLIDGLSSINRN 109

Query: 103 F--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGL 160
           +  KL+LNTILNS+T+RGP  GN+ G+LAM YN IN ++ S RGKHDS+ S+ SGAL G 
Sbjct: 110 YSGKLKLNTILNSITKRGPHWGNNAGVLAMTYNLINSSLDSYRGKHDSMGSVVSGALTGA 169

Query: 161 LFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           +FKS+ G++    AS + A  AG W   KK   +
Sbjct: 170 IFKSSKGVKPMVIASGLTAGAAGLWCGVKKQILE 203



>gi|409040929|gb|EKM50415.1| hypothetical protein PHACADRAFT_263691 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 211

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 12/165 (7%)

Query: 36  PGQLREIAGL-GAVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AG+   +DYL L++   +  PG   A+PSRG  DDLC               +
Sbjct: 47  PTKLHPMAGIEDKLDYLLLEDDKTSDLPGSGTAIPSRGWSDDLCYGTGTMYLSGLALGGL 106

Query: 90  WGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
           WGL EG     P    N +LR+N +LNSVTRRG F+GNS G+LA+ YN IN TI  +RGK
Sbjct: 107 WGLREG--ARKPLAVSNARLRINAVLNSVTRRGTFVGNSAGVLALVYNGINSTIDHVRGK 164

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           HD++ S+A+GA  G L+KSTAG+R A  A+   +  AG W+  K+
Sbjct: 165 HDTLGSMAAGAFTGALYKSTAGVRPALVAATFISGMAGVWSYVKR 209



>gi|134056178|emb|CAK96353.1| unnamed protein product [Aspergillus niger]
          Length = 250

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 94/160 (58%), Gaps = 9/160 (5%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVV--TPGA---LPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    +DY+ L++  +  TPG+   LPSRG  DDLC               
Sbjct: 36  PSQLHPLAGLNQDTLDYITLEDSALDQTPGSRSVLPSRGWSDDLCYGTGTTYLAGLTLGG 95

Query: 89  VWGLMEGLHGH--SPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKH 146
            WGL EGL     +   K+RLN  LNS+TRRGPF+GNS G++AM YN  N  +G  RGKH
Sbjct: 96  AWGLAEGLKKTPVTAPPKIRLNGALNSITRRGPFLGNSAGVVAMVYNGFNSGLGYARGKH 155

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           D+ NSI +GAL G++FKST GL+    +  I A  AG WT
Sbjct: 156 DAANSIVAGALSGMVFKSTRGLKPMVISGGIVAGIAGGWT 195



>gi|363748917|ref|XP_003644676.1| hypothetical protein Ecym_2106 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888309|gb|AET37859.1| Hypothetical protein Ecym_2106 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 211

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 106/187 (56%), Gaps = 14/187 (7%)

Query: 16  NQFGTDPVAVSDFLARVNLGPG-----QLREIAGLG-AVDYLRLDEQVVT-----PGALP 64
           +  G DP  V++ +A +   PG     +L  +AGL   V+YL L+++ ++      G +P
Sbjct: 23  DTLGFDPNQVTN-VANIIGTPGVLDVSRLHPLAGLERGVEYLDLEDEKLSNMEGSQGLIP 81

Query: 65  SRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIG 122
           SRG  DDLC                +G +EGL    P    KL+LNT+LN VTRRGPF+G
Sbjct: 82  SRGWTDDLCYGTGAVYLTGLGLGGTYGFLEGLKNIPPKSPGKLQLNTVLNHVTRRGPFLG 141

Query: 123 NSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATA 182
           N+ G+LA+ YN +N TI S RGKHD+V S+ +GAL G +FKS+ GL+  G AS      A
Sbjct: 142 NNAGVLALVYNLVNSTIASFRGKHDTVGSMTAGALSGAIFKSSKGLKPMGYASGTMMLAA 201

Query: 183 GTWTLAK 189
             W+  K
Sbjct: 202 AGWSSVK 208



>gi|459371641|gb|EMG49361.1| Mitochondrial import inner membrane translocase subunit TIM23
           [Candida maltosa Xu316]
          Length = 210

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 107/200 (53%), Gaps = 16/200 (8%)

Query: 5   SSNTYDYQSSPNQF------GTDPVAVSDFLARVNLGPGQLREIAGL-GAVDYLRLDEQV 57
           S NT   Q    Q       G DP  +SD      +    L  ++GL   ++YL L+E+ 
Sbjct: 9   SENTEQKQQESEQLKIQQTLGFDPREISD--VNTIISKSHLHPLSGLEKGIEYLDLEEEK 66

Query: 58  V-----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTI 110
           +     + G +PSR   DDLC               +WG  EG+     N   K++LN +
Sbjct: 67  LNTVEGSKGLIPSRSWTDDLCYGTGAVYLLGLGVGGLWGFQEGVRTIPENSPGKVKLNHL 126

Query: 111 LNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRA 170
           LN++T+RGPF+GNS G+LA+ YN I+ TI  +R KHD +NS+ +GAL G LF+S+AG++ 
Sbjct: 127 LNNITKRGPFLGNSAGVLALTYNLIDSTIDGVREKHDDLNSVVAGALAGALFRSSAGIKP 186

Query: 171 AGTASVICAATAGTWTLAKK 190
              +SV+ A  AG W   K+
Sbjct: 187 MAYSSVMMAGAAGIWCGLKR 206



>gi|393240514|gb|EJD48040.1| Tim17-domain-containing protein [Auricularia delicata TFB-10046
           SS5]
          Length = 209

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 86/145 (59%), Gaps = 6/145 (4%)

Query: 53  LDEQVVTPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLN 108
           ++E      ALPSRG  DDLC               +WGL EG     P    N +LRLN
Sbjct: 67  INEIAGANSALPSRGWSDDLCYGTGTTYLAGLSIGGLWGLREG--ARRPLAVSNSRLRLN 124

Query: 109 TILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGL 168
           +ILNS+TRRG ++GNS G+LA+ YN IN +I + RGKHD+  S+ +GA  G L+K TAG+
Sbjct: 125 SILNSITRRGSWMGNSAGVLALVYNGINSSIEAFRGKHDAYGSMGAGAATGALYKCTAGV 184

Query: 169 RAAGTASVICAATAGTWTLAKKYFF 193
           R   TAS+I  A AGTW+  K+   
Sbjct: 185 RPMLTASLIMTAAAGTWSAFKRNLL 209



>gi|399172309|emb|CCE26994.1| probable TIM23 translocase [Claviceps purpurea 20.1]
          Length = 234

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 100/168 (59%), Gaps = 12/168 (7%)

Query: 36  PGQLREIAGLG--AVDYLRLDEQVVT--PG---ALPSRGGFDDLCXXXXXXXXXXXXXXX 88
           P QL  +AGL    ++YL L++  ++  PG    LPSRG  DDLC               
Sbjct: 57  PSQLHPLAGLNKDTLEYLTLEDSALSALPGGQSVLPSRGFTDDLCYGTGITYLAGLSLGG 116

Query: 89  VWGLMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
           +WGL +GL       P  KLR+N ILN +TRRGPF+GNS G++A+ YN IN +IG +RGK
Sbjct: 117 LWGLKDGLQKSVAQPP--KLRMNAILNGMTRRGPFLGNSAGVVAIVYNCINSSIGYLRGK 174

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           HD+ N++A+G L G++FKST G R+   +  +  + A  W + ++ FF
Sbjct: 175 HDAANTVAAGVLSGMVFKSTRGGRSMLISGGVVGSVAAAWAIVRRSFF 222



>gi|170105098|ref|XP_001883762.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164641397|gb|EDR05658.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 218

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 82/133 (61%), Gaps = 6/133 (4%)

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRR 117
           A+PSRG  DDLC                WG+ EG     P    N +LRLN+ILNSVTRR
Sbjct: 86  AVPSRGWSDDLCYGTGTMYLSGLALGGAWGVREG--ASRPLAVSNSRLRLNSILNSVTRR 143

Query: 118 GPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           G FIGNS G+LA+ YN +N +I + RGKHD + S+ +GAL G L+KSTAG++ A  A+ +
Sbjct: 144 GTFIGNSAGVLALVYNGVNSSIDAFRGKHDMLGSMTAGALTGALYKSTAGVKPAIAAATV 203

Query: 178 CAATAGTWTLAKK 190
            +  AG W+  KK
Sbjct: 204 ISGMAGIWSYVKK 216



>gi|388583708|gb|EIM24009.1| Tim17-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 211

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVTRRGP 119
           ALPSRG  DDLC               +WG+ EG++    +P  +LR+N ILNSVT+RG 
Sbjct: 78  ALPSRGWTDDLCYGVGTTYVSGLGIGGLWGIREGMNKKLAAPVTRLRINAILNSVTKRGS 137

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           FIGNS G+LA+ YN  N ++ SIRGKHD +NS+ +GA+ G LFKSTAGLR    ++ I A
Sbjct: 138 FIGNSGGVLALVYNISNSSLDSIRGKHDVLNSMGAGAISGALFKSTAGLRPMAISAGILA 197

Query: 180 ATAGTWTLAKKYFF 193
           ++AG WTL K+   
Sbjct: 198 SSAGGWTLFKRTIL 211



>gi|403413659|emb|CCM00359.1| predicted protein [Fibroporia radiculosa]
          Length = 210

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 99/180 (55%), Gaps = 13/180 (7%)

Query: 21  DPVAVSDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVT---PG---ALPSRGGFDDLCX 74
           D V  SD L      P +L  +AGL       L +   T   PG   A+PSRG  DDL  
Sbjct: 32  DAVTASDLLLGA-FDPSKLHPMAGLEDKLDYLLLDDDKTSDLPGSSTAIPSRGWSDDLSY 90

Query: 75  XXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRRGPFIGNSCGILAM 130
                         VWGL EG     P    N +LR+N+ILNSVTRRG FIGNS G+LA+
Sbjct: 91  GTGTMYLSGLALGGVWGLREG--ARRPLAVSNARLRINSILNSVTRRGTFIGNSAGVLAL 148

Query: 131 GYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
            YN +N +I  IRGKHD + S+A+G L G L+KSTAG++ A  A+   +A AG W+  K+
Sbjct: 149 VYNGLNSSIDGIRGKHDILGSMAAGGLTGALYKSTAGVKPALAAATFVSALAGLWSYVKR 208



>gi|365991543|ref|XP_003672600.1| hypothetical protein NDAI_0K01660 [Naumovozyma dairenensis CBS 421]
 gi|343771376|emb|CCD27357.1| hypothetical protein NDAI_0K01660 [Naumovozyma dairenensis CBS 421]
          Length = 220

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 107/185 (57%), Gaps = 10/185 (5%)

Query: 18  FGTDPVAVSDFLARVNLGPGQLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDD 71
           F T+P+  ++    V+  P +L  +AGL   V+YL L+E+ ++      G +PSRG  DD
Sbjct: 38  FDTNPL--TNVFNNVSFDPARLHPLAGLDKGVEYLDLEEEQLSTLEGSQGLIPSRGWTDD 95

Query: 72  LCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILA 129
           LC                 G ++GL    PN   KL+LNTILNS+T+RGPFIGN+ GILA
Sbjct: 96  LCYGTGAVYLLGLGIGGFSGFIQGLKNIPPNSPGKLQLNTILNSITKRGPFIGNNAGILA 155

Query: 130 MGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
           + YN IN +I S RGKHD+  +IA+GA+ G +FKS+ GL+    AS + A  +  W   K
Sbjct: 156 LSYNLINSSIDSFRGKHDTPGAIAAGAITGAIFKSSKGLKPMAYASGLMAGASAAWCGMK 215

Query: 190 KYFFK 194
           K   +
Sbjct: 216 KTVLE 220



>gi|343425378|emb|CBQ68913.1| probable MAS6-mitochondrial inner membrane import translocase
           subunit [Sporisorium reilianum SRZ2]
          Length = 253

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 91/176 (51%), Gaps = 11/176 (6%)

Query: 26  SDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPG-------ALPSRGGFDDLCXXXXX 78
           +  L   +L  G L  +AGLG  D   LD     P        A+PSRG  DDLC     
Sbjct: 75  ASLLGDSSLDLGALGPLAGLGKDDLEYLDLTDGAPSSMEGARTAVPSRGWSDDLCYGTGT 134

Query: 79  XXXXXXXXXXVWGLMEGLHG----HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                     + G  EGL        P F+LRLN +LN VTRRG F GNS G++A+ YN 
Sbjct: 135 TYLSGLAIGGLLGAREGLFRPLGVDHPTFRLRLNAVLNQVTRRGSFFGNSAGVIALIYNL 194

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           ++ +I  +RGKHD   ++A+G + G +FK TAG+R    AS I    A TWT AK+
Sbjct: 195 VDASIDGVRGKHDIYGAVAAGGISGAMFKCTAGVRPMAVASAIMMGAAATWTTAKQ 250



>gi|511004272|gb|EPB85647.1| hypothetical protein HMPREF1544_07554 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 218

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 100/165 (60%), Gaps = 3/165 (1%)

Query: 25  VSDFLARVNLGPGQLREIAGLGAVDYLRLDEQVV--TPGALPSRGGFDDLCXXXXXXXXX 82
           + DF++ + L   +L+ ++ L  +D+L++++  V  + G  PSRG  DDLC         
Sbjct: 48  MPDFMSSITLDANRLQPMS-LQGLDFLQVEDAPVGTSSGLAPSRGWSDDLCYGTGTTYLA 106

Query: 83  XXXXXXVWGLMEGLHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSI 142
                  +G+MEGL   S   ++RLNT LNS+TRRGP +GN+ G++AM YN  N  I   
Sbjct: 107 GLTLGGAYGMMEGLKKSSGAPRVRLNTTLNSITRRGPGVGNAVGVIAMIYNGTNSLIDYS 166

Query: 143 RGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTL 187
           RG HD  NS+A+GA+ G +FK TAG R AG ++ +CA  AG WT+
Sbjct: 167 RGTHDVFNSLAAGAISGAIFKCTAGPRVAGISAAVCAGVAGAWTV 211



>gi|366987277|ref|XP_003673405.1| hypothetical protein NCAS_0A04600 [Naumovozyma castellii CBS 4309]
 gi|342299268|emb|CCC67018.1| hypothetical protein NCAS_0A04600 [Naumovozyma castellii CBS 4309]
          Length = 216

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 8/167 (4%)

Query: 36  PGQLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC               +
Sbjct: 50  PARLHPLAGLDKGVEYLDLEEEQLSTMEGSQGLIPSRGWTDDLCYGTGAVYLLGLGFGGL 109

Query: 90  WGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHD 147
            G  +G+    PN   KL+LNTILNS+T+RGPF+GN+ GILA+ YN IN TI S RGKHD
Sbjct: 110 SGFFQGIKNIPPNSPGKLQLNTILNSITKRGPFMGNNAGILALSYNLINSTIDSFRGKHD 169

Query: 148 SVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           +  +I +G + G +FKS+ GL+    AS + AA AGTW +AKK   +
Sbjct: 170 TPGAILAGGVTGAIFKSSKGLKPMAYASALMAAAAGTWGVAKKSVLE 216



>gi|465795795|emb|CCV00228.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 230

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 94/176 (53%), Gaps = 10/176 (5%)

Query: 28  FLARVNLGPGQLREIAGL-GAVDYLRLDEQVVTP-----GALPSRGGFDDLCXXXXXXXX 81
            L    L P +L   A +   ++YL ++E           ALPSRG  DDLC        
Sbjct: 55  LLRNTALDPAKLHPFADIKDDLEYLDIEEDRPNTIEGARTALPSRGWSDDLCYGTGTTYL 114

Query: 82  XXXXXXXVWGLMEGLHG----HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTING 137
                  + GL EG+       SP F+LR+N +LN V+RRG FIGNS G++A+ YN  + 
Sbjct: 115 GGLVVGGLLGLREGMTRPLGIDSPTFRLRMNAVLNQVSRRGTFIGNSAGVIALTYNIFDA 174

Query: 138 TIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +I + RGKHD   S+ASGAL G LF+ T+G RA   +S +    A TWTL K+ F 
Sbjct: 175 SIDAARGKHDIYGSVASGALSGALFRCTSGPRAMLVSSTLMMGAAATWTLGKQAFL 230



>gi|255725492|ref|XP_002547675.1| mitochondrial import inner membrane translocase subunit TIM23
           [Candida tropicalis MYA-3404]
 gi|240135566|gb|EER35120.1| mitochondrial import inner membrane translocase subunit TIM23
           [Candida tropicalis MYA-3404]
          Length = 218

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 106/193 (54%), Gaps = 19/193 (9%)

Query: 18  FGTDPVAVSDFLARVNLGPG----------QLREIAGLGA-VDYLRLDEQVV-----TPG 61
            G DP  +SD  + ++  PG          +L  +AGL   ++YL L+E+ +     + G
Sbjct: 23  LGFDPKEISDVNSIIST-PGSSTTNTSAFSKLHPLAGLDKGIEYLDLEEEKLNTVEGSKG 81

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGP 119
            +PSR   DDLC               +WG   G++    N   K++LN ILN++T+RGP
Sbjct: 82  LIPSRSWTDDLCYGTGAVYLLGLGIGGLWGFQTGVNTLPENAPGKVKLNHILNNITKRGP 141

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICA 179
           F+GNS G+LA+ YN I+ +I  IR KHD +NS+ +GAL G LFKS+AG +    +SV+ A
Sbjct: 142 FMGNSAGVLALTYNLIDSSIDGIREKHDDLNSVVAGALAGALFKSSAGFKPMAYSSVMMA 201

Query: 180 ATAGTWTLAKKYF 192
             AG W   K+  
Sbjct: 202 GAAGVWCGIKRLL 214



>gi|344302498|gb|EGW32772.1| hypothetical protein SPAPADRAFT_54791 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 218

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 110/200 (55%), Gaps = 12/200 (6%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSDFLARVN----LGPGQLREIAGLGA-VDYLRLDEQVV- 58
           SS+  D  S     G DP  V+D  A +         QL  +AGL   V+YL L+++ + 
Sbjct: 9   SSSQTDDASLKQTLGFDPKEVTDVHAMIQSPNLYTASQLHPLAGLEKGVEYLDLEDEKLN 68

Query: 59  ----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILN 112
               + G +PSR   DDLC                +GL EG+     N   KL+LNT+LN
Sbjct: 69  AVEGSQGIIPSRSWSDDLCYGTGAVYLLGLGLGGAYGLQEGVKNIPANAPPKLKLNTVLN 128

Query: 113 SVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG 172
            +T+RGPF+GNS G+LA+ YN I+ +I +IR KHD  NS+A+GAL G LFKS+AG++   
Sbjct: 129 HITKRGPFLGNSAGVLALTYNLIDSSIDAIRDKHDDYNSVAAGALAGALFKSSAGVKPMF 188

Query: 173 TASVICAATAGTWTLAKKYF 192
            AS + A  AG W   K+ F
Sbjct: 189 YASALMALGAGAWCGIKRAF 208



>gi|126135390|ref|XP_001384219.1| mitochondrial import inner membrane translocase subunit TIM23
           [Scheffersomyces stipitis CBS 6054]
 gi|126091417|gb|ABN66190.1| mitochondrial import inner membrane translocase subunit TIM23
           [Scheffersomyces stipitis CBS 6054]
          Length = 210

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 109/188 (57%), Gaps = 14/188 (7%)

Query: 18  FGTDPVAVSDFLARVNLGPG-----QLREIAGLGA-VDYLRL-DEQVVT----PGALPSR 66
            G DP  V+D ++++   PG     +L  +AGL   ++YL L DEQ+ T     G +PSR
Sbjct: 23  LGFDPAQVAD-VSQILQTPGVLDSSRLHPLAGLDKGIEYLDLEDEQLTTVEGAQGIIPSR 81

Query: 67  GGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNS 124
              DDLC                +G+ EG+    PN   KL+LNT+LN +T+RGP++GNS
Sbjct: 82  SWTDDLCYGTGAVYLLGLGLGGAYGMQEGIKNIPPNSPGKLQLNTVLNHMTKRGPYLGNS 141

Query: 125 CGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGT 184
            G+LA+ YN I+ ++ ++RGKHD  N++A+GAL G LF+S+AG++    ++ + A  A  
Sbjct: 142 AGVLALTYNLIDSSLDALRGKHDDYNTVAAGALAGALFRSSAGIKPMAYSTALMAGAASA 201

Query: 185 WTLAKKYF 192
           W   K+  
Sbjct: 202 WCGIKRLL 209



>gi|449547923|gb|EMD38890.1| hypothetical protein CERSUDRAFT_47854 [Ceriporiopsis subvermispora
           B]
          Length = 196

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 81/133 (60%), Gaps = 6/133 (4%)

Query: 62  ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSP----NFKLRLNTILNSVTRR 117
           A+PSRG  DDL                +WG  EG     P    N +LR+N+ILNSVTRR
Sbjct: 64  AIPSRGWSDDLSYGTGTMYLSGLTLGGLWGFREG--ARRPLAVSNTRLRINSILNSVTRR 121

Query: 118 GPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           G FIGNS G+LA+ YN+IN +I   RGKHD++ S+ +G L G L+KSTAG++ A  A+ +
Sbjct: 122 GTFIGNSAGVLALVYNSINSSIDYARGKHDTIGSMLAGGLTGALYKSTAGIKPALAAATL 181

Query: 178 CAATAGTWTLAKK 190
            +  AG W+  K+
Sbjct: 182 VSGLAGVWSYVKR 194



>gi|448080824|ref|XP_004194735.1| Piso0_005248 [Millerozyma farinosa CBS 7064]
 gi|359376157|emb|CCE86739.1| Piso0_005248 [Millerozyma farinosa CBS 7064]
          Length = 209

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 113/194 (58%), Gaps = 17/194 (8%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPG-----QLREIAGLGA-VDYLRLDEQVV 58
            +N+ D++    + G DP  VSD ++ V   PG     +L  +AGL   V+YL L+E+ +
Sbjct: 12  QNNSSDFKE---KLGFDPSQVSD-VSSVLQAPGVLDSARLHPLAGLDKGVEYLDLEEEQL 67

Query: 59  -----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTIL 111
                + G +PSR   DDLC               ++G  EGL     N   KL+LNT+L
Sbjct: 68  NKIEGSQGLIPSRDWTDDLCYGTGAVYLLGLGIGGLYGFQEGLSNMPKNAPPKLQLNTVL 127

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N +T+RGPF+GNS G+LA+ YN I+ ++ +IRGKHD +NS+A+G L G LF+S+AG++  
Sbjct: 128 NHITKRGPFLGNSAGVLALTYNLIDSSLDAIRGKHDDLNSLAAGGLAGALFRSSAGVKPM 187

Query: 172 GTASVICAATAGTW 185
           G ++ +    AG W
Sbjct: 188 GYSTALMVGAAGVW 201



>gi|448524117|ref|XP_003868926.1| Tim23 protein [Candida orthopsilosis Co 90-125]
 gi|380353266|emb|CCG26022.1| Tim23 protein [Candida orthopsilosis]
          Length = 224

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 93/156 (59%), Gaps = 10/156 (6%)

Query: 39  LREIAGLGA-VDYLRLDEQVV-----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGL 92
           L  +AGL   ++YL L+E+ +     + G +PSR   DDLC               + G 
Sbjct: 62  LHPLAGLDKGIEYLDLEEEKLNQVEGSQGLIPSRSWTDDLCYGTGAVYLIGLGLGGLSGF 121

Query: 93  MEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
             GL     +SP  K++LN ILN++T+RGPF+GN+ G+LA+ YN I+ ++  +RGKHD V
Sbjct: 122 QHGLKTLPANSPG-KVQLNHILNNITKRGPFLGNNAGVLALTYNLIDSSLDGVRGKHDDV 180

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           NS+ +GAL G LF+S+ GL+    +SV+ A  AG W
Sbjct: 181 NSVVAGALAGALFRSSRGLKPMAYSSVLMAGAAGLW 216



>gi|448085314|ref|XP_004195827.1| Piso0_005248 [Millerozyma farinosa CBS 7064]
 gi|359377249|emb|CCE85632.1| Piso0_005248 [Millerozyma farinosa CBS 7064]
          Length = 209

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 112/194 (57%), Gaps = 17/194 (8%)

Query: 5   SSNTYDYQSSPNQFGTDPVAVSDFLARVNLGPG-----QLREIAGL-GAVDYLRLDEQVV 58
            +N+ D++    + G D   VSD ++ V   PG     +L  +AGL   V+YL L+E+ +
Sbjct: 12  QNNSSDFKE---KLGFDASQVSD-VSSVLQAPGVLDSARLHPLAGLEKGVEYLDLEEEQL 67

Query: 59  -----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGHSPNF--KLRLNTIL 111
                + G +PSR   DDLC               ++G  EGL     N   KL+LNT+L
Sbjct: 68  NKIEGSQGLIPSRDWTDDLCYGTGAVYLLGLGIGGLYGFQEGLSNMPKNAPPKLQLNTVL 127

Query: 112 NSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAA 171
           N +T+RGPF+GNS G+LA+ YN I+ ++ +IRGKHD +NS+A+G L G LF+S+AGL+  
Sbjct: 128 NHITKRGPFLGNSAGVLALTYNLIDSSMDAIRGKHDDINSLAAGGLAGALFRSSAGLKPM 187

Query: 172 GTASVICAATAGTW 185
           G ++ +    AG W
Sbjct: 188 GYSTALMVGAAGVW 201



>gi|403215305|emb|CCK69804.1| hypothetical protein KNAG_0D00520 [Kazachstania naganishii CBS
           8797]
          Length = 238

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 96/161 (59%), Gaps = 11/161 (6%)

Query: 36  PGQLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXV 89
           P QL  +AGL   V+Y+ L+E+ ++      G +PSRG  DDLC               V
Sbjct: 70  PLQLHPLAGLERGVEYMDLEEEQLSTMEGSQGLIPSRGWTDDLCYGTGAVYLTGLGLGGV 129

Query: 90  WGLMEGLHG----HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK 145
            G+++GL       +P  KL+LNT+LNSVT+RGPF+GN+ G+LA+ YN +N ++ + RGK
Sbjct: 130 SGVLQGLRAIPSADAPG-KLKLNTVLNSVTKRGPFLGNTAGVLALSYNVVNSSLDAWRGK 188

Query: 146 HDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWT 186
           HD+  SIASGAL+G LF+S+ G +    +  + A     W+
Sbjct: 189 HDAAGSIASGALVGTLFRSSRGPKQMLISGSLMAGVCALWS 229



>gi|384499340|gb|EIE89831.1| hypothetical protein RO3G_14542 [Rhizopus delemar RA 99-880]
          Length = 221

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 102/167 (61%), Gaps = 4/167 (2%)

Query: 27  DFLARVNLGPGQLREIAGLGAVDYLRLDEQV---VTPGALPSRGGFDDLCXXXXXXXXXX 83
           DF++ + L   +L+ ++ L  +D+L++++      + G  PSRG  DDLC          
Sbjct: 52  DFMSSITLDANRLQPMS-LQGLDFLQIEDAAPVGASSGFAPSRGWSDDLCYGTGTVYLAG 110

Query: 84  XXXXXVWGLMEGLHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIR 143
                 +G+ EG+   S   K+RLNT LN++TRRGP +GN+ G++AM YN  N  +   R
Sbjct: 111 LTLGGAYGMAEGIKKSSGAAKVRLNTTLNTITRRGPGVGNAVGVIAMVYNGTNSLLDYSR 170

Query: 144 GKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           G HD  NS+A+G + G +FKSTAG+RAAG ++ ICAA AGTW++  K
Sbjct: 171 GTHDIFNSLAAGGIAGAIFKSTAGVRAAGISAAICAAAAGTWSVLVK 217



>gi|323346748|gb|EGA81029.1| Tim23p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 105

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 93  MEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVN 150
           M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+  
Sbjct: 1   MQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAG 60

Query: 151 SIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           SI +GAL G LFKS+ GL+  G +S + AA    W   KK   +
Sbjct: 61  SIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLE 104



>gi|254566507|ref|XP_002490364.1| Essential protein of the mitochondrial inner membrane, component of
           the mitochondrial import system [Komagataella pastoris
           GS115]
 gi|238030160|emb|CAY68083.1| Essential protein of the mitochondrial inner membrane, component of
           the mitochondrial import system [Komagataella pastoris
           GS115]
 gi|328350758|emb|CCA37158.1| Mitochondrial import inner membrane translocase subunit tim23
           [Komagataella pastoris CBS 7435]
          Length = 216

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 106/189 (56%), Gaps = 16/189 (8%)

Query: 12  QSSPNQFGTDPVAVSDFLARVNLGPG-----QLREIAGLGA-VDYLRLDEQVVTP----- 60
           Q      G DP  +SD ++ +   PG      L  +AGL   ++YL L+++ ++P     
Sbjct: 21  QQLQQTLGFDPSTISD-VSNIIKSPGVFDTNSLHPLAGLDKDLEYLDLEDEQLSPLEGSQ 79

Query: 61  GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGL----HGHSPNFKLRLNTILNSVTR 116
           G + SRG  DDLC               ++G  EG+     G   + KL+LNTILN VTR
Sbjct: 80  GLIASRGWSDDLCYGTGTAYLLGLGTGGLYGFREGVANLPKGADVSGKLKLNTILNHVTR 139

Query: 117 RGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASV 176
           RGPF+GNS G+LA+ YN IN T+ S RGKHD+ NS+A+GAL G +FKS+ G++    +S 
Sbjct: 140 RGPFLGNSAGVLAVTYNIINSTLDSFRGKHDTYNSLAAGALAGAIFKSSKGIKPMAISSG 199

Query: 177 ICAATAGTW 185
           +    AG W
Sbjct: 200 LMVLAAGAW 208



>gi|320580213|gb|EFW94436.1| mitochondrial import inner membrane translocase subunit TIM23
           [Ogataea parapolymorpha DL-1]
          Length = 220

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 99/192 (51%), Gaps = 23/192 (11%)

Query: 17  QFGTDPVAVSDF---LARVNLGPGQLREIAGLGA-VDYLRLDEQVVTP------GALPSR 66
           Q G D   +SD    L    L P +L  +AGL   ++YL LDE+ +T       G LPSR
Sbjct: 21  QAGFDANQISDISSILKSNTLDPTKLHPLAGLDKDIEYLDLDEEKLTTLEGAGNGLLPSR 80

Query: 67  GGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHG-------------HSPNFKLRLNTILNS 113
           G  DDLC               + GL EGL                   FKL+LNT+LN 
Sbjct: 81  GWTDDLCYGTGTVYVLGLGLGGIRGLNEGLKNLPQGRVDPVTNQLRPVPFKLKLNTVLNQ 140

Query: 114 VTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGT 173
           VT+ GP +GN+ G+LA+ YN I+ ++ +IR KHD +NS+A+G L G LF+S+ GL+  G 
Sbjct: 141 VTKFGPHMGNNAGVLAIMYNLIDSSLDNIRNKHDDLNSLAAGFLSGALFRSSKGLKPMGY 200

Query: 174 ASVICAATAGTW 185
           ++      A  W
Sbjct: 201 SAGAMTLVAAAW 212



>gi|406695202|gb|EKC98514.1| import inner membrane translocase subunit tim23 [Trichosporon
           asahii var. asahii CBS 8904]
          Length = 162

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 38  QLREIAGLGA-VDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +A LG  +D+L LDE  +T        LPSRG  DDLC                WG
Sbjct: 10  KLHPMANLGDNLDFLNLDEDKLTDMEGAESVLPSRGWTDDLCVGTGTTYLTGLLTGGAWG 69

Query: 92  LMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
           + EGL    G +P+ +LRLN++LNS TRRG F GNS G+L            S+RG HD+
Sbjct: 70  MKEGLSRPLGPNPSMRLRLNSVLNSCTRRGSFTGNSLGVLD-----------SLRGHHDA 118

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYF 192
           +NSI +GAL G LFK T+G+R A   + + A     W+  K Y 
Sbjct: 119 LNSIGAGALSGGLFKCTSGVRPAAVGATMGAGAMAAWSALKNYL 162



>gi|354548174|emb|CCE44910.1| hypothetical protein CPAR2_407120 [Candida parapsilosis]
          Length = 226

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 91/156 (58%), Gaps = 10/156 (6%)

Query: 39  LREIAGLG-AVDYLRLDEQVV-----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGL 92
           L  +AGL   V+YL L+E+ +     + G +PSR   DDLC               + G 
Sbjct: 64  LHPLAGLDKGVEYLDLEEEKLNQVEGSQGLIPSRSWTDDLCYGTGAVYLMGLGLGGLSGF 123

Query: 93  MEG---LHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
             G   L   +P  K++LN ILN++T+RGPF+GN+ G+LA+ YN I+ ++  +RGKHD V
Sbjct: 124 QHGVRTLPAGAPG-KVQLNHILNNITKRGPFLGNNAGVLALTYNLIDSSLDGLRGKHDDV 182

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           NS+ +GAL G LF+S+ GL+    +S + A  AG W
Sbjct: 183 NSVVAGALAGALFRSSRGLKPMVYSSALMAGAAGLW 218



>gi|443900222|dbj|GAC77548.1| mitochondrial import inner membrane translocase, subunit TIM23
           [Pseudozyma antarctica T-34]
          Length = 254

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 85/163 (52%), Gaps = 11/163 (6%)

Query: 26  SDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPG-------ALPSRGGFDDLCXXXXX 78
           +  L   +L  G L  +AGLG  +   LD     P        A+PSRG  DDLC     
Sbjct: 76  ASLLGDTSLNLGALSPLAGLGKDELEYLDLTDGAPSSMEGARTAVPSRGWSDDLCYGTGT 135

Query: 79  XXXXXXXXXXVWGLMEG----LHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                     + G  EG    L   +P F+LRLN +LN VTRRG F GNS G++A+ YN 
Sbjct: 136 TYLSGLAIGGLLGAREGFFRPLGVDNPTFRLRLNAVLNQVTRRGSFFGNSAGVVALIYNL 195

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           ++ +I  +RGKHD   ++ +GA+ G LFK TAG+R    AS I
Sbjct: 196 VDASIDGVRGKHDIAGAVTAGAISGALFKCTAGVRPMAVASGI 238



>gi|207341584|gb|EDZ69597.1| YNR017Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 184

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (61%), Gaps = 8/128 (6%)

Query: 38  QLREIAGLG-AVDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +AGL   V+YL L+E+ ++      G +PSRG  DDLC                 G
Sbjct: 57  RLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSG 116

Query: 92  LMEGLHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           +M+GL    PN   KL+LNT+LN +T+RGPF+GN+ GILA+ YN IN TI ++RGKHD+ 
Sbjct: 117 MMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTA 176

Query: 150 NSIASGAL 157
            SI +GAL
Sbjct: 177 GSIGAGAL 184



>gi|353239449|emb|CCA71360.1| probable MAS6-mitochondrial inner membrane import translocase
           subunit [Piriformospora indica DSM 11827]
          Length = 218

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 107/218 (49%), Gaps = 33/218 (15%)

Query: 4   FSSNTYDYQSSPNQFGTDPVA------------------VSDFLARVNLGPGQLREIAGL 45
           F  +  + ++ P Q  T+P+A                   SD LA     P +L  +AG+
Sbjct: 6   FLRDKGNKETPPPQTNTNPIAGVSFSKPESVPVVPEIVTASDVLANA-YDPSKLHPLAGI 64

Query: 46  GAVDYLRLDEQVVT---PG---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH 99
           G      L +       PG   ALPSRG  DDLC               +WGL EG    
Sbjct: 65  GDKLDYLLLDDDKLSTLPGGATALPSRGWSDDLCYGTGTTYLAGIGG--LWGLREG--AA 120

Query: 100 SP----NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASG 155
            P    N +LRLN+ILN VTRRG F+GNS G+LA+ YN +N TI S+RGKHD    +A+G
Sbjct: 121 RPLAVSNARLRLNSILNGVTRRGTFLGNSAGVLALIYNAVNSTIDSVRGKHDIWGGMAAG 180

Query: 156 ALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
            + G L+KSTAG++ A  A+ +    AG W+  K    
Sbjct: 181 GICGALYKSTAGVKPAFAAATLMTTAAGAWSWVKSAIL 218



>gi|164655112|ref|XP_001728687.1| hypothetical protein MGL_4166 [Malassezia globosa CBS 7966]
 gi|159102570|gb|EDP41473.1| hypothetical protein MGL_4166 [Malassezia globosa CBS 7966]
          Length = 244

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 83/158 (52%), Gaps = 10/158 (6%)

Query: 21  DPVAVSDFLARVNLGPGQLREIAGL-GAVDYLRLDEQVVTP-----GALPSRGGFDDLCX 74
           D    +  L    L P +L   A +   ++YL +++           ALPSRG  DDLC 
Sbjct: 51  DAPTAAGLLRNTALDPARLHPFADIKDDLEYLDIEDDRPNTIQGARTALPSRGWSDDLCY 110

Query: 75  XXXXXXXXXXXXXXVWGLMEGLHG----HSPNFKLRLNTILNSVTRRGPFIGNSCGILAM 130
                         + GL EGL       SP F+LR+N ILN VTRRG F+GNS G++A+
Sbjct: 111 GTGTTYLGGLSVGALIGLREGLTRPLGIDSPTFRLRMNAILNQVTRRGTFLGNSAGVIAL 170

Query: 131 GYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGL 168
            YN  + TI ++RG+HD   S+ASGAL G LF+ T  L
Sbjct: 171 TYNIFDATIDAVRGEHDIYGSVASGALSGALFRCTCTL 208



>gi|401887125|gb|EJT51130.1| import inner membrane translocase subunit [Trichosporon asahii var.
           asahii CBS 2479]
          Length = 235

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 84/157 (53%), Gaps = 20/157 (12%)

Query: 38  QLREIAGLGA-VDYLRLDEQVVT-----PGALPSRGGFDDLCXXXXXXXXXXXXXXXVWG 91
           +L  +A LG  +D+L LDE  +T        LPSRG  DDLC                WG
Sbjct: 90  KLHPMANLGDNLDFLNLDEDKLTDMEGAESVLPSRGWTDDLCVGTGTTYLTGLLTGGAWG 149

Query: 92  LMEGLH---GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
           + EGL    G +P+ +LRLN++LNS TRRG F GNS G+L            S+RG HD+
Sbjct: 150 MKEGLSRPLGPNPSMRLRLNSVLNSCTRRGSFTGNSLGVLD-----------SLRGHHDA 198

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTW 185
           +NSI +GAL G LFK T+G+R A   + + A     W
Sbjct: 199 LNSIGAGALSGGLFKCTSGVRPAAVGATMGAGAMAAW 235



>gi|50557202|ref|XP_506009.1| YALI0F29183p [Yarrowia lipolytica]
 gi|49651879|emb|CAG78821.1| YALI0F29183p [Yarrowia lipolytica CLIB122]
          Length = 215

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 18  FGTDPVAVS--DFLARVNLGPGQLREIAGLGA-VDYLRLD--EQVVTPGALPSRGGFDDL 72
           F  DP A S   FL   +L   +L  +AGL A ++Y  L+  E +   G LPSRG  DDL
Sbjct: 23  FDLDPNANSAASFL-NADLDTTKLHPMAGLDAGMEYFTLEGNETIYYDGLLPSRGWNDDL 81

Query: 73  CXXXXXXXXXXXXXXXVWGLMEGLH--GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAM 130
           C                 GLMEGL         K+++N +LN++T+RGPF+GNS G+L  
Sbjct: 82  CYGTGVLYLSGLGVGGFSGLMEGLRTVQEGAPAKIKINHVLNTITKRGPFLGNSMGVLGF 141

Query: 131 GYNTINGTI-GSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAK 189
            YN IN  I   IRGKHDS NSIA+GA+ G +F++  G +    AS I AA AG W + K
Sbjct: 142 FYNIINSKILYDIRGKHDSFNSIAAGAIAGAIFRAPRGTKPMLIASGITAAGAGVWCVFK 201

Query: 190 KYFF 193
           +  F
Sbjct: 202 QAVF 205



>gi|388857694|emb|CCF48588.1| probable MAS6-mitochondrial inner membrane import translocase
           subunit [Ustilago hordei]
          Length = 253

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 83/163 (50%), Gaps = 11/163 (6%)

Query: 26  SDFLARVNLGPGQLREIAGLGAVDYLRLDEQVVTPG-------ALPSRGGFDDLCXXXXX 78
           +  L   +L  G L  +AGLG  D   LD     P        A+PSRG  DDLC     
Sbjct: 75  ASLLGDASLNLGDLSPLAGLGKDDLEYLDLTDGAPSSMEGARTAVPSRGWSDDLCYGTGT 134

Query: 79  XXXXXXXXXXVWGLMEG----LHGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNT 134
                     + G  EG    L   +  F+LRLN +LN VTRRG F GNS G++A+ YN 
Sbjct: 135 TYLSGLAIGGLLGAREGFFRPLGVENTTFRLRLNAVLNQVTRRGSFFGNSAGVVALIYNL 194

Query: 135 INGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGTASVI 177
           ++ +I  +RGKHD   ++A+G L G LFK T+G R    AS I
Sbjct: 195 VDASIDGVRGKHDIYGAVAAGGLSGALFKCTSGARPMALASGI 237



>gi|149239921|ref|XP_001525836.1| mitochondrial import inner membrane translocase subunit TIM23
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449959|gb|EDK44215.1| mitochondrial import inner membrane translocase subunit TIM23
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 226

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 96/161 (59%), Gaps = 8/161 (4%)

Query: 42  IAGLGA-VDYLRLDEQVV-----TPGALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEG 95
           +AGL   ++YL L+E+ +     + G +PSR   DDLC               ++GL  G
Sbjct: 58  LAGLEKGIEYLDLEEEKLNTVEGSKGLIPSRSWTDDLCYGTGAVYLLGLGIGGLFGLQHG 117

Query: 96  LHGHSPNF--KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIA 153
           L     +   K++LN ILN++T+RGPF+GNS G+LA+ YN I+ TI ++R KH+ VNS+A
Sbjct: 118 LSTLPQDAPGKVKLNHILNNITKRGPFLGNSAGVLALTYNLIDSTIDAVREKHEDVNSVA 177

Query: 154 SGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
           +GAL G LF+S+ GL+    +SV+ A  AG W   K+   +
Sbjct: 178 AGALAGALFRSSRGLKPMAYSSVMMAGAAGVWCALKRSIHE 218



>gi|358060850|dbj|GAA93468.1| hypothetical protein E5Q_00109 [Mixia osmundae IAM 14324]
          Length = 296

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 62/95 (65%)

Query: 99  HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALI 158
            SP FKLRLNT+LNS+TRRG F+GN+ G+LA+ YN IN ++   RG+HD   S+ +GA  
Sbjct: 202 RSPGFKLRLNTVLNSITRRGTFLGNNAGVLALIYNAINSSVDKYRGRHDIYGSMFAGAGT 261

Query: 159 GLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           G ++KSTAGLR    AS I    A  WT  K Y  
Sbjct: 262 GAIWKSTAGLRPMLIASGIMTTGAAAWTSVKPYII 296



>gi|385302072|gb|EIF46221.1| mitochondrial import inner membrane translocase subunit tim23
           [Dekkera bruxellensis AWRI1499]
          Length = 222

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 86/169 (50%), Gaps = 20/169 (11%)

Query: 25  VSDFLARVNLGPGQLREIAGLGA-VDYLRLDEQVVTPGA------LPSRGGFDDLCXXXX 77
           V D L  V+  P +L  +AGL   ++YL LD++ ++         L +RG  DDLC    
Sbjct: 33  VQDILNTVDFEPZKLHPLAGLNKDIEYLDLDDEKLSTMEGSGNPILATRGWGDDLCYGAG 92

Query: 78  XXXXXXXXXXXVWGLMEGLHG-HSPN------------FKLRLNTILNSVTRRGPFIGNS 124
                      + G  EGL     P             FKL+LNTILN VT+ GP  GN+
Sbjct: 93  TVYVLGLGFGGLRGFDEGLKSLPQPKVDPLTNKLRPVPFKLKLNTILNQVTKFGPHAGNT 152

Query: 125 CGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAGT 173
            G+L + YN IN +    RGKHD  NS+ASG L G L+KST+GL + G 
Sbjct: 153 AGVLGIMYNIINSSFDHYRGKHDDWNSLASGFLSGALYKSTSGLESNGN 201



>gi|505757048|gb|EOR01182.1| hypothetical protein J056_004503 [Wallemia ichthyophaga EXF-994]
          Length = 401

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 91/170 (53%), Gaps = 10/170 (5%)

Query: 6   SNTYDYQSSPNQFGTDPVAVSDFLAR--VNLGPGQLREIAGLGAVDYLRLDEQVVT---P 60
           S+T    + P    T P A     A+  +++ P  L  +A +G      L +       P
Sbjct: 24  SSTQPINTQPTNTRTQPTATQATSAQDVLSIDPTTLHPMADVGDKLDYLLLDDEKLSELP 83

Query: 61  G---ALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLHGH--SPNFKLRLNTILNSVT 115
           G   ALPSRG  DDLC               +WGL EG++    +P  +LR+N ILNS+T
Sbjct: 84  GSETALPSRGWSDDLCYGVGTTYVSGLGLGGLWGLREGMNKKLAAPVTRLRVNAILNSLT 143

Query: 116 RRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKST 165
           +RG FI NS GI+AM YN  N ++ SIRGKHD +NS+ +GA  G LFKST
Sbjct: 144 KRGSFIANSGGIIAMVYNMTNSSLDSIRGKHDVLNSMGAGAFSGALFKST 193



>gi|340385810|ref|XP_003391401.1| PREDICTED: mitochondrial import inner membrane translocase subunit
           tim23-like [Amphimedon queenslandica]
          Length = 186

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 89  VWGLMEGLH-GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHD 147
            WGL EG+        +LR+N++LNS TRRGPF+GN+  +LA+ Y+ +   +   RG  D
Sbjct: 73  TWGLWEGIRRPEGRTTRLRVNSVLNSCTRRGPFLGNTAAVLALMYSPLCSALAHYRGVDD 132

Query: 148 SVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYF 192
           S+NSIA+ ++ GLL+KSTAGLRA G A        G ++++  YF
Sbjct: 133 SINSIAAASITGLLYKSTAGLRAMGVAGAAGCVALGVYSISSYYF 177



>gi|340374126|ref|XP_003385589.1| PREDICTED: mitochondrial import inner membrane translocase subunit
           tim23-like [Amphimedon queenslandica]
          Length = 186

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 89  VWGLMEGLH-GHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHD 147
            WGL EG+        +LR+N++LNS TRRGPF+GN+  +LA+ Y+ +   +   RG  D
Sbjct: 73  AWGLWEGIRRPEGRTTRLRVNSVLNSCTRRGPFLGNTAAVLALMYSPLCSALAHYRGVDD 132

Query: 148 SVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYF 192
           S+NSIA+ ++ GLL+KSTAGLRA G A        G ++++  YF
Sbjct: 133 SINSIAAASITGLLYKSTAGLRAMGVAGAAGCVALGIYSISSYYF 177



>gi|328857189|gb|EGG06307.1| hypothetical protein MELLADRAFT_43572 [Melampsora larici-populina
           98AG31]
          Length = 271

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 60/92 (65%)

Query: 102 NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLL 161
           +++LRLN ILN +TRRG F GN+CGILA+ YN  N T+   R +HD+ NSI +G L G L
Sbjct: 180 SWRLRLNAILNGITRRGSFTGNTCGILALMYNAFNCTLDRYREQHDNWNSIMAGGLTGAL 239

Query: 162 FKSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           F+ TAG +    AS + AA A  W+ AK +  
Sbjct: 240 FRCTAGPQKMLIASSLMAAGAMGWSTAKPHLI 271



>gi|328767736|gb|EGF77785.1| hypothetical protein BATDEDRAFT_91477 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 253

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 61  GALPSRGGFDDLCXXXXXXXXXXXXXXXVWGLMEGLH-GHSPNFKLRLNTILNSVTRRGP 119
           G +P R G+D L                V+G++ GL     PNFK+R+N+I+N  TR GP
Sbjct: 90  GPIPMRTGYDKLLYGTGVSYLSGLSYGAVYGVIRGLQTAQVPNFKVRMNSIVNQTTRYGP 149

Query: 120 FIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLLFKSTAGLRAAG-TASVIC 178
           +  NS G++ M +  ++ T+  IRGK D  N I++    G+LFKSTAG+R A  T S++ 
Sbjct: 150 WAANSLGVMTMTWAIMDNTLSMIRGKSDYFNHISAAFASGILFKSTAGIRPAVITGSILA 209

Query: 179 AATAG 183
           +  +G
Sbjct: 210 SIVSG 214



>gi|331228220|ref|XP_003326777.1| hypothetical protein PGTG_08314 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309305767|gb|EFP82358.1| hypothetical protein PGTG_08314 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 272

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (65%)

Query: 102 NFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSVNSIASGALIGLL 161
           +++LRLN ILN +TRRG F GN+CGILA+ YN  N T+   RG+HD  NS+ +G L G L
Sbjct: 179 SWRLRLNAILNGITRRGSFTGNTCGILAVMYNAFNCTLDRQRGQHDQWNSVIAGGLTGAL 238

Query: 162 FKSTAGLRAAGTASVICAATAGTWTLAK 189
           F+ TAG +    AS + AA A  W+  K
Sbjct: 239 FRCTAGFQKMFIASSLMAAGAMGWSAVK 266



>gi|156363539|ref|XP_001626100.1| predicted protein [Nematostella vectensis]
 gi|156212964|gb|EDO34000.1| predicted protein [Nematostella vectensis]
          Length = 199

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 1/101 (0%)

Query: 91  GLMEGLHG-HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDSV 149
           GL EGL       FKLRLN++LN  TRRGPF  NS G++A+ Y++ +   G +RG+ D +
Sbjct: 84  GLYEGLRNPDGKTFKLRLNSVLNGCTRRGPFAANSLGVIALMYSSFDSLYGKLRGEEDEL 143

Query: 150 NSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKK 190
           NSIA+    G++FKSTAG+R    A  +  + A  +   +K
Sbjct: 144 NSIAAAVTTGMIFKSTAGVRPIAIAGALGGSLAAAYHFGEK 184



>gi|449665172|ref|XP_002158574.2| PREDICTED: mitochondrial import inner membrane translocase subunit
           tim23-like [Hydra magnipapillata]
          Length = 137

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 89  VWGLMEGLHG-HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHD 147
           VWG+MEGL       FKLRLN++LN  TRRGPF+GN+  ++A+ Y  IN  I + RG  D
Sbjct: 18  VWGVMEGLRNPEGKTFKLRLNSLLNGCTRRGPFLGNNLAVVALMYGCINAAIETGRGVED 77

Query: 148 SVNSIASGALIGLLFKSTAGLRA 170
             NS AS    G LFKSTAG RA
Sbjct: 78  EYNSYASAITAGALFKSTAGPRA 100



>gi|196012802|ref|XP_002116263.1| hypothetical protein TRIADDRAFT_60178 [Trichoplax adhaerens]
 gi|190581218|gb|EDV21296.1| hypothetical protein TRIADDRAFT_60178 [Trichoplax adhaerens]
          Length = 198

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 5/107 (4%)

Query: 89  VWGLMEGLHG-HSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHD 147
            WGL EGL   H    KLR+N ILNS TRRGPF+GNS G +     TI G +     + +
Sbjct: 84  AWGLFEGLRTPHGNTMKLRINGILNSCTRRGPFVGNSLGCI----ETILGKVTQKEDEDN 139

Query: 148 SVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYFFK 194
             N++ +  L G +FKST G+RA   A+ I    A T+   +  + K
Sbjct: 140 PYNTVGAAVLTGAIFKSTGGIRATALAAAIGGTLAVTYHFGQMIWQK 186



>gi|342319315|gb|EGU11264.1| Mitochondrial import inner membrane translocase subunit tim23
           [Rhodotorula glutinis ATCC 204091]
          Length = 877

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 104 KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK-HDSVNSIASGALIGLLF 162
           +LR N ILN VTRRG  +GNS G+LA+ YN IN TI   RG  HD   S+ + AL GL++
Sbjct: 156 RLRWNNILNQVTRRGTSMGNSAGVLALIYNGINSTIDVYRGHVHDVYGSMTAAALTGLIW 215

Query: 163 KSTAGLRAAGTASVICAATAGTWTLAKKYFF 193
           +STAG++     S +  A A  W+  K    
Sbjct: 216 RSTAGIKPMVITSGLLTAGAAGWSWVKVQLL 246



>gi|472586893|gb|EMS24392.1| mitochondrial import inner membrane translocase subunit TIM23
           [Rhodosporidium toruloides NP11]
          Length = 275

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 104 KLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGK-HDSVNSIASGALIGLLF 162
           +LR N ILN VTRRG  +GNS G+LA+ YN IN TI   RG  HD   S+ + AL GL++
Sbjct: 185 RLRWNNILNQVTRRGTSMGNSAGVLALIYNGINSTIDVYRGHVHDVYGSMTAAALTGLIW 244

Query: 163 KSTAGLRAAGTASVICAATAGTWTLAK 189
           +STAG++     S +  A A  W+  K
Sbjct: 245 RSTAGIKPMVITSGLLTAGAAGWSWVK 271



>gi|326426837|gb|EGD72407.1| hypothetical protein PTSG_00427 [Salpingoeca sp. ATCC 50818]
          Length = 218

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 89  VWGLMEGL-HGHSPNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRG-KH 146
           ++G++EGL H  + + +LR+ T+LN+V +RGPF+GN+  +L++ +++ING I   RG K 
Sbjct: 95  LYGVVEGLRHPAATSNRLRVTTVLNAVGKRGPFLGNTLAVLSVMFHSINGGIIKARGEKD 154

Query: 147 DSVNSIASGALIGLLFKSTAGLRAAGTASVICAATAGTWTLAKKYF 192
           D VN +A+    G LF+ T+G RAA    +  A  A    + K + 
Sbjct: 155 DIVNDVAAAVATGTLFRITSGPRAAAFGGLTGAGLAAAVYVVKTFL 200



>gi|485620853|gb|EOD17364.1| hypothetical protein EMIHUDRAFT_416045 [Emiliania huxleyi CCMP1516]
          Length = 184

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 1/92 (1%)

Query: 90  WGLMEGLHGHS-PNFKLRLNTILNSVTRRGPFIGNSCGILAMGYNTINGTIGSIRGKHDS 148
           WGL EGL   +    ++R+N +LN+  + GP +GNS G L M ++T      + RG+ D 
Sbjct: 80  WGLYEGLKSSTGERQRIRINAVLNATGKHGPGLGNSVGCLGMMFSTFETLAFNFRGEDDM 139

Query: 149 VNSIASGALIGLLFKSTAGLRAAGTASVICAA 180
           +N + +GAL G +FKS AGLR AGTA++  +A
Sbjct: 140 LNVMGAGALAGGIFKSQAGLRTAGTAALGMSA 171