BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10088_c0_seq1-m.31 complete 75-506(+) 144 (+)
         (143 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511007955|gb|EPB89231.1| AP-2 complex subunit sigma [Mucor ci...   286   9e-76   Mucor circinelloides f. circinelloides 1006PhL
gi|440472313|gb|ELQ41183.1| vacuolar protein-sorting protein BRO...   283   1e-74   Magnaporthe oryzae Y34
gi|320591222|gb|EFX03661.1| vacuolar protein-sorting protein bro...   281   3e-74   Grosmannia clavigera kw1407
gi|367022198|ref|XP_003660384.1| hypothetical protein MYCTH_2054...   273   1e-71   Myceliophthora thermophila ATCC 42464
gi|85108910|ref|XP_962659.1| AP-2 complex subunit sigma [Neurosp...   272   2e-71   Neurospora crassa OR74A
gi|116195880|ref|XP_001223752.1| conserved hypothetical protein ...   272   2e-71   Chaetomium globosum CBS 148.51
gi|296418629|ref|XP_002838933.1| hypothetical protein [Tuber mel...   271   4e-71   Tuber melanosporum Mel28
gi|389745094|gb|EIM86276.1| clathrin coat assembly protein ap17 ...   271   5e-71   Stereum hirsutum FP-91666 SS1
gi|400601884|gb|EJP69509.1| AP-2 complex subunit sigma [Beauveri...   271   6e-71   Beauveria bassiana ARSEF 2860
gi|477528791|gb|ENH80564.1| ap-2 complex subunit sigma [Colletot...   270   6e-71   Colletotrichum orbiculare MAFF 240422
gi|171690862|ref|XP_001910356.1| hypothetical protein [Podospora...   270   9e-71   Podospora anserina S mat+
gi|409075117|gb|EKM75501.1| hypothetical protein AGABI1DRAFT_116...   270   1e-70   Agaricus bisporus var. burnettii JB137-S8
gi|358056244|dbj|GAA97795.1| hypothetical protein E5Q_04474 [Mix...   269   1e-70   Mixia osmundae IAM 14324
gi|471559688|gb|EMR62011.1| putative ap-2 complex subunit sigma ...   269   2e-70   Eutypa lata UCREL1
gi|512189204|gb|EPE04972.1| ap-2 adaptor complex subunit sigma [...   269   2e-70   Ophiostoma piceae UAMH 11346
gi|429862987|gb|ELA37572.1| ap-2 complex subunit sigma [Colletot...   269   2e-70   Colletotrichum gloeosporioides Nara gc5
gi|389634221|ref|XP_003714763.1| AP-2 complex subunit sigma [Mag...   268   3e-70   Magnaporthe oryzae 70-15
gi|402078729|gb|EJT73994.1| AP-2 complex subunit sigma [Gaeumann...   268   3e-70   Gaeumannomyces graminis var. tritici R3-111a-1
gi|322701702|gb|EFY93451.1| AP-2 complex subunit sigma [Metarhiz...   268   3e-70   Metarhizium acridum CQMa 102
gi|302895327|ref|XP_003046544.1| predicted protein [Nectria haem...   268   4e-70   Nectria haematococca mpVI 77-13-4
gi|406866627|gb|EKD19666.1| vacuolar protein-sorting protein bro...   268   4e-70   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|343425499|emb|CBQ69034.1| probable clathrin coat assembly pro...   268   4e-70   Sporisorium reilianum SRZ2
gi|154318566|ref|XP_001558601.1| clathrin coat assembly protein ...   268   5e-70   Botrytis cinerea B05.10
gi|310792201|gb|EFQ27728.1| clathrin adaptor complex small chain...   268   5e-70   Colletotrichum graminicola M1.001
gi|440638698|gb|ELR08617.1| AP-2 complex subunit sigma [Geomyces...   268   5e-70   Pseudogymnoascus destructans 20631-21
gi|425770087|gb|EKV08561.1| AP-2 complex subunit sigma [Penicill...   267   5e-70   Penicillium digitatum Pd1
gi|494828679|gb|EON65464.1| AP-2 complex subunit sigma [Coniospo...   267   6e-70   Coniosporium apollinis CBS 100218
gi|399170343|emb|CCE28720.1| probable clathrin assembly protein ...   267   6e-70   Claviceps purpurea 20.1
gi|393215998|gb|EJD01489.1| clathrin coat assembly protein ap17 ...   267   6e-70   Fomitiporia mediterranea MF3/22
gi|340960385|gb|EGS21566.1| hypothetical protein CTHT_0034270 [C...   267   8e-70   Chaetomium thermophilum var. thermophilum DSM 1495
gi|407924618|gb|EKG17651.1| Longin-like protein [Macrophomina ph...   267   8e-70   Macrophomina phaseolina MS6
gi|189191482|ref|XP_001932080.1| AP-2 complex subunit sigma [Pyr...   266   1e-69   Pyrenophora tritici-repentis Pt-1C-BFP
gi|46121429|ref|XP_385269.1| hypothetical protein FG05093.1 [Fus...   266   1e-69   
gi|443900335|dbj|GAC77661.1| clathrin adaptor complex, small sub...   266   1e-69   Moesziomyces antarcticus T-34
gi|358393749|gb|EHK43150.1| hypothetical protein TRIATDRAFT_9453...   266   1e-69   Trichoderma atroviride IMI 206040
gi|395325463|gb|EJF57885.1| clathrin coat assembly protein ap17 ...   266   2e-69   Dichomitus squalens LYAD-421 SS1
gi|336369466|gb|EGN97807.1| hypothetical protein SERLA73DRAFT_18...   266   2e-69   Serpula lacrymans var. lacrymans S7.3
gi|505757860|gb|EOR01970.1| AP-2 complex subunit sigma [Wallemia...   266   2e-69   Wallemia ichthyophaga EXF-994
gi|169600853|ref|XP_001793849.1| hypothetical protein SNOG_03279...   266   2e-69   Parastagonospora nodorum SN15
gi|169868570|ref|XP_001840856.1| clathrin coat assembly protein ...   265   2e-69   Coprinopsis cinerea okayama7#130
gi|451853035|gb|EMD66329.1| hypothetical protein COCSADRAFT_3489...   265   3e-69   Bipolaris sorokiniana ND90Pr
gi|170097225|ref|XP_001879832.1| predicted protein [Laccaria bic...   265   3e-69   Laccaria bicolor S238N-H82
gi|302423036|ref|XP_003009348.1| AP-2 complex subunit sigma [Ver...   265   3e-69   Verticillium alfalfae VaMs.102
gi|388579833|gb|EIM20153.1| Adaptor protein complex sigma subuni...   265   3e-69   Wallemia mellicola CBS 633.66
gi|449548534|gb|EMD39500.1| hypothetical protein CERSUDRAFT_1118...   265   4e-69   Gelatoporia subvermispora B
gi|388857788|emb|CCF48682.1| probable clathrin coat assembly pro...   264   6e-69   Ustilago hordei
gi|255941554|ref|XP_002561546.1| Pc16g12470 [Penicillium chrysog...   264   7e-69   Penicillium rubens Wisconsin 54-1255
gi|121701189|ref|XP_001268859.1| AP-2 adaptor complex subunit si...   263   8e-69   Aspergillus clavatus NRRL 1
gi|392592214|gb|EIW81541.1| clathrin coat assembly protein ap17 ...   263   9e-69   Coniophora puteana RWD-64-598 SS2
gi|392559139|gb|EIW52324.1| clathrin coat assembly protein ap17 ...   263   1e-68   Trametes versicolor FP-101664 SS1
gi|302687987|ref|XP_003033673.1| hypothetical protein SCHCODRAFT...   263   1e-68   Schizophyllum commune H4-8
gi|70996032|ref|XP_752771.1| AP-2 adaptor complex subunit sigma ...   263   1e-68   Aspergillus fumigatus Af293
gi|212533647|ref|XP_002146980.1| AP-2 adaptor complex subunit si...   263   1e-68   Talaromyces marneffei ATCC 18224
gi|145240377|ref|XP_001392835.1| AP-2 complex subunit sigma [Asp...   262   2e-68   Aspergillus niger CBS 513.88
gi|67516881|ref|XP_658326.1| hypothetical protein AN0722.2 [Aspe...   262   3e-68   Aspergillus nidulans FGSC A4
gi|402223873|gb|EJU03937.1| Adaptor protein complex sigma subuni...   261   3e-68   Dacryopinax primogenitus
gi|409039339|gb|EKM48964.1| hypothetical protein PHACADRAFT_2021...   261   3e-68   Phanerochaete carnosa HHB-10118-sp
gi|154276548|ref|XP_001539119.1| conserved hypothetical protein ...   261   3e-68   Histoplasma capsulatum NAm1
gi|392870647|gb|EAS32465.2| AP-2 complex subunit sigma [Coccidio...   261   4e-68   
gi|501305679|dbj|GAC94801.1| hypothetical protein PHSY_002374 [P...   261   5e-68   Pseudozyma hubeiensis SY62
gi|392572723|gb|EIW65868.1| hypothetical protein TREMEDRAFT_7047...   261   6e-68   Tremella mesenterica DSM 1558
gi|452981084|gb|EME80844.1| hypothetical protein MYCFIDRAFT_6116...   261   6e-68   Cercospora fijiensis CIRAD86
gi|353239255|emb|CCA71173.1| probable clathrin coat assembly pro...   260   8e-68   Serendipita indica DSM 11827
gi|115492117|ref|XP_001210686.1| AP-2 complex subunit sigma [Asp...   260   8e-68   Aspergillus terreus NIH2624
gi|390602807|gb|EIN12199.1| Adaptor protein complex sigma subuni...   260   9e-68   Punctularia strigosozonata HHB-11173 SS5
gi|119186637|ref|XP_001243925.1| conserved hypothetical protein ...   260   1e-67   
gi|449299810|gb|EMC95823.1| hypothetical protein BAUCODRAFT_7147...   259   1e-67   Baudoinia panamericana UAMH 10762
gi|453084956|gb|EMF13000.1| clathrin coat assembly protein ap17 ...   259   1e-67   Sphaerulina musiva SO2202
gi|296822322|ref|XP_002850266.1| clathrin coat assembly protein ...   259   1e-67   Arthroderma otae CBS 113480
gi|58262560|ref|XP_568690.1| vesicle-mediated transport-related ...   258   4e-67   Cryptococcus neoformans var. neoformans JEC21
gi|225681867|gb|EEH20151.1| AP-2 complex subunit sigma [Paracocc...   258   4e-67   
gi|331228242|ref|XP_003326788.1| hypothetical protein PGTG_08325...   258   4e-67   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|452840392|gb|EME42330.1| hypothetical protein DOTSEDRAFT_7322...   258   4e-67   Dothistroma septosporum NZE10
gi|295671480|ref|XP_002796287.1| AP-2 complex subunit sigma [Par...   258   5e-67   Paracoccidioides lutzii Pb01
gi|347830687|emb|CCD46384.1| similar to AP-2 adaptor complex sub...   258   5e-67   Botrytis cinerea T4
gi|398396440|ref|XP_003851678.1| hypothetical protein MYCGRDRAFT...   256   1e-66   Zymoseptoria tritici IPO323
gi|350292421|gb|EGZ73616.1| Adaptor protein complex sigma subuni...   254   4e-66   Neurospora tetrasperma FGSC 2509
gi|378732439|gb|EHY58898.1| AP-2 complex subunit sigma [Exophial...   254   8e-66   Exophiala dermatitidis NIH/UT8656
gi|403412832|emb|CCL99532.1| predicted protein [Fibroporia radic...   253   2e-65   Fibroporia radiculosa
gi|501754966|emb|CCG81731.1| AP-2 complex subunit sigma [Taphrin...   251   4e-65   Taphrina deformans PYCC 5710
gi|393243801|gb|EJD51315.1| clathrin coat assembly protein ap17 ...   250   1e-64   Auricularia subglabra TFB-10046 SS5
gi|472581968|gb|EMS19676.1| AP-2 complex subunit sigma [Rhodospo...   249   1e-64   Rhodotorula toruloides NP11
gi|134118910|ref|XP_771958.1| hypothetical protein CNBN1380 [Cry...   244   4e-63   Cryptococcus neoformans var. neoformans B-3501A
gi|396466520|ref|XP_003837709.1| hypothetical protein LEMA_P1224...   243   2e-62   Leptosphaeria maculans JN3
gi|485925286|gb|EOD49909.1| putative ap-2 complex subunit sigma ...   238   4e-61   Neofusicoccum parvum UCRNP2
gi|258563352|ref|XP_002582421.1| AP-2 complex subunit sigma [Unc...   236   1e-60   Uncinocarpus reesii 1704
gi|470319418|gb|EMR11037.1| hypothetical protein PNEG_00634 [Pne...   235   3e-60   Pneumocystis murina B123
gi|210075210|ref|XP_500486.2| YALI0B04246p [Yarrowia lipolytica]...   233   1e-59   Yarrowia lipolytica CLIB122
gi|328854277|gb|EGG03410.1| hypothetical protein MELLADRAFT_9012...   232   3e-59   Melampsora larici-populina 98AG31
gi|328774046|gb|EGF84083.1| hypothetical protein BATDEDRAFT_8507...   226   1e-57   Batrachochytrium dendrobatidis JAM81
gi|345562798|gb|EGX45811.1| hypothetical protein AOL_s00117g16 [...   226   2e-57   Arthrobotrys oligospora ATCC 24927
gi|239607205|gb|EEQ84192.1| clathrin coat assembly protein ap17 ...   219   1e-55   
gi|327351162|gb|EGE80019.1| clathrin coat assembly protein [Ajel...   219   2e-55   
gi|405123892|gb|AFR98655.1| clathrin coat assembly protein [Cryp...   219   2e-55   
gi|213406449|ref|XP_002173996.1| AP-2 complex subunit sigma [Sch...   215   3e-54   Schizosaccharomyces japonicus yFS275
gi|240278776|gb|EER42282.1| clathrin coat assembly protein ap17 ...   215   4e-54   Histoplasma capsulatum H143
gi|401882005|gb|EJT46280.1| vesicle-mediated transport-related p...   213   2e-53   Trichosporon asahii var. asahii CBS 2479
gi|485628639|gb|EOD24106.1| Adaptor protein 2 sigma subunit [Emi...   212   3e-53   Emiliania huxleyi CCMP1516
gi|166240245|ref|XP_636079.2| adaptor-related protein complex 2,...   210   8e-53   Dictyostelium discoideum AX4
gi|19112930|ref|NP_596138.1| AP-2 adaptor complex subunit Aps2 (...   209   3e-52   Schizosaccharomyces pombe 972h-
gi|291001725|ref|XP_002683429.1| predicted protein [Naegleria gr...   208   5e-52   Naegleria gruberi strain NEG-M
gi|357157007|ref|XP_003577651.1| PREDICTED: AP-2 complex subunit...   207   8e-52   Brachypodium distachyon [annual false brome]
gi|313238048|emb|CBY13167.1| unnamed protein product [Oikopleura...   206   1e-51   Oikopleura dioica
gi|330935913|ref|XP_003305179.1| hypothetical protein PTT_17946 ...   206   1e-51   Pyrenophora teres f. teres 0-1
gi|482574471|gb|EOA38658.1| hypothetical protein CARUB_v10010593...   206   2e-51   Capsella rubella
gi|326437187|gb|EGD82757.1| clathrin-associated protein 17 [Salp...   206   2e-51   Salpingoeca rosetta
gi|115649656|ref|XP_786054.2| PREDICTED: AP-2 complex subunit si...   206   2e-51   Strongylocentrotus purpuratus [purple urchin]
gi|261200895|ref|XP_002626848.1| clathrin coat assembly protein ...   206   2e-51   Blastomyces gilchristii SLH14081
gi|351726367|ref|NP_001237124.1| uncharacterized protein LOC1005...   206   2e-51   Glycine max [soybeans]
gi|225431145|ref|XP_002268045.1| PREDICTED: AP-2 complex subunit...   205   3e-51   Vitis vinifera
gi|470110180|ref|XP_004291364.1| PREDICTED: AP-2 complex subunit...   205   3e-51   Fragaria vesca subsp. vesca
gi|357438415|ref|XP_003589483.1| AP-2 complex subunit sigma-1 [M...   205   3e-51   Medicago truncatula
gi|30584435|gb|AAP36470.1| Homo sapiens adaptor-related protein ...   205   3e-51   synthetic construct
gi|56961624|ref|NP_075241.2| AP-2 complex subunit sigma [Rattus ...   205   3e-51   Rattus norvegicus [brown rat]
gi|15220987|ref|NP_175219.1| SNARE-like superfamily protein [Ara...   205   4e-51   Arabidopsis thaliana [mouse-ear cress]
gi|242067999|ref|XP_002449276.1| hypothetical protein SORBIDRAFT...   205   4e-51   Sorghum bicolor [broomcorn]
gi|351721716|ref|NP_001236195.1| uncharacterized protein LOC1005...   205   4e-51   Glycine max [soybeans]
gi|145354863|ref|XP_001421694.1| predicted protein [Ostreococcus...   205   4e-51   Ostreococcus lucimarinus CCE9901
gi|302815031|ref|XP_002989198.1| hypothetical protein SELMODRAFT...   204   5e-51   Selaginella moellendorffii
gi|504175502|ref|XP_004597269.1| PREDICTED: AP-2 complex subunit...   204   5e-51   
gi|297735018|emb|CBI17380.3| unnamed protein product [Vitis vini...   204   6e-51   Vitis vinifera
gi|115487800|ref|NP_001066387.1| Os12g0207300 [Oryza sativa Japo...   204   7e-51   
gi|344247455|gb|EGW03559.1| AP-2 complex subunit sigma [Cricetul...   204   7e-51   Cricetulus griseus [Chinese hamsters]
gi|224065891|ref|XP_002301979.1| predicted protein [Populus tric...   204   7e-51   Populus trichocarpa [western balsam poplar]
gi|24648686|ref|NP_650961.2| AP-2sigma [Drosophila melanogaster]...   204   7e-51   Drosophila melanogaster
gi|145531767|ref|XP_001451650.1| hypothetical protein [Parameciu...   204   7e-51   Paramecium tetraurelia strain d4-2
gi|255538924|ref|XP_002510527.1| clathrin coat assembly protein ...   204   7e-51   Ricinus communis
gi|388503672|gb|AFK39902.1| unknown [Lotus japonicus]                 204   8e-51   Lotus japonicus
gi|224083002|ref|XP_002306925.1| predicted protein [Populus tric...   204   8e-51   Populus trichocarpa [western balsam poplar]
gi|1296607|emb|CAA65782.1| clathrin-associated protein [Homo sap...   204   8e-51   Homo sapiens [man]
gi|260803746|ref|XP_002596750.1| hypothetical protein BRAFLDRAFT...   204   9e-51   Branchiostoma floridae
gi|91087215|ref|XP_975476.1| PREDICTED: similar to clathrin coat...   204   9e-51   Tribolium castaneum [rust-red flour beetle]
gi|291241881|ref|XP_002740838.1| PREDICTED: AdaPtin, Small chain...   204   9e-51   
gi|157104909|ref|XP_001648627.1| clathrin coat assembly protein ...   204   9e-51   Aedes aegypti
gi|478250334|gb|ENN70831.1| hypothetical protein YQE_12495, part...   203   1e-50   Dendroctonus ponderosae
gi|507578342|ref|XP_004672689.1| PREDICTED: AP-2 complex subunit...   203   1e-50   Jaculus jaculus
gi|432090573|gb|ELK23989.1| AP-2 complex subunit sigma [Myotis d...   203   1e-50   Myotis davidii
gi|209730620|gb|ACI66179.1| AP-2 complex subunit sigma-1 [Salmo ...   203   1e-50   Salmo salar
gi|168049922|ref|XP_001777410.1| predicted protein [Physcomitrel...   203   1e-50   Physcomitrella patens
gi|47085925|ref|NP_998320.1| AP-2 complex subunit sigma [Danio r...   203   1e-50   Danio rerio [leopard danio]
gi|321469738|gb|EFX80717.1| hypothetical protein DAPPUDRAFT_3038...   203   1e-50   Daphnia pulex
gi|195996217|ref|XP_002107977.1| conserved hypothetical protein ...   203   2e-50   Trichoplax adhaerens
gi|355703695|gb|EHH30186.1| hypothetical protein EGK_10802, part...   203   2e-50   Macaca mulatta [rhesus macaque]
gi|281202459|gb|EFA76661.1| adaptor-related protein complex 2 [P...   202   2e-50   Polysphondylium pallidum PN500
gi|449437206|ref|XP_004136383.1| PREDICTED: AP-2 complex subunit...   202   2e-50   Cucumis sativus [cucumbers]
gi|114678037|ref|XP_001168447.1| PREDICTED: AP-2 complex subunit...   202   2e-50   
gi|242021509|ref|XP_002431187.1| clathrin coat assembly protein ...   202   2e-50   Pediculus humanus corporis [human body lice]
gi|114678035|ref|XP_001168470.1| PREDICTED: AP-2 complex subunit...   202   2e-50   Pan troglodytes
gi|116786965|gb|ABK24321.1| unknown [Picea sitchensis]                202   2e-50   Picea sitchensis
gi|426243988|ref|XP_004015820.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|125578822|gb|EAZ19968.1| hypothetical protein OsJ_35559 [Oryz...   202   3e-50   Oryza sativa Japonica Group [Japonica rice]
gi|402906046|ref|XP_003915818.1| PREDICTED: AP-2 complex subunit...   202   3e-50   Papio anubis [Doguera baboon]
gi|383858038|ref|XP_003704510.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|302811191|ref|XP_002987285.1| hypothetical protein SELMODRAFT...   202   3e-50   Selaginella moellendorffii
gi|125536086|gb|EAY82574.1| hypothetical protein OsI_37796 [Oryz...   202   3e-50   Oryza sativa Indica Group [Indian rice]
gi|389612603|dbj|BAM19730.1| clathrin coat assembly protein ap17...   202   3e-50   Papilio xuthus [Chinese swallowtail]
gi|350423072|ref|XP_003493376.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|340727423|ref|XP_003402043.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|444730777|gb|ELW71151.1| AP-2 complex subunit sigma [Tupaia c...   202   3e-50   Tupaia chinensis
gi|380027828|ref|XP_003697618.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|345495771|ref|XP_001600601.2| PREDICTED: AP-2 complex subunit...   202   3e-50   Nasonia vitripennis
gi|332376661|gb|AEE63470.1| unknown [Dendroctonus ponderosae]         202   3e-50   Dendroctonus ponderosae
gi|512827969|ref|XP_004881300.1| PREDICTED: AP-2 complex subunit...   202   3e-50   
gi|195113909|ref|XP_002001510.1| GI10836 [Drosophila mojavensis]...   201   4e-50   
gi|354496926|ref|XP_003510574.1| PREDICTED: AP-2 complex subunit...   201   4e-50   
gi|440901773|gb|ELR52659.1| AP-2 complex subunit sigma, partial ...   201   4e-50   Bos mutus
gi|504175505|ref|XP_004597270.1| PREDICTED: AP-2 complex subunit...   201   4e-50   
gi|348526700|ref|XP_003450857.1| PREDICTED: AP-2 complex subunit...   201   4e-50   Oreochromis niloticus
gi|414878313|tpg|DAA55444.1| TPA: hypothetical protein ZEAMMB73_...   201   4e-50   Zea mays [maize]
gi|357160511|ref|XP_003578788.1| PREDICTED: AP-2 complex subunit...   201   4e-50   Brachypodium distachyon [annual false brome]
gi|156387510|ref|XP_001634246.1| predicted protein [Nematostella...   201   5e-50   Nematostella vectensis
gi|355755971|gb|EHH59718.1| hypothetical protein EGM_09903, part...   201   5e-50   Macaca fascicularis [crab eating macaque]
gi|30983940|gb|AAP40645.1| clathrin coat assembly protein [Gossy...   201   5e-50   Gossypium barbadense [Egyptian cotton]
gi|159485706|ref|XP_001700885.1| Sigma2-Adaptin [Chlamydomonas r...   201   5e-50   Chlamydomonas reinhardtii
gi|270010572|gb|EFA07020.1| hypothetical protein TcasGA2_TC00999...   201   6e-50   
gi|460385326|ref|XP_004238355.1| PREDICTED: AP-2 complex subunit...   201   7e-50   Solanum lycopersicum
gi|221115717|ref|XP_002157396.1| PREDICTED: AP-2 complex subunit...   201   7e-50   Hydra vulgaris
gi|424513332|emb|CCO65954.1| predicted protein [Bathycoccus pras...   201   7e-50   Bathycoccus prasinos
gi|241730132|ref|XP_002412265.1| clathrin adaptor complex, small...   201   7e-50   Ixodes scapularis [blacklegged tick]
gi|348557867|ref|XP_003464740.1| PREDICTED: AP-2 complex subunit...   201   7e-50   
gi|428181191|gb|EKX50056.1| Adaptor protein complex 2 subunit si...   201   8e-50   Guillardia theta CCMP2712
gi|145519722|ref|XP_001445722.1| hypothetical protein [Parameciu...   200   8e-50   Paramecium tetraurelia strain d4-2
gi|391331217|ref|XP_003740046.1| PREDICTED: AP-2 complex subunit...   200   9e-50   Metaseiulus occidentalis
gi|240849129|ref|NP_001155429.1| clathrin coat assembly protein ...   200   9e-50   Acyrthosiphon pisum
gi|290562477|gb|ADD38634.1| AP-2 complex subunit sigma [Lepeopht...   200   9e-50   Lepeophtheirus salmonis
gi|474376929|gb|EMS64227.1| AP-2 complex subunit sigma [Triticum...   200   9e-50   Triticum urartu
gi|384248781|gb|EIE22264.1| putative clathrin coat assembly prot...   200   1e-49   Coccomyxa subellipsoidea C-169
gi|432890272|ref|XP_004075449.1| PREDICTED: AP-2 complex subunit...   200   1e-49   
gi|47225038|emb|CAF97453.1| unnamed protein product [Tetraodon n...   199   1e-49   Tetraodon nigroviridis
gi|302142656|emb|CBI19859.3| unnamed protein product [Vitis vini...   199   1e-49   Vitis vinifera
gi|339236459|ref|XP_003379784.1| AP-2 complex subunit sigma [Tri...   199   1e-49   Trichinella spiralis
gi|301775354|ref|XP_002923090.1| PREDICTED: AP-2 complex subunit...   199   2e-49   Ailuropoda melanoleuca
gi|145491883|ref|XP_001431940.1| hypothetical protein [Parameciu...   199   2e-49   Paramecium tetraurelia strain d4-2
gi|225457985|ref|XP_002275803.1| PREDICTED: AP-2 complex subunit...   199   2e-49   Vitis vinifera
gi|198426268|ref|XP_002126503.1| PREDICTED: AP-2 complex subunit...   199   2e-49   Ciona intestinalis [sea vase]
gi|17551440|ref|NP_508767.1| Protein APS-2 [Caenorhabditis elega...   199   2e-49   Caenorhabditis elegans [roundworm]
gi|360044484|emb|CCD82032.1| putative clathrin coat assembly pro...   199   2e-49   Schistosoma mansoni
gi|256077833|ref|XP_002575204.1| clathrin coat assembly protein ...   199   2e-49   
gi|349979408|dbj|GAA41671.1| AP-2 complex subunit sigma-1 [Clono...   199   2e-49   Clonorchis sinensis [oriental liver fluke]
gi|443700628|gb|ELT99508.1| hypothetical protein CAPTEDRAFT_1085...   199   3e-49   Capitella teleta
gi|302847048|ref|XP_002955059.1| hypothetical protein VOLCADRAFT...   199   3e-49   Volvox carteri f. nagariensis
gi|308321949|gb|ADO28112.1| AP-2 complex subunit sigma [Ictaluru...   198   3e-49   Ictalurus furcatus
gi|226492775|ref|NP_001148376.1| clathrin coat assembly protein ...   198   4e-49   Zea mays [maize]
gi|167518065|ref|XP_001743373.1| hypothetical protein [Monosiga ...   198   4e-49   Monosiga brevicollis MX1
gi|391332932|ref|XP_003740880.1| PREDICTED: AP-2 complex subunit...   198   5e-49   Metaseiulus occidentalis
gi|255079040|ref|XP_002503100.1| predicted protein [Micromonas s...   198   5e-49   Micromonas commoda
gi|1809320|gb|AAB46980.1| clathrin-associated protein 17 [Rattus...   198   5e-49   Rattus norvegicus [brown rat]
gi|294887926|ref|XP_002772285.1| AP-2 complex subunit sigma, put...   197   6e-49   Perkinsus marinus ATCC 50983
gi|147835478|emb|CAN68414.1| hypothetical protein VITISV_034781 ...   197   6e-49   Vitis vinifera
gi|146183579|ref|XP_001026490.2| Clathrin adaptor complex small ...   197   7e-49   Tetrahymena thermophila SB210
gi|281353691|gb|EFB29275.1| hypothetical protein PANDA_012174 [A...   197   9e-49   Ailuropoda melanoleuca
gi|403299096|ref|XP_003940327.1| PREDICTED: AP-2 complex subunit...   197   1e-48   Saimiri boliviensis boliviensis
gi|340381140|ref|XP_003389079.1| PREDICTED: AP-2 complex subunit...   197   1e-48   Amphimedon queenslandica
gi|313220392|emb|CBY31246.1| unnamed protein product [Oikopleura...   196   1e-48   Oikopleura dioica
gi|224007261|ref|XP_002292590.1| AP17, clathrin adaptor complex ...   196   1e-48   Thalassiosira pseudonana CCMP1335
gi|168053306|ref|XP_001779078.1| predicted protein [Physcomitrel...   196   1e-48   Physcomitrella patens
gi|313232851|emb|CBY09534.1| unnamed protein product [Oikopleura...   196   2e-48   Oikopleura dioica
gi|170580259|ref|XP_001895184.1| clathrin adaptor complex small ...   196   2e-48   Brugia malayi [agent of lymphatic filariasis]
gi|11999128|gb|AAG43052.1|AF228055_1 adaptor protein complex AP-...   195   3e-48   Drosophila melanogaster
gi|145499839|ref|XP_001435904.1| hypothetical protein [Parameciu...   195   3e-48   Paramecium tetraurelia strain d4-2
gi|219125917|ref|XP_002183216.1| predicted protein [Phaeodactylu...   195   4e-48   Phaeodactylum tricornutum CCAP 1055/1
gi|471233408|ref|XP_004037711.1| hypothetical protein IMG5_04237...   195   4e-48   Ichthyophthirius multifiliis
gi|303283648|ref|XP_003061115.1| predicted protein [Micromonas p...   195   4e-48   Micromonas pusilla CCMP1545
gi|294874896|ref|XP_002767141.1| AP-2 complex subunit sigma, put...   194   7e-48   Perkinsus marinus ATCC 50983
gi|475552655|gb|EMT11832.1| AP-2 complex subunit sigma-1 [Aegilo...   193   1e-47   Aegilops tauschii
gi|397567875|gb|EJK45830.1| hypothetical protein THAOC_35532, pa...   192   2e-47   Thalassiosira oceanica
gi|344230500|gb|EGV62385.1| hypothetical protein CANTEDRAFT_1076...   191   4e-47   Candida tenuis ATCC 10573
gi|470411899|ref|XP_004336416.1| AP2 complex subunit sigma, puta...   191   7e-47   Acanthamoeba castellanii str. Neff
gi|294943807|ref|XP_002783966.1| AP-2 complex subunit sigma, put...   189   2e-46   Perkinsus marinus ATCC 50983
gi|325181606|emb|CCA16056.1| conserved unknown protein putative ...   189   2e-46   Albugo laibachii Nc14
gi|47115580|sp|O50016.1|AP2S1_MAIZE RecName: Full=AP-2 complex s...   189   2e-46   Zea mays [maize]
gi|470527792|ref|XP_004357447.1| AP2 complex subunit sigma, puta...   188   4e-46   Acanthamoeba castellanii str. Neff
gi|465956715|gb|EMP27082.1| AP-2 complex subunit sigma [Chelonia...   187   9e-46   Chelonia mydas [green seaturtle]
gi|308812392|ref|XP_003083503.1| KPYC_SOLTU Pyruvate kinase, cyt...   187   9e-46   Ostreococcus tauri
gi|320583353|gb|EFW97568.1| vesicle-mediated transport-related p...   186   1e-45   
gi|299473246|emb|CBN77646.1| conserved unknown protein [Ectocarp...   185   3e-45   Ectocarpus siliculosus
gi|307108172|gb|EFN56413.1| hypothetical protein CHLNCDRAFT_1450...   184   5e-45   Chlorella variabilis
gi|406604940|emb|CCH43613.1| AP-2 complex subunit sigma [Wickerh...   184   6e-45   Wickerhamomyces ciferrii
gi|190345822|gb|EDK37770.2| hypothetical protein PGUG_01868 [Mey...   184   8e-45   Meyerozyma guilliermondii ATCC 6260
gi|260943902|ref|XP_002616249.1| hypothetical protein CLUG_03490...   184   8e-45   Clavispora lusitaniae ATCC 42720
gi|354545173|emb|CCE41900.1| hypothetical protein CPAR2_804500 [...   183   1e-44   Candida parapsilosis
gi|448510098|ref|XP_003866277.1| hypothetical protein CORT_0A044...   182   2e-44   Candida orthopsilosis Co 90-125
gi|254572357|ref|XP_002493288.1| Small subunit of the clathrin-a...   182   3e-44   Komagataella phaffii GS115
gi|348683694|gb|EGZ23509.1| clathrin adaptor complex-like protei...   181   4e-44   Phytophthora sojae
gi|403333437|gb|EJY65816.1| Clathrin adaptor complex, small subu...   181   5e-44   Oxytricha trifallax
gi|308198160|ref|XP_001386883.2| predicted protein [Scheffersomy...   181   6e-44   Scheffersomyces stipitis CBS 6054
gi|351697943|gb|EHB00862.1| AP-2 complex subunit sigma [Heteroce...   181   7e-44   Heterocephalus glaber [naked mole rat]
gi|146420483|ref|XP_001486197.1| hypothetical protein PGUG_01868...   180   1e-43   Meyerozyma guilliermondii ATCC 6260
gi|30851514|gb|AAH52499.1| Adaptor-related protein complex 2, si...   180   1e-43   Mus musculus [mouse]
gi|294658465|ref|XP_460809.2| DEHA2F10230p [Debaryomyces hanseni...   178   3e-43   Debaryomyces hansenii CBS767
gi|308161532|gb|EFO63974.1| Sigma adaptin [Giardia lamblia P15]       178   4e-43   Giardia lamblia P15
gi|68486047|ref|XP_713040.1| potential clathrin-associated prote...   178   5e-43   Candida albicans SC5314
gi|253743623|gb|EES99971.1| Sigma adaptin [Giardia intestinalis ...   178   5e-43   Giardia intestinalis ATCC 50581
gi|241950053|ref|XP_002417749.1| clathrin assembly protein 2 sma...   177   6e-43   Candida dubliniensis CD36
gi|159111182|ref|XP_001705823.1| Sigma adaptin [Giardia lamblia ...   177   8e-43   Giardia lamblia ATCC 50803
gi|326480387|gb|EGE04397.1| clathrin coat assembly protein ap17 ...   177   1e-42   Trichophyton equinum CBS 127.97
gi|344302121|gb|EGW32426.1| hypothetical protein SPAPADRAFT_1389...   177   1e-42   Spathaspora passalidarum NRRL Y-27907
gi|255728489|ref|XP_002549170.1| AP-2 complex subunit sigma [Can...   176   1e-42   Candida tropicalis MYA-3404
gi|238878422|gb|EEQ42060.1| AP-2 complex subunit sigma [Candida ...   176   1e-42   Candida albicans WO-1
gi|448089624|ref|XP_004196857.1| Piso0_004085 [Millerozyma farin...   175   3e-42   Millerozyma farinosa CBS 7064
gi|300175483|emb|CBK20794.2| unnamed protein product [Blastocyst...   173   1e-41   Blastocystis hominis
gi|67483790|ref|XP_657115.1| Clathrin adaptor complex small chai...   173   2e-41   Entamoeba histolytica HM-1:IMSS
gi|471203248|ref|XP_004258445.1| AP-2 complex subunit sigma, put...   172   3e-41   Entamoeba invadens IP1
gi|154414325|ref|XP_001580190.1| clathrin coat assembly protein ...   172   3e-41   Trichomonas vaginalis G3
gi|469609963|gb|AGH62054.1| AP-2 complex subunit sigma [Trypanos...   172   3e-41   Trypanosoma grayi
gi|123502088|ref|XP_001328220.1| clathrin coat assembly protein ...   171   4e-41   Trichomonas vaginalis G3
gi|44889992|emb|CAF32110.1| clathrin coat assembly protein, puta...   170   1e-40   Aspergillus fumigatus
gi|123400222|ref|XP_001301621.1| clathrin coat assembly protein ...   169   2e-40   Trichomonas vaginalis G3
gi|401428607|ref|XP_003878786.1| putative clathrin coat assembly...   169   3e-40   Leishmania mexicana MHOM/GT/2001/U1103
gi|410079487|ref|XP_003957324.1| hypothetical protein KAFR_0E003...   168   5e-40   Kazachstania africana CBS 2517
gi|223948393|gb|ACN28280.1| unknown [Zea mays] >gi|414873201|tpg...   168   6e-40   Zea mays [maize]
gi|302809017|ref|XP_002986202.1| hypothetical protein SELMODRAFT...   167   6e-40   Selaginella moellendorffii
gi|209154306|gb|ACI33385.1| AP-2 complex subunit sigma-1 [Salmo ...   167   7e-40   Salmo salar
gi|414873202|tpg|DAA51759.1| TPA: AP-1 complex subunit sigma-2 [...   167   8e-40   Zea mays [maize]
gi|357112902|ref|XP_003558244.1| PREDICTED: AP-1 complex subunit...   167   8e-40   Brachypodium distachyon [annual false brome]
gi|71660146|ref|XP_821791.1| clathrin coat assembly protein AP17...   167   1e-39   Trypanosoma cruzi strain CL Brener
gi|108711414|gb|ABF99209.1| Adapter-related protein complex 1 si...   167   1e-39   Oryza sativa Japonica Group [Japonica rice]
gi|168051195|ref|XP_001778041.1| predicted protein [Physcomitrel...   166   1e-39   Physcomitrella patens
gi|474357009|gb|EMS63145.1| AP-1 complex subunit sigma-1 [Tritic...   166   2e-39   Triticum urartu
gi|513237819|ref|XP_003643618.2| PREDICTED: uncharacterized prot...   166   2e-39   
gi|414878314|tpg|DAA55445.1| TPA: hypothetical protein ZEAMMB73_...   166   2e-39   
gi|471401615|ref|XP_004383433.1| PREDICTED: AP-2 complex subunit...   166   3e-39   
gi|255546658|ref|XP_002514388.1| clathrin coat assembly protein ...   165   3e-39   
gi|406657700|gb|AFS50008.1| AP-1 complex subunit sigma-2-like pr...   165   3e-39   
gi|218193851|gb|EEC76278.1| hypothetical protein OsI_13777 [Oryz...   165   3e-39   
gi|115456139|ref|NP_001051670.1| Os03g0811300 [Oryza sativa Japo...   165   4e-39   
gi|302806725|ref|XP_002985094.1| hypothetical protein SELMODRAFT...   165   4e-39   
gi|226503071|ref|NP_001148359.1| AP-1 complex subunit sigma-2 [Z...   165   4e-39   
gi|195053858|ref|XP_001993843.1| GH18926 [Drosophila grimshawi] ...   165   4e-39   
gi|475623660|gb|EMT32315.1| AP-1 complex subunit sigma-2 [Aegilo...   164   5e-39   
gi|512903824|ref|XP_004925712.1| PREDICTED: AP-2 complex subunit...   164   5e-39   
gi|444315812|ref|XP_004178563.1| hypothetical protein TBLA_0B020...   164   6e-39   
gi|146099192|ref|XP_001468581.1| putative clathrin coat assembly...   164   6e-39   
gi|460408858|ref|XP_004249858.1| PREDICTED: AP-1 complex subunit...   164   6e-39   
gi|115455737|ref|NP_001051469.1| Os03g0783700 [Oryza sativa Japo...   164   7e-39   
gi|297739027|emb|CBI28516.3| unnamed protein product [Vitis vini...   164   8e-39   
gi|225425515|ref|XP_002263114.1| PREDICTED: AP-1 complex subunit...   164   8e-39   
gi|428175508|gb|EKX44398.1| clathrin assembly protein [Guillardi...   164   8e-39   
gi|351722941|ref|NP_001238029.1| uncharacterized protein LOC1004...   164   8e-39   
gi|157875929|ref|XP_001686331.1| putative clathrin coat assembly...   163   1e-38   
gi|353441142|gb|AEQ94155.1| clathrin adaptor complex family prot...   163   1e-38   
gi|302143840|emb|CBI22701.3| unnamed protein product [Vitis vini...   163   1e-38   
gi|462395804|gb|EMJ01603.1| hypothetical protein PRUPE_ppa012622...   163   1e-38   
gi|225464497|ref|XP_002269251.1| PREDICTED: AP-1 complex subunit...   163   1e-38   
gi|405978279|gb|EKC42684.1| AP-2 complex subunit sigma [Crassost...   163   2e-38   
gi|164658958|ref|XP_001730604.1| hypothetical protein MGL_2400 [...   163   2e-38   
gi|168033991|ref|XP_001769497.1| predicted protein [Physcomitrel...   163   2e-38   
gi|508723955|gb|EOY15852.1| Clathrin adaptor complex small chain...   163   2e-38   
gi|50288901|ref|XP_446880.1| hypothetical protein [Candida glabr...   163   2e-38   
gi|498950933|ref|XP_004543729.1| PREDICTED: AP-2 complex subunit...   162   2e-38   
gi|154336459|ref|XP_001564465.1| putative clathrin coat assembly...   162   3e-38   
gi|151945126|gb|EDN63377.1| clathrin associated protein complex ...   162   4e-38   
gi|347300451|ref|NP_001231382.1| AP-2 complex subunit sigma isof...   162   4e-38   
gi|15237005|ref|NP_195267.1| AP-1 complex subunit sigma-2 [Arabi...   161   4e-38   
gi|242037657|ref|XP_002466223.1| hypothetical protein SORBIDRAFT...   161   5e-38   
gi|357495613|ref|XP_003618095.1| Clathrin assembly small subunit...   161   5e-38   
gi|482553255|gb|EOA17448.1| hypothetical protein CARUB_v10005766...   161   5e-38   
gi|217071666|gb|ACJ84193.1| unknown [Medicago truncatula]             161   5e-38   
gi|18398407|ref|NP_565415.1| AP-1 complex subunit sigma-1 [Arabi...   161   5e-38   
gi|254585255|ref|XP_002498195.1| ZYRO0G04532p [Zygosaccharomyces...   161   6e-38   
gi|68071689|ref|XP_677758.1| clathrin assembly protein AP19 [Pla...   161   6e-38   
gi|297832344|ref|XP_002884054.1| hypothetical protein ARALYDRAFT...   161   6e-38   
gi|226505938|ref|NP_001151826.1| LOC100285461 [Zea mays] >gi|195...   161   6e-38   
gi|508707060|gb|EOX98956.1| Clathrin adaptor complex small chain...   161   6e-38   
gi|401625024|gb|EJS43050.1| aps2p [Saccharomyces arboricola H-6]      161   7e-38   
gi|502134135|ref|XP_004502012.1| PREDICTED: AP-1 complex subunit...   161   7e-38   
gi|56759138|gb|AAW27709.1| SJCHGC04812 protein [Schistosoma japo...   161   7e-38   
gi|224121234|ref|XP_002318532.1| predicted protein [Populus tric...   160   7e-38   
gi|29841297|gb|AAP06329.1| similar to GenBank Accession Number Q...   160   8e-38   
gi|6322518|ref|NP_012592.1| Aps2p [Saccharomyces cerevisiae S288...   160   9e-38   
gi|149246798|ref|XP_001527824.1| AP-2 complex subunit sigma [Lod...   160   1e-37   
gi|367015156|ref|XP_003682077.1| hypothetical protein TDEL_0F005...   160   1e-37   
gi|403216592|emb|CCK71088.1| hypothetical protein KNAG_0G00300 [...   160   1e-37   
gi|388516467|gb|AFK46295.1| unknown [Lotus japonicus]                 160   1e-37   
gi|224127562|ref|XP_002320105.1| predicted protein [Populus tric...   160   1e-37   
gi|357112904|ref|XP_003558245.1| PREDICTED: AP-1 complex subunit...   160   1e-37   
gi|299469872|emb|CBN76726.1| Clathrin assembly complex, small su...   160   1e-37   
gi|502147493|ref|XP_004506804.1| PREDICTED: AP-1 complex subunit...   160   2e-37   
gi|221056088|ref|XP_002259182.1| Clathrin assembly protein AP19 ...   159   2e-37   
gi|1762309|gb|AAB39510.1| AP-1 Golgi-related complex component; ...   159   2e-37   
gi|321265642|ref|XP_003197537.1| hypothetical protein CGB_N2191W...   159   2e-37   
gi|124803952|ref|XP_001347858.1| clathrin assembly protein AP19,...   159   2e-37   
gi|2231698|gb|AAB96887.1| clathrin assembly protein AP19 [Arabid...   159   2e-37   
gi|396582356|gb|AFN88219.1| putative clathrin coat assembly prot...   159   2e-37   
gi|301115842|ref|XP_002905650.1| AP-2 complex subunit sigma-1 [P...   159   2e-37   
gi|156098534|ref|XP_001615299.1| clathrin assembly protein AP19 ...   159   3e-37   
gi|302809021|ref|XP_002986204.1| hypothetical protein SELMODRAFT...   158   5e-37   
gi|462406593|gb|EMJ12057.1| hypothetical protein PRUPE_ppa015306...   158   5e-37   
gi|330804414|ref|XP_003290190.1| hypothetical protein DICPUDRAFT...   158   6e-37   
gi|449453636|ref|XP_004144562.1| PREDICTED: AP-1 complex subunit...   157   6e-37   
gi|502098228|ref|XP_004491184.1| PREDICTED: AP-1 complex subunit...   157   8e-37   
gi|470530207|ref|XP_004368201.1| AP-1 complex subunit sigma-2, p...   157   1e-36   
gi|224065617|ref|XP_002301886.1| predicted protein [Populus tric...   157   1e-36   
gi|166240177|ref|XP_001733048.1| sigma adaptin [Dictyostelium di...   157   1e-36   
gi|388495676|gb|AFK35904.1| unknown [Lotus japonicus]                 157   1e-36   
gi|366995631|ref|XP_003677579.1| hypothetical protein NCAS_0G034...   155   3e-36   
gi|470107529|ref|XP_004290097.1| PREDICTED: AP-1 complex subunit...   155   4e-36   
gi|357493601|ref|XP_003617089.1| AP-1 complex subunit sigma-2 [M...   154   6e-36   
gi|118482584|gb|ABK93212.1| unknown [Populus trichocarpa]             154   6e-36   
gi|307107271|gb|EFN55514.1| hypothetical protein CHLNCDRAFT_5967...   154   7e-36   
gi|414878315|tpg|DAA55446.1| TPA: hypothetical protein ZEAMMB73_...   154   7e-36   
gi|255712127|ref|XP_002552346.1| KLTH0C02706p [Lachancea thermot...   154   7e-36   
gi|356499273|ref|XP_003518466.1| PREDICTED: AP-1 complex subunit...   154   8e-36   
gi|82594963|ref|XP_725648.1| clathrin assembly protein AP19, sma...   154   8e-36   
gi|156839822|ref|XP_001643598.1| hypothetical protein Kpol_1073p...   154   9e-36   
gi|358058548|dbj|GAA95511.1| hypothetical protein E5Q_02166 [Mix...   154   1e-35   
gi|399217149|emb|CCF73836.1| unnamed protein product [Babesia mi...   154   1e-35   
gi|485607279|gb|EOD06805.1| Aps1, sigma subunit of the adaptin 1...   153   1e-35   
gi|291001687|ref|XP_002683410.1| predicted protein [Naegleria gr...   153   1e-35   
gi|198433222|ref|XP_002122331.1| PREDICTED: AP-1 complex subunit...   153   1e-35   
gi|365985736|ref|XP_003669700.1| hypothetical protein NDAI_0D014...   153   1e-35   
gi|302809990|ref|XP_002986687.1| hypothetical protein SELMODRAFT...   153   1e-35   
gi|367007567|ref|XP_003688513.1| hypothetical protein TPHA_0O011...   153   2e-35   
gi|325183550|emb|CCA18011.1| Clathrin assembly complex putative ...   153   2e-35   
gi|67587733|ref|XP_665272.1| clathrin assembly protein AP19 [Cry...   152   2e-35   
gi|395328818|gb|EJF61208.1| Adaptor protein complex sigma subuni...   152   3e-35   
gi|66361296|ref|XP_627295.1| Aps1p/AP17 like clathrin adaptor pr...   152   3e-35   
gi|299747736|ref|XP_001837225.2| hypothetical protein CC1G_00361...   152   4e-35   
gi|392568818|gb|EIW61992.1| Adaptor protein complex sigma subuni...   151   5e-35   
gi|470241428|ref|XP_004352289.1| sigma adaptin [Dictyostelium fa...   151   5e-35   
gi|449549786|gb|EMD40751.1| hypothetical protein CERSUDRAFT_2605...   151   5e-35   
gi|255079926|ref|XP_002503543.1| predicted protein [Micromonas s...   151   5e-35   
gi|302783394|ref|XP_002973470.1| hypothetical protein SELMODRAFT...   151   5e-35   
gi|170091850|ref|XP_001877147.1| predicted protein [Laccaria bic...   151   6e-35   
gi|390601064|gb|EIN10458.1| Adaptor protein complex sigma subuni...   151   6e-35   
gi|343429831|emb|CBQ73403.1| probable APS1-AP-1 complex subunit,...   151   6e-35   
gi|395526904|ref|XP_003765594.1| PREDICTED: AP-1 complex subunit...   151   7e-35   
gi|409079755|gb|EKM80116.1| hypothetical protein AGABI1DRAFT_113...   150   7e-35   
gi|390358083|ref|XP_792185.3| PREDICTED: AP-1 complex subunit si...   150   8e-35   
gi|390358085|ref|XP_003729176.1| PREDICTED: AP-1 complex subunit...   150   8e-35   
gi|501308700|dbj|GAC97594.1| hypothetical protein PHSY_005180 [P...   150   8e-35   
gi|390370563|ref|XP_797938.3| PREDICTED: AP-1 complex subunit si...   150   1e-34   
gi|393215503|gb|EJD00994.1| Adaptor protein complex sigma subuni...   150   1e-34   
gi|255549138|ref|XP_002515624.1| clathrin coat assembly protein ...   150   2e-34   
gi|290562383|gb|ADD38588.1| AP-1 complex subunit sigma-1A [Lepeo...   149   2e-34   
gi|336386353|gb|EGO27499.1| hypothetical protein SERLADRAFT_4610...   149   2e-34   
gi|291407126|ref|XP_002719966.1| PREDICTED: adaptor-related prot...   149   2e-34   
gi|336373533|gb|EGO01871.1| hypothetical protein SERLA73DRAFT_13...   149   2e-34   
gi|392574191|gb|EIW67328.1| hypothetical protein TREMEDRAFT_4530...   149   2e-34   
gi|60458787|dbj|BAD90690.1| sigma1 subunit of AP-1 complex of cl...   149   2e-34   
gi|71017841|ref|XP_759151.1| hypothetical protein UM03004.1 [Ust...   149   3e-34   
gi|53133198|emb|CAG31971.1| hypothetical protein RCJMB04_14n22 [...   149   3e-34   
gi|147898683|ref|NP_001088344.1| adaptor-related protein complex...   149   3e-34   
gi|512922498|ref|XP_004904746.1| PREDICTED: AP-1 complex subunit...   149   3e-34   
gi|512922502|ref|XP_004904747.1| PREDICTED: AP-1 complex subunit...   149   3e-34   
gi|12005732|gb|AAG44595.1|AF251295_1 DC22 [Homo sapiens]              149   3e-34   
gi|401411663|ref|XP_003885279.1| Ap4s1 protein, related [Neospor...   149   3e-34   
gi|395838120|ref|XP_003791972.1| PREDICTED: uncharacterized prot...   149   3e-34   
gi|426395279|ref|XP_004063902.1| PREDICTED: uncharacterized prot...   149   3e-34   
gi|512922494|ref|XP_004904745.1| PREDICTED: AP-1 complex subunit...   149   4e-34   
gi|483519549|gb|EOB05297.1| AP-1 complex subunit sigma-2, partia...   148   4e-34   
gi|488582627|ref|XP_004476721.1| PREDICTED: AP-1 complex subunit...   148   4e-34   
gi|390479547|ref|XP_002762700.2| PREDICTED: AP-1 complex subunit...   148   4e-34   
gi|57525488|ref|NP_001006261.1| AP-1 complex subunit sigma-2 [Ga...   148   4e-34   
gi|30584173|gb|AAP36335.1| Homo sapiens adaptor-related protein ...   148   4e-34   
gi|62857949|ref|NP_001016579.1| adaptor-related protein complex ...   148   4e-34   
gi|119614772|gb|EAW94366.1| hCG2000493, isoform CRA_a [Homo sapi...   148   4e-34   
gi|512922505|ref|XP_004904748.1| PREDICTED: AP-1 complex subunit...   148   4e-34   
gi|119619309|gb|EAW98903.1| adaptor-related protein complex 1, s...   148   4e-34   
gi|119614773|gb|EAW94367.1| hCG2000493, isoform CRA_b [Homo sapi...   148   4e-34   
gi|340370292|ref|XP_003383680.1| PREDICTED: AP-1 complex subunit...   148   4e-34   
gi|94966974|ref|NP_001035681.1| AP-1 complex subunit sigma-2 [Bo...   148   4e-34   
gi|119619312|gb|EAW98906.1| adaptor-related protein complex 1, s...   148   4e-34   
gi|449270923|gb|EMC81566.1| AP-1 complex subunit sigma-2, partia...   148   4e-34   
gi|302696459|ref|XP_003037908.1| hypothetical protein SCHCODRAFT...   148   4e-34   
gi|40254484|ref|NP_081163.2| AP-1 complex subunit sigma-2 [Mus m...   148   4e-34   
gi|119619311|gb|EAW98905.1| adaptor-related protein complex 1, s...   148   4e-34   
gi|22027655|ref|NP_003907.3| AP-1 complex subunit sigma-2 isofor...   148   4e-34   
gi|344288571|ref|XP_003416021.1| PREDICTED: AP-1 complex subunit...   148   4e-34   
gi|302564681|ref|NP_001181839.1| AP-1 complex subunit sigma-2 [M...   148   4e-34   
gi|351712655|gb|EHB15574.1| AP-1 complex subunit sigma-2, partia...   148   4e-34   
gi|194389590|dbj|BAG61756.1| unnamed protein product [Homo sapiens]   148   4e-34   
gi|444707446|gb|ELW48721.1| AP-1 complex subunit sigma-2 [Tupaia...   148   5e-34   
gi|119619310|gb|EAW98904.1| adaptor-related protein complex 1, s...   148   5e-34   
gi|348554505|ref|XP_003463066.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|513009505|ref|XP_004866174.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|281340364|gb|EFB15948.1| hypothetical protein PANDA_020066 [A...   148   5e-34   
gi|149035841|gb|EDL90508.1| adaptor-related protein complex 1, s...   148   5e-34   
gi|488582633|ref|XP_004476724.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|327268313|ref|XP_003218942.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|148708821|gb|EDL40768.1| adaptor-related protein complex 1, s...   148   5e-34   
gi|511877986|ref|XP_004758952.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|353234998|emb|CCA67017.1| probable APS1-AP-1 complex subunit,...   148   5e-34   
gi|507642339|ref|XP_004701868.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|134026028|gb|AAI35369.1| LOC733931 protein [Xenopus (Silurana...   148   5e-34   
gi|426384430|ref|XP_004058771.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|340370294|ref|XP_003383681.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|294894426|ref|XP_002774827.1| clathrin coat assembly protein ...   148   5e-34   
gi|397468610|ref|XP_003805970.1| PREDICTED: AP-1 complex subunit...   148   5e-34   
gi|229367864|gb|ACQ58912.1| AP-1 complex subunit sigma-2 [Anoplo...   148   6e-34   
gi|303272459|ref|XP_003055591.1| predicted protein [Micromonas p...   147   6e-34   
gi|365759899|gb|EHN01659.1| Aps2p [Saccharomyces cerevisiae x Sa...   147   6e-34   
gi|45433520|ref|NP_991121.1| AP-1 complex subunit sigma-2 [Danio...   147   7e-34   
gi|513028492|ref|XP_004875372.1| PREDICTED: LOW QUALITY PROTEIN:...   147   7e-34   
gi|301171303|ref|NP_001180334.1| adaptor-related protein complex...   147   7e-34   
gi|229366010|gb|ACQ57985.1| AP-1 complex subunit sigma-2 [Anoplo...   147   7e-34   
gi|403266748|ref|XP_003925525.1| PREDICTED: AP-1 complex subunit...   147   7e-34   
gi|154341088|ref|XP_001566497.1| putative sigma adaptin [Leishma...   147   7e-34   
gi|72387135|ref|XP_843992.1| clathrin coat assembly protein AP19...   147   7e-34   
gi|488522536|ref|XP_004453170.1| PREDICTED: AP-1 complex subunit...   147   7e-34   
gi|221041176|dbj|BAH12265.1| unnamed protein product [Homo sapiens]   147   8e-34   
gi|472389218|ref|XP_004413933.1| PREDICTED: AP-1 complex subunit...   147   8e-34   
gi|345567574|gb|EGX50504.1| hypothetical protein AOL_s00075g233 ...   147   8e-34   
gi|389746932|gb|EIM88111.1| Adaptor protein complex sigma subuni...   147   8e-34   
gi|432856149|ref|XP_004068378.1| PREDICTED: AP-1 complex subunit...   147   8e-34   
gi|393246110|gb|EJD53619.1| Adaptor protein complex sigma subuni...   147   8e-34   
gi|472583854|gb|EMS21470.1| clathrin coat assembly protein ap19 ...   147   8e-34   
gi|449482887|ref|XP_004174980.1| PREDICTED: AP-1 complex subunit...   147   9e-34   
gi|384251674|gb|EIE25151.1| sigma1 subunit of AP-1 complex of cl...   147   1e-33   
gi|465986975|gb|EMP37279.1| AP-1 complex subunit sigma-3, partia...   147   1e-33   
gi|499010012|ref|XP_004557118.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|348504896|ref|XP_003439997.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|499010018|ref|XP_004557120.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|410920826|ref|XP_003973884.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|119591221|gb|EAW70815.1| adaptor-related protein complex 1, s...   147   1e-33   
gi|410920830|ref|XP_003973886.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|465966261|ref|XP_004262695.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|21541959|sp|Q96PC3.1|AP1S3_HUMAN RecName: Full=AP-1 complex s...   147   1e-33   
gi|50303761|ref|XP_451826.1| hypothetical protein [Kluyveromyces...   147   1e-33   
gi|344303958|gb|EGW34207.1| hypothetical protein SPAPADRAFT_5964...   147   1e-33   
gi|31324170|gb|AAP47182.1| sigma adaptin [Leishmania mexicana me...   147   1e-33   
gi|499010006|ref|XP_004557116.1| PREDICTED: AP-1 complex subunit...   147   1e-33   
gi|387915434|gb|AFK11326.1| adaptor-related protein complex 1, s...   147   1e-33   
gi|194386586|dbj|BAG61103.1| unnamed protein product [Homo sapiens]   147   1e-33   
gi|459358802|pdb|4HMY|S Chain S, Structural Basis For Recruitmen...   147   1e-33   
gi|321259393|ref|XP_003194417.1| hypothetical protein CGB_E5510W...   147   1e-33   
gi|58268064|ref|XP_571188.1| hypothetical protein [Cryptococcus ...   147   1e-33   
gi|194380770|dbj|BAG58538.1| unnamed protein product [Homo sapiens]   146   1e-33   
gi|47123241|gb|AAH70003.1| Ap1s1 protein [Danio rerio]                146   1e-33   
gi|348500851|ref|XP_003437985.1| PREDICTED: AP-1 complex subunit...   146   1e-33   
gi|4557471|ref|NP_001274.1| AP-1 complex subunit sigma-1A [Homo ...   146   1e-33   
gi|194218868|ref|XP_001492588.2| PREDICTED: AP-1 complex subunit...   146   2e-33   
gi|134112349|ref|XP_775149.1| hypothetical protein CNBE4230 [Cry...   146   2e-33   
gi|88703051|ref|NP_001034658.1| AP-1 complex subunit sigma-3 [Ho...   146   2e-33   
gi|58268066|ref|XP_571189.1| hypothetical protein [Cryptococcus ...   146   2e-33   
gi|410910644|ref|XP_003968800.1| PREDICTED: AP-1 complex subunit...   146   2e-33   
gi|296205718|ref|XP_002749969.1| PREDICTED: AP-1 complex subunit...   146   2e-33   
gi|225706432|gb|ACO09062.1| AP-1 complex subunit sigma-2 [Osmeru...   146   2e-33   
gi|62988779|gb|AAY24166.1| unknown [Homo sapiens]                     146   2e-33   
gi|237830517|ref|XP_002364556.1| clathrin coat assembly protein ...   146   2e-33   


>gi|511007955|gb|EPB89231.1| AP-2 complex subunit sigma [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 143

 Score =  286 bits (733), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 137/143 (95%), Positives = 143/143 (100%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+RFILVQNRQGKTRL+KWYVPYEDEEKVKLKGEVHRL+APRDQKHQSNFVEFRNYK+VY
Sbjct: 1   MLRFILVQNRQGKTRLAKWYVPYEDEEKVKLKGEVHRLIAPRDQKHQSNFVEFRNYKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNEL+YLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELSYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSKN+VLTRLDHLDKLE
Sbjct: 121 AGEIEETSKNVVLTRLDHLDKLE 143



>gi|440472313|gb|ELQ41183.1| vacuolar protein-sorting protein BRO1 [Magnaporthe oryzae Y34]
 gi|440483111|gb|ELQ63546.1| vacuolar protein-sorting protein BRO1 [Magnaporthe oryzae P131]
          Length = 1173

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 127/143 (88%), Positives = 136/143 (95%)

Query: 1    MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
            M+ FIL+QNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1031 MLSFILIQNRQGKTRLAKWYAPYSDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKLVY 1090

Query: 61   RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
            RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 1091 RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 1150

Query: 121  AGEIEETSKNIVLTRLDHLDKLE 143
            AGEIEETSK +VLTRL+HLDKLE
Sbjct: 1151 AGEIEETSKTVVLTRLEHLDKLE 1173



>gi|320591222|gb|EFX03661.1| vacuolar protein-sorting protein bro1 [Grosmannia clavigera kw1407]
          Length = 1078

 Score =  281 bits (720), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 127/143 (88%), Positives = 138/143 (96%)

Query: 1    MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
            M+ FIL+QNRQGKTRL+KWYVPY D+EK+KLKGEVHRLVAPRDQK+QSNFVEFR++KVVY
Sbjct: 936  MLSFILIQNRQGKTRLAKWYVPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEFRDHKVVY 995

Query: 61   RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
            RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 996  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 1055

Query: 121  AGEIEETSKNIVLTRLDHLDKLE 143
            AGEIEETSK +VLTRL+HLDKLE
Sbjct: 1056 AGEIEETSKQVVLTRLEHLDKLE 1078



>gi|367022198|ref|XP_003660384.1| hypothetical protein MYCTH_2054491 [Myceliophthora thermophila ATCC
           42464]
 gi|367045336|ref|XP_003653048.1| hypothetical protein THITE_107262 [Thielavia terrestris NRRL 8126]
 gi|347000310|gb|AEO66712.1| hypothetical protein THITE_107262 [Thielavia terrestris NRRL 8126]
 gi|347007651|gb|AEO55139.1| hypothetical protein MYCTH_2054491 [Myceliophthora thermophila ATCC
           42464]
          Length = 143

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+KLKGE+HRLVAPRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDEEKIKLKGEIHRLVAPRDQKYQSNFVEFRNHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|85108910|ref|XP_962659.1| AP-2 complex subunit sigma [Neurospora crassa OR74A]
 gi|336268076|ref|XP_003348803.1| hypothetical protein SMAC_01826 [Sordaria macrospora k-hell]
 gi|74617209|sp|Q7SAQ1.1|AP2S_NEUCR RecName: Full=AP-2 complex subunit sigma; AltName: Full=Adaptin
           small chain; AltName: Full=Clathrin assembly protein 2
           small chain; AltName: Full=Sigma2-adaptin
 gi|28924270|gb|EAA33423.1| AP-2 complex subunit sigma [Neurospora crassa OR74A]
 gi|336471328|gb|EGO59489.1| clathrin assembly protein 2 small chain [Neurospora tetrasperma
           FGSC 2508]
 gi|380094061|emb|CCC08278.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 143

 Score =  272 bits (695), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+KLKGE+HRLVAPRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDEEKIKLKGEIHRLVAPRDQKYQSNFVEFRNHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|116195880|ref|XP_001223752.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88180451|gb|EAQ87919.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 143

 Score =  272 bits (695), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRNHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|296418629|ref|XP_002838933.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634916|emb|CAZ83124.1| unnamed protein product [Tuber melanosporum]
          Length = 144

 Score =  271 bits (694), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 130/143 (90%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           ++ FIL+QNRQGKTRL+KWY PY+DEEKVKLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYDDEEKVKLKGEVHRLVAPRDQKNQSNFVEFRNNKIVY 61

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 62  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 121

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 AGEIEETSKQVVLTRLEHLDKLE 144



>gi|389745094|gb|EIM86276.1| clathrin coat assembly protein ap17 [Stereum hirsutum FP-91666 SS1]
          Length = 143

 Score =  271 bits (692), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 140/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+DEEKV+L+GEVHRLVAPRDQKHQSNFVEFRNYKVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDEEKVRLRGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVE+LD+FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEILDSFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK++VL+RL+ L+KLE
Sbjct: 121 AGEVEETSKDVVLSRLEQLEKLE 143



>gi|400601884|gb|EJP69509.1| AP-2 complex subunit sigma [Beauveria bassiana ARSEF 2860]
          Length = 265

 Score =  271 bits (692), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ +IL+QNRQGKTRL+KWY P+ DEEK+K+KGEVHRLVAPRDQK+QSNFVEFRN+K+VY
Sbjct: 123 MLSYILIQNRQGKTRLAKWYAPFSDEEKIKVKGEVHRLVAPRDQKYQSNFVEFRNHKIVY 182

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVD NDNELAYLEAIHFFVEVLDAFFGNV ELDLVFNFYKVYAILDEVFL
Sbjct: 183 RRYAGLFFCVCVDTNDNELAYLEAIHFFVEVLDAFFGNVSELDLVFNFYKVYAILDEVFL 242

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK  VLTRL+HLDKLE
Sbjct: 243 AGEIEETSKQAVLTRLEHLDKLE 265



>gi|477528791|gb|ENH80564.1| ap-2 complex subunit sigma [Colletotrichum orbiculare MAFF 240422]
          Length = 143

 Score =  270 bits (691), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|171690862|ref|XP_001910356.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945379|emb|CAP71491.1| unnamed protein product [Podospora anserina S mat+]
          Length = 143

 Score =  270 bits (690), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY D+EKVK+KGEVHRLVAPRDQK+QSNFVEFRN+K+VY
Sbjct: 1   MLNFILIQNRQGKTRLAKWYVPYSDDEKVKVKGEVHRLVAPRDQKYQSNFVEFRNHKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|409075117|gb|EKM75501.1| hypothetical protein AGABI1DRAFT_116341 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426191716|gb|EKV41657.1| hypothetical protein AGABI2DRAFT_196256 [Agaricus bisporus var.
           bisporus H97]
          Length = 143

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 140/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRNYKVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL+RLD L+KLE
Sbjct: 121 AGEIEETSKDVVLSRLDELEKLE 143



>gi|358056244|dbj|GAA97795.1| hypothetical protein E5Q_04474 [Mixia osmundae IAM 14324]
          Length = 722

 Score =  269 bits (688), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 119/143 (83%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+L+QNRQGKTRLSKWY  Y+D++KV+++GEVHRL+APRDQK+QSNFVEFRN+K+VY
Sbjct: 580 MIRFVLIQNRQGKTRLSKWYTGYDDDDKVRIRGEVHRLIAPRDQKYQSNFVEFRNHKIVY 639

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+ VDANDNELAYLEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 640 RRYAGLFFCIGVDANDNELAYLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 699

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK ++L RLD+L+KL+
Sbjct: 700 AGEIEETSKTVILRRLDYLEKLD 722



>gi|471559688|gb|EMR62011.1| putative ap-2 complex subunit sigma protein [Eutypa lata UCREL1]
          Length = 143

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY D+EK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|512189204|gb|EPE04972.1| ap-2 adaptor complex subunit sigma [Ophiostoma piceae UAMH 11346]
          Length = 143

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY D+EK+KLKGE+HRLVAPRDQK+QSNFVEFRN+K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYTDDEKIKLKGEIHRLVAPRDQKYQSNFVEFRNHKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLE IHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEGIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|429862987|gb|ELA37572.1| ap-2 complex subunit sigma [Colletotrichum gloeosporioides Nara
           gc5]
 gi|500258602|gb|EOO01514.1| putative ap-2 complex subunit sigma protein [Togninia minima
           UCRPA7]
          Length = 143

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|389634221|ref|XP_003714763.1| AP-2 complex subunit sigma [Magnaporthe oryzae 70-15]
 gi|351647096|gb|EHA54956.1| AP-2 complex subunit sigma [Magnaporthe oryzae 70-15]
          Length = 143

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKTVVLTRLEHLDKLE 143



>gi|402078729|gb|EJT73994.1| AP-2 complex subunit sigma [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 143

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+K+KGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDEEKIKVKGEVHRLVAPRDQKYQSNFVEFRNNKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKTVVLTRLEHLDKLE 143



>gi|322701702|gb|EFY93451.1| AP-2 complex subunit sigma [Metarhizium acridum CQMa 102]
 gi|322706799|gb|EFY98379.1| AP-2 complex subunit sigma [Metarhizium anisopliae ARSEF 23]
          Length = 143

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D++K+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDDQKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|302895327|ref|XP_003046544.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727471|gb|EEU40831.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|342880302|gb|EGU81468.1| hypothetical protein FOXB_08050 [Fusarium oxysporum Fo5176]
 gi|475662910|gb|EMT60706.1| AP-2 complex subunit sigma [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477510084|gb|ENH63372.1| AP-2 complex subunit sigma [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 143

 Score =  268 bits (685), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY P+ DE+K+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPFSDEQKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|406866627|gb|EKD19666.1| vacuolar protein-sorting protein bro1 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 144

 Score =  268 bits (684), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           ++ FIL+QNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFR +K+VY
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYNDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRTHKIVY 61

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEA+HFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 62  RRYAGLFFCVCVDANDNELAYLEAVHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 121

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK +VLTRL+HLDKLE
Sbjct: 122 AGEVEETSKQVVLTRLEHLDKLE 144



>gi|343425499|emb|CBQ69034.1| probable clathrin coat assembly protein ap17 [Sporisorium reilianum
           SRZ2]
          Length = 143

 Score =  268 bits (684), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 140/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSK+YVPY+DEEK++L+GEVHRL+APRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKFYVPYDDEEKIRLRGEVHRLIAPRDQKYQSNFVEFRNYKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL RLD L+KL+
Sbjct: 121 AGEIEETSKHVVLARLDQLEKLD 143



>gi|154318566|ref|XP_001558601.1| clathrin coat assembly protein [Botryotinia fuckeliana B05.10]
 gi|472235944|gb|EMR80892.1| putative ap-2 complex subunit sigma protein [Botryotinia fuckeliana
           BcDW1]
          Length = 144

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           ++ F+L+QNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 2   VLSFVLIQNRQGKTRLAKWYAPYNDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 61

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVDANDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 62  RRYAGLFFCACVDANDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 121

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 AGEIEETSKQVVLTRLEHLDKLE 144



>gi|310792201|gb|EFQ27728.1| clathrin adaptor complex small chain [Glomerella graminicola
           M1.001]
 gi|340521684|gb|EGR51918.1| adaptor protein complex AP-2 small subunit [Trichoderma reesei
           QM6a]
 gi|358384744|gb|EHK22341.1| hypothetical protein TRIVIDRAFT_28039 [Trichoderma virens Gv29-8]
 gi|380481667|emb|CCF41707.1| AP-2 complex subunit sigma [Colletotrichum higginsianum]
          Length = 143

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|440638698|gb|ELR08617.1| AP-2 complex subunit sigma [Geomyces destructans 20631-21]
          Length = 144

 Score =  268 bits (684), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           ++ FIL+QNRQGKTRL+KWY PY D +K+KLKGEVHRL+APRDQKHQSNFVEFR ++VVY
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYTDADKIKLKGEVHRLIAPRDQKHQSNFVEFRQHRVVY 61

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 62  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 121

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 AGEIEETSKQVVLTRLEHLDKLE 144



>gi|425770087|gb|EKV08561.1| AP-2 complex subunit sigma [Penicillium digitatum Pd1]
 gi|425771634|gb|EKV10071.1| AP-2 complex subunit sigma [Penicillium digitatum PHI26]
          Length = 385

 Score =  267 bits (683), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FI+VQNRQGKTRL+KWY PY DEEK+KLKGEVHRLVAPRDQK+QSNFVEFR + KVV
Sbjct: 242 VLSFIIVQNRQGKTRLAKWYSPYSDEEKIKLKGEVHRLVAPRDQKYQSNFVEFRRSTKVV 301

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 302 YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 361

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 362 LAGEIQETSKQVVLTRLEHLDKLE 385



>gi|494828679|gb|EON65464.1| AP-2 complex subunit sigma [Coniosporium apollinis CBS 100218]
          Length = 145

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 128/144 (88%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY DEEKVKLKGEVHRL+APRDQKHQSNFVEFRN  K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLIAPRDQKHQSNFVEFRNTSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|399170343|emb|CCE28720.1| probable clathrin assembly protein [Claviceps purpurea 20.1]
          Length = 239

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRL+APRDQK+QSNFVEFRN ++VY
Sbjct: 97  MLSFILIQNRQGKTRLAKWYAPYSDDEKIKLKGEVHRLIAPRDQKYQSNFVEFRNNRIVY 156

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEA+HFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 157 RRYAGLFFCACVDTNDNELAYLEALHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 216

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKL+
Sbjct: 217 AGEIEETSKQVVLTRLEHLDKLD 239



>gi|393215998|gb|EJD01489.1| clathrin coat assembly protein ap17 [Fomitiporia mediterranea
           MF3/22]
          Length = 143

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVP++D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRNYKVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPFDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFENVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL+RLD L++LE
Sbjct: 121 AGEIEETSKEVVLSRLDELERLE 143



>gi|340960385|gb|EGS21566.1| hypothetical protein CTHT_0034270 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 143

 Score =  267 bits (682), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+KLKGE+HRLVAPRDQK+QSNFVE+RN KVVY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYTDEEKIKLKGEIHRLVAPRDQKYQSNFVEYRNLKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC  VD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCAGVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|407924618|gb|EKG17651.1| Longin-like protein [Macrophomina phaseolina MS6]
          Length = 145

 Score =  267 bits (682), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY DEEKVKLKGE+HRL+APRDQKHQSNFVEFRN  K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDEEKVKLKGEIHRLIAPRDQKHQSNFVEFRNTSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|189191482|ref|XP_001932080.1| AP-2 complex subunit sigma [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973686|gb|EDU41185.1| AP-2 complex subunit sigma [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 145

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/144 (88%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY DEEKVKLKGEVHRL+APRDQKHQSNFVEFRN  K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLIAPRDQKHQSNFVEFRNMSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLAHLDKLE 145



>gi|46121429|ref|XP_385269.1| hypothetical protein FG05093.1 [Fusarium graminearum PH-1]
 gi|85700951|sp|Q4ICG5.1|AP2S_GIBZE RecName: Full=AP-2 complex subunit sigma; AltName: Full=Adaptin
           small chain; AltName: Full=Clathrin assembly protein 2
           small chain; AltName: Full=Sigma2-adaptin
 gi|408388847|gb|EKJ68525.1| hypothetical protein FPSE_11301 [Fusarium pseudograminearum CS3096]
          Length = 143

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY P+ DE+K+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPFSDEQKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|443900335|dbj|GAC77661.1| clathrin adaptor complex, small subunit [Pseudozyma antarctica
           T-34]
          Length = 143

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 140/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSK+YVPY+D+EK++L+GEVHRL+APRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKFYVPYDDDEKIRLRGEVHRLIAPRDQKYQSNFVEFRNYKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL RLD L+KL+
Sbjct: 121 AGEIEETSKHVVLARLDQLEKLD 143



>gi|358393749|gb|EHK43150.1| hypothetical protein TRIATDRAFT_94532 [Trichoderma atroviride IMI
           206040]
          Length = 143

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELA+LEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|395325463|gb|EJF57885.1| clathrin coat assembly protein ap17 [Dichomitus squalens LYAD-421
           SS1]
          Length = 143

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/143 (89%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL RL+ L+KLE
Sbjct: 121 AGEIEETSKDVVLARLEQLEKLE 143



>gi|336369466|gb|EGN97807.1| hypothetical protein SERLA73DRAFT_182556 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382249|gb|EGO23399.1| hypothetical protein SERLADRAFT_469275 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 143

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+DEEKV+L+GEVHRL+APRDQK+QSNFVEFR++KVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDEEKVRLRGEVHRLIAPRDQKYQSNFVEFRSHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL+RL+ L+KLE
Sbjct: 121 AGEIEETSKEVVLSRLEELEKLE 143



>gi|505757860|gb|EOR01970.1| AP-2 complex subunit sigma [Wallemia ichthyophaga EXF-994]
          Length = 143

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+RFILVQNRQGKTRLSKWYVP EDE+K+KL+GEVHRLVAPRDQKHQSNFVEFRNYKVVY
Sbjct: 1   MLRFILVQNRQGKTRLSKWYVPVEDEDKIKLRGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLE IH FVEVLDAFF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEIIHLFVEVLDAFFSNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK ++L RL++L++LE
Sbjct: 121 AGEIEETSKQVILNRLEYLERLE 143



>gi|169600853|ref|XP_001793849.1| hypothetical protein SNOG_03279 [Phaeosphaeria nodorum SN15]
 gi|111068890|gb|EAT90010.1| hypothetical protein SNOG_03279 [Phaeosphaeria nodorum SN15]
          Length = 145

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/144 (87%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY DEEK+KLKGEVHRL+APRDQKHQSNFVEFRN  K++
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDEEKIKLKGEVHRLIAPRDQKHQSNFVEFRNMSKII 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLAHLDKLE 145



>gi|169868570|ref|XP_001840856.1| clathrin coat assembly protein ap17 [Coprinopsis cinerea
           okayama7#130]
 gi|116498014|gb|EAU80909.1| clathrin coat assembly protein ap17 [Coprinopsis cinerea
           okayama7#130]
          Length = 143

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNYKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVE+LD FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEILDNFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL+RL+ L+KLE
Sbjct: 121 AGEIEETSKDVVLSRLEELEKLE 143



>gi|451853035|gb|EMD66329.1| hypothetical protein COCSADRAFT_34894 [Bipolaris sorokiniana
           ND90Pr]
 gi|452002606|gb|EMD95064.1| hypothetical protein COCHEDRAFT_1129199 [Bipolaris maydis C5]
 gi|477582977|gb|ENI00080.1| hypothetical protein COCC4DRAFT_179709 [Bipolaris maydis ATCC
           48331]
 gi|482808115|gb|EOA85048.1| hypothetical protein SETTUDRAFT_154646 [Setosphaeria turcica Et28A]
          Length = 145

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EKVKLKGEVHRL+APRDQKHQSNFVEFRN  K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDDEKVKLKGEVHRLIAPRDQKHQSNFVEFRNMSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLAHLDKLE 145



>gi|170097225|ref|XP_001879832.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164645235|gb|EDR09483.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 143

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+DEEKV+L+GEVHRLVAPRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDEEKVRLRGEVHRLVAPRDQKYQSNFVEFRNYKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+CVD NDNELAYLEAIH FVEVLD FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCLCVDGNDNELAYLEAIHLFVEVLDQFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL+RL+ L+KLE
Sbjct: 121 AGEIEETSKDVVLSRLEELEKLE 143



>gi|302423036|ref|XP_003009348.1| AP-2 complex subunit sigma [Verticillium albo-atrum VaMs.102]
 gi|261352494|gb|EEY14922.1| AP-2 complex subunit sigma [Verticillium albo-atrum VaMs.102]
 gi|346970509|gb|EGY13961.1| AP-2 complex subunit sigma [Verticillium dahliae VdLs.17]
          Length = 143

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQK+QSNFVE RN K+VY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYAPYSDDEKIKLKGEVHRLVAPRDQKYQSNFVEHRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 121 AGEIEETSKQVVLTRLEHLDKLE 143



>gi|388579833|gb|EIM20153.1| Adaptor protein complex sigma subunit [Wallemia sebi CBS 633.66]
          Length = 143

 Score =  265 bits (676), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+RFILVQNRQGKTRLSKWYVP EDE+K++L+GEVHRLVAPRDQKHQSNFVEFRNYKVVY
Sbjct: 1   MLRFILVQNRQGKTRLSKWYVPVEDEDKIRLRGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVC+DANDNELAYLE IH FVEVLDAFF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCIDANDNELAYLEIIHLFVEVLDAFFSNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK ++L RL++L++LE
Sbjct: 121 AGEIEETSKQVILNRLEYLERLE 143



>gi|449548534|gb|EMD39500.1| hypothetical protein CERSUDRAFT_111812 [Ceriporiopsis subvermispora
           B]
          Length = 143

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRN+K+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNHKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+CVDANDNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCICVDANDNELAYLEAIHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL+RL+ L+KLE
Sbjct: 121 AGEIEETSKEVVLSRLEELEKLE 143



>gi|388857788|emb|CCF48682.1| probable clathrin coat assembly protein ap17 [Ustilago hordei]
          Length = 143

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 140/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSK+YVPY+D+EK++L+GEVHRL+APRDQK+QSNFVEFRN+K+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKFYVPYDDDEKIRLRGEVHRLIAPRDQKYQSNFVEFRNHKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL RLD L+KL+
Sbjct: 121 AGEIEETSKHVVLARLDMLEKLD 143



>gi|255941554|ref|XP_002561546.1| Pc16g12470 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586169|emb|CAP93917.1| Pc16g12470 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 145

 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 129/144 (89%), Positives = 137/144 (95%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEFR + KVV
Sbjct: 2   VLSFILVQNRQGKTRLAKWYSPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFRRSTKVV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|121701189|ref|XP_001268859.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus clavatus
           NRRL 1]
 gi|119397002|gb|EAW07433.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus clavatus
           NRRL 1]
          Length = 145

 Score =  263 bits (673), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 129/144 (89%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEF R+ KVV
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKVV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDA DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDATDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|392592214|gb|EIW81541.1| clathrin coat assembly protein ap17 [Coniophora puteana RWD-64-598
           SS2]
          Length = 143

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 124/143 (86%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+++GEVHRLVAPRDQK+QSNFVEFR++K+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRMRGEVHRLVAPRDQKYQSNFVEFRHHKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVE+LD+FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEILDSFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL+RLD L+KLE
Sbjct: 121 AGEIEETSKEVVLSRLDELEKLE 143



>gi|392559139|gb|EIW52324.1| clathrin coat assembly protein ap17 [Trametes versicolor FP-101664
           SS1]
          Length = 143

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNHKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDA+DNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDADDNELAYLEAIHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK++VL RL+ L+KLE
Sbjct: 121 AGEVEETSKDVVLARLEELEKLE 143



>gi|302687987|ref|XP_003033673.1| hypothetical protein SCHCODRAFT_14718 [Schizophyllum commune H4-8]
 gi|300107368|gb|EFI98770.1| hypothetical protein SCHCODRAFT_14718 [Schizophyllum commune H4-8]
          Length = 143

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 139/143 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQ+HQSNFVEFR YK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQRHQSNFVEFRAYKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEA+H FVEVLD+FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAVHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETS+++VL+RL+ L++LE
Sbjct: 121 AGEIEETSRDVVLSRLEELERLE 143



>gi|70996032|ref|XP_752771.1| AP-2 adaptor complex subunit sigma [Aspergillus fumigatus Af293]
 gi|119495128|ref|XP_001264356.1| clathrin coat assembly protein ap17 [Neosartorya fischeri NRRL 181]
 gi|74672344|sp|Q4WS49.1|AP2S_ASPFU RecName: Full=AP-2 complex subunit sigma; AltName: Full=Adaptin
           small chain; AltName: Full=Clathrin assembly protein 2
           small chain; AltName: Full=Sigma2-adaptin
 gi|66850406|gb|EAL90733.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus fumigatus
           Af293]
 gi|119412518|gb|EAW22459.1| clathrin coat assembly protein ap17 [Neosartorya fischeri NRRL 181]
 gi|159131525|gb|EDP56638.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus fumigatus
           A1163]
          Length = 145

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/144 (88%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEF R+ K+V
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDA DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDATDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|212533647|ref|XP_002146980.1| AP-2 adaptor complex subunit sigma, putative [Talaromyces marneffei
           ATCC 18224]
 gi|242778580|ref|XP_002479268.1| AP-2 adaptor complex subunit sigma, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|210072344|gb|EEA26433.1| AP-2 adaptor complex subunit sigma, putative [Talaromyces marneffei
           ATCC 18224]
 gi|218722887|gb|EED22305.1| AP-2 adaptor complex subunit sigma, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 145

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EKVKLKGEVHRLVAPRDQK+QSNFVEF R+ K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDDEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|145240377|ref|XP_001392835.1| AP-2 complex subunit sigma [Aspergillus niger CBS 513.88]
 gi|134077352|emb|CAK39967.1| unnamed protein product [Aspergillus niger]
 gi|350629874|gb|EHA18247.1| hypothetical protein ASPNIDRAFT_207896 [Aspergillus niger ATCC
           1015]
 gi|358370838|dbj|GAA87448.1| AP-2 complex subunit sigma [Aspergillus kawachii IFO 4308]
          Length = 145

 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/144 (88%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEF R+ KVV
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKVV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDA DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDATDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|67516881|ref|XP_658326.1| hypothetical protein AN0722.2 [Aspergillus nidulans FGSC A4]
 gi|238489039|ref|XP_002375757.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus flavus
           NRRL3357]
 gi|317137076|ref|XP_003190017.1| AP-2 complex subunit sigma [Aspergillus oryzae RIB40]
 gi|74598753|sp|Q5BFF8.1|AP2S_EMENI RecName: Full=AP-2 complex subunit sigma; AltName: Full=Adaptin
           small chain; AltName: Full=Clathrin assembly protein 2
           small chain; AltName: Full=Sigma2-adaptin
 gi|40746043|gb|EAA65199.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 gi|220698145|gb|EED54485.1| AP-2 adaptor complex subunit sigma, putative [Aspergillus flavus
           NRRL3357]
 gi|259489003|tpe|CBF88916.1| TPA: AP-2 complex subunit sigma (Sigma2-adaptin)(Adaptin small
           chain)(Clathrin assembly protein 2 small chain)
           [Source:UniProtKB/Swiss-Prot;Acc:Q5BFF8] [Aspergillus
           nidulans FGSC A4]
          Length = 145

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEF R+ K+V
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDA DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDATDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|402223873|gb|EJU03937.1| Adaptor protein complex sigma subunit [Dacryopinax sp. DJM-731 SS1]
          Length = 143

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVP++DEEKV+L+GEVHRL+APRDQK QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPFDDEEKVRLRGEVHRLIAPRDQKWQSNFVEFRNYKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+C+D NDNELAYLEAIH FVE+LDAFF NVCELDLVFNFYK YAILDE+FL
Sbjct: 61  RRYAGLFFCLCIDQNDNELAYLEAIHLFVEILDAFFQNVCELDLVFNFYKAYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK ++L RLD+LD+LE
Sbjct: 121 AGEIEETSKAVILERLDYLDRLE 143



>gi|409039339|gb|EKM48964.1| hypothetical protein PHACADRAFT_202182 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 143

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI FILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVEFRN K+VY
Sbjct: 1   MINFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEFRNNKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDSFFDNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK++VL RL+ L+KLE
Sbjct: 121 AGEIEETSKDVVLARLEELEKLE 143



>gi|154276548|ref|XP_001539119.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150414192|gb|EDN09557.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|225560299|gb|EEH08581.1| clathrin coat assembly protein ap17 [Ajellomyces capsulatus G186AR]
          Length = 145

 Score =  261 bits (668), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/144 (87%), Positives = 137/144 (95%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EKVKLKGEVHRL+APRDQK+QSNFVEFR + K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYNDDEKVKLKGEVHRLIAPRDQKYQSNFVEFRRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|392870647|gb|EAS32465.2| AP-2 complex subunit sigma [Coccidioides immitis RS]
          Length = 194

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FILVQNRQGKTRL+KWY PY D+EKV+LKGEVHRL+APRDQK+QSNFVEFR + K+V
Sbjct: 51  VLSFILVQNRQGKTRLAKWYAPYTDDEKVRLKGEVHRLIAPRDQKYQSNFVEFRRSTKIV 110

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 111 YRRYAGLFFCACVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 170

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 171 LAGEIEETSKQVVLTRLEHLDKLE 194



>gi|501305679|dbj|GAC94801.1| hypothetical protein PHSY_002374 [Pseudozyma hubeiensis SY62]
          Length = 153

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 125/138 (90%), Positives = 135/138 (97%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSK+YVPY+DEEK++L+GEVHRL+APRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKFYVPYDDEEKIRLRGEVHRLIAPRDQKYQSNFVEFRNYKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVDANDNELAYLEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDH 138
           AGEIEETSK++VL RLD 
Sbjct: 121 AGEIEETSKHVVLARLDQ 138



>gi|392572723|gb|EIW65868.1| hypothetical protein TREMEDRAFT_70476 [Tremella mesenterica DSM
           1558]
          Length = 143

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/143 (86%), Positives = 138/143 (96%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+FILVQNRQGKTRLSKWYVPY+D+EK++L+GEVHRL+APRDQK+QSNFVEFRN K+VY
Sbjct: 1   MIKFILVQNRQGKTRLSKWYVPYDDDEKLRLRGEVHRLIAPRDQKYQSNFVEFRNDKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVD+NDNELAYLEAIH FVEVLDAFF NVCELDLVF+FYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCVCVDSNDNELAYLEAIHLFVEVLDAFFQNVCELDLVFSFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL RLD+L+KLE
Sbjct: 121 AGEIEETSKQVVLDRLDYLEKLE 143



>gi|452981084|gb|EME80844.1| hypothetical protein MYCFIDRAFT_61166 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 145

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQKHQSNFVEFR + KVV
Sbjct: 2   VLSFILIQNRQGKTRLAKWYSPYTDDEKIKLKGEVHRLVAPRDQKHQSNFVEFRGSSKVV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDA+DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDASDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|353239255|emb|CCA71173.1| probable clathrin coat assembly protein ap17 [Piriformospora indica
           DSM 11827]
          Length = 143

 Score =  260 bits (665), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWY P++D+EK++++GEVHRL+APRDQKHQSNFVE+RNYKVVY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYAPFDDDEKLRIRGEVHRLIAPRDQKHQSNFVEYRNYKVVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+CVD+NDNELAYLEAIH FVEVLD+FF NVCELDLVFNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFCLCVDSNDNELAYLEAIHLFVEVLDSFFENVCELDLVFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL RL+ L+KLE
Sbjct: 121 AGEIEETSKEVVLARLEELEKLE 143



>gi|115492117|ref|XP_001210686.1| AP-2 complex subunit sigma [Aspergillus terreus NIH2624]
 gi|114197546|gb|EAU39246.1| AP-2 complex subunit sigma [Aspergillus terreus NIH2624]
          Length = 145

 Score =  260 bits (664), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/144 (87%), Positives = 134/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRLVAPRDQK+QSNFVEF R+ K+V
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYSDEEKVKLKGEVHRLVAPRDQKYQSNFVEFKRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD  DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDTTDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|390602807|gb|EIN12199.1| Adaptor protein complex sigma subunit [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 143

 Score =  260 bits (664), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVPY+D EKV+L+GEVHRLVAPRDQK+QSNFVEF+NYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDNEKVRLRGEVHRLVAPRDQKYQSNFVEFQNYKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVD NDNELAYLEAIH FVE+LD+FF NVCELDLVFNFYKVYAILDE+FL
Sbjct: 61  RRYAGLFFCVCVDGNDNELAYLEAIHLFVEILDSFFDNVCELDLVFNFYKVYAILDEIFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK++VL RL+ L++LE
Sbjct: 121 AGEVEETSKDVVLQRLEELERLE 143



>gi|119186637|ref|XP_001243925.1| conserved hypothetical protein [Coccidioides immitis RS]
 gi|303317626|ref|XP_003068815.1| AP-2 complex subunit sigma, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|240108496|gb|EER26670.1| AP-2 complex subunit sigma, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320038812|gb|EFW20747.1| AP-2 complex subunit sigma [Coccidioides posadasii str. Silveira]
          Length = 145

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FILVQNRQGKTRL+KWY PY D+EKV+LKGEVHRL+APRDQK+QSNFVEFR + K+V
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYTDDEKVRLKGEVHRLIAPRDQKYQSNFVEFRRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|449299810|gb|EMC95823.1| hypothetical protein BAUCODRAFT_71477 [Baudoinia compniacensis UAMH
           10762]
          Length = 145

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EK+KLKGE+HRLVAPRDQKHQSNFVEFR + K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYNDDEKIKLKGEIHRLVAPRDQKHQSNFVEFRGSSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           L GEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LGGEIQETSKQVVLTRLEHLDKLE 145



>gi|453084956|gb|EMF13000.1| clathrin coat assembly protein ap17 [Mycosphaerella populorum
           SO2202]
          Length = 145

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           +I FIL+QNRQGKTRL+KWY PY D+EK+KLKGEVHRLVAPRDQKHQSNFVEFR + K+V
Sbjct: 2   VISFILIQNRQGKTRLAKWYSPYNDDEKIKLKGEVHRLVAPRDQKHQSNFVEFRGSSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD+ DNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDSTDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|296822322|ref|XP_002850266.1| clathrin coat assembly protein ap17 [Arthroderma otae CBS 113480]
 gi|315056289|ref|XP_003177519.1| AP-2 complex subunit sigma [Arthroderma gypseum CBS 118893]
 gi|327294291|ref|XP_003231841.1| AP-2 complex subunit sigma [Trichophyton rubrum CBS 118892]
 gi|238837820|gb|EEQ27482.1| clathrin coat assembly protein ap17 [Arthroderma otae CBS 113480]
 gi|311339365|gb|EFQ98567.1| AP-2 complex subunit sigma [Arthroderma gypseum CBS 118893]
 gi|326465786|gb|EGD91239.1| AP-2 complex subunit sigma [Trichophyton rubrum CBS 118892]
 gi|326475267|gb|EGD99276.1| clathrin coat assembly protein ap17 [Trichophyton tonsurans CBS
           112818]
          Length = 145

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 137/144 (95%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEF-RNYKVV 59
           ++ FI+VQNRQGKTRL+KWY PY D+EKV+LKGEVHRLVAPRDQK+QSNFVEF R+ K+V
Sbjct: 2   VLSFIIVQNRQGKTRLAKWYAPYNDDEKVRLKGEVHRLVAPRDQKYQSNFVEFKRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|58262560|ref|XP_568690.1| vesicle-mediated transport-related protein [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|57230864|gb|AAW47173.1| vesicle-mediated transport-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 215

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 137/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+FILVQNRQGKTRLSKWY PY+D+EKV+L+GEVHRL+APRDQK+QSNFVEFR+ KV+Y
Sbjct: 73  MIKFILVQNRQGKTRLSKWYAPYDDDEKVRLRGEVHRLIAPRDQKYQSNFVEFRDDKVIY 132

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFCVCVD+NDNELAYLEAIH FVEVLDAFF NVCELDLVF+FYKVYAILDEVFL
Sbjct: 133 RRYAGLFFCVCVDSNDNELAYLEAIHLFVEVLDAFFQNVCELDLVFSFYKVYAILDEVFL 192

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VL RLD+L+KL+
Sbjct: 193 AGEIEETSKQVVLDRLDYLEKLD 215



>gi|225681867|gb|EEH20151.1| AP-2 complex subunit sigma [Paracoccidioides brasiliensis Pb03]
 gi|226289034|gb|EEH44546.1| AP-2 complex subunit sigma [Paracoccidioides brasiliensis Pb18]
          Length = 145

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EKVKLKGEVHRL+APRDQK+QSNFVEFR + K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYNDDEKVKLKGEVHRLIAPRDQKYQSNFVEFRLSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCV VDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVGVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|331228242|ref|XP_003326788.1| hypothetical protein PGTG_08325 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309305778|gb|EFP82369.1| hypothetical protein PGTG_08325 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 199

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/143 (84%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWYVP EDEEKVK++GEVHRLVA RDQK+QSNFVEFR  KVVY
Sbjct: 57  MIRFILVQNRQGKTRLSKWYVPLEDEEKVKVRGEVHRLVATRDQKYQSNFVEFRTSKVVY 116

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+C+D+NDNEL+YLEAIH FVEVLDAFFGNVCELDLVF F++VY+ILDEVFL
Sbjct: 117 RRYAGLFFCICIDSNDNELSYLEAIHLFVEVLDAFFGNVCELDLVFQFHRVYSILDEVFL 176

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK+++L RLD+L+KLE
Sbjct: 177 AGEIEETSKSVILERLDYLEKLE 199



>gi|452840392|gb|EME42330.1| hypothetical protein DOTSEDRAFT_73227 [Dothistroma septosporum
           NZE10]
          Length = 145

 Score =  258 bits (658), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (93%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY  Y D+EK+KLKGEVHRLVAPRDQKHQSNFVEFR + K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYSGYNDDEKIKLKGEVHRLVAPRDQKHQSNFVEFRGSSKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|295671480|ref|XP_002796287.1| AP-2 complex subunit sigma [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284420|gb|EEH39986.1| AP-2 complex subunit sigma [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 145

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/144 (86%), Positives = 136/144 (94%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           ++ FIL+QNRQGKTRL+KWY PY D+EKVKLKGEVHRL+APRDQK+QSNFVEFR + K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYNDDEKVKLKGEVHRLIAPRDQKYQSNFVEFRRSTKIV 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFCV VDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCVGVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIEETSKQVVLTRLEHLDKLE 145



>gi|347830687|emb|CCD46384.1| similar to AP-2 adaptor complex subunit sigma [Botryotinia
           fuckeliana T4]
          Length = 161

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 126/160 (78%), Positives = 137/160 (85%), Gaps = 17/160 (10%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVH-----------------RLVAPRD 43
           ++ F+L+QNRQGKTRL+KWY PY DEEK+KLKGEVH                 RLVAPRD
Sbjct: 2   VLSFVLIQNRQGKTRLAKWYAPYNDEEKIKLKGEVHCPPPILATSNLTTHQVHRLVAPRD 61

Query: 44  QKHQSNFVEFRNYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELD 103
           QK+QSNFVEFRN K+VYRRYAGLFFC CVDANDNELAYLEAIHFFVEVLD+FFGNVCELD
Sbjct: 62  QKYQSNFVEFRNNKIVYRRYAGLFFCACVDANDNELAYLEAIHFFVEVLDSFFGNVCELD 121

Query: 104 LVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           LVFNFYKVYAILDEVFLAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 LVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLEHLDKLE 161



>gi|398396440|ref|XP_003851678.1| hypothetical protein MYCGRDRAFT_60448 [Zymoseptoria tritici IPO323]
 gi|339471558|gb|EGP86654.1| hypothetical protein MYCGRDRAFT_60448 [Zymoseptoria tritici IPO323]
          Length = 145

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 1/144 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVV 59
           +I F+L+QNRQGKTRL+KWY PY D +K+KLKGEVHRLVAPRDQKHQSNFVEFR + K++
Sbjct: 2   VISFMLIQNRQGKTRLAKWYSPYTDADKIKLKGEVHRLVAPRDQKHQSNFVEFRGSSKII 61

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVDANDN LAYLE IHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 62  YRRYAGLFFCACVDANDNALAYLEGIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVF 121

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEI+ETSK +VLTRL+HLDKLE
Sbjct: 122 LAGEIQETSKQVVLTRLEHLDKLE 145



>gi|350292421|gb|EGZ73616.1| Adaptor protein complex sigma subunit [Neurospora tetrasperma FGSC
           2509]
          Length = 138

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 5/143 (3%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+ FIL+QNRQGKTRL+KWYVPY DEEK+KLKGE      PRDQK+QSNFVEFRN+KVVY
Sbjct: 1   MLSFILIQNRQGKTRLAKWYVPYSDEEKIKLKGE-----PPRDQKYQSNFVEFRNHKVVY 55

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD NDNELAYLEAIHFFVEVLD+FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 56  RRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFL 115

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK +VLTRL+HLDKLE
Sbjct: 116 AGEIEETSKQVVLTRLEHLDKLE 138



>gi|378732439|gb|EHY58898.1| AP-2 complex subunit sigma [Exophiala dermatitidis NIH/UT8656]
          Length = 172

 Score =  254 bits (648), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 128/171 (74%), Positives = 137/171 (80%), Gaps = 28/171 (16%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR------ 54
           ++ FILVQNRQGKTRL+KWY PY DEEKVKLKGEVHRL+APRDQK+QSNFVEFR      
Sbjct: 2   VLSFILVQNRQGKTRLAKWYAPYTDEEKVKLKGEVHRLIAPRDQKYQSNFVEFRSAPSIS 61

Query: 55  ----------------------NYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVL 92
                                 + K+VYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVL
Sbjct: 62  NSSSGSGTSGTGGHHLVRQNLSSTKIVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVL 121

Query: 93  DAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           D FFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSK +VLTRL+HLDKLE
Sbjct: 122 DQFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLEHLDKLE 172



>gi|403412832|emb|CCL99532.1| predicted protein [Fibroporia radiculosa]
          Length = 162

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/162 (77%), Positives = 139/162 (85%), Gaps = 19/162 (11%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVE-------- 52
           MIRFILVQNRQGKTRLSKWYVPY+D+EKV+L+GEVHRLVAPRDQK+QSNFVE        
Sbjct: 1   MIRFILVQNRQGKTRLSKWYVPYDDDEKVRLRGEVHRLVAPRDQKYQSNFVEVRPIRLLK 60

Query: 53  -----------FRNYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCE 101
                      FRN+K+VYRRYAGLFFCVCVDA+DNELAYLEAIH FVEVLD+FF NVCE
Sbjct: 61  TVVSSKDAIIKFRNHKLVYRRYAGLFFCVCVDADDNELAYLEAIHLFVEVLDSFFDNVCE 120

Query: 102 LDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           LDLVFNFYKVYAILDEVFLAGEIEETSK +VL+RL+ L+KLE
Sbjct: 121 LDLVFNFYKVYAILDEVFLAGEIEETSKEVVLSRLEALEKLE 162



>gi|501754966|emb|CCG81731.1| AP-2 complex subunit sigma [Taphrina deformans PYCC 5710]
          Length = 144

 Score =  251 bits (641), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 116/142 (81%), Positives = 129/142 (90%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           + FILVQNRQGKTRLSKWY  Y D EK K KG+VHRL+APRDQKHQSNF E+ NYK++YR
Sbjct: 3   LHFILVQNRQGKTRLSKWYDAYSDAEKNKTKGDVHRLIAPRDQKHQSNFTEYLNYKIIYR 62

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFFC CVD NDNELAYLEAIH FVE+LD+FFGNVCELDLVFNFYKVYAILDEVFLA
Sbjct: 63  RYAGLFFCACVDTNDNELAYLEAIHLFVEILDSFFGNVCELDLVFNFYKVYAILDEVFLA 122

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEIEET+K ++LTRLDHL+KL+
Sbjct: 123 GEIEETNKTVILTRLDHLEKLD 144



>gi|393243801|gb|EJD51315.1| clathrin coat assembly protein ap17 [Auricularia delicata TFB-10046
           SS5]
          Length = 143

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 136/143 (95%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSKWY  ++D+EKV+++GEVHRLVA RDQK+QSNFVEFRNYKV+Y
Sbjct: 1   MIRFILVQNRQGKTRLSKWYTAFDDDEKVRIRGEVHRLVAARDQKYQSNFVEFRNYKVIY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVDANDNELAYLEAIH FVEVLD+FF NVCELDLVF+FYKVYAILDE+FL
Sbjct: 61  RRYAGLYFCLCVDANDNELAYLEAIHLFVEVLDSFFENVCELDLVFHFYKVYAILDELFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK ++L+RL+ L++LE
Sbjct: 121 AGEVEETSKEVILSRLEELERLE 143



>gi|472581968|gb|EMS19676.1| AP-2 complex subunit sigma [Rhodosporidium toruloides NP11]
          Length = 143

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/143 (81%), Positives = 135/143 (94%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGKTRLSK+YVPYE++EK +++GEVHR++APRDQK+QSNFVEFRNYK+VY
Sbjct: 1   MIRFILVQNRQGKTRLSKFYVPYEEDEKARIRGEVHRMIAPRDQKYQSNFVEFRNYKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF  CVDANDNEL +LEAIH FVEVLDAFFGNVCELDLVFNFYKVYAILDE FL
Sbjct: 61  RRYAGLFFSFCVDANDNELVWLEAIHLFVEVLDAFFGNVCELDLVFNFYKVYAILDECFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK ++L RL++L++LE
Sbjct: 121 AGEVEETSKQVILDRLEYLERLE 143



>gi|134118910|ref|XP_771958.1| hypothetical protein CNBN1380 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254562|gb|EAL17311.1| hypothetical protein CNBN1380 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 168

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 122/168 (72%), Positives = 137/168 (81%), Gaps = 25/168 (14%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVK-------------------------LKGEV 35
           MI+FILVQNRQGKTRLSKWY PY+D+EKV+                         L+GEV
Sbjct: 1   MIKFILVQNRQGKTRLSKWYAPYDDDEKVRHVPLSTFIHDYPQPLLISTPTLQVRLRGEV 60

Query: 36  HRLVAPRDQKHQSNFVEFRNYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAF 95
           HRL+APRDQK+QSNFVEFR+ KV+YRRYAGLFFCVCVD+NDNELAYLEAIH FVEVLDAF
Sbjct: 61  HRLIAPRDQKYQSNFVEFRDDKVIYRRYAGLFFCVCVDSNDNELAYLEAIHLFVEVLDAF 120

Query: 96  FGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           F NVCELDLVF+FYKVYAILDEVFLAGEIEETSK +VL RLD+L+KL+
Sbjct: 121 FQNVCELDLVFSFYKVYAILDEVFLAGEIEETSKQVVLDRLDYLEKLD 168



>gi|396466520|ref|XP_003837709.1| hypothetical protein LEMA_P122440.1 [Leptosphaeria maculans JN3]
 gi|312214272|emb|CBX94265.1| hypothetical protein LEMA_P122440.1 [Leptosphaeria maculans JN3]
          Length = 263

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 1/132 (0%)

Query: 5   ILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVVYRRY 63
           ++ Q  +GKTRL+KWY PY DEEKVKLKGEVHRL+APRDQKHQSNFVEFRN  K+VYRRY
Sbjct: 90  VIDQPNRGKTRLAKWYAPYSDEEKVKLKGEVHRLIAPRDQKHQSNFVEFRNMSKIVYRRY 149

Query: 64  AGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGE 123
           AGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGE
Sbjct: 150 AGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGE 209

Query: 124 IEETSKNIVLTR 135
           IEETSK +VLTR
Sbjct: 210 IEETSKQVVLTR 221



>gi|485925286|gb|EOD49909.1| putative ap-2 complex subunit sigma protein [Neofusicoccum parvum
           UCRNP2]
          Length = 135

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 119/144 (82%), Positives = 126/144 (87%), Gaps = 11/144 (7%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY-KVV 59
           ++ FIL+QNRQGKTRL+KWY PY DEEKVKLKGE          KHQSNFVEFRN  K+V
Sbjct: 2   VLSFILIQNRQGKTRLAKWYAPYSDEEKVKLKGE----------KHQSNFVEFRNTSKIV 51

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFFC CVD NDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF
Sbjct: 52  YRRYAGLFFCACVDTNDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 111

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           LAGEIEETSK +VLTRL+HLDKLE
Sbjct: 112 LAGEIEETSKQVVLTRLEHLDKLE 135



>gi|258563352|ref|XP_002582421.1| AP-2 complex subunit sigma [Uncinocarpus reesii 1704]
 gi|237907928|gb|EEP82329.1| AP-2 complex subunit sigma [Uncinocarpus reesii 1704]
          Length = 146

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (87%), Gaps = 9/146 (6%)

Query: 7   VQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAG 65
           ++  +GKTRL+KWY PY D+EKV+LKGEVHRL+APRDQK+QSNFVEFR + K+VYRRYAG
Sbjct: 1   METARGKTRLAKWYAPYTDDEKVRLKGEVHRLIAPRDQKYQSNFVEFRRSTKIVYRRYAG 60

Query: 66  LFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYK--------VYAILDE 117
           LFFC CVDANDNELAYLEAIHFFVEVLD FFGNVCELDLVFNFYK        VYAILDE
Sbjct: 61  LFFCACVDANDNELAYLEAIHFFVEVLDQFFGNVCELDLVFNFYKVSGTALSRVYAILDE 120

Query: 118 VFLAGEIEETSKNIVLTRLDHLDKLE 143
           VFLAGEIEE SK +VLTRL+HLDKLE
Sbjct: 121 VFLAGEIEEASKQVVLTRLEHLDKLE 146



>gi|470319418|gb|EMR11037.1| hypothetical protein PNEG_00634 [Pneumocystis murina B123]
          Length = 143

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/143 (76%), Positives = 128/143 (89%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+RFILVQNRQGKTRLSKWYVP +D+EK K+KGE+HRL+  RDQ+ QSNFV+F NYK++Y
Sbjct: 1   MLRFILVQNRQGKTRLSKWYVPCDDQEKNKIKGEIHRLIVFRDQRRQSNFVDFDNYKIIY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF VCVD +DNELAYLEAIH FVEV+D+FFGNVCELDL+FNFYKVYAILDEVFL
Sbjct: 61  RRYAGLFFSVCVDLDDNELAYLEAIHLFVEVIDSFFGNVCELDLIFNFYKVYAILDEVFL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+EETSK+ +  RLD L  L+
Sbjct: 121 AGELEETSKSAIFMRLDDLSLLD 143



>gi|210075210|ref|XP_500486.2| YALI0B04246p [Yarrowia lipolytica]
 gi|199425133|emb|CAG82713.2| YALI0B04246p [Yarrowia lipolytica CLIB122]
          Length = 144

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (88%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           ++++ILVQNRQGKTRL+KWY  Y D EK+KL GEVHRLVA RDQ++QSNFVE  NYKV+Y
Sbjct: 2   VLQYILVQNRQGKTRLAKWYNAYSDTEKIKLMGEVHRLVAARDQRYQSNFVELGNYKVIY 61

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+ VD +DNEL YLEAIH FVEVLD FFGNVCELDLVFNFYKVYAILDEVFL
Sbjct: 62  RRYAGLFFCIVVDESDNELFYLEAIHLFVEVLDTFFGNVCELDLVFNFYKVYAILDEVFL 121

Query: 121 AGEIEETSKNIVLTRLDHLDK 141
           AGE+EETSK +VL RL+ +DK
Sbjct: 122 AGELEETSKKVVLARLEEIDK 142



>gi|328854277|gb|EGG03410.1| hypothetical protein MELLADRAFT_90126 [Melampsora larici-populina
           98AG31]
          Length = 136

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (89%), Gaps = 7/143 (4%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFILVQNRQGK RLSKWYVP EDEEKV+++GEVHRLVA RDQK+QSNFVE        
Sbjct: 1   MIRFILVQNRQGKARLSKWYVPMEDEEKVRIRGEVHRLVATRDQKYQSNFVEVE------ 54

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
            RYAGLFFCVCVD+NDNELAYLE+IH FVEVLDA+FGNVCELDLVF F+KVY+ILDEVFL
Sbjct: 55  -RYAGLFFCVCVDSNDNELAYLESIHLFVEVLDAYFGNVCELDLVFQFHKVYSILDEVFL 113

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETSK+I+L RL++L+KL+
Sbjct: 114 AGEIEETSKSIILERLEYLEKLD 136



>gi|328774046|gb|EGF84083.1| hypothetical protein BATDEDRAFT_8507, partial [Batrachochytrium
           dendrobatidis JAM81]
          Length = 162

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (92%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFILVQNRQGKTRLSKWY P+ED+EK+KLK EVHRLVA RDQK+QSNFVEFRNYK+VYR
Sbjct: 1   IRFILVQNRQGKTRLSKWYTPFEDDEKLKLKAEVHRLVASRDQKYQSNFVEFRNYKIVYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFFC CVD NDNELA LEAIHFFVEVLD FF +VCELDLVFNFY+VYAILDEVFL 
Sbjct: 61  RYAGLFFCFCVDTNDNELACLEAIHFFVEVLDTFFKSVCELDLVFNFYRVYAILDEVFLG 120

Query: 122 GEIEE 126
           GEI+E
Sbjct: 121 GEIQE 125



>gi|345562798|gb|EGX45811.1| hypothetical protein AOL_s00117g16 [Arthrobotrys oligospora ATCC
           24927]
          Length = 133

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 115/136 (84%), Positives = 119/136 (87%), Gaps = 10/136 (7%)

Query: 8   QNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYRRYAGLF 67
           QN  GK           D+EKVKLKGEVHRLVAPRDQK+QSNFVEFRN K+VYRRYAGLF
Sbjct: 8   QNATGKV----------DDEKVKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVYRRYAGLF 57

Query: 68  FCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEET 127
           FCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEE 
Sbjct: 58  FCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEEA 117

Query: 128 SKNIVLTRLDHLDKLE 143
           SK  VLTRL+HLDKLE
Sbjct: 118 SKQTVLTRLEHLDKLE 133



>gi|239607205|gb|EEQ84192.1| clathrin coat assembly protein ap17 [Ajellomyces dermatitidis ER-3]
          Length = 150

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (96%), Gaps = 1/120 (0%)

Query: 25  DEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAGLFFCVCVDANDNELAYLE 83
           D+EKVKLKGEVHRL+APRDQK+QSNFVEFR + K+VYRRYAGLFFCVCVDANDNELAYLE
Sbjct: 31  DDEKVKLKGEVHRLIAPRDQKYQSNFVEFRRSTKIVYRRYAGLFFCVCVDANDNELAYLE 90

Query: 84  AIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           AIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVFLAGE+EETSK +VLTRL+HLDKLE
Sbjct: 91  AIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVFLAGEVEETSKQVVLTRLEHLDKLE 150



>gi|327351162|gb|EGE80019.1| clathrin coat assembly protein [Ajellomyces dermatitidis ATCC
           18188]
          Length = 121

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (96%), Gaps = 1/120 (0%)

Query: 25  DEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAGLFFCVCVDANDNELAYLE 83
           D+EKVKLKGEVHRL+APRDQK+QSNFVEFR + K+VYRRYAGLFFCVCVDANDNELAYLE
Sbjct: 2   DDEKVKLKGEVHRLIAPRDQKYQSNFVEFRRSTKIVYRRYAGLFFCVCVDANDNELAYLE 61

Query: 84  AIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           AIHFFVEVLD FFGNVCELDLVFNFYKVYAILDEVFLAGE+EETSK +VLTRL+HLDKLE
Sbjct: 62  AIHFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVFLAGEVEETSKQVVLTRLEHLDKLE 121



>gi|405123892|gb|AFR98655.1| clathrin coat assembly protein [Cryptococcus neoformans var. grubii
           H99]
          Length = 145

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/147 (74%), Positives = 125/147 (85%), Gaps = 8/147 (5%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+FILVQNRQGKTRLSKWY PY+D+EKV+L+GEVHRL+APRDQK+QSNFVEFR+ KV+Y
Sbjct: 1   MIKFILVQNRQGKTRLSKWYAPYDDDEKVRLRGEVHRLIAPRDQKYQSNFVEFRDDKVIY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLD-----AFFGNVCELDLVFNFYKVYAIL 115
           RRYAGLFFCVCVD+NDNELAYLEAIH FVEVL         GN  E  L   + +VYAIL
Sbjct: 61  RRYAGLFFCVCVDSNDNELAYLEAIHLFVEVLGQSRRFCMDGNTAERRL---WLQVYAIL 117

Query: 116 DEVFLAGEIEETSKNIVLTRLDHLDKL 142
           DEVFLAGEIEETSK +VL RLD+L+KL
Sbjct: 118 DEVFLAGEIEETSKQVVLDRLDYLEKL 144



>gi|213406449|ref|XP_002173996.1| AP-2 complex subunit sigma [Schizosaccharomyces japonicus yFS275]
 gi|212002043|gb|EEB07703.1| AP-2 complex subunit sigma [Schizosaccharomyces japonicus yFS275]
          Length = 143

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI FILVQNR GKTRLSK+YVPY DEEK++LKG VHRLVA RDQ++Q+NFVE+ + K+VY
Sbjct: 1   MIHFILVQNRHGKTRLSKFYVPYNDEEKIQLKGRVHRLVAQRDQRYQANFVEYSSSKIVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD +DN+LA LE IHFFVE LD++FGNVCELDLVFNF+KV AILDE+ L
Sbjct: 61  RRYAGLFFCFCVDVDDNDLAILEMIHFFVEALDSYFGNVCELDLVFNFHKVSAILDEIIL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+ E SK  +L R++ L KL+
Sbjct: 121 AGEMGEASKEKLLKRIEMLAKLD 143



>gi|240278776|gb|EER42282.1| clathrin coat assembly protein ap17 [Ajellomyces capsulatus H143]
 gi|325090313|gb|EGC43623.1| clathrin coat assembly protein ap17 [Ajellomyces capsulatus H88]
          Length = 145

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 105/117 (89%), Positives = 113/117 (96%), Gaps = 1/117 (0%)

Query: 28  KVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAGLFFCVCVDANDNELAYLEAIH 86
           ++KLKGEVHRL+APRDQK+QSNFVEFR + K+VYRRYAGLFFCVCVDANDNELAYLEAIH
Sbjct: 29  QLKLKGEVHRLIAPRDQKYQSNFVEFRRSTKIVYRRYAGLFFCVCVDANDNELAYLEAIH 88

Query: 87  FFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           FFVEVLD FFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSK +VLTRL+HLDKLE
Sbjct: 89  FFVEVLDQFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLEHLDKLE 145



>gi|401882005|gb|EJT46280.1| vesicle-mediated transport-related protein [Trichosporon asahii
           var. asahii CBS 2479]
 gi|406700963|gb|EKD04122.1| vesicle-mediated transport-related protein [Trichosporon asahii
           var. asahii CBS 8904]
          Length = 138

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 121/147 (82%), Gaps = 13/147 (8%)

Query: 1   MIRFILVQNR----QGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNY 56
           MI+FILVQ R     G  R+             +L+GEVHRL+APRDQK+QSNFVEFRN 
Sbjct: 1   MIKFILVQERLVCLSGTPRMKMTR---------RLRGEVHRLIAPRDQKYQSNFVEFRND 51

Query: 57  KVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILD 116
           K+VYRRYAGLFFCVCVD+NDNELAYLEAIH FVEVLDAFF NVCELDLVF+FYKVYAILD
Sbjct: 52  KIVYRRYAGLFFCVCVDSNDNELAYLEAIHLFVEVLDAFFQNVCELDLVFSFYKVYAILD 111

Query: 117 EVFLAGEIEETSKNIVLTRLDHLDKLE 143
           EVFLAGEIEETSK +VL RLD+L+KLE
Sbjct: 112 EVFLAGEIEETSKQVVLDRLDYLEKLE 138



>gi|485628639|gb|EOD24106.1| Adaptor protein 2 sigma subunit [Emiliania huxleyi CCMP1516]
 gi|485638646|gb|EOD33030.1| clathrin adaptor complex, small subunit [Emiliania huxleyi
           CCMP1516]
 gi|485638647|gb|EOD33031.1| Adaptor protein 2 sigma subunit [Emiliania huxleyi CCMP1516]
          Length = 142

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+FIL+QNRQGKTRLSK+Y  Y D+EK+K++ E+HR+V  RDQK  +NFVEF+ YK++Y
Sbjct: 1   MIQFILLQNRQGKTRLSKYYRTYTDDEKIKIEAEIHRIVTTRDQKF-TNFVEFKQYKLIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD NDNEL Y E+IH FVE+LD FFGNVCELDLVFNF KVY ILDE FL
Sbjct: 60  RRYAGLFFTLCVDVNDNELVYFESIHLFVELLDQFFGNVCELDLVFNFNKVYMILDEFFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  +L R+  LDKLE
Sbjct: 120 AGEVQETSKQTILHRVQDLDKLE 142



>gi|166240245|ref|XP_636079.2| adaptor-related protein complex 2, sigma 1 subunit [Dictyostelium
           discoideum AX4]
 gi|182627624|sp|Q54H39.2|AP2S_DICDI RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma-1 subunit;
           AltName: Full=Adaptin small chain; AltName:
           Full=Clathrin assembly protein 2 small chain; AltName:
           Full=Sigma2-adaptin
 gi|165988502|gb|EAL62572.2| adaptor-related protein complex 2, sigma 1 subunit [Dictyostelium
           discoideum AX4]
          Length = 142

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 102/142 (71%), Positives = 119/142 (83%), Gaps = 1/142 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI FIL+QNRQGKTRLSKWY PYED EK KL  E+H++V  R+ K  +NFVEFR +++VY
Sbjct: 1   MIHFILIQNRQGKTRLSKWYTPYEDVEKRKLSHEIHKIVNSRETKF-TNFVEFRTHRIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF VCVD  DNEL  LEAIH FVEVLDA+FGNVCELDLVFNFYKVYAI+DEVFL
Sbjct: 60  RRYAGLFFSVCVDPTDNELFCLEAIHLFVEVLDAYFGNVCELDLVFNFYKVYAIIDEVFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
           AGE+ E SK+++L R++ LD L
Sbjct: 120 AGELMEPSKHVILQRMEFLDNL 141



>gi|19112930|ref|NP_596138.1| AP-2 adaptor complex subunit Aps2 (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74626304|sp|Q9Y7L6.1|AP2S_SCHPO RecName: Full=AP-2 complex subunit sigma; AltName: Full=Adaptin
           small chain; AltName: Full=Clathrin assembly protein 2
           small chain; AltName: Full=Sigma2-adaptin
 gi|4538667|emb|CAB39361.1| AP-2 adaptor complex subunit Aps2 (predicted) [Schizosaccharomyces
           pombe]
          Length = 143

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 123/143 (86%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+FIL+QNR GK RLSK+YVP++D+EKV+LK  +H+L++ R+QK Q+NF+E+ N K+VY
Sbjct: 1   MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLEWENSKLVY 60

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC CVD+ DN+LA LE IHFFVE+LD+FFGNVCELDL+FNFYKV AILDE+ L
Sbjct: 61  RRYAGLYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIIL 120

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI E++K  VL R++ L+KLE
Sbjct: 121 GGEIGESNKKSVLERIEALEKLE 143



>gi|291001725|ref|XP_002683429.1| predicted protein [Naegleria gruberi]
 gi|284097058|gb|EFC50685.1| predicted protein [Naegleria gruberi]
          Length = 142

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 121/143 (84%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI FIL+QNR GKTRLSKWY  +ED+EK K+K EVHRL+  RDQK  +N VEFR YKVVY
Sbjct: 1   MIHFILLQNRAGKTRLSKWYEAFEDDEKEKIKIEVHRLITSRDQKF-TNMVEFRKYKVVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F + VD NDN+LA LE++H FVEVLD FFGNVCELDLVFNF+KVY ILDE+++
Sbjct: 60  RRYAGLYFSMGVDVNDNDLACLESVHLFVEVLDQFFGNVCELDLVFNFHKVYMILDEMYM 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI+ET+K ++L+RL  LDKLE
Sbjct: 120 AGEIQETAKPVILSRLQLLDKLE 142



>gi|357157007|ref|XP_003577651.1| PREDICTED: AP-2 complex subunit sigma-like [Brachypodium
           distachyon]
          Length = 142

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++GEVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEGEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFAICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KL+
Sbjct: 120 AGELQETSKKAIIERMGELEKLD 142



>gi|313238048|emb|CBY13167.1| unnamed protein product [Oikopleura dioica]
          Length = 142

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH LV  RD KH +NFVEFR+YK++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHALVTIRDAKH-TNFVEFRDYKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE FL
Sbjct: 60  RRYAGLFFCLCVDVNDNNLKYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDETFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+N ++ +L  L +LE
Sbjct: 120 AGEIRETSQNKIIRQLQTLSQLE 142



>gi|330935913|ref|XP_003305179.1| hypothetical protein PTT_17946 [Pyrenophora teres f. teres 0-1]
 gi|311317936|gb|EFQ86735.1| hypothetical protein PTT_17946 [Pyrenophora teres f. teres 0-1]
          Length = 125

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/111 (90%), Positives = 105/111 (94%), Gaps = 1/111 (0%)

Query: 34  EVHRLVAPRDQKHQSNFVEFRNY-KVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVL 92
           +VHRL+APRDQKHQSNFVEFRN  K+VYRRYAGLFFC CVD NDNELAYLEAIHFFVEVL
Sbjct: 15  KVHRLIAPRDQKHQSNFVEFRNMSKIVYRRYAGLFFCACVDTNDNELAYLEAIHFFVEVL 74

Query: 93  DAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           DAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSK +VLTRL HLDKLE
Sbjct: 75  DAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLAHLDKLE 125



>gi|482574471|gb|EOA38658.1| hypothetical protein CARUB_v10010593mg [Capsella rubella]
          Length = 142

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDAKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF VCVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSVCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKRAIIERMSELEKLE 142



>gi|326437187|gb|EGD82757.1| clathrin-associated protein 17 [Salpingoeca sp. ATCC 50818]
          Length = 142

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF L+QNR GKTRL+KWY+P+ED+EK KL  EVH LV+ R  +H +NFVEFR +K+VY
Sbjct: 1   MIRFFLIQNRAGKTRLAKWYMPFEDDEKQKLIEEVHALVSVRGSQH-TNFVEFRTFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+CVD NDN LAY+EAIH FVE+L+ FF NVCELDL+FNFYKVYA++DE+FL
Sbjct: 60  RRYAGLFFCLCVDINDNNLAYMEAIHNFVEILNQFFTNVCELDLLFNFYKVYALVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI+ETS   VL RL+ L  ++
Sbjct: 120 AGEIQETSPAKVLKRLEILTTMD 142



>gi|115649656|ref|XP_786054.2| PREDICTED: AP-2 complex subunit sigma-like [Strongylocentrotus
           purpuratus]
          Length = 142

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++DEEK KL  EVH LV  RD KH +NFVE+RN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMAFDDEEKQKLIEEVHALVTVRDAKH-TNFVEYRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVGDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L +LE
Sbjct: 120 AGEIRETSQTKVLKQLMALGQLE 142



>gi|261200895|ref|XP_002626848.1| clathrin coat assembly protein [Ajellomyces dermatitidis SLH14081]
 gi|239593920|gb|EEQ76501.1| clathrin coat assembly protein [Ajellomyces dermatitidis SLH14081]
          Length = 151

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/118 (84%), Positives = 110/118 (93%), Gaps = 1/118 (0%)

Query: 27  EKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAGLFFCVCVDANDNELAYLEAI 85
            K ++  +VHRL+APRDQK+QSNFVEFR + K+VYRRYAGLFFCVCVDANDNELAYLEAI
Sbjct: 34  SKARVILQVHRLIAPRDQKYQSNFVEFRRSTKIVYRRYAGLFFCVCVDANDNELAYLEAI 93

Query: 86  HFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           HFFVEVLD FFGNVCELDLVFNFYKVYAILDEVFLAGE+EETSK +VLTRL+HLDKLE
Sbjct: 94  HFFVEVLDQFFGNVCELDLVFNFYKVYAILDEVFLAGEVEETSKQVVLTRLEHLDKLE 151



>gi|351726367|ref|NP_001237124.1| uncharacterized protein LOC100500378 [Glycine max]
 gi|255630161|gb|ACU15434.1| unknown [Glycine max]
          Length = 142

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K+ +NFVEFR +K++Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKY-TNFVEFRTHKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|225431145|ref|XP_002268045.1| PREDICTED: AP-2 complex subunit sigma-like [Vitis vinifera]
          Length = 142

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP+E+ EK K++ EVHRLV  RD KH +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPFEESEKHKVEYEVHRLVVNRDPKH-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+K E
Sbjct: 120 AGELQETSKKAIIERMGELEKQE 142



>gi|470110180|ref|XP_004291364.1| PREDICTED: AP-2 complex subunit sigma-like [Fragaria vesca subsp.
           vesca]
          Length = 196

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 55  MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 113

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 114 RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 173

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 174 AGELQETSKKAIIERMGELEKLE 196



>gi|357438415|ref|XP_003589483.1| AP-2 complex subunit sigma-1 [Medicago truncatula]
 gi|502126344|ref|XP_004499272.1| PREDICTED: AP-2 complex subunit sigma-like [Cicer arietinum]
 gi|217075070|gb|ACJ85895.1| unknown [Medicago truncatula]
 gi|355478531|gb|AES59734.1| AP-2 complex subunit sigma-1 [Medicago truncatula]
 gi|388497856|gb|AFK36994.1| unknown [Medicago truncatula]
          Length = 142

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K+ +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKY-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|30584435|gb|AAP36470.1| Homo sapiens adaptor-related protein complex 2, sigma 1 subunit
           [synthetic construct]
 gi|60653233|gb|AAX29311.1| adaptor-related protein complex 2 sigma 1 subunit [synthetic
           construct]
          Length = 143

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|56961624|ref|NP_075241.2| AP-2 complex subunit sigma [Rattus norvegicus]
 gi|70906430|ref|NP_004060.2| AP-2 complex subunit sigma isoform AP17 [Homo sapiens]
 gi|115497184|ref|NP_001069546.1| AP-2 complex subunit sigma [Bos taurus]
 gi|161086984|ref|NP_941015.2| AP-2 complex subunit sigma [Mus musculus]
 gi|197101227|ref|NP_001125999.1| AP-2 complex subunit sigma [Pongo abelii]
 gi|346986460|ref|NP_001231381.1| AP-2 complex subunit sigma isoform 1 [Sus scrofa]
 gi|386781031|ref|NP_001248072.1| AP-2 complex subunit sigma [Macaca mulatta]
 gi|55649469|ref|XP_512774.1| PREDICTED: AP-2 complex subunit sigma isoform 4 [Pan troglodytes]
 gi|57036403|ref|XP_533634.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Canis lupus
           familiaris]
 gi|327286735|ref|XP_003228085.1| PREDICTED: AP-2 complex subunit sigma-like [Anolis carolinensis]
 gi|332257124|ref|XP_003277665.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Nomascus
           leucogenys]
 gi|334328672|ref|XP_001373350.2| PREDICTED: AP-2 complex subunit sigma-like [Monodelphis domestica]
 gi|338710547|ref|XP_001917157.2| PREDICTED: AP-2 complex subunit sigma-like [Equus caballus]
 gi|395854210|ref|XP_003799591.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Otolemur
           garnettii]
 gi|395854212|ref|XP_003799592.1| PREDICTED: AP-2 complex subunit sigma isoform 2 [Otolemur
           garnettii]
 gi|402906044|ref|XP_003915817.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Papio anubis]
 gi|410054135|ref|XP_003953587.1| PREDICTED: AP-2 complex subunit sigma [Pan troglodytes]
 gi|410054138|ref|XP_003953588.1| PREDICTED: AP-2 complex subunit sigma [Pan troglodytes]
 gi|410054140|ref|XP_003953589.1| PREDICTED: AP-2 complex subunit sigma [Pan troglodytes]
 gi|410982666|ref|XP_003997670.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Felis catus]
 gi|441655973|ref|XP_004091086.1| PREDICTED: AP-2 complex subunit sigma [Nomascus leucogenys]
 gi|466015699|ref|XP_004271174.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Orcinus orca]
 gi|471395914|ref|XP_004381663.1| PREDICTED: AP-2 complex subunit sigma [Trichechus manatus
           latirostris]
 gi|472362825|ref|XP_004400995.1| PREDICTED: AP-2 complex subunit sigma [Odobenus rosmarus divergens]
 gi|478532182|ref|XP_004440241.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Ceratotherium
           simum simum]
 gi|488587602|ref|XP_004479122.1| PREDICTED: AP-2 complex subunit sigma [Dasypus novemcinctus]
 gi|505799400|ref|XP_004607767.1| PREDICTED: AP-2 complex subunit sigma isoform X1 [Sorex araneus]
 gi|507981536|ref|XP_004694285.1| PREDICTED: AP-2 complex subunit sigma [Condylura cristata]
 gi|511895931|ref|XP_004767566.1| PREDICTED: AP-2 complex subunit sigma [Mustela putorius furo]
 gi|511988416|ref|XP_004811953.1| PREDICTED: AP-2 complex subunit sigma [Mustela putorius furo]
 gi|51316970|sp|P62744.1|AP2S1_RAT RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor protein complex AP-2 subunit
           sigma; AltName: Full=Clathrin assembly protein 2 small
           chain; AltName: Full=Clathrin coat assembly protein
           AP17; AltName: Full=Clathrin coat-associated protein
           AP17; AltName: Full=Plasma membrane adaptor AP-2 17 kDa
           protein; AltName: Full=Sigma-adaptin 3b; AltName:
           Full=Sigma2-adaptin
 gi|51316976|sp|P62743.1|AP2S1_MOUSE RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor protein complex AP-2 subunit
           sigma; AltName: Full=Clathrin assembly protein 2 small
           chain; AltName: Full=Clathrin coat assembly protein
           AP17; AltName: Full=Clathrin coat-associated protein
           AP17; AltName: Full=Plasma membrane adaptor AP-2 17 kDa
           protein; AltName: Full=Sigma-adaptin 3b; AltName:
           Full=Sigma2-adaptin
 gi|51338780|sp|P53680.2|AP2S1_HUMAN RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor protein complex AP-2 subunit
           sigma; AltName: Full=Clathrin assembly protein 2 small
           chain; AltName: Full=Clathrin coat assembly protein
           AP17; AltName: Full=Clathrin coat-associated protein
           AP17; AltName: Full=HA2 17 kDa subunit; AltName:
           Full=Plasma membrane adaptor AP-2 17 kDa protein;
           AltName: Full=Sigma2-adaptin
 gi|73622190|sp|Q5R940.1|AP2S1_PONAB RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor protein complex AP-2 subunit
           sigma; AltName: Full=Clathrin assembly protein 2 small
           chain; AltName: Full=Clathrin coat assembly protein
           AP17; AltName: Full=Clathrin coat-associated protein
           AP17; AltName: Full=Plasma membrane adaptor AP-2 17 kDa
           protein; AltName: Full=Sigma-adaptin 3b; AltName:
           Full=Sigma2-adaptin
 gi|122143669|sp|Q17QC5.1|AP2S1_BOVIN RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor protein complex AP-2 subunit
           sigma; AltName: Full=Clathrin assembly protein 2 small
           chain; AltName: Full=Clathrin coat assembly protein
           AP17; AltName: Full=Clathrin coat-associated protein
           AP17; AltName: Full=Plasma membrane adaptor AP-2 17 kDa
           protein; AltName: Full=Sigma2-adaptin
 gi|163931091|pdb|2VGL|S Chain S, Ap2 Clathrin Adaptor Core
 gi|210060728|pdb|2JKR|I Chain I, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm(
           Phosphos)qikrllse
 gi|210060733|pdb|2JKR|S Chain S, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm(
           Phosphos)qikrllse
 gi|210060738|pdb|2JKT|I Chain I, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide Rm(
           Phosphos)eikrllse  Q To E Mutant
 gi|210060743|pdb|2JKT|S Chain S, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide Rm(
           Phosphos)eikrllse  Q To E Mutant
 gi|301015719|pdb|2XA7|S Chain S, Ap2 Clathrin Adaptor Core In Active Complex With Cargo
           Peptides
 gi|202928|gb|AAA40742.1| clathrin-associated protein 17 [Rattus norvegicus]
 gi|13623469|gb|AAH06337.1| Adaptor-related protein complex 2, sigma 1 subunit [Homo sapiens]
 gi|55729989|emb|CAH91720.1| hypothetical protein [Pongo abelii]
 gi|56789450|gb|AAH88138.1| Adaptor-related protein complex 2, sigma 1 subunit [Rattus
           norvegicus]
 gi|74144582|dbj|BAE27279.1| unnamed protein product [Mus musculus]
 gi|109659228|gb|AAI18438.1| Adaptor-related protein complex 2, sigma 1 subunit [Bos taurus]
 gi|119577852|gb|EAW57448.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Homo sapiens]
 gi|148710137|gb|EDL42083.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Mus musculus]
 gi|148710138|gb|EDL42084.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Mus musculus]
 gi|149056879|gb|EDM08310.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Rattus norvegicus]
 gi|149056881|gb|EDM08312.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Rattus norvegicus]
 gi|149056882|gb|EDM08313.1| adaptor-related protein complex 2, sigma 1 subunit, isoform CRA_a
           [Rattus norvegicus]
 gi|189065218|dbj|BAG34941.1| unnamed protein product [Homo sapiens]
 gi|296477502|tpg|DAA19617.1| TPA: AP-2 complex subunit sigma [Bos taurus]
 gi|300837101|gb|ADK38582.1| adaptor-related protein complex 2 sigma 1 subunit [Ailuropoda
           melanoleuca]
 gi|325464029|gb|ADZ15785.1| adaptor-related protein complex 2, sigma 1 subunit [synthetic
           construct]
          Length = 142

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|15220987|ref|NP_175219.1| SNARE-like superfamily protein [Arabidopsis thaliana]
 gi|297852382|ref|XP_002894072.1| hypothetical protein ARALYDRAFT_891585 [Arabidopsis lyrata subsp.
           lyrata]
 gi|75148767|sp|Q84WL9.1|AP2S_ARATH RecName: Full=AP-2 complex subunit sigma; AltName:
           Full=Adapter-related protein complex 2 sigma subunit;
           AltName: Full=Adaptor AP-2 17 kDa protein; AltName:
           Full=Clathrin assembly protein 2 small chain; AltName:
           Full=Clathrin coat assembly protein AP17; AltName:
           Full=Clathrin coat-associated protein AP17; AltName:
           Full=Sigma2-adaptin
 gi|27764984|gb|AAO23613.1| At1g47830 [Arabidopsis thaliana]
 gi|110742867|dbj|BAE99331.1| putative clathrin coat assembly protein AP17 [Arabidopsis thaliana]
 gi|297339914|gb|EFH70331.1| hypothetical protein ARALYDRAFT_891585 [Arabidopsis lyrata subsp.
           lyrata]
 gi|332194099|gb|AEE32220.1| AP-2 complex subunit sigma [Arabidopsis thaliana]
          Length = 142

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDAKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF VCVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSVCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KL+
Sbjct: 120 AGELQETSKRAIIERMSELEKLQ 142



>gi|242067999|ref|XP_002449276.1| hypothetical protein SORBIDRAFT_05g007040 [Sorghum bicolor]
 gi|223942567|gb|ACN25367.1| unknown [Zea mays]
 gi|241935119|gb|EES08264.1| hypothetical protein SORBIDRAFT_05g007040 [Sorghum bicolor]
 gi|414591316|tpg|DAA41887.1| TPA: hypothetical protein ZEAMMB73_842750 [Zea mays]
          Length = 142

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|351721716|ref|NP_001236195.1| uncharacterized protein LOC100500054 [Glycine max]
 gi|255628845|gb|ACU14767.1| unknown [Glycine max]
 gi|388502922|gb|AFK39527.1| unknown [Lotus japonicus]
          Length = 142

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K+ +NFVEFR +K++Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKY-TNFVEFRTHKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|145354863|ref|XP_001421694.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581932|gb|ABO99987.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 143

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP+ D+EK KL+ EVHRLV  RD KH +NFVEFRNYKV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPFADDEKRKLESEVHRLVVNRDPKH-TNFVEFRNYKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD NDNEL +LE+IH FVE+LD FF NVCELDLVFNF KVY ++DE  L
Sbjct: 60  RRYAGLFFSLCVDLNDNELTHLESIHLFVEMLDHFFANVCELDLVFNFQKVYLLVDEFLL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GE+++TSK  ++ RL  L++++
Sbjct: 120 GGEVQDTSKRAIMERLAELERIK 142



>gi|302815031|ref|XP_002989198.1| hypothetical protein SELMODRAFT_272044 [Selaginella moellendorffii]
 gi|300143098|gb|EFJ09792.1| hypothetical protein SELMODRAFT_272044 [Selaginella moellendorffii]
          Length = 142

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK KL+ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKQKLQYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSMCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L++ E
Sbjct: 120 AGELQETSKKAIIERMAELERQE 142



>gi|504175502|ref|XP_004597269.1| PREDICTED: AP-2 complex subunit sigma-like [Ochotona princeps]
          Length = 175

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 34  MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 92

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 93  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 152

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 153 AGEIRETSQTKVLKQLLMLQSLE 175



>gi|297735018|emb|CBI17380.3| unnamed protein product [Vitis vinifera]
          Length = 172

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNRQGKTRL+K+YVP+E+ EK K++ EVHRLV  RD KH +NFVEFR +KV+YR
Sbjct: 32  IRFILLQNRQGKTRLAKYYVPFEESEKHKVEYEVHRLVVNRDPKH-TNFVEFRTHKVIYR 90

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  LA
Sbjct: 91  RYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 150

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE++ETSK  ++ R+  L+K E
Sbjct: 151 GELQETSKKAIIERMGELEKQE 172



>gi|115487800|ref|NP_001066387.1| Os12g0207300 [Oryza sativa Japonica Group]
 gi|242085198|ref|XP_002443024.1| hypothetical protein SORBIDRAFT_08g006500 [Sorghum bicolor]
 gi|17149110|gb|AAL35901.1|AF443601_1 clathrin assembly protein AP17-like protein [Oryza sativa]
 gi|77553342|gb|ABA96138.1| Clathrin coat assembly protein AP17, putative, expressed [Oryza
           sativa Japonica Group]
 gi|113648894|dbj|BAF29406.1| Os12g0207300 [Oryza sativa Japonica Group]
 gi|215697333|dbj|BAG91327.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|241943717|gb|EES16862.1| hypothetical protein SORBIDRAFT_08g006500 [Sorghum bicolor]
          Length = 142

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSMCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKRAIIERMGELEKLE 142



>gi|344247455|gb|EGW03559.1| AP-2 complex subunit sigma [Cricetulus griseus]
          Length = 145

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 4   LIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 62

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 63  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 122

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 123 AGEIRETSQTKVLKQLLMLQSLE 145



>gi|224065891|ref|XP_002301979.1| predicted protein [Populus trichocarpa]
 gi|222843705|gb|EEE81252.1| predicted protein [Populus trichocarpa]
          Length = 142

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDAKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKRAIIERMGELEKLE 142



>gi|24648686|ref|NP_650961.2| AP-2sigma [Drosophila melanogaster]
 gi|194741694|ref|XP_001953322.1| GF17262 [Drosophila ananassae]
 gi|194899530|ref|XP_001979312.1| GG14749 [Drosophila erecta]
 gi|195166168|ref|XP_002023907.1| GL27163 [Drosophila persimilis]
 gi|195355522|ref|XP_002044240.1| GM15088 [Drosophila sechellia]
 gi|195399730|ref|XP_002058472.1| GJ14442 [Drosophila virilis]
 gi|195454244|ref|XP_002074153.1| GK12771 [Drosophila willistoni]
 gi|195498458|ref|XP_002096532.1| AP-2sigma [Drosophila yakuba]
 gi|195569215|ref|XP_002102606.1| GD19995 [Drosophila simulans]
 gi|198450599|ref|XP_001358057.2| GA19327 [Drosophila pseudoobscura pseudoobscura]
 gi|7300728|gb|AAF55874.1| AP-2sigma [Drosophila melanogaster]
 gi|33636545|gb|AAQ23570.1| RE35245p [Drosophila melanogaster]
 gi|38048177|gb|AAR09991.1| similar to Drosophila melanogaster AP-2sigma, partial [Drosophila
           yakuba]
 gi|190626381|gb|EDV41905.1| GF17262 [Drosophila ananassae]
 gi|190651015|gb|EDV48270.1| GG14749 [Drosophila erecta]
 gi|194106067|gb|EDW28110.1| GL27163 [Drosophila persimilis]
 gi|194129541|gb|EDW51584.1| GM15088 [Drosophila sechellia]
 gi|194142032|gb|EDW58440.1| GJ14442 [Drosophila virilis]
 gi|194170238|gb|EDW85139.1| GK12771 [Drosophila willistoni]
 gi|194182633|gb|EDW96244.1| AP-2sigma [Drosophila yakuba]
 gi|194198533|gb|EDX12109.1| GD19995 [Drosophila simulans]
 gi|198131105|gb|EAL27194.2| GA19327 [Drosophila pseudoobscura pseudoobscura]
 gi|220950834|gb|ACL87960.1| AP-2sigma-PA [synthetic construct]
 gi|220959526|gb|ACL92306.1| AP-2sigma-PA [synthetic construct]
          Length = 142

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLTLNSLE 142



>gi|145531767|ref|XP_001451650.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124419305|emb|CAK84253.1| unnamed protein product [Paramecium tetraurelia]
          Length = 470

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRLSKWYV Y+D EKVKL+ EVHRL+  RD KH +NF+EFRNYK++Y
Sbjct: 329 MIRFILLQNRQGKTRLSKWYVYYDDAEKVKLQNEVHRLIVCRDTKH-TNFLEFRNYKIIY 387

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           +RYAGLFF +CVD +DNEL  LE IH +VEVLD +FGNVCELD+VFNF K Y+ILDE+ +
Sbjct: 388 KRYAGLFFALCVDVSDNELTMLELIHLYVEVLDKYFGNVCELDIVFNFNKAYSILDEMIV 447

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI ETSK +++T + +++ L+
Sbjct: 448 GGEIVETSKQVIITAVKNIELLD 470



>gi|255538924|ref|XP_002510527.1| clathrin coat assembly protein ap17, putative [Ricinus communis]
 gi|223551228|gb|EEF52714.1| clathrin coat assembly protein ap17, putative [Ricinus communis]
 gi|462422950|gb|EMJ27213.1| hypothetical protein PRUPE_ppa013056mg [Prunus persica]
 gi|508723122|gb|EOY15019.1| SNARE-like superfamily protein [Theobroma cacao]
          Length = 142

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|388503672|gb|AFK39902.1| unknown [Lotus japonicus]
          Length = 142

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K+ +NFVEFR +K++Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKY-TNFVEFRTHKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY +LDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLMLDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|224083002|ref|XP_002306925.1| predicted protein [Populus trichocarpa]
 gi|118482928|gb|ABK93377.1| unknown [Populus trichocarpa]
 gi|118487844|gb|ABK95745.1| unknown [Populus trichocarpa]
 gi|118488818|gb|ABK96219.1| unknown [Populus trichocarpa x Populus deltoides]
 gi|222856374|gb|EEE93921.1| predicted protein [Populus trichocarpa]
          Length = 142

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 101/143 (70%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFALCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKRAIIERMGELEKLE 142



>gi|1296607|emb|CAA65782.1| clathrin-associated protein [Homo sapiens]
 gi|3413475|emb|CAA09018.1| clathrin-associated protein AP17 [Homo sapiens]
          Length = 142

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN+LAYLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNKLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|260803746|ref|XP_002596750.1| hypothetical protein BRAFLDRAFT_262959 [Branchiostoma floridae]
 gi|229282010|gb|EEN52762.1| hypothetical protein BRAFLDRAFT_262959 [Branchiostoma floridae]
          Length = 142

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH  V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHACVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLMYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLNSLE 142



>gi|91087215|ref|XP_975476.1| PREDICTED: similar to clathrin coat assembly protein ap17
           [Tribolium castaneum]
 gi|512903816|ref|XP_004925710.1| PREDICTED: AP-2 complex subunit sigma-like isoform X1 [Bombyx mori]
 gi|512903820|ref|XP_004925711.1| PREDICTED: AP-2 complex subunit sigma-like isoform X2 [Bombyx mori]
 gi|285027713|gb|ADC34230.1| clathrin coat assembly protein ap17 [Solenopsis invicta]
 gi|506969043|gb|AGM32865.1| clathrin coat assembly protein AP17-like protein [Coptotermes
           formosanus]
          Length = 142

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLNSLE 142



>gi|291241881|ref|XP_002740838.1| PREDICTED: AdaPtin, Small chain (clathrin associated complex)
           family member (aps-2)-like [Saccoglossus kowalevskii]
          Length = 229

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH LV  RD KH +NFVEFRN+K+VYR
Sbjct: 89  IRFILIQNRAGKTRLAKWYMSFDDDEKQKLIEEVHALVTVRDAKH-TNFVEFRNFKIVYR 147

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVYA++DE+FLA
Sbjct: 148 RYAGLYFCICVDVTDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYAVVDEMFLA 207

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 208 GEIRETSQTKVLKQLLMLQALE 229



>gi|157104909|ref|XP_001648627.1| clathrin coat assembly protein ap17 [Aedes aegypti]
 gi|157104911|ref|XP_001648628.1| clathrin coat assembly protein ap17 [Aedes aegypti]
 gi|158301732|ref|XP_321389.2| AGAP001703-PA [Anopheles gambiae str. PEST]
 gi|170047224|ref|XP_001851131.1| clathrin coat assembly protein AP17 [Culex quinquefasciatus]
 gi|498997261|ref|XP_004533559.1| PREDICTED: AP-2 complex subunit sigma-like [Ceratitis capitata]
 gi|94468540|gb|ABF18119.1| clathrin adaptor complex small subunit [Aedes aegypti]
 gi|108869115|gb|EAT33340.1| AAEL014375-PA [Aedes aegypti]
 gi|108869116|gb|EAT33341.1| AAEL014375-PB [Aedes aegypti]
 gi|157012615|gb|EAA01622.2| AGAP001703-PA [Anopheles gambiae str. PEST]
 gi|167869701|gb|EDS33084.1| clathrin coat assembly protein AP17 [Culex quinquefasciatus]
 gi|312372019|gb|EFR20072.1| hypothetical protein AND_30500 [Anopheles darlingi]
          Length = 142

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLTLNSLE 142



>gi|478250334|gb|ENN70831.1| hypothetical protein YQE_12495, partial [Dendroctonus ponderosae]
          Length = 142

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLTLNNLE 142



>gi|507578342|ref|XP_004672689.1| PREDICTED: AP-2 complex subunit sigma isoform X1 [Jaculus jaculus]
 gi|507700184|ref|XP_004644336.1| PREDICTED: AP-2 complex subunit sigma [Octodon degus]
 gi|513011479|ref|XP_004867144.1| PREDICTED: AP-2 complex subunit sigma isoform X2 [Heterocephalus
           glaber]
          Length = 142

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD +DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVSDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|432090573|gb|ELK23989.1| AP-2 complex subunit sigma [Myotis davidii]
          Length = 168

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 28  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 86

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 87  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 146

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 147 GEIRETSQTKVLKQLLMLQSLE 168



>gi|209730620|gb|ACI66179.1| AP-2 complex subunit sigma-1 [Salmo salar]
          Length = 142

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFAICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KL+
Sbjct: 120 AGELQETSKKAIIERMGELEKLD 142



>gi|168049922|ref|XP_001777410.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671259|gb|EDQ57814.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 142

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (82%), Gaps = 1/141 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+Y+P ED EK KL+ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYIPLEDSEKHKLEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDK 141
           AGE++ETSK  ++ R+  L+K
Sbjct: 120 AGELQETSKKAIIERMGELEK 140



>gi|47085925|ref|NP_998320.1| AP-2 complex subunit sigma [Danio rerio]
 gi|62858689|ref|NP_001016325.1| adaptor-related protein complex 2, sigma 1 subunit [Xenopus
           (Silurana) tropicalis]
 gi|148234855|ref|NP_001087189.1| adaptor-related protein complex 2, sigma 1 subunit [Xenopus laevis]
 gi|34784526|gb|AAH58042.1| Zgc:65827 [Danio rerio]
 gi|51874015|gb|AAH78470.1| MGC85224 protein [Xenopus laevis]
 gi|89266929|emb|CAJ83655.1| adaptor-related protein complex 2, sigma 1 subunit [Xenopus
           (Silurana) tropicalis]
 gi|213625562|gb|AAI70868.1| adaptor-related protein complex 2, sigma 1 subunit [Xenopus
           (Silurana) tropicalis]
 gi|213625635|gb|AAI71019.1| adaptor-related protein complex 2, sigma 1 subunit [Xenopus
           (Silurana) tropicalis]
          Length = 142

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVTDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|321469738|gb|EFX80717.1| hypothetical protein DAPPUDRAFT_303876 [Daphnia pulex]
          Length = 142

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDINDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLSSLE 142



>gi|195996217|ref|XP_002107977.1| conserved hypothetical protein [Trichoplax adhaerens]
 gi|190588753|gb|EDV28775.1| conserved hypothetical protein [Trichoplax adhaerens]
          Length = 142

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/136 (72%), Positives = 115/136 (84%), Gaps = 1/136 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFI +QNR GKTRL+KWY+ +EDEEK KL  EVH LV  RD KH +NFVEFRNYK+VY
Sbjct: 1   MIRFIFIQNRAGKTRLAKWYMHFEDEEKQKLIEEVHALVTVRDAKH-TNFVEFRNYKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCLCVDIADNSLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRL 136
           AGEI ETS++ VL +L
Sbjct: 120 AGEIRETSQSKVLKQL 135



>gi|355703695|gb|EHH30186.1| hypothetical protein EGK_10802, partial [Macaca mulatta]
          Length = 142

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 2   IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 61  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 120

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 121 GEIRETSQTKVLKQLLMLQSLE 142



>gi|281202459|gb|EFA76661.1| adaptor-related protein complex 2 [Polysphondylium pallidum PN500]
          Length = 135

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/135 (71%), Positives = 113/135 (83%), Gaps = 1/135 (0%)

Query: 8   QNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYRRYAGLF 67
            NRQGKTRLSKWY PY+D EK KL  E+H++V  R+ K  +NFVEFR ++++YRRYAGLF
Sbjct: 1   MNRQGKTRLSKWYTPYDDVEKRKLSNEIHKIVNSRETKF-TNFVEFRTHRIIYRRYAGLF 59

Query: 68  FCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEET 127
           FC+CVD  DNEL  LEAIH FVEVLDA+FGNVCELDLVFNFYKVYAILDEVFLAGE+ E 
Sbjct: 60  FCMCVDPTDNELFCLEAIHLFVEVLDAYFGNVCELDLVFNFYKVYAILDEVFLAGELMEP 119

Query: 128 SKNIVLTRLDHLDKL 142
           SK+I+L R+D LD L
Sbjct: 120 SKHIILQRMDFLDNL 134



>gi|449437206|ref|XP_004136383.1| PREDICTED: AP-2 complex subunit sigma-like [Cucumis sativus]
 gi|449505752|ref|XP_004162559.1| PREDICTED: AP-2 complex subunit sigma-like [Cucumis sativus]
          Length = 142

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|114678037|ref|XP_001168447.1| PREDICTED: AP-2 complex subunit sigma isoform 2 [Pan troglodytes]
 gi|332257128|ref|XP_003277667.1| PREDICTED: AP-2 complex subunit sigma isoform 3 [Nomascus
           leucogenys]
 gi|402906048|ref|XP_003915819.1| PREDICTED: AP-2 complex subunit sigma isoform 3 [Papio anubis]
          Length = 144

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 4   IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 62

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 63  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 122

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 123 GEIRETSQTKVLKQLLMLQSLE 144



>gi|242021509|ref|XP_002431187.1| clathrin coat assembly protein ap17, putative [Pediculus humanus
           corporis]
 gi|212516436|gb|EEB18449.1| clathrin coat assembly protein ap17, putative [Pediculus humanus
           corporis]
          Length = 142

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+  +D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNIDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLNSLE 142



>gi|114678035|ref|XP_001168470.1| PREDICTED: AP-2 complex subunit sigma isoform 3 [Pan troglodytes]
 gi|332257126|ref|XP_003277666.1| PREDICTED: AP-2 complex subunit sigma isoform 2 [Nomascus
           leucogenys]
          Length = 158

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 18  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 76

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 77  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 136

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 137 GEIRETSQTKVLKQLLMLQSLE 158



>gi|116786965|gb|ABK24321.1| unknown [Picea sitchensis]
          Length = 142

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+Y+P E+ EK KL+ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYIPLEESEKHKLEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSMCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L++ E
Sbjct: 120 AGELQETSKKAIIERMTELERQE 142



>gi|426243988|ref|XP_004015820.1| PREDICTED: AP-2 complex subunit sigma [Ovis aries]
          Length = 225

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 85  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 143

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 144 RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 203

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 204 GEIRETSQTKVLKQLLMLQSLE 225



>gi|125578822|gb|EAZ19968.1| hypothetical protein OsJ_35559 [Oryza sativa Japonica Group]
          Length = 151

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+YR
Sbjct: 11  IRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIYR 69

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  LA
Sbjct: 70  RYAGLFFSMCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 129

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE++ETSK  ++ R+  L+KLE
Sbjct: 130 GELQETSKRAIIERMGELEKLE 151



>gi|402906046|ref|XP_003915818.1| PREDICTED: AP-2 complex subunit sigma isoform 2 [Papio anubis]
          Length = 158

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 18  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 76

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 77  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 136

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 137 GEIRETSQTKVLKQLLMLQSLE 158



>gi|383858038|ref|XP_003704510.1| PREDICTED: AP-2 complex subunit sigma-like [Megachile rotundata]
          Length = 147

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 6   IIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 64

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 65  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 124

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 125 AGEIRETSQTKVLKQLLMLNSLE 147



>gi|302811191|ref|XP_002987285.1| hypothetical protein SELMODRAFT_271913 [Selaginella moellendorffii]
 gi|300144920|gb|EFJ11600.1| hypothetical protein SELMODRAFT_271913 [Selaginella moellendorffii]
          Length = 142

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK KL+ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKQKLQYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+I+ FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSMCVDITDNELAYLESIYLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L++ E
Sbjct: 120 AGELQETSKKAIIERMAELERQE 142



>gi|125536086|gb|EAY82574.1| hypothetical protein OsI_37796 [Oryza sativa Indica Group]
          Length = 151

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+YR
Sbjct: 11  IRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIYR 69

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  LA
Sbjct: 70  RYAGLFFSMCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 129

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE++ETSK  ++ R+  L+KLE
Sbjct: 130 GELQETSKRAIIERMGELEKLE 151



>gi|389612603|dbj|BAM19730.1| clathrin coat assembly protein ap17 [Papilio xuthus]
          Length = 142

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNF+KVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFFKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLNSLE 142



>gi|350423072|ref|XP_003493376.1| PREDICTED: AP-2 complex subunit sigma-like [Bombus impatiens]
          Length = 182

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 41  IIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 99

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 100 RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 159

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 160 AGEIRETSQTKVLKQLLMLNSLE 182



>gi|340727423|ref|XP_003402043.1| PREDICTED: AP-2 complex subunit sigma-like [Bombus terrestris]
          Length = 182

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 41  IIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 99

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 100 RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 159

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 160 AGEIRETSQTKVLKQLLMLNSLE 182



>gi|444730777|gb|ELW71151.1| AP-2 complex subunit sigma [Tupaia chinensis]
          Length = 162

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 22  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 80

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 81  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 140

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 141 GEIRETSQTKVLKQLLMLQSLE 162



>gi|380027828|ref|XP_003697618.1| PREDICTED: AP-2 complex subunit sigma-like [Apis florea]
          Length = 153

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 12  IIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 70

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 71  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 130

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 131 AGEIRETSQTKVLKQLLMLNSLE 153



>gi|345495771|ref|XP_001600601.2| PREDICTED: AP-2 complex subunit sigma-like [Nasonia vitripennis]
          Length = 142

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLNSLE 142



>gi|332376661|gb|AEE63470.1| unknown [Dendroctonus ponderosae]
          Length = 142

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK K   EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKFIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLLTLNNLE 142



>gi|512827969|ref|XP_004881300.1| PREDICTED: AP-2 complex subunit sigma [Heterocephalus glaber]
 gi|513011477|ref|XP_004867143.1| PREDICTED: AP-2 complex subunit sigma isoform X1 [Heterocephalus
           glaber]
          Length = 162

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 22  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 80

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD +DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 81  RYAGLYFCICVDVSDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 140

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 141 GEIRETSQTKVLKQLLMLQSLE 162



>gi|195113909|ref|XP_002001510.1| GI10836 [Drosophila mojavensis]
 gi|193918104|gb|EDW16971.1| GI10836 [Drosophila mojavensis]
          Length = 141

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 119/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VYR
Sbjct: 1   IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVYR 59

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FLA
Sbjct: 60  RYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLA 119

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L+ LE
Sbjct: 120 GEIRETSQTKVLKQLLTLNSLE 141



>gi|354496926|ref|XP_003510574.1| PREDICTED: AP-2 complex subunit sigma-like [Cricetulus griseus]
          Length = 169

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 29  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 87

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 88  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 147

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 148 GEIRETSQTKVLKQLLMLQSLE 169



>gi|440901773|gb|ELR52659.1| AP-2 complex subunit sigma, partial [Bos grunniens mutus]
          Length = 166

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 26  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 84

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 85  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 144

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 145 GEIRETSQTKVLKQLLMLQSLE 166



>gi|504175505|ref|XP_004597270.1| PREDICTED: AP-2 complex subunit sigma-like [Ochotona princeps]
          Length = 166

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 26  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 84

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 85  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 144

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 145 GEIRETSQTKVLKQLLMLQSLE 166



>gi|348526700|ref|XP_003450857.1| PREDICTED: AP-2 complex subunit sigma-like [Oreochromis niloticus]
 gi|410909866|ref|XP_003968411.1| PREDICTED: AP-2 complex subunit sigma-like [Takifugu rubripes]
 gi|432890270|ref|XP_004075448.1| PREDICTED: AP-2 complex subunit sigma-like isoform 1 [Oryzias
           latipes]
 gi|498950928|ref|XP_004543728.1| PREDICTED: AP-2 complex subunit sigma-like isoform X1 [Maylandia
           zebra]
 gi|209156056|gb|ACI34260.1| AP-2 complex subunit sigma-1 [Salmo salar]
 gi|221219556|gb|ACM08439.1| AP-2 complex subunit sigma-1 [Salmo salar]
 gi|223646926|gb|ACN10221.1| AP-2 complex subunit sigma-1 [Salmo salar]
 gi|223672789|gb|ACN12576.1| AP-2 complex subunit sigma-1 [Salmo salar]
 gi|225703512|gb|ACO07602.1| AP-2 complex subunit sigma-1 [Oncorhynchus mykiss]
 gi|225705112|gb|ACO08402.1| AP-2 complex subunit sigma-1 [Oncorhynchus mykiss]
          Length = 142

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVTDNNLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLQSLE 142



>gi|414878313|tpg|DAA55444.1| TPA: hypothetical protein ZEAMMB73_059633 [Zea mays]
          Length = 142

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YV  ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVALEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKRAIIERMGELEKLE 142



>gi|357160511|ref|XP_003578788.1| PREDICTED: AP-2 complex subunit sigma-like [Brachypodium
           distachyon]
 gi|326523623|dbj|BAJ92982.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326532016|dbj|BAK01384.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 142

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNEL YLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSICVDITDNELVYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KL+
Sbjct: 120 AGELQETSKKAIIERMGELEKLD 142



>gi|156387510|ref|XP_001634246.1| predicted protein [Nematostella vectensis]
 gi|156221327|gb|EDO42183.1| predicted protein [Nematostella vectensis]
          Length = 142

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (84%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH LV  RD KH +NFVEFRN+K+VYR
Sbjct: 2   IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHALVTVRDAKH-TNFVEFRNFKIVYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC CVD +DN L YLEAIH FVEVL+ FF NVCELDLVFNFYKVY+++DE+FLA
Sbjct: 61  RYAGLYFCFCVDVSDNNLYYLEAIHNFVEVLNEFFHNVCELDLVFNFYKVYSVVDEMFLA 120

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE+ ETS++ VL +L+ L +LE
Sbjct: 121 GELRETSQSKVLKQLNMLQQLE 142



>gi|355755971|gb|EHH59718.1| hypothetical protein EGM_09903, partial [Macaca fascicularis]
          Length = 142

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 2   IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 61  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 120

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L     LE
Sbjct: 121 GEIRETSQTKVLKQLLMTQSLE 142



>gi|30983940|gb|AAP40645.1| clathrin coat assembly protein [Gossypium barbadense]
          Length = 142

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+ +QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFVSLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 120 AGELQETSKKAIIERMGELEKLE 142



>gi|159485706|ref|XP_001700885.1| Sigma2-Adaptin [Chlamydomonas reinhardtii]
 gi|158281384|gb|EDP07139.1| Sigma2-Adaptin [Chlamydomonas reinhardtii]
          Length = 143

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR G+TRLSK+YVP E++E+ KL+ E+HRLV  RD KH +NF+EFRNYKVVY
Sbjct: 1   MIRFILLQNRAGRTRLSKYYVPIEEKERRKLEYEIHRLVVNRDPKH-TNFLEFRNYKVVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +C+D +DNEL  LEAIH FVE+LD +F NVCELDLVFNF+KVY ILDE   
Sbjct: 60  RRYAGLFFSMCIDQSDNELTCLEAIHLFVEILDHYFSNVCELDLVFNFHKVYLILDEFIC 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI+ET+K ++L RL  LDK++
Sbjct: 120 GGEIQETAKKVILERLAELDKID 142



>gi|270010572|gb|EFA07020.1| hypothetical protein TcasGA2_TC009991 [Tribolium castaneum]
          Length = 160

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VYR
Sbjct: 20  IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVYR 78

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 79  RYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 138

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L+ LE
Sbjct: 139 GEIRETSQTKVLKQLLMLNSLE 160



>gi|460385326|ref|XP_004238355.1| PREDICTED: AP-2 complex subunit sigma-like [Solanum lycopersicum]
          Length = 142

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+Y+P E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYIPLEESEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+K E
Sbjct: 120 AGELQETSKRAIIERMGELEKQE 142



>gi|221115717|ref|XP_002157396.1| PREDICTED: AP-2 complex subunit sigma-like [Hydra magnipapillata]
          Length = 142

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+P +DEEK KL  EVH  V  RD KH +NFVEFR++K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYIPLDDEEKQKLIEEVHATVTVRDAKH-TNFVEFRSFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC CVD  DN L YLEAIH FVEVL+ FF NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCFCVDVGDNNLVYLEAIHNFVEVLNEFFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  +  LE
Sbjct: 120 AGEIRETSQAKVLKQLYMIGTLE 142



>gi|424513332|emb|CCO65954.1| predicted protein [Bathycoccus prasinos]
          Length = 143

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 121/143 (84%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP E++EK +L+ EVHR+V  RD KH S FVEF+N+K+VY
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEEDEKHQLETEVHRVVVNRDPKHTS-FVEFKNHKLVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD++DNEL +LE+IH FVE+LD FF NVCELDLVFNF KVY I+DE  L
Sbjct: 60  RRYAGLFFTLCVDSSDNELVHLESIHLFVEILDHFFANVCELDLVFNFQKVYVIVDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ RL  L++++
Sbjct: 120 AGEVQETSKKAIMMRLAELEQIK 142



>gi|241730132|ref|XP_002412265.1| clathrin adaptor complex, small subunit [Ixodes scapularis]
 gi|215505504|gb|EEC14998.1| clathrin adaptor complex, small subunit [Ixodes scapularis]
          Length = 142

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 120/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD +DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVHDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L   + LE
Sbjct: 120 AGEIRETSQTKVLKQLLVYNSLE 142



>gi|348557867|ref|XP_003464740.1| PREDICTED: AP-2 complex subunit sigma-like [Cavia porcellus]
          Length = 222

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 81  LIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 139

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD +DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 140 RRYAGLYFCICVDVSDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 199

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 200 AGEIRETSQTKVLKQLLMLQSLE 222



>gi|428181191|gb|EKX50056.1| Adaptor protein complex 2 subunit sigma [Guillardia theta CCMP2712]
          Length = 145

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+L+QNRQGKTRLSKWYVPY+D EK  ++ E H++V  R+ K  +NFVE+R +K+VY
Sbjct: 1   MIRFLLLQNRQGKTRLSKWYVPYDDTEKQSIQLECHKVVTQRESKF-TNFVEWRTHKLVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD NDNELA LEAIH FVE+LD +FGNVCELDLVFNF+KV+ ILDE FL
Sbjct: 60  RRYAGLFFTLCVDVNDNELACLEAIHLFVEILDQYFGNVCELDLVFNFHKVFVILDEYFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
           AGE+ ETSK  +L R+  +D+L
Sbjct: 120 AGEVMETSKVQILNRVHEIDRL 141



>gi|145519722|ref|XP_001445722.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124413188|emb|CAK78325.1| unnamed protein product [Paramecium tetraurelia]
          Length = 147

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           +IRFIL+QNRQGKTRLSKWYV Y+D EKVKL+ EVHRL+  RD KH +NF+EFRNYK++Y
Sbjct: 6   IIRFILLQNRQGKTRLSKWYVYYDDAEKVKLQNEVHRLIVCRDTKH-TNFLEFRNYKIIY 64

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           +RYAGLFF +CVD +DNEL  LE IH +VEVLD +FGNVCELD+VFNF K Y+ILDE+ +
Sbjct: 65  KRYAGLFFALCVDVSDNELTMLELIHLYVEVLDKYFGNVCELDIVFNFNKAYSILDEMIV 124

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI ETSK +++  + +++ L+
Sbjct: 125 GGEIVETSKQVIINAVKNIELLD 147



>gi|391331217|ref|XP_003740046.1| PREDICTED: AP-2 complex subunit sigma-like [Metaseiulus
           occidentalis]
          Length = 142

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVGDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L   + LE
Sbjct: 120 AGEIRETSQTKVLKQLLVYNSLE 142



>gi|240849129|ref|NP_001155429.1| clathrin coat assembly protein ap17-like [Acyrthosiphon pisum]
 gi|239792022|dbj|BAH72399.1| ACYPI001489 [Acyrthosiphon pisum]
          Length = 142

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVGDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLSSLE 142



>gi|290562477|gb|ADD38634.1| AP-2 complex subunit sigma [Lepeophtheirus salmonis]
          Length = 142

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI+F+++QNR GKTRL+KWY+ ++D+EK KL  EVH  V  RD KH +NFVEFR+YK+VY
Sbjct: 1   MIKFVMIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHACVTVRDAKH-TNFVEFRHYKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLYYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLTMLNSLE 142



>gi|474376929|gb|EMS64227.1| AP-2 complex subunit sigma [Triticum urartu]
          Length = 226

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
            IRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 85  TIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 143

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNEL YLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 144 RRYAGLFFSICVDITDNELVYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 203

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KL+
Sbjct: 204 AGELQETSKKAIIERMGELEKLD 226



>gi|384248781|gb|EIE22264.1| putative clathrin coat assembly protein [Coccomyxa subellipsoidea
           C-169]
          Length = 143

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+K+YVP +D EK  L+ +VHRL+A RD K  +NFVEF+  KV+Y
Sbjct: 1   MIRFILLQNRAGKTRLAKYYVPLDDSEKRNLEYDVHRLIATRDAKF-TNFVEFKTNKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F VCVD  DNELAYLE+IH FVE+LD +F NVCELDLVFNF+KVY ILDE  +
Sbjct: 60  RRYAGLYFSVCVDVTDNELAYLESIHLFVEILDHYFSNVCELDLVFNFHKVYLILDEFIM 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI+ETSK ++L RL  LD++E
Sbjct: 120 GGEIQETSKKVILERLAELDRIE 142



>gi|432890272|ref|XP_004075449.1| PREDICTED: AP-2 complex subunit sigma-like isoform 2 [Oryzias
           latipes]
          Length = 167

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 116/142 (81%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 27  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 85

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD  DN LAYLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 86  RYAGLYFCICVDVTDNNLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 145

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 146 GEIRETSQTKVLKQLLMLQSLE 167



>gi|47225038|emb|CAF97453.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 146

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 116/142 (81%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 6   IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 64

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD  DN LAYLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 65  RYAGLYFCICVDVTDNNLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 124

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 125 GEIRETSQTKVLKQLLMLQSLE 146



>gi|302142656|emb|CBI19859.3| unnamed protein product [Vitis vinifera]
          Length = 188

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFI++QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 47  MIRFIILQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 105

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 106 RRYAGLFFSLCVDMTDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 165

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+K E
Sbjct: 166 AGELQETSKKAIIERMGELEKQE 188



>gi|339236459|ref|XP_003379784.1| AP-2 complex subunit sigma [Trichinella spiralis]
 gi|316977503|gb|EFV60595.1| AP-2 complex subunit sigma [Trichinella spiralis]
          Length = 142

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMHFDDNEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+C D  DN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVYA++DE+FL
Sbjct: 60  RRYAGLYFCICCDITDNNLYYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYAVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L+ LE
Sbjct: 120 AGEIRETSQTKVLKQLMMLNSLE 142



>gi|301775354|ref|XP_002923090.1| PREDICTED: AP-2 complex subunit sigma-like [Ailuropoda melanoleuca]
          Length = 146

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (80%), Gaps = 5/147 (3%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGE----IEETSKNIVLTRLDHLDKLE 143
           AGE    I ETS+  VL +L  L  LE
Sbjct: 120 AGEIREXIRETSQTKVLKQLLMLQSLE 146



>gi|145491883|ref|XP_001431940.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124399047|emb|CAK64542.1| unnamed protein product [Paramecium tetraurelia]
          Length = 468

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRLSKWYV Y+D EK+KL+ EVHRL+  RD KH +NF+EFRNYK++Y
Sbjct: 327 MIRFILLQNRQGKTRLSKWYVYYDDAEKIKLQNEVHRLIVCRDTKH-TNFLEFRNYKIIY 385

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           +RYAGLFF +CVD +DNEL  LE IH +VEVLD +FGNVCELD+VFNF K Y+I DE+ +
Sbjct: 386 KRYAGLFFALCVDVSDNELTMLELIHLYVEVLDKYFGNVCELDIVFNFNKAYSIFDEMII 445

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI ETSK +++  + +++ L+
Sbjct: 446 GGEIIETSKQVIINAVKNIELLD 468



>gi|225457985|ref|XP_002275803.1| PREDICTED: AP-2 complex subunit sigma-like [Vitis vinifera]
          Length = 142

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFI++QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFIILQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSLCVDMTDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+K E
Sbjct: 120 AGELQETSKKAIIERMGELEKQE 142



>gi|198426268|ref|XP_002126503.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Ciona
           intestinalis]
          Length = 142

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD +DN LA LEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVSDNNLACLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  V+ +L  L  LE
Sbjct: 120 AGEIRETSQTKVIQQLLMLQNLE 142



>gi|17551440|ref|NP_508767.1| Protein APS-2 [Caenorhabditis elegans]
 gi|268579117|ref|XP_002644541.1| C. briggsae CBR-APS-2 protein [Caenorhabditis briggsae]
 gi|308511523|ref|XP_003117944.1| CRE-APS-2 protein [Caenorhabditis remanei]
 gi|308238590|gb|EFO82542.1| CRE-APS-2 protein [Caenorhabditis remanei]
 gi|341874566|gb|EGT30501.1| CBN-APS-2 protein [Caenorhabditis brenneri]
 gi|373219576|emb|CCD83385.1| Protein APS-2 [Caenorhabditis elegans]
          Length = 142

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH  V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMHFDDDEKQKLIEEVHACVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDITDNNLYYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLTSLE 142



>gi|360044484|emb|CCD82032.1| putative clathrin coat assembly protein AP17 [Schistosoma mansoni]
          Length = 142

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+  +DEEK KL  EVH LV  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNLDDEEKQKLIEEVHALVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+C+D  DN LAYLEAIH FVEVL+  F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCMCIDLMDNSLAYLEAIHNFVEVLNELFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL ++     LE
Sbjct: 120 AGEIRETSQTKVLKQVIMYSALE 142



>gi|256077833|ref|XP_002575204.1| clathrin coat assembly protein AP17 [Schistosoma mansoni]
          Length = 152

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+  +DEEK KL  EVH LV  RD KH +NFVEFRN+K+VY
Sbjct: 11  MIRFILIQNRAGKTRLAKWYMNLDDEEKQKLIEEVHALVTVRDAKH-TNFVEFRNFKIVY 69

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+C+D  DN LAYLEAIH FVEVL+  F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 70  RRYAGLYFCMCIDLMDNSLAYLEAIHNFVEVLNELFHNVCELDLVFNFYKVYSVVDEMFL 129

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL ++     LE
Sbjct: 130 AGEIRETSQTKVLKQVIMYSALE 152



>gi|349979408|dbj|GAA41671.1| AP-2 complex subunit sigma-1 [Clonorchis sinensis]
          Length = 142

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 115/143 (80%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+  +DEEK KL  EVH +V  RD KH +NFVEFRNYK+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMHLDDEEKQKLIEEVHAVVTVRDAKH-TNFVEFRNYKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FCVC+D  DN L YLEAIH FVEVL+  F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCVCIDVMDNSLMYLEAIHNFVEVLNELFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL ++     LE
Sbjct: 120 AGEIRETSQTKVLKQILMYSALE 142



>gi|443700628|gb|ELT99508.1| hypothetical protein CAPTEDRAFT_108511 [Capitella teleta]
          Length = 147

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++++EK KL  EVH +V  RD KH +NFVEFRN+K+VYR
Sbjct: 7   IRFILIQNRAGKTRLAKWYMHFDNDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIVYR 65

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD  DN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FLA
Sbjct: 66  RYAGLYFCICVDVADNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLA 125

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEI ETS+  VL +L  L  LE
Sbjct: 126 GEIRETSQTKVLKQLLMLSSLE 147



>gi|302847048|ref|XP_002955059.1| hypothetical protein VOLCADRAFT_76532 [Volvox carteri f.
           nagariensis]
 gi|300259587|gb|EFJ43813.1| hypothetical protein VOLCADRAFT_76532 [Volvox carteri f.
           nagariensis]
          Length = 143

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR G+TRLSK+YVP E+ E+ KL+ E+HRLV  RD KH +NF+EFR+YKVVY
Sbjct: 1   MIRFILLQNRAGRTRLSKYYVPIEEGERRKLEYEIHRLVVNRDPKH-TNFLEFRSYKVVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +C+D +DNEL  LEAIH FVE+LD +F NVCELDLVFNF+KVY ILDE   
Sbjct: 60  RRYAGLFFSMCIDQSDNELTCLEAIHLFVEILDHYFSNVCELDLVFNFHKVYLILDEFIS 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI+ET+K ++L RL  LDK++
Sbjct: 120 GGEIQETAKKVILERLAELDKID 142



>gi|308321949|gb|ADO28112.1| AP-2 complex subunit sigma [Ictalurus furcatus]
          Length = 142

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN LAYLE IH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVTDNNLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  V  +L  L  LE
Sbjct: 120 AGEIRETSQTKVPKQLLMLQSLE 142



>gi|226492775|ref|NP_001148376.1| clathrin coat assembly protein AP17 [Zea mays]
 gi|195618724|gb|ACG31192.1| AP-2 complex subunit sigma-1 [Zea mays]
          Length = 141

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 117/143 (81%), Gaps = 2/143 (1%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+ +YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLA-YYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 58

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 59  RRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 118

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE++ETSK  ++ R+  L+KLE
Sbjct: 119 AGELQETSKKAIIERMGELEKLE 141



>gi|167518065|ref|XP_001743373.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778472|gb|EDQ92087.1| predicted protein [Monosiga brevicollis MX1]
          Length = 142

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (79%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF L+QNR GKTRL+KWY+P++D+EK KL  EVH L++ R   H +NF+EFR +K+VY
Sbjct: 1   MIRFFLIQNRSGKTRLAKWYMPFDDDEKQKLIEEVHSLISVRSTSH-TNFIEFRTFKLVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF  CVD NDN L YLEAIH FVEVL+ FF NVCELDL+FNFYKVYA++DE+FL
Sbjct: 60  RRYAGLFFVFCVDINDNNLTYLEAIHNFVEVLNNFFTNVCELDLLFNFYKVYALVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEIEETS   VL RL  +   E
Sbjct: 120 AGEIEETSHTEVLRRLTDITTRE 142



>gi|391332932|ref|XP_003740880.1| PREDICTED: AP-2 complex subunit sigma-like [Metaseiulus
           occidentalis]
          Length = 142

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+  ED+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMTLEDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FCVCVD  +N LAYLEAIH FVEVL+ +F +VCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCVCVDVKENNLAYLEAIHNFVEVLNEYFHSVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L   + LE
Sbjct: 120 AGEIRETSQTKVLKQLLVYNSLE 142



>gi|255079040|ref|XP_002503100.1| predicted protein [Micromonas sp. RCC299]
 gi|226518366|gb|ACO64358.1| predicted protein [Micromonas sp. RCC299]
          Length = 143

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+L+QNRQGKTR +K+YVP +D+EK +L+ EVHRLV  RD K  +NF EFRN+K++Y
Sbjct: 1   MIRFLLLQNRQGKTRTAKYYVPMDDDEKHQLEFEVHRLVVNRDPKF-TNFAEFRNHKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD NDNELA LEAIH FVEVLD +F NVCELDLVFNF+KVY ++DE  L
Sbjct: 60  RRYAGLFFSLCVDVNDNELALLEAIHLFVEVLDHYFSNVCELDLVFNFHKVYQVIDEFIL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI+ETSK  ++ RL  L+K++
Sbjct: 120 AGEIQETSKKQIMERLYELEKIK 142



>gi|1809320|gb|AAB46980.1| clathrin-associated protein 17 [Rattus norvegicus]
          Length = 142

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLE IH FVEVL+ +F NVCELDLVFNFY+ Y ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEGIHNFVEVLNEYFHNVCELDLVFNFYRFYTVVDEIFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI E S+  VL +L  L  LE
Sbjct: 120 AGEIRERSQTKVLKQLLMLQSLE 142



>gi|294887926|ref|XP_002772285.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
 gi|239876360|gb|EER04101.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
          Length = 142

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 94/143 (65%), Positives = 115/143 (80%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+LVQNRQGKTRLSKWYVPY   +K K++GE+HR V  RD +  +NF+E+R++KV+Y
Sbjct: 1   MIRFVLVQNRQGKTRLSKWYVPYNAAQKNKVEGEIHRAVVSRDSR-STNFLEYRSFKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF  CVD NDNE+  LE IH FVEVLD +FGNVCELDLVF+F KVY ILDE+ L
Sbjct: 60  RRYAGLFFSFCVDVNDNEMCVLELIHLFVEVLDGYFGNVCELDLVFHFDKVYHILDELLL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEIE+TS  ++L +L   DKL+
Sbjct: 120 DGEIEDTSSAVILEKLRQSDKLD 142



>gi|147835478|emb|CAN68414.1| hypothetical protein VITISV_034781 [Vitis vinifera]
          Length = 145

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (81%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFI++QNRQGKTRL+K+YVP E+ EK K++ EVHRLV  RD K  +NFVEFR +KV+YR
Sbjct: 5   IRFIILQNRQGKTRLAKYYVPLEESEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIYR 63

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  LA
Sbjct: 64  RYAGLFFSLCVDMTDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 123

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE++ETSK  ++ R+  L+K E
Sbjct: 124 GELQETSKKAIIERMGELEKQE 145



>gi|146183579|ref|XP_001026490.2| Clathrin adaptor complex small chain family protein [Tetrahymena
           thermophila]
 gi|146143545|gb|EAS06245.2| Clathrin adaptor complex small chain family protein [Tetrahymena
           thermophila SB210]
          Length = 142

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 90/143 (62%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+KWYV Y+++EK KL+GE++R++  RD+KH +NF+EFRNYK++Y
Sbjct: 1   MIRFILLQNRQGKTRLAKWYVDYDEQEKQKLQGEINRIIVYRDRKH-TNFLEFRNYKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           +RYAGLFF +CVD  DNEL YLE IH FVEVLD++F NV ELD+V+NF+K + ILDE+ +
Sbjct: 60  KRYAGLFFSICVDTTDNELTYLEMIHLFVEVLDSYFSNVRELDIVYNFHKAFGILDEMII 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI ETSK+ +L  L  ++ LE
Sbjct: 120 GGEIMETSKSQILAALRQVELLE 142



>gi|281353691|gb|EFB29275.1| hypothetical protein PANDA_012174 [Ailuropoda melanoleuca]
          Length = 146

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (80%), Gaps = 5/146 (3%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 2   IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLA
Sbjct: 61  RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA 120

Query: 122 GE----IEETSKNIVLTRLDHLDKLE 143
           GE    I ETS+  VL +L  L  LE
Sbjct: 121 GEIREXIRETSQTKVLKQLLMLQSLE 146



>gi|403299096|ref|XP_003940327.1| PREDICTED: AP-2 complex subunit sigma isoform 1 [Saimiri
           boliviensis boliviensis]
          Length = 140

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 117/143 (81%), Gaps = 3/143 (2%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH F  VL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEAIHNF--VLNEYFHNVCELDLVFNFYKVYTVVDEMFL 117

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 118 AGEIRETSQTKVLKQLLMLQSLE 140



>gi|340381140|ref|XP_003389079.1| PREDICTED: AP-2 complex subunit sigma-like [Amphimedon
           queenslandica]
          Length = 142

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/132 (71%), Positives = 114/132 (86%), Gaps = 1/132 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFV FRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMHFDDDEKQKLIEEVHAIVTVRDAKH-TNFVAFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD +DN LAYLEAIH FVEVL+ FF NVCELDLVFNFYKVYA++DE+FL
Sbjct: 60  RRYAGLYFCICVDLDDNNLAYLEAIHNFVEVLNEFFHNVCELDLVFNFYKVYAVVDEMFL 119

Query: 121 AGEIEETSKNIV 132
           AGEI ETS++ V
Sbjct: 120 AGEIRETSQSRV 131



>gi|313220392|emb|CBY31246.1| unnamed protein product [Oikopleura dioica]
          Length = 142

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/143 (65%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ Y++ EK KL  +VH L+  RD KH +NFVEFR++KVVY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYIQYDETEKQKLIEDVHALITVRDAKH-TNFVEFRDFKVVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD +DN LA+LE IH FVEVL+ +F NVCELDLVFNF+KVY+++DE FL
Sbjct: 60  RRYAGLFFCFCVDVDDNNLAHLEGIHNFVEVLNEYFHNVCELDLVFNFHKVYSVVDEAFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+ ETS+  +L  ++HL  LE
Sbjct: 120 AGELRETSQQKLLKEINHLHSLE 142



>gi|224007261|ref|XP_002292590.1| AP17, clathrin adaptor complex AP2 small chain [Thalassiosira
           pseudonana CCMP1335]
 gi|220971452|gb|EED89786.1| AP17, clathrin adaptor complex AP2 small chain [Thalassiosira
           pseudonana CCMP1335]
          Length = 142

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (81%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRF L+QNRQGKTRLSKWY P    EK +++ EVHRLV  RD+K+ +NF+E+ NYK++YR
Sbjct: 2   IRFFLLQNRQGKTRLSKWYDPPPPSEKARIETEVHRLVTSRDKKY-TNFIEYNNYKLIYR 60

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF + VD  DNEL+YLE+IH FVE+LD++F NVCELD+VFNF KVY+ILDE  LA
Sbjct: 61  RYAGLFFTIAVDVQDNELSYLESIHLFVELLDSYFANVCELDIVFNFNKVYSILDEYMLA 120

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GEIEETSK  +L R+  L+KL+
Sbjct: 121 GEIEETSKKEILDRVKFLEKLD 142



>gi|168053306|ref|XP_001779078.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669530|gb|EDQ56115.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 157

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 116/141 (82%), Gaps = 2/141 (1%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEV-HRLVAPRDQKHQSNFVEFRNYKVVY 60
           IRFIL+QNRQGKTRL+K+Y+P ED EK KL+ EV HRLV  RD K  +NFVEFR +KV+Y
Sbjct: 16  IRFILLQNRQGKTRLAKYYIPLEDSEKHKLEYEVVHRLVVNRDPKF-TNFVEFRTHKVIY 74

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNELAYLE+IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 75  RRYAGLFFSMCVDITDNELAYLESIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 134

Query: 121 AGEIEETSKNIVLTRLDHLDK 141
           AGE++ETSK  ++ R+  L+K
Sbjct: 135 AGELQETSKKAIIERMGELEK 155



>gi|313232851|emb|CBY09534.1| unnamed protein product [Oikopleura dioica]
          Length = 142

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/143 (65%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ Y++ EK KL  +VH L+  RD KH +NFVEFR++KVVY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYIHYDETEKQKLIEDVHALITVRDAKH-TNFVEFRDFKVVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC CVD +DN LA+LE IH FVEVL+ +F NVCELDLVFNF+KVY+++DE FL
Sbjct: 60  RRYAGLFFCFCVDVDDNNLAHLEGIHNFVEVLNEYFHNVCELDLVFNFHKVYSVVDEAFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGE+ ETS+  +L  ++HL  LE
Sbjct: 120 AGELRETSQQKLLKEINHLHSLE 142



>gi|170580259|ref|XP_001895184.1| clathrin adaptor complex small chain [Brugia malayi]
 gi|312083208|ref|XP_003143765.1| clathrin adaptor complex small chain [Loa loa]
 gi|158597963|gb|EDP35969.1| clathrin adaptor complex small chain, putative [Brugia malayi]
 gi|307761071|gb|EFO20305.1| AP-2 complex subunit sigma [Loa loa]
 gi|402589480|gb|EJW83412.1| clathrin adaptor complex [Wuchereria bancrofti]
          Length = 142

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 116/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++++EK KL  EVH  V  RD KH +NFVEFRN+K+VY
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMNFDNDEKQKLIEEVHACVTVRDAKH-TNFVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD  DN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDILDNNLYYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 120 AGEIRETSQTKVLKQLLMLSSLE 142



>gi|11999128|gb|AAG43052.1|AF228055_1 adaptor protein complex AP-2 small chain sigma2 [Drosophila
           melanogaster]
          Length = 142

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (81%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+Q+R GKTRL+KWY+ ++ +EK KL  EVH +V  RD KH S FVEFRN+K+VY
Sbjct: 1   MIRFILIQSRAGKTRLAKWYMNFDGDEKQKLIEEVHAVVTVRDAKHTS-FVEFRNFKIVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN L YLEAIH FVEVL+ +F NVCELDLVFNFYKVY+++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           A EI ETS+  VL +L  L+ LE
Sbjct: 120 APEIRETSQTKVLKQLLTLNSLE 142



>gi|145499839|ref|XP_001435904.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124403040|emb|CAK68507.1| unnamed protein product [Paramecium tetraurelia]
          Length = 143

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 116/140 (82%), Gaps = 1/140 (0%)

Query: 4   FILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYRRY 63
           FIL+QNRQGKTRLSKWYV Y+D EKVKL+ EVHRL+  RD KH +NF+EFRNYK++Y+RY
Sbjct: 5   FILLQNRQGKTRLSKWYVYYDDAEKVKLQNEVHRLIVCRDTKH-TNFLEFRNYKIIYKRY 63

Query: 64  AGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGE 123
           AGLFF +CVD +DNEL  LE IH +VEVLD +FGNVCELD+VFNF K Y+I+DE+ + GE
Sbjct: 64  AGLFFALCVDVSDNELTMLELIHLYVEVLDKYFGNVCELDIVFNFNKAYSIIDEMIVGGE 123

Query: 124 IEETSKNIVLTRLDHLDKLE 143
           I ETSK +++  + +++ L+
Sbjct: 124 IIETSKQVIINAVKNIELLD 143



>gi|219125917|ref|XP_002183216.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405491|gb|EEC45434.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 152

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 119/153 (77%), Gaps = 11/153 (7%)

Query: 1   MIRFILVQNRQGKTRLSKWYVP----------YEDEEKVKLKGEVHRLVAPRDQKHQSNF 50
           MIRF L+QNRQGKTRLSKWYVP            + EKV+++ EVHRLV  RD+K+ +NF
Sbjct: 1   MIRFFLLQNRQGKTRLSKWYVPPPSTQNGSTVSPEAEKVRIEAEVHRLVTARDKKY-TNF 59

Query: 51  VEFRNYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYK 110
           +E+ NYK++YRRYAGLFF + VD  +NEL+YLE IH FVE+LD++F NVCELD+VFNF K
Sbjct: 60  IEYNNYKLIYRRYAGLFFTIAVDLQENELSYLETIHLFVELLDSYFSNVCELDIVFNFNK 119

Query: 111 VYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           VY+ILDE  LAGEIEETSK  +L R+  L+K+E
Sbjct: 120 VYSILDEFMLAGEIEETSKREILDRVKLLEKME 152



>gi|471233408|ref|XP_004037711.1| hypothetical protein IMG5_042370, partial [Ichthyophthirius
           multifiliis]
 gi|340507848|gb|EGR33725.1| hypothetical protein IMG5_042370 [Ichthyophthirius multifiliis]
          Length = 147

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 119/142 (83%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNRQGKTRL+KWYV Y+++EKVKL+ E++R++  RD+K Q+NF+EFRNYKV+Y+
Sbjct: 7   IRFILLQNRQGKTRLAKWYVDYDEQEKVKLQSEINRIIVYRDRK-QTNFLEFRNYKVIYK 65

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RYAGLFF +CVD NDNEL YLE IHFFVEVLD FF +V ELD+V+NF+KVY I+DE+ + 
Sbjct: 66  RYAGLFFSICVDVNDNELTYLEMIHFFVEVLDQFFSSVRELDIVYNFHKVYGIIDEMIIG 125

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE+ ETSK  +L+ +   + LE
Sbjct: 126 GELVETSKAQILSLMRQYELLE 147



>gi|303283648|ref|XP_003061115.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457466|gb|EEH54765.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 154

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/154 (63%), Positives = 122/154 (79%), Gaps = 12/154 (7%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+L+QNRQGKTRL+K+YVP +D+EK +L+ EVHRLV  RD K  +NFVEFRNYK++Y
Sbjct: 1   MIRFLLMQNRQGKTRLAKYYVPLDDDEKHQLEYEVHRLVVNRDPKF-TNFVEFRNYKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD NDNELA LEAIH FVEVLD +FG+VCELDLVFNF+K Y ++DE  L
Sbjct: 60  RRYAGLFFSLCVDVNDNELALLEAIHLFVEVLDHYFGSVCELDLVFNFHKAYTVIDEFIL 119

Query: 121 AGEIE-----------ETSKNIVLTRLDHLDKLE 143
           AGEI+           ETSK  ++ RL+ L+K++
Sbjct: 120 AGEIQARSIHWSPYDRETSKKQIMERLEELEKVK 153



>gi|294874896|ref|XP_002767141.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
 gi|239868590|gb|EEQ99858.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
          Length = 142

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+LVQNRQGKTRLSKWYVPY   +K K++ E+HR V  RD K  +NF+E+RNYKV+Y
Sbjct: 1   MIRFVLVQNRQGKTRLSKWYVPYNAAQKNKVEREIHRAVVSRD-KRSTNFLEYRNYKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF  CVD NDNE+  LE IH  VEVLD +FGNVCELDLVF+F KVY I+D++ L
Sbjct: 60  RRYAGLFFSFCVDVNDNEMCVLELIHLLVEVLDGYFGNVCELDLVFHFDKVYHIMDDLLL 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEIE+TS  ++L +L   DKL+
Sbjct: 120 YGEIEDTSSAVILDKLRQSDKLD 142



>gi|475552655|gb|EMT11832.1| AP-2 complex subunit sigma-1 [Aegilops tauschii]
          Length = 141

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/129 (73%), Positives = 108/129 (83%), Gaps = 1/129 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNEL YLE IH FVE+LD FF NVCELDLVFNF+KVY ILDE  L
Sbjct: 60  RRYAGLFFSICVDITDNELVYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFIL 119

Query: 121 AGEIEETSK 129
           AGE++ETSK
Sbjct: 120 AGELQETSK 128



>gi|397567875|gb|EJK45830.1| hypothetical protein THAOC_35532, partial [Thalassiosira oceanica]
          Length = 161

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/162 (59%), Positives = 118/162 (72%), Gaps = 21/162 (12%)

Query: 2   IRFILVQNRQGKTRLSKWYVP--------------------YEDEEKVKLKGEVHRLVAP 41
           IRF L+QNRQGKTRLSKWYVP                      D EK +++ EVHRLV  
Sbjct: 1   IRFFLLQNRQGKTRLSKWYVPPPTGGNKDNGAPSYATADSTATDAEKARIESEVHRLVTS 60

Query: 42  RDQKHQSNFVEFRNYKVVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCE 101
           RD+K+ +NF+EF NYK++YRRYAGLFF + VD +DNEL+YLE+IH FVE+LD++F NVCE
Sbjct: 61  RDKKY-TNFIEFNNYKLIYRRYAGLFFTIAVDMHDNELSYLESIHLFVELLDSYFNNVCE 119

Query: 102 LDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           LD+VFNF KVY ILDE  LAGEIEETSK  +L R+  LDKL+
Sbjct: 120 LDIVFNFNKVYMILDEYMLAGEIEETSKREILDRVKFLDKLD 161



>gi|344230500|gb|EGV62385.1| hypothetical protein CANTEDRAFT_107637 [Candida tenuis ATCC 10573]
          Length = 145

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/143 (62%), Positives = 114/143 (79%), Gaps = 1/143 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           I ++L+ NRQGKTRLS+WY   Y    + K   E+HRLV+ RD KHQSNF+E++  K+VY
Sbjct: 3   IHYVLILNRQGKTRLSRWYDKTYSRGAQNKSITEIHRLVSSRDSKHQSNFIEYQEKKLVY 62

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F + +D ND+ELAYLE++HFFVE+LD +F NVCELDLVFNFYK+YAILDEV+L
Sbjct: 63  RRYAGLYFIMSIDINDSELAYLESLHFFVEILDVYFDNVCELDLVFNFYKLYAILDEVYL 122

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI E SK+ +L RL  LD+LE
Sbjct: 123 GGEIHEVSKSRILARLTELDRLE 145



>gi|470411899|ref|XP_004336416.1| AP2 complex subunit sigma, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440793215|gb|ELR14403.1| AP2 complex subunit sigma, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 143

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/143 (65%), Positives = 114/143 (79%), Gaps = 2/143 (1%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           M+RF LVQNRQGK RL+KWYVPYEDEEK KL  E+HRLV  R  K  +NF E+R +K++Y
Sbjct: 1   MLRFFLVQNRQGKVRLAKWYVPYEDEEKSKLSAEIHRLVNARLTKF-TNFTEYREHKLIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFG-NVCELDLVFNFYKVYAILDEVF 119
           RRYAGL+FCVCVD +DNELA LEAIH  VE+LD++F  NVCEL LVFNF +VYAILDEV 
Sbjct: 60  RRYAGLYFCVCVDPDDNELAALEAIHLIVELLDSYFDHNVCELHLVFNFNRVYAILDEVI 119

Query: 120 LAGEIEETSKNIVLTRLDHLDKL 142
           + GE+ ETS+  +L R+D L+ L
Sbjct: 120 VGGEVIETSRTKILQRVDELEDL 142



>gi|294943807|ref|XP_002783966.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
 gi|239896948|gb|EER15762.1| AP-2 complex subunit sigma, putative [Perkinsus marinus ATCC 50983]
          Length = 152

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/143 (62%), Positives = 111/143 (77%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRF+LVQNRQGKTRLS+WYVPY   +K K++ E+HR V  RD +  +NF+E+RNYKV+Y
Sbjct: 11  MIRFVLVQNRQGKTRLSRWYVPYNAAQKNKVEREIHRAVVSRDNR-STNFLEYRNYKVIY 69

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF  CVD NDNE+  LE IH  VEVLD +FGNVCELDLVF+F KVY I+D + L
Sbjct: 70  RRYAGLFFSFCVDVNDNEMCVLELIHLLVEVLDGYFGNVCELDLVFHFDKVYHIMDALLL 129

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEIE+T   ++L +L   DKL+
Sbjct: 130 YGEIEDTISAVILDKLRQSDKLD 152



>gi|325181606|emb|CCA16056.1| conserved unknown protein putative [Albugo laibachii Nc14]
          Length = 197

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/144 (64%), Positives = 115/144 (79%), Gaps = 2/144 (1%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPY-EDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVV 59
           MIRF L+QNRQGKTRLSKWYVP  +D+EK +L+ E+HRLV  RD KH +NF+EFR+YK++
Sbjct: 55  MIRFFLLQNRQGKTRLSKWYVPAPDDQEKFRLENEIHRLVVSRDAKH-TNFIEFRSYKLI 113

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFF + VD + NEL  LE IH FVE+LD  F NVCELD+VFNF KVY++LDE  
Sbjct: 114 YRRYAGLFFILGVDLHANELLSLETIHLFVELLDQQFSNVCELDIVFNFNKVYSMLDEYI 173

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           L GE++ETSK  +L R+  L+KLE
Sbjct: 174 LGGEVQETSKREMLDRIRELEKLE 197



>gi|47115580|sp|O50016.1|AP2S1_MAIZE RecName: Full=AP-2 complex subunit sigma; AltName: Full=Clathrin
           assembly protein 2 small chain; AltName: Full=Clathrin
           coat assembly protein AP17; AltName: Full=Clathrin
           coat-associated protein AP17; AltName: Full=Plasma
           membrane adaptor AP-2 17 kDa protein; AltName:
           Full=Sigma2-adaptin
 gi|2959358|emb|CAA65533.1| clathrin coat assembly protein AP17 [Zea mays]
          Length = 132

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 3/131 (2%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRL+K+YVP ED EK K++ EVHRLV  RD K  +NFVEFR +KV+Y
Sbjct: 1   MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKF-TNFVEFRTHKVIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKV--YAILDEV 118
           RRYAGLFF +CVD  DNELAYLE IH FVE+LD FF NVCELDLVFNF+KV  Y ILDE 
Sbjct: 60  RRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYRYLILDEF 119

Query: 119 FLAGEIEETSK 129
            LAGE++ETSK
Sbjct: 120 ILAGELQETSK 130



>gi|470527792|ref|XP_004357447.1| AP2 complex subunit sigma, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440804180|gb|ELR25057.1| AP2 complex subunit sigma, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 142

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 112/142 (78%), Gaps = 1/142 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MI F LVQNRQGK R +KW+VPY+D E+ KL  E HR+V  R  K  +NFVEFR++K+VY
Sbjct: 1   MINFFLVQNRQGKVRAAKWWVPYDDAERAKLALEAHRVVNARHSKF-TNFVEFRDHKLVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F +CVD +DNELA LE IH FVE LDA+FGNVCELDLVFNF KVY +LDE+ +
Sbjct: 60  RRYAGLYFYLCVDVSDNELAALELIHLFVEALDAYFGNVCELDLVFNFAKVYQMLDEIVV 119

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
            GE+ ETSK  +L R+D LD+L
Sbjct: 120 GGELIETSKARILQRVDELDQL 141



>gi|465956715|gb|EMP27082.1| AP-2 complex subunit sigma [Chelonia mydas]
          Length = 125

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (86%), Gaps = 1/122 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 60  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 119

Query: 121 AG 122
           AG
Sbjct: 120 AG 121



>gi|308812392|ref|XP_003083503.1| KPYC_SOLTU Pyruvate kinase, cytosolic isozyme (ISS) [Ostreococcus
           tauri]
 gi|116055384|emb|CAL58052.1| KPYC_SOLTU Pyruvate kinase, cytosolic isozyme (ISS) [Ostreococcus
           tauri]
          Length = 699

 Score =  187 bits (474), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 85/138 (61%), Positives = 110/138 (79%), Gaps = 2/138 (1%)

Query: 7   VQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFR-NYKVVYRRYAG 65
           + NRQGKTRL+K+YVP +D+EK +++ +VHRLV  RD KH +N  EFR N K+VYRRYAG
Sbjct: 562 ISNRQGKTRLAKYYVPLDDDEKRRVESDVHRLVVNRDPKH-TNICEFRGNSKIVYRRYAG 620

Query: 66  LFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIE 125
           LFF +CVD NDNEL +LE+IH FVE+LD FF NVCELDLVFNF KVY ++DE  L GE++
Sbjct: 621 LFFSLCVDLNDNELTHLESIHLFVEMLDHFFANVCELDLVFNFQKVYLLVDEFILGGEVQ 680

Query: 126 ETSKNIVLTRLDHLDKLE 143
           +TSK  ++ RL  L++L+
Sbjct: 681 DTSKRAIMERLAELERLK 698



>gi|320583353|gb|EFW97568.1| vesicle-mediated transport-related protein [Ogataea parapolymorpha
           DL-1]
          Length = 144

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/142 (59%), Positives = 109/142 (76%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           I F++  NRQGK R+SKWY    D++K +   +VHRL++ RD + QSNFV F N K+VYR
Sbjct: 3   IHFLIALNRQGKLRISKWYTSVPDKQKKQTMLKVHRLISSRDHQKQSNFVNFENQKLVYR 62

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLA 121
           RY GLFF + VD  DNEL+YLE +H  VEVLD++F NVCELD++FNFYKVY +LDE+FL+
Sbjct: 63  RYNGLFFVMAVDVQDNELSYLEMVHLMVEVLDSYFNNVCELDIIFNFYKVYQVLDEMFLS 122

Query: 122 GEIEETSKNIVLTRLDHLDKLE 143
           GE +ETSK +VL RL +LD LE
Sbjct: 123 GEFQETSKQVVLDRLHYLDNLE 144



>gi|299473246|emb|CBN77646.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 143

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/144 (61%), Positives = 117/144 (81%), Gaps = 2/144 (1%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDE-EKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVV 59
           MIRF+L+QNRQGKTRLSKW++P  DE EKV+++ EVHRLV  RD+K+ +NFVE+  YK++
Sbjct: 1   MIRFLLLQNRQGKTRLSKWWIPLHDEKEKVRIENEVHRLVVTRDRKY-TNFVEYGTYKLI 59

Query: 60  YRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVF 119
           YRRYAGLFF   +D NDNEL  LE +H FVE+L+++F NVCELD+VFNF KVY ILDE  
Sbjct: 60  YRRYAGLFFTFGMDVNDNELLALETVHLFVELLESYFSNVCELDIVFNFNKVYNILDEFI 119

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           L+GE+EE+SK  +L R+  ++KL+
Sbjct: 120 LSGEVEESSKREILDRIREVEKLD 143



>gi|307108172|gb|EFN56413.1| hypothetical protein CHLNCDRAFT_145001 [Chlorella variabilis]
          Length = 173

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 112/144 (77%), Gaps = 3/144 (2%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRF L+QNR GKTRL+K+Y+P  D++K + + EV+RL+A RD K  +NF+E++ YKVVYR
Sbjct: 30  IRFFLLQNRAGKTRLAKYYMPLSDDDKSRTEDEVYRLIANRDAKF-TNFLEYKTYKVVYR 88

Query: 62  RYAGLFFCVCVDANDNELAYLEAIHFFVEV--LDAFFGNVCELDLVFNFYKVYAILDEVF 119
           RYAGL+F  CVD  DNEL YLE IH FVEV  LD +FGNVCELDLVF F+KVY ILDE  
Sbjct: 89  RYAGLYFIFCVDVTDNELLYLETIHLFVEVRILDHYFGNVCELDLVFGFHKVYCILDEFI 148

Query: 120 LAGEIEETSKNIVLTRLDHLDKLE 143
           + GEI+ETSK ++L RL  LD LE
Sbjct: 149 IGGEIQETSKKVILERLKELDSLE 172



>gi|406604940|emb|CCH43613.1| AP-2 complex subunit sigma [Wickerhamomyces ciferrii]
          Length = 135

 Score =  184 bits (468), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 111/135 (82%), Gaps = 1/135 (0%)

Query: 9   NRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYRRYAGLFF 68
           NRQGK R +KWY  Y   +K +L  +VH+L++ RDQKHQSNFVEF+N K+VY+RYAGL+F
Sbjct: 2   NRQGKVRFAKWYSDYS-VKKYRLNVDVHKLISSRDQKHQSNFVEFQNNKLVYKRYAGLYF 60

Query: 69  CVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETS 128
              +D  DNEL YL +IH  VE+LDA+F NVCELDLVFNF+K+YA+LDE+FLAGEI+ETS
Sbjct: 61  IAGIDLADNELIYLSSIHLLVEILDAYFENVCELDLVFNFHKIYAVLDEMFLAGEIQETS 120

Query: 129 KNIVLTRLDHLDKLE 143
           K+++L RL+++D LE
Sbjct: 121 KDLILKRLEYIDSLE 135



>gi|190345822|gb|EDK37770.2| hypothetical protein PGUG_01868 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 161

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 115/142 (80%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           IRFI+V NRQGK+RL KW+   Y +++K ++  EVHRL++ RD +HQSNFVEF+N K+VY
Sbjct: 19  IRFIVVLNRQGKSRLIKWFDCRYHNQDKQRIVSEVHRLISTRDSRHQSNFVEFQNIKLVY 78

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F   +D +D+EL+YLE++HF VE+LD +F +VCELDLVFNF+K+Y ILDE++L
Sbjct: 79  RRYAGLYFVAGIDLDDSELSYLESLHFMVEILDTYFDSVCELDLVFNFHKLYTILDEIYL 138

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
            GEI+E SK  +L RL ++D L
Sbjct: 139 GGEIQEISKQRILDRLQYIDGL 160



>gi|260943902|ref|XP_002616249.1| hypothetical protein CLUG_03490 [Clavispora lusitaniae ATCC 42720]
 gi|238849898|gb|EEQ39362.1| hypothetical protein CLUG_03490 [Clavispora lusitaniae ATCC 42720]
          Length = 190

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (79%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           I + L+ NRQGK RL+KW+   + D +K ++  +VHRLV+ RD K+QSNFVEFR  K+VY
Sbjct: 47  IHYFLILNRQGKIRLAKWFDNTFMDSDKKEIVEDVHRLVSSRDSKYQSNFVEFRGNKLVY 106

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF + VD +DNEL+YLE++HFFVE+LD +F NVCELDLVFNFYK+Y ILDE++L
Sbjct: 107 RRYAGLFFIMSVDYDDNELSYLESVHFFVEILDTYFDNVCELDLVFNFYKLYQILDEIYL 166

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
            GE+ E SK  V++RL  LD+L
Sbjct: 167 GGELSEISKQKVVSRLTQLDEL 188



>gi|354545173|emb|CCE41900.1| hypothetical protein CPAR2_804500 [Candida parapsilosis]
          Length = 145

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/146 (58%), Positives = 114/146 (78%), Gaps = 7/146 (4%)

Query: 2   IRFILVQNRQGKTRLSKW----YVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYK 57
           I+FILV NRQGK+RL KW    Y P + ++ +    ++HRL++ RD KHQSNFV F+N+K
Sbjct: 3   IQFILVLNRQGKSRLVKWFDNSYTPSQKQQNIT---DIHRLISSRDSKHQSNFVLFQNHK 59

Query: 58  VVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDE 117
           + YRRYAGLFF + +D  DNEL+YLE++HFFVE+LD +F NVCE+DLVFNFYK+Y ILDE
Sbjct: 60  LCYRRYAGLFFIISIDLLDNELSYLESLHFFVEILDVYFNNVCEVDLVFNFYKLYFILDE 119

Query: 118 VFLAGEIEETSKNIVLTRLDHLDKLE 143
           V+L GEI++ SK  +L RL +LD +E
Sbjct: 120 VYLGGEIQDISKQKILDRLQYLDSME 145



>gi|448510098|ref|XP_003866277.1| hypothetical protein CORT_0A04490 [Candida orthopsilosis Co 90-125]
 gi|380350615|emb|CCG20837.1| hypothetical protein CORT_0A04490 [Candida orthopsilosis Co 90-125]
          Length = 145

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 114/146 (78%), Gaps = 7/146 (4%)

Query: 2   IRFILVQNRQGKTRLSKW----YVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYK 57
           I+FILV NRQGK+RL KW    Y P + ++ +    ++HRL++ RD KHQSNFV F+N+K
Sbjct: 3   IQFILVLNRQGKSRLVKWFDNSYTPAQKQQNIT---DIHRLISSRDSKHQSNFVLFQNHK 59

Query: 58  VVYRRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDE 117
           + YRRYAGL+F + +D  DNEL+YLE++HFFVE+LD +F NVCE+DLVFNFYK+Y ILDE
Sbjct: 60  LCYRRYAGLYFIISIDLQDNELSYLESLHFFVEILDVYFNNVCEVDLVFNFYKLYFILDE 119

Query: 118 VFLAGEIEETSKNIVLTRLDHLDKLE 143
           V+L GEI++ SK  +L RL +LD ++
Sbjct: 120 VYLGGEIQDISKQKILDRLSYLDSMD 145



>gi|254572357|ref|XP_002493288.1| Small subunit of the clathrin-associated adaptor complex AP-2
           [Komagataella pastoris GS115]
 gi|238033086|emb|CAY71109.1| Small subunit of the clathrin-associated adaptor complex AP-2
           [Komagataella pastoris GS115]
          Length = 145

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (79%), Gaps = 1/139 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           I +IL  NRQGK R+SKW+      +E+ +++ ++HRL+  RD K+QSNFVEF   K+VY
Sbjct: 3   IHYILALNRQGKVRISKWFDRKISLDEQFQVRQKIHRLILSRDHKNQSNFVEFEKKKLVY 62

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFFC+C+D +D EL YLE+IH  VEVLD +F NVCELDLVF+FYKVYA++DE+F+
Sbjct: 63  RRYAGLFFCMCIDMDDGELMYLESIHLLVEVLDQYFNNVCELDLVFSFYKVYAVIDEMFM 122

Query: 121 AGEIEETSKNIVLTRLDHL 139
           +GEIEETSK +VL R+D +
Sbjct: 123 SGEIEETSKAVVLDRVDQV 141



>gi|348683694|gb|EGZ23509.1| clathrin adaptor complex-like protein [Phytophthora sojae]
          Length = 154

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 110/143 (76%), Gaps = 2/143 (1%)

Query: 2   IRFILVQNRQGKTRLSKWYVPY-EDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           + F L  NRQGKTRLSKWYVP  ED+EK +L+ E+HRLV  RD KH +NF+EFRNYK++Y
Sbjct: 13  LTFSLWPNRQGKTRLSKWYVPPPEDQEKARLEAEIHRLVVARDAKH-TNFIEFRNYKLIY 71

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF + VD   NEL  LE IH FVE+LD  F NVCELD+VFNF KVY++LDE  L
Sbjct: 72  RRYAGLFFILGVDLAANELLGLETIHLFVELLDQQFANVCELDIVFNFNKVYSMLDEYIL 131

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GE++ETSK  +L R+  L+KLE
Sbjct: 132 GGEVQETSKREMLDRIRELEKLE 154



>gi|403333437|gb|EJY65816.1| Clathrin adaptor complex, small subunit [Oxytricha trifallax]
          Length = 142

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 114/143 (79%), Gaps = 1/143 (0%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+QNRQGKTRLS+WYV Y +EE+ K++ EVHR +  RD KH +NF+EFRN+K+VY
Sbjct: 1   MIRFILLQNRQGKTRLSRWYVAYNEEERKKIEIEVHRQIVQRDSKH-TNFLEFRNHKLVY 59

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGLFF +CVD  DNEL+ LE IH FVEVLD +FG+VCELDLVFNF+KVY ILD + +
Sbjct: 60  RRYAGLFFTLCVDQGDNELSMLEFIHLFVEVLDQYFGSVCELDLVFNFFKVYQILDSMVI 119

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI E++K ++   LD  D  E
Sbjct: 120 GGEIMESAKPVIRQELDQADYYE 142



>gi|308198160|ref|XP_001386883.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|149388892|gb|EAZ62860.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 145

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/143 (60%), Positives = 111/143 (77%), Gaps = 1/143 (0%)

Query: 2   IRFILVQNRQGKTRLSKWYV-PYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           I FILV NRQGK RL+KW+   Y  E+K K   ++HRL++ RD K QSNFVE+++ K+VY
Sbjct: 3   IHFILVLNRQGKIRLAKWFNNSYTQEDKHKFVSDIHRLISSRDTKKQSNFVEYQSTKLVY 62

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F   VD  D+EL+YLE++HF VE+LD +F NVCELDLVFNFYK+Y ILDE++L
Sbjct: 63  RRYAGLYFICSVDLVDSELSYLESLHFLVEILDTYFDNVCELDLVFNFYKLYNILDEIYL 122

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GEI+E SK  +L RL +LDKL 
Sbjct: 123 GGEIQEISKKKILDRLAYLDKLS 145



>gi|351697943|gb|EHB00862.1| AP-2 complex subunit sigma [Heterocephalus glaber]
          Length = 203

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 97/180 (53%), Positives = 118/180 (65%), Gaps = 39/180 (21%)

Query: 2   IRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVYR 61
           IRFIL+QNR GKTRL+KWY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++YR
Sbjct: 25  IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIYR 83

Query: 62  RYAGL--------------------------------------FFCVCVDANDNELAYLE 83
           RYAGL                                      +FC+CVD +DN LAYLE
Sbjct: 84  RYAGLYFCICVDVSDNNLAYLEAIHNFVEFRNFKIIYRRYAGLYFCICVDVSDNNLAYLE 143

Query: 84  AIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNIVLTRLDHLDKLE 143
           AIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FLAGEI ETS+  VL +L  L  LE
Sbjct: 144 AIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE 203



>gi|146420483|ref|XP_001486197.1| hypothetical protein PGUG_01868 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 161

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 114/142 (80%), Gaps = 1/142 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           IRFI+V NRQGK+RL KW+   Y +++K ++  EVHRL++ RD +HQSNFVEF+N K+VY
Sbjct: 19  IRFIVVLNRQGKSRLIKWFDCRYHNQDKQRIVSEVHRLISTRDLRHQSNFVEFQNIKLVY 78

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F   +D +D+EL+YLE++HF VE+LD +F +VCELDLVFNF+K+Y ILDE++L
Sbjct: 79  RRYAGLYFVAGIDLDDSELSYLESLHFMVEILDTYFDSVCELDLVFNFHKLYTILDEIYL 138

Query: 121 AGEIEETSKNIVLTRLDHLDKL 142
            GEI+E  K  +L RL ++D L
Sbjct: 139 GGEIQEILKQRILDRLQYIDGL 160



>gi|30851514|gb|AAH52499.1| Adaptor-related protein complex 2, sigma 1 subunit [Mus musculus]
          Length = 132

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 110/143 (76%), Gaps = 11/143 (7%)

Query: 1   MIRFILVQNRQGKTRLSKWYVPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           MIRFIL+Q          WY+ ++D+EK KL  EVH +V  RD KH +NFVEFRN+K++Y
Sbjct: 1   MIRFILIQ----------WYMQFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFRNFKIIY 49

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+FC+CVD NDN LAYLEAIH FVEVL+ +F NVCELDLVFNFYKVY ++DE+FL
Sbjct: 50  RRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 109

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
           AGEI ETS+  VL +L  L  LE
Sbjct: 110 AGEIRETSQTKVLKQLLMLQSLE 132



>gi|294658465|ref|XP_460809.2| DEHA2F10230p [Debaryomyces hansenii CBS767]
 gi|202953153|emb|CAG89150.2| DEHA2F10230p [Debaryomyces hansenii CBS767]
          Length = 145

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/143 (58%), Positives = 112/143 (78%), Gaps = 1/143 (0%)

Query: 2   IRFILVQNRQGKTRLSKWY-VPYEDEEKVKLKGEVHRLVAPRDQKHQSNFVEFRNYKVVY 60
           I FILV NRQGKTRL+KW+   Y  ++K +   E+HRL++ RD K+QSNF+E++  K+VY
Sbjct: 3   IHFILVLNRQGKTRLAKWFDNNYTTQDKQRYTTEIHRLISSRDSKYQSNFIEYQQNKLVY 62

Query: 61  RRYAGLFFCVCVDANDNELAYLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFL 120
           RRYAGL+F   +D  D+EL  LE++HF VEVLD +F NVCELDL+FNFYK+Y+ILDE+FL
Sbjct: 63  RRYAGLYFISSIDLIDSELDSLESLHFLVEVLDVYFDNVCELDLIFNFYKLYSILDEIFL 122

Query: 121 AGEIEETSKNIVLTRLDHLDKLE 143
            GE +E SK+ +L RL +LDKL+
Sbjct: 123 GGEFQEISKDKILERLAYLDKLD 145