BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10089_c0_seq1-m.32 5prime_partial 3-611(+) 203 (+)
         (202 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384486984|gb|EIE79164.1| 60S ribosomal protein L16 [Rhizopus ...   250   2e-64   Rhizopus delemar RA 99-880
gi|384500502|gb|EIE90993.1| 60S ribosomal protein L16 [Rhizopus ...   248   4e-64   Rhizopus delemar RA 99-880
gi|326432054|gb|EGD77624.1| ribosomal protein L13Ae [Salpingoeca...   247   1e-63   Salpingoeca rosetta
gi|511008880|gb|EPB90135.1| 60S ribosomal protein L16 [Mucor cir...   247   1e-63   Mucor circinelloides f. circinelloides 1006PhL
gi|384486333|gb|EIE78513.1| 60S ribosomal protein L16 [Rhizopus ...   247   1e-63   Rhizopus delemar RA 99-880
gi|470509002|ref|XP_004349662.1| ribosomal protein L13, putative...   246   2e-63   Acanthamoeba castellanii str. Neff
gi|511009345|gb|EPB90589.1| 60S ribosomal protein L16 [Mucor cir...   244   6e-63   Mucor circinelloides f. circinelloides 1006PhL
gi|61654640|gb|AAX48846.1| L13a [Suberites domuncula]                 244   8e-63   Suberites domuncula
gi|196006053|ref|XP_002112893.1| expressed hypothetical protein ...   243   3e-62   Trichoplax adhaerens
gi|167535340|ref|XP_001749344.1| hypothetical protein [Monosiga ...   242   4e-62   Monosiga brevicollis MX1
gi|161661015|gb|ABX75375.1| 60S ribosomal protein L13A [Lycosa s...   240   2e-61   Lycosa singoriensis
gi|469664413|gb|AGH70161.1| 60S ribosomal protein L13a [Placozoa...   239   3e-61   Placozoa sp. H4
gi|156377756|ref|XP_001630812.1| predicted protein [Nematostella...   238   5e-61   Nematostella vectensis
gi|197210359|gb|ACH48187.1| 60S ribosomal protein L13a [Haplopel...   237   1e-60   Haplopelma schmidti [Chinese bird spider]
gi|340514499|gb|EGR44761.1| ribosomal protein L16, L13 family [T...   235   6e-60   Trichoderma reesei QM6a
gi|242784707|ref|XP_002480444.1| 60S ribosomal protein L16 [Tala...   235   6e-60   Talaromyces stipitatus ATCC 10500
gi|212527810|ref|XP_002144062.1| 60S ribosomal protein L16 [Tala...   235   6e-60   Talaromyces marneffei ATCC 18224
gi|457867069|emb|CCQ18645.1| 60S ribosomal protein L13a [Sycon c...   234   6e-60   Sycon ciliatum
gi|91082991|ref|XP_974304.1| PREDICTED: similar to ribosomal pro...   234   1e-59   Tribolium castaneum [rust-red flour beetle]
gi|358381799|gb|EHK19473.1| hypothetical protein TRIVIDRAFT_1116...   233   1e-59   Trichoderma virens Gv29-8
gi|46110435|ref|XP_382275.1| RL16_NEUCR 60S ribosomal protein L1...   233   2e-59   
gi|156544548|ref|XP_001607858.1| PREDICTED: 60S ribosomal protei...   233   2e-59   
gi|358400158|gb|EHK49489.1| hypothetical protein TRIATDRAFT_2974...   233   3e-59   Trichoderma atroviride IMI 206040
gi|158187860|gb|ABW23219.1| ribosomal protein rpl13a [Eurythoe c...   233   3e-59   Eurythoe complanata
gi|367025231|ref|XP_003661900.1| hypothetical protein MYCTH_2314...   233   3e-59   Myceliophthora thermophila ATCC 42464
gi|494826410|gb|EON63492.1| 60S ribosomal protein L16 [Coniospor...   232   3e-59   Coniosporium apollinis CBS 100218
gi|264667421|gb|ACY71296.1| ribosomal protein L13A [Chrysomela t...   232   4e-59   Chrysomela tremula
gi|169844141|ref|XP_001828792.1| 60S ribosomal protein L16 [Copr...   232   4e-59   Coprinopsis cinerea okayama7#130
gi|116198555|ref|XP_001225089.1| 60S ribosomal protein L16 [Chae...   232   4e-59   Chaetomium globosum CBS 148.51
gi|406867770|gb|EKD20808.1| 60S ribosomal protein L13 [Marssonin...   232   4e-59   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|451847125|gb|EMD60433.1| hypothetical protein COCSADRAFT_1842...   232   5e-59   Bipolaris sorokiniana ND90Pr
gi|256087799|ref|XP_002580051.1| 60S ribosomal protein L13a [Sch...   231   6e-59   
gi|340371027|ref|XP_003384047.1| PREDICTED: 60S ribosomal protei...   231   7e-59   Amphimedon queenslandica
gi|302897600|ref|XP_003047678.1| 60S ribosomal protein L16 [Nect...   231   8e-59   Nectria haematococca mpVI 77-13-4
gi|289472558|gb|ADC97464.1| putative 60S ribosomal protein L13a ...   231   9e-59   Amblyomma maculatum
gi|425769666|gb|EKV08153.1| Ribosomal protein L16a [Penicillium ...   231   9e-59   Penicillium digitatum Pd1
gi|429856676|gb|ELA31573.1| 60s ribosomal protein l16 [Colletotr...   231   1e-58   Colletotrichum gloeosporioides Nara gc5
gi|367038147|ref|XP_003649454.1| 60S ribosomal protein L16 [Thie...   231   1e-58   Thielavia terrestris NRRL 8126
gi|261197579|ref|XP_002625192.1| 60S ribosomal protein L16 [Ajel...   230   1e-58   Blastomyces gilchristii SLH14081
gi|240281531|gb|EER45034.1| 60S ribosomal protein L13a [Ajellomy...   230   1e-58   Histoplasma capsulatum H143
gi|485924264|gb|EOD49135.1| putative 60s ribosomal protein l16 p...   230   1e-58   Neofusicoccum parvum UCRNP2
gi|255935209|ref|XP_002558631.1| Pc13g01870 [Penicillium chrysog...   230   1e-58   Penicillium rubens Wisconsin 54-1255
gi|500255353|gb|EON98747.1| putative 60s ribosomal protein l16 p...   230   1e-58   Phaeoacremonium minimum UCRPA7
gi|440640148|gb|ELR10067.1| 60S ribosomal protein L16 [Geomyces ...   230   1e-58   Pseudogymnoascus destructans 20631-21
gi|402081475|gb|EJT76620.1| 60S ribosomal protein L16 [Gaeumanno...   230   1e-58   Gaeumannomyces graminis var. tritici R3-111a-1
gi|260791482|ref|XP_002590758.1| hypothetical protein BRAFLDRAFT...   230   1e-58   Branchiostoma floridae
gi|399169320|emb|CCE29838.1| probable ribosomal protein l13a [Cl...   230   2e-58   Claviceps purpurea 20.1
gi|171692595|ref|XP_001911222.1| hypothetical protein [Podospora...   230   2e-58   Podospora anserina S mat+
gi|353237126|emb|CCA69106.1| probable ribosomal protein L13a [Pi...   230   2e-58   Serendipita indica DSM 11827
gi|295670798|ref|XP_002795946.1| 60S ribosomal protein L16 [Para...   230   2e-58   Paracoccidioides lutzii Pb01
gi|310769831|gb|ADP21473.1| ribosomal protein L13A [Antheraea ya...   229   2e-58   Antheraea yamamai [Japanese oak silk moth]
gi|31340318|sp|Q962U0.1|RL13A_SPOFR RecName: Full=60S ribosomal ...   229   3e-58   Spodoptera frugiperda
gi|340905182|gb|EGS17550.1| 60S ribosomal protein L16-like prote...   229   3e-58   Chaetomium thermophilum var. thermophilum DSM 1495
gi|225681570|gb|EEH19854.1| 60S ribosomal protein L16-B [Paracoc...   229   3e-58   
gi|407924252|gb|EKG17306.1| Ribosomal protein L13 eukaryotic/arc...   229   3e-58   Macrophomina phaseolina MS6
gi|258576693|ref|XP_002542528.1| 60S ribosomal protein L16 [Unci...   229   3e-58   Uncinocarpus reesii 1704
gi|154312810|ref|XP_001555732.1| 60S ribosomal protein L16 [Botr...   229   3e-58   Botrytis cinerea B05.10
gi|482813490|gb|EOA90181.1| hypothetical protein SETTUDRAFT_1587...   229   3e-58   Setosphaeria turcica Et28A
gi|400593955|gb|EJP61841.1| 60S ribosomal protein L16 [Beauveria...   229   4e-58   Beauveria bassiana ARSEF 2860
gi|501295729|dbj|BAN20926.1| ribosomal protein L13A [Riptortus p...   229   4e-58   Riptortus pedestris
gi|115389400|ref|XP_001212205.1| serine palmitoyltransferase 2 [...   229   4e-58   Aspergillus terreus NIH2624
gi|268306366|gb|ACY95304.1| ribosomal protein L13A [Manduca sexta]    228   5e-58   Manduca sexta [Carolina sphinx]
gi|302697987|ref|XP_003038672.1| 60S ribosomal protein L16 [Schi...   228   5e-58   Schizophyllum commune H4-8
gi|170084017|ref|XP_001873232.1| 60S ribosomal protein L16 [Lacc...   228   5e-58   Laccaria bicolor S238N-H82
gi|85103730|ref|XP_961587.1| 60S ribosomal protein L16 [Neurospo...   228   5e-58   
gi|320587705|gb|EFX00180.1| 60S ribosomal protein l16 [Grosmanni...   228   6e-58   Grosmannia clavigera kw1407
gi|169622968|ref|XP_001804892.1| hypothetical protein SNOG_14710...   228   6e-58   Parastagonospora nodorum SN15
gi|336472697|gb|EGO60857.1| hypothetical protein NEUTE1DRAFT_115...   228   7e-58   Neurospora tetrasperma FGSC 2508
gi|94732930|emb|CAK04157.1| ribosomal protein L13a [Danio rerio]      228   7e-58   Danio rerio [leopard danio]
gi|389625313|ref|XP_003710310.1| 60S ribosomal protein L16 [Magn...   228   7e-58   Magnaporthe oryzae 70-15
gi|350413093|ref|XP_003489877.1| PREDICTED: 60S ribosomal protei...   228   7e-58   Bombus impatiens
gi|56759068|gb|AAW27674.1| SJCHGC04249 protein [Schistosoma japo...   228   7e-58   Schistosoma japonicum
gi|225556668|gb|EEH04956.1| AMP dependent synthetase and ligase ...   228   7e-58   Histoplasma capsulatum G186AR
gi|242004232|ref|XP_002436282.1| ribosomal protein L13A, putativ...   228   8e-58   Ixodes scapularis [blacklegged tick]
gi|390604813|gb|EIN14204.1| ribosomal protein L16a [Punctularia ...   228   8e-58   Punctularia strigosozonata HHB-11173 SS5
gi|336266622|ref|XP_003348078.1| 60S ribosomal protein L16 [Sord...   228   8e-58   Sordaria macrospora k-hell
gi|393218414|gb|EJD03902.1| ribosomal protein L16a [Fomitiporia ...   228   9e-58   Fomitiporia mediterranea MF3/22
gi|50548325|ref|XP_501632.1| 60S ribosomal protein L16 [Yarrowia...   228   9e-58   Yarrowia lipolytica CLIB122
gi|348531543|ref|XP_003453268.1| PREDICTED: 60S ribosomal protei...   228   9e-58   Oreochromis niloticus
gi|225711696|gb|ACO11694.1| 60S ribosomal protein L13A [Caligus ...   228   9e-58   Caligus rogercresseyi
gi|470326355|ref|XP_004364677.1| ribosomal protein L16a [Capsasp...   228   9e-58   Capsaspora owczarzaki ATCC 30864
gi|449551272|gb|EMD42236.1| hypothetical protein CERSUDRAFT_7983...   227   1e-57   Gelatoporia subvermispora B
gi|148234180|ref|NP_001080130.1| ribosomal protein L13a [Xenopus...   227   1e-57   Xenopus laevis [clawed frog]
gi|471570790|gb|EMR69805.1| putative 60s ribosomal protein l16 p...   227   1e-57   Eutypa lata UCREL1
gi|393248182|gb|EJD55689.1| 60S ribosomal protein L13a [Auricula...   227   1e-57   Auricularia subglabra TFB-10046 SS5
gi|386783753|gb|AFJ24771.1| 60S ribosomal protein L13a [Schmidte...   227   1e-57   Schmidtea mediterranea [freshwater planarian]
gi|378729297|gb|EHY55756.1| 60S ribosomal protein L16 [Exophiala...   227   1e-57   Exophiala dermatitidis NIH/UT8656
gi|189188534|ref|XP_001930606.1| 60S ribosomal protein L16 [Pyre...   227   1e-57   Pyrenophora tritici-repentis Pt-1C-BFP
gi|342877686|gb|EGU79132.1| hypothetical protein FOXB_10370 [Fus...   227   1e-57   Fusarium oxysporum Fo5176
gi|320580562|gb|EFW94784.1| cytosolic ribosomal protein L16, put...   227   2e-57   
gi|410898551|ref|XP_003962761.1| PREDICTED: 60S ribosomal protei...   227   2e-57   
gi|289472560|gb|ADC97465.1| putative 60S ribosomal protein L13a ...   227   2e-57   Amblyomma hebraeum [African tick bite fever vector]
gi|67527912|ref|XP_661806.1| RL16_NEUCR 60S ribosomal protein L1...   226   2e-57   Aspergillus nidulans FGSC A4
gi|145255027|ref|XP_001398840.1| 60S ribosomal protein L16 [Aspe...   226   2e-57   Aspergillus niger CBS 513.88
gi|505852913|ref|XP_004619892.1| PREDICTED: 60S ribosomal protei...   226   2e-57   Sorex araneus [Eurasian shrew]
gi|169764939|ref|XP_001816941.1| 60S ribosomal protein L16 [Aspe...   226   2e-57   Aspergillus oryzae RIB40
gi|406606146|emb|CCH42506.1| 60S ribosomal protein L16-A [Wicker...   226   2e-57   Wickerhamomyces ciferrii
gi|498933781|ref|XP_004540518.1| PREDICTED: 60S ribosomal protei...   226   2e-57   Maylandia zebra
gi|346227222|ref|NP_001230997.1| ribosomal protein L13a isoform ...   226   2e-57   Sus scrofa [pigs]
gi|296824912|ref|XP_002850731.1| 60S ribosomal protein L16 [Arth...   226   2e-57   Arthroderma otae CBS 113480
gi|315115437|gb|ADT80691.1| ribosomal protein L13A [Euphydryas a...   226   2e-57   Euphydryas aurinia [marsh fritillary]
gi|358366768|dbj|GAA83388.1| serine palmitoyltransferase 2 [Aspe...   226   2e-57   Aspergillus kawachii IFO 4308
gi|326470919|gb|EGD94928.1| 60S ribosomal protein L16 [Trichophy...   226   2e-57   Trichophyton tonsurans CBS 112818
gi|2500261|sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal p...   226   2e-57   Cyanophora paradoxa
gi|432936812|ref|XP_004082291.1| PREDICTED: 60S ribosomal protei...   226   2e-57   
gi|346227224|ref|NP_001230998.1| ribosomal protein L13a isoform ...   226   2e-57   Sus scrofa [pigs]
gi|66500885|ref|XP_623813.1| PREDICTED: 60S ribosomal protein L1...   226   2e-57   Apis mellifera [European honey bee]
gi|322708490|gb|EFZ00068.1| 60S ribosomal protein L16 [Metarhizi...   226   2e-57   Metarhizium robertsii ARSEF 23
gi|507981697|ref|XP_004694340.1| PREDICTED: 60S ribosomal protei...   226   2e-57   Condylura cristata
gi|466015254|ref|XP_004271087.1| PREDICTED: 60S ribosomal protei...   226   2e-57   Orcinus orca [Orca]
gi|389751574|gb|EIM92647.1| 60S ribosomal protein L13a [Stereum ...   226   2e-57   Stereum hirsutum FP-91666 SS1
gi|315055347|ref|XP_003177048.1| 60S ribosomal protein L16 [Arth...   226   2e-57   Microsporum gypseum CBS 118893
gi|238606250|ref|XP_002396666.1| hypothetical protein MPER_03052...   226   3e-57   
gi|159130823|gb|EDP55936.1| ribosomal protein L16a [Aspergillus ...   226   3e-57   Aspergillus fumigatus A1163
gi|62858175|ref|NP_001016486.1| ribosomal protein L13a [Xenopus ...   226   3e-57   Xenopus tropicalis [western clawed frog]
gi|146322483|ref|XP_750349.2| ribosomal protein L16a [Aspergillu...   226   3e-57   Aspergillus fumigatus Af293
gi|452988355|gb|EME88110.1| hypothetical protein MYCFIDRAFT_2097...   226   3e-57   Cercospora fijiensis CIRAD86
gi|119187609|ref|XP_001244411.1| 60S ribosomal protein L16 [Cocc...   226   3e-57   Coccidioides immitis RS
gi|429884774|gb|AGA17991.1| ribosomal protein L13A, partial [Agr...   226   3e-57   Agrotis ipsilon [dark sword grass moth]
gi|156051676|ref|XP_001591799.1| 60S ribosomal protein L16 [Scle...   226   3e-57   Sclerotinia sclerotiorum 1980 UF-70
gi|112984370|ref|NP_001037156.1| ribosomal protein L13A [Bombyx ...   226   3e-57   Bombyx mori [silk moth]
gi|392571216|gb|EIW64388.1| 60S ribosomal protein L13a [Trametes...   226   3e-57   Trametes versicolor FP-101664 SS1
gi|403418460|emb|CCM05160.1| predicted protein [Fibroporia radic...   226   3e-57   Fibroporia radiculosa
gi|75077219|sp|Q4R8Z2.3|RL13A_MACFA RecName: Full=60S ribosomal ...   226   3e-57   Macaca fascicularis [crab eating macaque]
gi|296234343|ref|XP_002762391.1| PREDICTED: 60S ribosomal protei...   226   3e-57   Callithrix jacchus [common marmoset]
gi|504174964|ref|XP_004597042.1| PREDICTED: 60S ribosomal protei...   226   3e-57   Ochotona princeps [southern American pika]
gi|116004215|ref|NP_001070466.1| 60S ribosomal protein L13a [Bos...   226   3e-57   Bos taurus [bovine]
gi|511895529|ref|XP_004767370.1| PREDICTED: 60S ribosomal protei...   226   4e-57   Mustela putorius furo [black ferret]
gi|163658449|gb|ABY28364.1| ribosomal protein L13A [Oncorhynchus...   226   4e-57   Oncorhynchus masou formosanus [Taiwan salmon]
gi|306482619|ref|NP_001182348.1| ribosomal protein L13a [Macaca ...   226   4e-57   Macaca mulatta [rhesus macaque]
gi|149757870|ref|XP_001491926.1| PREDICTED: 60S ribosomal protei...   226   4e-57   Equus caballus [domestic horse]
gi|471396052|ref|XP_004381707.1| PREDICTED: 60S ribosomal protei...   225   4e-57   Trichechus manatus latirostris
gi|512192851|gb|EPE08609.1| 60s ribosomal protein l16 [Ophiostom...   225   4e-57   Ophiostoma piceae UAMH 11346
gi|38114878|gb|AAH04900.2| RPL13A protein, partial [Homo sapiens]     225   4e-57   Homo sapiens [man]
gi|6912634|ref|NP_036555.1| 60S ribosomal protein L13a isoform 1...   225   4e-57   Homo sapiens [man]
gi|507577548|ref|XP_004672300.1| PREDICTED: 60S ribosomal protei...   225   4e-57   Jaculus jaculus
gi|395334661|gb|EJF67037.1| 60S ribosomal protein L13a [Dichomit...   225   4e-57   Dichomitus squalens LYAD-421 SS1
gi|392597311|gb|EIW86633.1| ribosomal protein L16a [Coniophora p...   225   4e-57   Coniophora puteana RWD-64-598 SS2
gi|440898008|gb|ELR49590.1| 60S ribosomal protein L13a, partial ...   225   4e-57   Bos mutus
gi|301764969|ref|XP_002917886.1| PREDICTED: 60S ribosomal protei...   225   4e-57   
gi|355756040|gb|EHH59787.1| hypothetical protein EGM_09978, part...   225   5e-57   Macaca fascicularis [crab eating macaque]
gi|472381083|ref|XP_004409938.1| PREDICTED: 60S ribosomal protei...   225   5e-57   Odobenus rosmarus divergens
gi|478532374|ref|XP_004440337.1| PREDICTED: 60S ribosomal protei...   225   5e-57   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|383862429|ref|XP_003706686.1| PREDICTED: 60S ribosomal protei...   225   5e-57   Megachile rotundata
gi|47086477|ref|NP_997949.1| 60S ribosomal protein L13a [Danio r...   225   5e-57   Danio rerio [leopard danio]
gi|281348356|gb|EFB23940.1| hypothetical protein PANDA_006273 [A...   225   5e-57   Ailuropoda melanoleuca
gi|389608161|dbj|BAM17692.1| ribosomal protein L13A [Papilio xut...   225   5e-57   Papilio xuthus [Chinese swallowtail]
gi|340709161|ref|XP_003393181.1| PREDICTED: 60S ribosomal protei...   225   5e-57   Bombus terrestris [large earth bumblebee]
gi|166952291|gb|ABZ04228.1| ribosomal protein rpl13a [Lineus vir...   225   5e-57   Lineus viridis
gi|395858350|ref|XP_003801534.1| PREDICTED: 60S ribosomal protei...   225   5e-57   Otolemur garnettii
gi|296414579|ref|XP_002836976.1| 60S ribosomal protein L16 [Tube...   225   6e-57   Tuber melanosporum Mel28
gi|342356425|gb|AEL28871.1| ribosomal protein L13A [Heliconius m...   225   6e-57   Heliconius melpomene cythera
gi|149445952|ref|XP_001507007.1| PREDICTED: 60S ribosomal protei...   225   6e-57   Ornithorhynchus anatinus [duck-billed platypus]
gi|507708723|ref|XP_004646507.1| PREDICTED: 60S ribosomal protei...   225   6e-57   Octodon degus
gi|351702733|gb|EHB05652.1| 60S ribosomal protein L13a, partial ...   225   6e-57   Heterocephalus glaber [naked mole rat]
gi|402221819|gb|EJU01887.1| ribosomal protein L13 [Dacryopinax s...   225   6e-57   Dacryopinax primogenitus
gi|410050483|ref|XP_003952917.1| PREDICTED: 60S ribosomal protei...   225   6e-57   
gi|327283014|ref|XP_003226237.1| PREDICTED: 60S ribosomal protei...   224   7e-57   Anolis carolinensis [Carolina anole]
gi|354493134|ref|XP_003508699.1| PREDICTED: 60S ribosomal protei...   224   7e-57   
gi|119496591|ref|XP_001265069.1| 60S ribosomal protein L16 [Neos...   224   7e-57   Aspergillus fischeri NRRL 181
gi|426235490|ref|XP_004011713.1| PREDICTED: 60S ribosomal protei...   224   7e-57   Ovis aries [domestic sheep]
gi|326478481|gb|EGE02491.1| 60S ribosomal protein L16 [Trichophy...   224   7e-57   Trichophyton equinum CBS 127.97
gi|114663280|ref|XP_001167494.1| PREDICTED: 60S ribosomal protei...   224   8e-57   
gi|397509354|ref|XP_003825090.1| PREDICTED: 60S ribosomal protei...   224   8e-57   
gi|121702595|ref|XP_001269562.1| 60S ribosomal protein L16 [Aspe...   224   8e-57   Aspergillus clavatus NRRL 1
gi|310790306|gb|EFQ25839.1| ribosomal protein L13 [Glomerella gr...   224   8e-57   Colletotrichum graminicola M1.001
gi|332864827|ref|XP_001154037.2| PREDICTED: 60S ribosomal protei...   224   8e-57   
gi|62897053|dbj|BAD96467.1| ribosomal protein L13a variant [Homo...   224   9e-57   Homo sapiens [man]
gi|409083452|gb|EKM83809.1| hypothetical protein AGABI1DRAFT_815...   224   9e-57   Agaricus bisporus var. burnettii JB137-S8
gi|225717546|gb|ACO14619.1| 60S ribosomal protein L13A [Caligus ...   224   9e-57   Caligus clemensi
gi|344269432|ref|XP_003406556.1| PREDICTED: 60S ribosomal protei...   224   1e-56   
gi|389610885|dbj|BAM19053.1| ribosomal protein L13A [Papilio pol...   224   1e-56   Papilio polytes
gi|348559516|ref|XP_003465562.1| PREDICTED: 60S ribosomal protei...   224   1e-56   Cavia porcellus [guinea pig]
gi|242213173|ref|XP_002472416.1| 60S ribosomal protein L13a [Pos...   224   1e-56   Postia placenta Mad-698-R
gi|488566004|ref|XP_004472671.1| PREDICTED: 60S ribosomal protei...   224   1e-56   Dasypus novemcinctus
gi|449304843|gb|EMD00850.1| hypothetical protein BAUCODRAFT_6097...   224   1e-56   Baudoinia panamericana UAMH 10762
gi|302405445|ref|XP_003000559.1| 60S ribosomal protein L16 [Vert...   224   1e-56   Verticillium alfalfae VaMs.102
gi|150981986|gb|ABR87195.1| large subunit ribosomal protein 16 [...   224   1e-56   Pristionchus sp. 10 RS5133
gi|507680614|ref|XP_004710493.1| PREDICTED: 60S ribosomal protei...   224   1e-56   Echinops telfairi [lesser hedgehog tenrec]
gi|355703776|gb|EHH30267.1| hypothetical protein EGK_10889, part...   224   1e-56   Macaca mulatta [rhesus macaque]
gi|357602430|gb|EHJ63396.1| 60S ribosomal protein L13a [Danaus p...   224   1e-56   Danaus plexippus [American monarch]
gi|198285633|gb|ACH85355.1| ribosomal protein L13a [Salmo salar]      223   2e-56   Salmo salar
gi|223646380|gb|ACN09948.1| 60S ribosomal protein L13a [Salmo sa...   223   2e-56   Salmo salar
gi|223647244|gb|ACN10380.1| 60S ribosomal protein L13a [Salmo sa...   223   2e-56   Salmo salar
gi|255718289|ref|XP_002555425.1| 60S ribosomal protein L16 [Lach...   223   2e-56   Lachancea thermotolerans CBS 6340
gi|507622344|ref|XP_004625632.1| PREDICTED: 60S ribosomal protei...   223   2e-56   
gi|403299252|ref|XP_003940403.1| PREDICTED: 60S ribosomal protei...   223   2e-56   Saimiri boliviensis boliviensis
gi|197099650|ref|NP_001125810.1| 60S ribosomal protein L13a [Pon...   223   2e-56   Pongo abelii [Orang-utan]
gi|33337718|gb|AAQ13495.1|AF109186_1 FWP004 [Homo sapiens]            223   2e-56   Homo sapiens [man]
gi|77404207|ref|NP_775462.2| 60S ribosomal protein L13a [Rattus ...   223   2e-56   Rattus norvegicus [brown rat]
gi|507686941|ref|XP_004640903.1| PREDICTED: 60S ribosomal protei...   223   2e-56   
gi|431920762|gb|ELK18535.1| 60S ribosomal protein L13a [Pteropus...   223   2e-56   Pteropus alecto
gi|380471255|emb|CCF47368.1| 60S ribosomal protein L16, partial ...   223   2e-56   Colletotrichum higginsianum
gi|31340317|sp|Q8MUR4.1|RL13A_CHOPR RecName: Full=60S ribosomal ...   223   2e-56   Choristoneura parallela
gi|444705748|gb|ELW47139.1| Aldehyde dehydrogenase family 16 mem...   223   2e-56   Tupaia chinensis
gi|62083489|gb|AAX62469.1| ribosomal protein L13a [Lysiphlebus t...   223   3e-56   Lysiphlebus testaceipes
gi|311334488|emb|CBN08625.1| small nucleolar RNA, C/D box 32A [M...   223   3e-56   Microcosmus squamiger
gi|55050|emb|CAA35908.1| tum- transplantation antigen P198 [Mus ...   223   3e-56   Mus musculus [mouse]
gi|31981945|ref|NP_033464.2| 60S ribosomal protein L13a [Mus mus...   222   3e-56   Mus musculus [mouse]
gi|470318844|gb|EMR10485.1| hypothetical protein PNEG_01198 [Pne...   222   3e-56   Pneumocystis murina B123
gi|297667473|ref|XP_002812003.1| PREDICTED: 60S ribosomal protei...   222   3e-56   
gi|160550223|gb|ABX44816.1| putative 60S ribosomal protein RPL13...   222   3e-56   Flustra foliacea
gi|154091237|gb|ABS57429.1| ribosomal protein L13a [Heliconius m...   222   3e-56   Heliconius melpomene [common postman]
gi|421975934|gb|AFX72999.1| 60S ribosomal protein L13a [Spiromet...   222   4e-56   Spirometra erinaceieuropaei
gi|298714763|emb|CBJ25662.1| 60S ribosomal protein L13a [Ectocar...   222   4e-56   Ectocarpus siliculosus
gi|209733998|gb|ACI67868.1| 60S ribosomal protein L13a [Salmo sa...   222   4e-56   Salmo salar
gi|504133232|ref|XP_004579204.1| PREDICTED: 60S ribosomal protei...   222   4e-56   Ochotona princeps [southern American pika]
gi|198285601|gb|ACH85339.1| ribosomal protein L13a [Salmo salar]      222   4e-56   Salmo salar
gi|390365124|ref|XP_003730751.1| PREDICTED: 60S ribosomal protei...   222   4e-56   
gi|72044438|ref|XP_784515.1| PREDICTED: 60S ribosomal protein L1...   222   5e-56   Strongylocentrotus purpuratus [purple urchin]
gi|409051687|gb|EKM61163.1| hypothetical protein PHACADRAFT_2475...   222   5e-56   Phanerochaete carnosa HHB-10118-sp
gi|307207585|gb|EFN85250.1| 60S ribosomal protein L13a [Harpegna...   221   5e-56   Harpegnathos saltator
gi|226490975|ref|NP_001147262.1| 60S ribosomal protein L13a-2 [Z...   221   6e-56   
gi|478261744|gb|ENN80891.1| hypothetical protein YQE_02680, part...   221   7e-56   Dendroctonus ponderosae
gi|332373202|gb|AEE61742.1| unknown [Dendroctonus ponderosae]         221   7e-56   Dendroctonus ponderosae
gi|365983664|ref|XP_003668665.1| ribosomal protein L16 [Naumovoz...   221   8e-56   Naumovozyma dairenensis CBS 421
gi|548747|sp|P35427.2|RL13A_RAT RecName: Full=60S ribosomal prot...   221   9e-56   Rattus norvegicus [brown rat]
gi|76573377|gb|ABA46793.1| 60S ribosomal protein L13A [Mytilus e...   221   1e-55   Mytilus edulis [blue mussel]
gi|398412115|ref|XP_003857387.1| 60S ribosomal protein L16 [Zymo...   221   1e-55   Zymoseptoria tritici IPO323
gi|150981998|gb|ABR87201.1| large subunit ribosomal protein 16 [...   221   1e-55   Koerneria sp. RS1982
gi|410083427|ref|XP_003959291.1| hypothetical protein KAFR_0J008...   221   1e-55   Kazachstania africana CBS 2517
gi|150981992|gb|ABR87198.1| large subunit ribosomal protein 16 [...   221   1e-55   Pristionchus sp. 13 RS5231
gi|187609308|pdb|2ZKR|JJ Chain j, Structure Of A Mammalian Ribos...   220   1e-55   Canis lupus familiaris [dogs]
gi|325530312|sp|Q9XSU0.2|RL13A_CANFA RecName: Full=60S ribosomal...   220   1e-55   Canis lupus familiaris [dogs]
gi|507619095|ref|XP_004624823.1| PREDICTED: 60S ribosomal protei...   220   2e-55   
gi|345562379|gb|EGX45447.1| hypothetical protein AOL_s00169g53 [...   220   2e-55   Arthrobotrys oligospora ATCC 24927
gi|150981972|gb|ABR87188.1| large subunit ribosomal protein 16 [...   220   2e-55   Pristionchus sp. 3 CZ3975
gi|114649907|ref|XP_001137817.1| PREDICTED: 60S ribosomal protei...   220   2e-55   
gi|453088978|gb|EMF17018.1| 60S ribosomal protein L16-B [Mycosph...   219   2e-55   Sphaerulina musiva SO2202
gi|512206266|gb|EPE35086.1| Ribosomal protein L13 [Glarea lozoye...   219   3e-55   Glarea lozoyensis ATCC 20868
gi|150981994|gb|ABR87199.1| large subunit ribosomal protein 16 [...   219   3e-55   Pristionchus sp. 14 RS5230
gi|126273925|ref|XP_001387342.1| 60S ribosomal protein L16 [Sche...   219   3e-55   Scheffersomyces stipitis CBS 6054
gi|459176842|ref|XP_004226142.1| PREDICTED: 60S ribosomal protei...   219   3e-55   Ciona intestinalis [sea vase]
gi|150981970|gb|ABR87187.1| large subunit ribosomal protein 16 [...   219   4e-55   Pristionchus uniformis
gi|392874348|gb|AFM86006.1| 60S ribosomal protein L13a [Callorhi...   219   4e-55   Callorhinchus milii [Australian ghost shark]
gi|452848315|gb|EME50247.1| hypothetical protein DOTSEDRAFT_6895...   219   4e-55   Dothistroma septosporum NZE10
gi|477534346|gb|ENH85897.1| 60s ribosomal protein l16 [Colletotr...   219   4e-55   Colletotrichum orbiculare MAFF 240422
gi|426375599|ref|XP_004054617.1| PREDICTED: 60S ribosomal protei...   218   5e-55   Gorilla gorilla gorilla [lowland gorilla]
gi|150981982|gb|ABR87193.1| large subunit ribosomal protein 16 [...   218   5e-55   Pristionchus pauli
gi|344304398|gb|EGW34630.1| 60S large subunit ribosomal protein ...   218   5e-55   Spathaspora passalidarum NRRL Y-27907
gi|151943033|gb|EDN61368.1| ribosomal protein L16A [Saccharomyce...   218   5e-55   Saccharomyces cerevisiae YJM789
gi|390135481|gb|AFL56721.1| large subunit ribosomal protein 16, ...   218   5e-55   Pristionchus arcanus
gi|390135433|gb|AFL56697.1| large subunit ribosomal protein 16, ...   218   5e-55   Pristionchus exspectatus
gi|150981988|gb|ABR87196.1| large subunit ribosomal protein 16 [...   218   5e-55   Pristionchus sp. 11 RS5228
gi|307188111|gb|EFN72943.1| 60S ribosomal protein L13a [Camponot...   218   6e-55   Camponotus floridanus
gi|472587889|gb|EMS25385.1| 60S ribosomal protein l16 [Rhodospor...   218   6e-55   Rhodotorula toruloides NP11
gi|350535877|ref|NP_001232687.1| putative ribosomal protein L13A...   218   6e-55   Taeniopygia guttata
gi|387914352|gb|AFK10785.1| 60S ribosomal protein L13a [Callorhi...   218   6e-55   Callorhinchus milii [Australian ghost shark]
gi|392883676|gb|AFM90670.1| 60S ribosomal protein L13a [Callorhi...   218   7e-55   Callorhinchus milii [Australian ghost shark]
gi|392877418|gb|AFM87541.1| 60S ribosomal protein L13a [Callorhi...   218   7e-55   Callorhinchus milii [Australian ghost shark]
gi|164658129|ref|XP_001730190.1| hypothetical protein MGL_2572 [...   218   7e-55   Malassezia globosa CBS 7966
gi|392878342|gb|AFM88003.1| 60S ribosomal protein L13a [Callorhi...   218   8e-55   Callorhinchus milii [Australian ghost shark]
gi|336376038|gb|EGO04373.1| hypothetical protein SERLA73DRAFT_17...   218   9e-55   Serpula lacrymans var. lacrymans S7.3
gi|229366008|gb|ACQ57984.1| 60S ribosomal protein L13a [Anoplopo...   218   9e-55   Anoplopoma fimbria
gi|393912068|gb|EFO20746.2| 60S ribosomal protein L13a [Loa loa]      218   9e-55   Loa loa
gi|109121027|ref|XP_001093017.1| PREDICTED: 60S ribosomal protei...   218   9e-55   
gi|405976110|gb|EKC40630.1| 60S ribosomal protein L13a [Crassost...   218   9e-55   Crassostrea gigas
gi|312082137|ref|XP_003143319.1| 60S ribosomal protein L13a [Loa...   218   1e-54   Loa loa
gi|68473888|ref|XP_719047.1| likely cytosolic ribosomal protein ...   218   1e-54   Candida albicans SC5314
gi|50291439|ref|XP_448152.1| 60S ribosomal protein L16 [Candida ...   217   1e-54   Candida glabrata CBS 138
gi|150981962|gb|ABR87183.1| large subunit ribosomal protein 16 [...   217   1e-54   Pristionchus pacificus
gi|156842379|ref|XP_001644557.1| hypothetical protein Kpol_1003p...   217   1e-54   Vanderwaltozyma polyspora DSM 70294
gi|150981964|gb|ABR87184.1| large subunit ribosomal protein 16 [...   217   1e-54   Pristionchus maupasi
gi|444322129|ref|XP_004181720.1| hypothetical protein TBLA_0G026...   217   1e-54   Tetrapisispora blattae CBS 6284
gi|259147122|emb|CAY80375.1| Rpl16ap [Saccharomyces cerevisiae E...   217   1e-54   Saccharomyces cerevisiae EC1118
gi|15293895|gb|AAK95140.1| ribosomal protein L13a [Ictalurus pun...   217   1e-54   Ictalurus punctatus
gi|164690957|dbj|BAF98661.1| ribosomal protein L13a [Solea seneg...   217   1e-54   Solea senegalensis
gi|479330833|gb|AGJ74543.1| large subunit ribosomal protein 16, ...   217   2e-54   Pristionchus bucculentus
gi|50310543|ref|XP_455291.1| 60S ribosomal protein L16 [Kluyvero...   216   2e-54   Kluyveromyces lactis NRRL Y-1140
gi|392875094|gb|AFM86379.1| 60S ribosomal protein L13a [Callorhi...   216   2e-54   Callorhinchus milii [Australian ghost shark]
gi|343426774|emb|CBQ70302.1| probable ribosomal protein L13a [Sp...   216   2e-54   Sporisorium reilianum SRZ2
gi|45190969|ref|NP_985223.1| 60S ribosomal protein L16 [Ashbya g...   216   2e-54   Eremothecium gossypii ATCC 10895
gi|195395995|ref|XP_002056619.1| GJ11043 [Drosophila virilis] >g...   216   2e-54   Drosophila virilis
gi|126330006|ref|XP_001363221.1| PREDICTED: 60S ribosomal protei...   216   2e-54   Monodelphis domestica
gi|466001748|gb|EMP41574.1| 60S ribosomal protein L13a [Chelonia...   216   2e-54   Chelonia mydas [green seaturtle]
gi|6322058|ref|NP_012133.1| ribosomal 60S subunit protein L16A [...   216   2e-54   Saccharomyces cerevisiae S288c
gi|339258186|ref|XP_003369279.1| 60S ribosomal protein L13a [Tri...   216   2e-54   Trichinella spiralis
gi|443925470|gb|ELU44301.1| 60S ribosomal protein L13a [Rhizocto...   216   2e-54   Rhizoctonia solani AG-1 IA
gi|365987936|ref|XP_003670799.1| ribosomal protein L16 [Naumovoz...   216   2e-54   Naumovozyma dairenensis CBS 421
gi|194745518|ref|XP_001955235.1| GF16337 [Drosophila ananassae] ...   216   3e-54   
gi|363753500|ref|XP_003646966.1| hypothetical protein Ecym_5394 ...   216   3e-54   
gi|502126223|ref|XP_004499225.1| PREDICTED: 60S ribosomal protei...   216   3e-54   
gi|150981978|gb|ABR87191.1| large subunit ribosomal protein 16 [...   216   3e-54   
gi|402588514|gb|EJW82447.1| 60S ribosomal protein L13a [Wucherer...   216   3e-54   
gi|366995535|ref|XP_003677531.1| hypothetical protein NCAS_0G029...   216   3e-54   
gi|150981980|gb|ABR87192.1| large subunit ribosomal protein 16 [...   216   3e-54   
gi|448123249|ref|XP_004204646.1| Piso0_000506 [Millerozyma farin...   216   4e-54   
gi|322696559|gb|EFY88349.1| 60S ribosomal protein L16 [Metarhizi...   216   4e-54   
gi|195054357|ref|XP_001994092.1| GH22962 [Drosophila grimshawi] ...   215   4e-54   
gi|482567268|gb|EOA31457.1| hypothetical protein CARUB_v10014643...   215   4e-54   
gi|392883962|gb|AFM90813.1| 60S ribosomal protein L13a [Callorhi...   215   4e-54   
gi|170586672|ref|XP_001898103.1| 60S ribosomal protein L13a [Bru...   215   4e-54   
gi|491845578|gb|AGL33439.1| 60S ribosomal protein L13a, partial ...   215   5e-54   
gi|21357053|ref|NP_649560.1| ribosomal protein L13A, isoform B [...   215   5e-54   
gi|441629268|ref|XP_004092948.1| PREDICTED: LOW QUALITY PROTEIN:...   215   5e-54   
gi|367012089|ref|XP_003680545.1| 60S ribosomal protein L16 [Toru...   215   5e-54   
gi|197128903|gb|ACH45401.1| putative ribosomal protein L13A [Tae...   215   5e-54   
gi|150981968|gb|ABR87186.1| large subunit ribosomal protein 16 [...   215   5e-54   
gi|403215937|emb|CCK70435.1| hypothetical protein KNAG_0E01730 [...   215   5e-54   
gi|19423912|gb|AAL87341.1| putative 60S ribosomal protein [Arabi...   215   5e-54   
gi|15230197|ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabi...   215   6e-54   
gi|512829229|ref|XP_004881622.1| PREDICTED: 60S ribosomal protei...   215   6e-54   
gi|224140811|ref|XP_002323772.1| predicted protein [Populus tric...   215   6e-54   
gi|150981974|gb|ABR87189.1| large subunit ribosomal protein 16 [...   215   6e-54   
gi|195451719|ref|XP_002073047.1| GK13926 [Drosophila willistoni]...   215   6e-54   
gi|71004814|ref|XP_757073.1| hypothetical protein UM00926.1 [Ust...   214   7e-54   
gi|354544203|emb|CCE40926.1| hypothetical protein CPAR2_109630 [...   214   8e-54   
gi|356559017|ref|XP_003547798.1| PREDICTED: 60S ribosomal protei...   214   8e-54   
gi|60417180|emb|CAH57701.1| 60S ribosomal protein L13A [Platicht...   214   8e-54   
gi|351727116|ref|NP_001235102.1| uncharacterized protein LOC1004...   214   9e-54   
gi|448520038|ref|XP_003868207.1| Rpl16a protein [Candida orthops...   214   9e-54   
gi|367002648|ref|XP_003686058.1| 60S ribosomal protein L16 [Tetr...   214   9e-54   
gi|255730141|ref|XP_002549995.1| 60S ribosomal protein L16-A [Ca...   214   9e-54   
gi|297790564|ref|XP_002863167.1| predicted protein [Arabidopsis ...   214   9e-54   
gi|297831364|ref|XP_002883564.1| 60S ribosomal protein L13A [Ara...   214   1e-53   
gi|125775701|ref|XP_001359035.1| GA13222 [Drosophila pseudoobscu...   214   1e-53   
gi|388513755|gb|AFK44939.1| unknown [Lotus japonicus]                 214   1e-53   
gi|50409748|ref|XP_456903.1| 60S ribosomal protein L16 [Debaryom...   214   1e-53   
gi|15235617|ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabi...   214   1e-53   
gi|256270220|gb|EEU05440.1| Rpl16ap [Saccharomyces cerevisiae JA...   214   1e-53   
gi|195111769|ref|XP_002000450.1| GI10239 [Drosophila mojavensis]...   214   1e-53   
gi|38048387|gb|AAR10096.1| similar to Drosophila melanogaster CG...   214   1e-53   
gi|118483379|gb|ABK93590.1| unknown [Populus trichocarpa]             214   1e-53   
gi|315113298|pdb|3IZR|K Chain K, Localization Of The Large Subun...   213   2e-53   
gi|432099330|gb|ELK28587.1| Aldehyde dehydrogenase family 16 mem...   213   2e-53   
gi|388851439|emb|CCF54841.1| probable ribosomal protein L13a [Us...   213   2e-53   
gi|401884567|gb|EJT48722.1| structural constituent of ribosome [...   213   2e-53   
gi|328771281|gb|EGF81321.1| hypothetical protein BATDEDRAFT_1638...   213   2e-53   
gi|254576879|ref|XP_002494426.1| 60S ribosomal protein L16 [Zygo...   213   2e-53   
gi|432936814|ref|XP_004082292.1| PREDICTED: 60S ribosomal protei...   213   2e-53   
gi|318169635|ref|NP_001187674.1| 60S ribosomal protein l13a [Ict...   213   2e-53   
gi|149244176|ref|XP_001526631.1| 60S ribosomal protein L16-A [Lo...   213   2e-53   
gi|213409015|ref|XP_002175278.1| 60S ribosomal protein L16 [Schi...   213   2e-53   
gi|459366759|gb|EMG45994.1| 60S ribosomal protein L16-A [Candida...   213   2e-53   
gi|460415302|ref|XP_004252998.1| PREDICTED: 60S ribosomal protei...   213   3e-53   
gi|76573371|gb|ABA46790.1| 60S ribosomal protein L13a-like prote...   213   3e-53   
gi|460388412|ref|XP_004239861.1| PREDICTED: 60S ribosomal protei...   213   3e-53   
gi|391344022|ref|XP_003746303.1| PREDICTED: 60S ribosomal protei...   212   3e-53   
gi|15231394|ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabi...   212   4e-53   
gi|19112045|ref|NP_595253.1| 60S ribosomal protein L16 [Schizosa...   212   4e-53   
gi|159145712|gb|ABW90393.1| putative ribosomal protein L13a [Bar...   212   4e-53   
gi|150981996|gb|ABR87200.1| large subunit ribosomal protein 16 [...   212   4e-53   
gi|499012557|ref|XP_004537322.1| PREDICTED: 60S ribosomal protei...   212   4e-53   
gi|332217470|ref|XP_003257882.1| PREDICTED: 60S ribosomal protei...   212   4e-53   
gi|331240818|ref|XP_003333059.1| 60S ribosomal protein L16 [Pucc...   212   4e-53   
gi|255560155|ref|XP_002521095.1| 60S ribosomal protein L13a, put...   212   5e-53   
gi|297795569|ref|XP_002865669.1| 60S ribosomal protein L13A [Ara...   212   5e-53   
gi|114632810|ref|XP_001144533.1| PREDICTED: 60S ribosomal protei...   212   5e-53   
gi|71064085|gb|AAZ22494.1| Rpl16ap [Saccharomyces cerevisiae]         211   6e-53   
gi|482567276|gb|EOA31465.1| hypothetical protein CARUB_v10014649...   211   6e-53   
gi|151944465|gb|EDN62743.1| ribosomal protein L16B [Saccharomyce...   211   6e-53   
gi|19115353|ref|NP_594441.1| 60S ribosomal protein L16 [Schizosa...   211   6e-53   
gi|351721919|ref|NP_001236202.1| uncharacterized protein LOC1005...   211   6e-53   
gi|366990691|ref|XP_003675113.1| hypothetical protein NCAS_0B065...   211   6e-53   
gi|12329977|emb|CAC24570.1| ribosomal protein L13A [Xanthophyllo...   211   6e-53   
gi|397510497|ref|XP_003825632.1| PREDICTED: 60S ribosomal protei...   211   7e-53   
gi|150981966|gb|ABR87185.1| large subunit ribosomal protein 16 [...   211   7e-53   
gi|501310245|dbj|GAC99018.1| 60S ribosomal protein L13/L16 [Pseu...   211   7e-53   
gi|392877556|gb|AFM87610.1| 60S ribosomal protein L13a [Callorhi...   211   7e-53   
gi|255640596|gb|ACU20583.1| unknown [Glycine max]                     211   7e-53   
gi|213405297|ref|XP_002173420.1| 60S ribosomal protein L16 [Schi...   211   7e-53   
gi|40748267|gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum ...   211   8e-53   
gi|168043562|ref|XP_001774253.1| predicted protein [Physcomitrel...   211   9e-53   
gi|217035903|gb|ACJ74467.1| 60S ribosomal protein L13a [Ochlerot...   211   9e-53   
gi|225465463|ref|XP_002267491.1| PREDICTED: 60S ribosomal protei...   211   9e-53   
gi|392579233|gb|EIW72360.1| hypothetical protein TREMEDRAFT_5589...   211   1e-52   
gi|323454360|gb|EGB10230.1| hypothetical protein AURANDRAFT_5886...   211   1e-52   
gi|395831191|ref|XP_003788690.1| PREDICTED: 60S ribosomal protei...   210   1e-52   
gi|346319420|gb|EGX89022.1| 60S ribosomal protein L16 [Cordyceps...   210   1e-52   
gi|94468830|gb|ABF18264.1| 60S ribosomal protein L13a [Aedes aeg...   210   1e-52   
gi|341897374|gb|EGT53309.1| hypothetical protein CAEBREN_29425 [...   210   1e-52   
gi|268573023|ref|XP_002641489.1| C. briggsae CBR-RPL-16 protein ...   210   1e-52   
gi|168025661|ref|XP_001765352.1| predicted protein [Physcomitrel...   210   1e-52   
gi|332262612|ref|XP_003280356.1| PREDICTED: 60S ribosomal protei...   210   1e-52   
gi|308501615|ref|XP_003112992.1| CRE-RPL-16 protein [Caenorhabdi...   210   1e-52   
gi|15239698|ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabi...   210   1e-52   
gi|58262006|ref|XP_568413.1| structural constituent of ribosome ...   210   1e-52   
gi|462395928|gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553...   210   2e-52   
gi|6324260|ref|NP_014330.1| ribosomal 60S subunit protein L16B [...   210   2e-52   
gi|449432416|ref|XP_004133995.1| PREDICTED: 60S ribosomal protei...   210   2e-52   
gi|460404757|ref|XP_004247847.1| PREDICTED: 60S ribosomal protei...   210   2e-52   
gi|449476086|ref|XP_004154636.1| PREDICTED: 60S ribosomal protei...   210   2e-52   
gi|321265303|ref|XP_003197368.1| structural constituent of ribos...   210   2e-52   
gi|482553209|gb|EOA17402.1| hypothetical protein CARUB_v10005705...   210   2e-52   
gi|357111775|ref|XP_003557686.1| PREDICTED: 60S ribosomal protei...   210   2e-52   
gi|62361059|gb|AAX81225.1| ribosomal protein L13 [Uroleptus sp. ...   209   2e-52   
gi|449442379|ref|XP_004138959.1| PREDICTED: 60S ribosomal protei...   209   2e-52   
gi|452825065|gb|EME32064.1| 60S ribosomal protein L13A [Galdieri...   209   2e-52   
gi|449476090|ref|XP_004154637.1| PREDICTED: 60S ribosomal protei...   209   2e-52   
gi|356527386|ref|XP_003532292.1| PREDICTED: 60S ribosomal protei...   209   2e-52   
gi|482549815|gb|EOA14009.1| hypothetical protein CARUB_v10027141...   209   2e-52   
gi|426371753|ref|XP_004052805.1| PREDICTED: 60S ribosomal protei...   209   2e-52   
gi|392296922|gb|EIW08023.1| Rpl16bp [Saccharomyces cerevisiae CE...   209   2e-52   
gi|3299816|dbj|BAA31555.1| ribosomal protein rp22 homolog [Schiz...   209   3e-52   
gi|207344419|gb|EDZ71571.1| YIL133Cp-like protein [Saccharomyces...   209   3e-52   
gi|327307406|ref|XP_003238394.1| 60S ribosomal protein L16 [Tric...   209   3e-52   
gi|357492907|ref|XP_003616742.1| 60S ribosomal protein L13A [Med...   209   3e-52   
gi|242038073|ref|XP_002466431.1| hypothetical protein SORBIDRAFT...   209   3e-52   
gi|55667103|ref|XP_520754.1| PREDICTED: 60S ribosomal protein L1...   209   3e-52   
gi|313586505|gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea b...   209   3e-52   
gi|194690170|gb|ACF79169.1| unknown [Zea mays] >gi|414872896|tpg...   209   3e-52   
gi|256274452|gb|EEU09354.1| Rpl16bp [Saccharomyces cerevisiae JA...   209   3e-52   
gi|209967443|gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia...   209   4e-52   
gi|115455427|ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japo...   209   4e-52   
gi|255554134|ref|XP_002518107.1| 60S ribosomal protein L13a, put...   209   4e-52   
gi|510904606|ref|XP_004830849.1| 60S ribosomal protein L13, puta...   209   4e-52   
gi|168022463|ref|XP_001763759.1| predicted protein [Physcomitrel...   209   4e-52   
gi|223943487|gb|ACN25827.1| unknown [Zea mays] >gi|413933030|gb|...   209   4e-52   
gi|221123161|ref|XP_002162037.1| PREDICTED: 60S ribosomal protei...   209   5e-52   
gi|6093869|sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal p...   209   5e-52   
gi|115470251|ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japo...   208   5e-52   
gi|405123695|gb|AFR98459.1| ribosomal protein L13A [Cryptococcus...   208   5e-52   
gi|6093870|sp|Q91487.1|RL13A_SALTR RecName: Full=60S ribosomal p...   208   5e-52   
gi|242086701|ref|XP_002439183.1| hypothetical protein SORBIDRAFT...   208   6e-52   
gi|357115104|ref|XP_003559332.1| PREDICTED: 60S ribosomal protei...   208   6e-52   
gi|301121418|ref|XP_002908436.1| 60S ribosomal protein L13, puta...   208   6e-52   
gi|388493528|gb|AFK34830.1| unknown [Medicago truncatula]             208   7e-52   
gi|146416537|ref|XP_001484238.1| conserved hypothetical protein ...   208   8e-52   
gi|470103307|ref|XP_004288082.1| PREDICTED: 60S ribosomal protei...   208   8e-52   
gi|225433548|ref|XP_002268901.1| PREDICTED: 60S ribosomal protei...   207   8e-52   
gi|79313149|ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Ar...   207   9e-52   
gi|428177977|gb|EKX46854.1| large subunit ribosomal protein L13A...   207   9e-52   
gi|443895530|dbj|GAC72876.1| hypothetical protein PANT_7d00319 [...   207   9e-52   
gi|356555879|ref|XP_003546257.1| PREDICTED: 60S ribosomal protei...   207   1e-51   
gi|508702037|gb|EOX93933.1| Ribosomal protein L13 family protein...   207   1e-51   
gi|470122167|ref|XP_004297119.1| PREDICTED: 60S ribosomal protei...   207   1e-51   
gi|212275159|ref|NP_001130808.1| uncharacterized protein LOC1001...   207   1e-51   
gi|260943802|ref|XP_002616199.1| 60S ribosomal protein L16 [Clav...   207   1e-51   
gi|154284646|ref|XP_001543118.1| 60S ribosomal protein L16 [Ajel...   207   1e-51   
gi|462420385|gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551...   207   1e-51   
gi|297829258|ref|XP_002882511.1| structural constituent of ribos...   207   1e-51   
gi|465792444|emb|CCU97554.1| unnamed protein product [Malassezia...   207   1e-51   
gi|17554234|ref|NP_497721.1| Protein RPL-16 [Caenorhabditis eleg...   207   1e-51   
gi|365765070|gb|EHN06584.1| Rpl16ap [Saccharomyces cerevisiae x ...   207   1e-51   
gi|195628576|gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]     207   1e-51   
gi|323333123|gb|EGA74523.1| Rpl16ap [Saccharomyces cerevisiae AW...   207   1e-51   
gi|225712076|gb|ACO11884.1| 60S ribosomal protein L13A [Lepeopht...   207   1e-51   
gi|189484025|gb|ACE00306.1| L13a protein, partial [Caenorhabditi...   207   1e-51   
gi|302762086|ref|XP_002964465.1| hypothetical protein SELMODRAFT...   207   2e-51   
gi|367000311|ref|XP_003684891.1| 60S ribosomal protein L16 [Tetr...   206   2e-51   
gi|217070956|gb|ACJ83838.1| unknown [Medicago truncatula] >gi|38...   206   2e-51   
gi|397474919|ref|XP_003808903.1| PREDICTED: 60S ribosomal protei...   206   3e-51   
gi|465970379|ref|XP_004263334.1| PREDICTED: 60S ribosomal protei...   206   3e-51   
gi|357438209|ref|XP_003589380.1| 60S ribosomal protein L13a [Med...   206   3e-51   
gi|428164280|gb|EKX33312.1| large subunit ribosomal protein L13A...   205   4e-51   
gi|71725679|gb|AAZ38985.1| 60S ribosomal protein L13a, partial [...   205   4e-51   
gi|195623288|gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]     205   4e-51   
gi|226491882|ref|NP_001150028.1| 60S ribosomal protein L13a [Zea...   205   5e-51   
gi|168042299|ref|XP_001773626.1| predicted protein [Physcomitrel...   205   5e-51   
gi|395822490|ref|XP_003784550.1| PREDICTED: 60S ribosomal protei...   205   5e-51   
gi|472236054|gb|EMR80997.1| putative 60s ribosomal protein l16 p...   204   7e-51   
gi|119616692|gb|EAW96286.1| hCG27695, isoform CRA_a [Homo sapiens]    204   7e-51   
gi|443702039|gb|ELU00201.1| hypothetical protein CAPTEDRAFT_2208...   204   7e-51   
gi|157124310|ref|XP_001660415.1| 60S ribosomal protein L13a [Aed...   204   8e-51   
gi|223646376|gb|ACN09946.1| 60S ribosomal protein L13a [Salmo sa...   204   8e-51   
gi|125598870|gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryz...   204   9e-51   
gi|160948260|emb|CAO94731.1| putative ribosomal protein L13a [Po...   204   1e-50   
gi|148283608|gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]   204   1e-50   
gi|168026772|ref|XP_001765905.1| predicted protein [Physcomitrel...   203   2e-50   
gi|344231204|gb|EGV63086.1| hypothetical protein CANTEDRAFT_1143...   203   2e-50   
gi|330802565|ref|XP_003289286.1| ribosomal protein L13a [Dictyos...   203   2e-50   
gi|385302101|gb|EIF46249.1| 60s ribosomal protein l16-a [Dekkera...   203   3e-50   
gi|159469516|ref|XP_001692909.1| ribosomal protein L13a, compone...   202   3e-50   
gi|508713411|gb|EOY05308.1| Ribosomal protein L13 family protein...   202   3e-50   
gi|19113226|ref|NP_596434.1| 60S ribosomal protein L16 [Schizosa...   202   3e-50   
gi|71028758|ref|XP_764022.1| 60S ribosomal protein L13 [Theileri...   202   4e-50   
gi|473999607|gb|EMS52180.1| 60S ribosomal protein L13a-4 [Tritic...   202   5e-50   
gi|302843691|ref|XP_002953387.1| component of cytosolic 80S ribo...   202   5e-50   
gi|110456514|gb|ABG74718.1| putative 60S ribosomal protein L13A ...   202   5e-50   
gi|242020424|ref|XP_002430655.1| 60S ribosomal protein L13A, put...   202   5e-50   
gi|485629976|gb|EOD25270.1| hypothetical protein EMIHUDRAFT_4141...   201   6e-50   
gi|195658071|gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]     201   8e-50   
gi|148710103|gb|EDL42049.1| mCG18643 [Mus musculus]                   201   9e-50   
gi|326525309|dbj|BAK07924.1| predicted protein [Hordeum vulgare ...   201   9e-50   
gi|403364720|gb|EJY82133.1| Ribosomal protein L13 [Oxytricha tri...   201   1e-49   
gi|66819767|ref|XP_643542.1| S60 ribosomal protein L13a [Dictyos...   201   1e-49   
gi|193664668|ref|XP_001949629.1| PREDICTED: 60S ribosomal protei...   200   2e-49   
gi|156084640|ref|XP_001609803.1| ribosomal protein L13 [Babesia ...   200   2e-49   
gi|475514149|gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilo...   199   2e-49   
gi|291242297|ref|XP_002741044.1| PREDICTED: ribosomal protein rp...   199   3e-49   
gi|449018980|dbj|BAM82382.1| 60S ribosomal protein L13A [Cyanidi...   199   3e-49   
gi|56199502|gb|AAV84240.1| ribosomal protein L13 [Culicoides son...   199   5e-49   
gi|254573008|ref|XP_002493613.1| 60S ribosomal protein L16 [Koma...   199   5e-49   
gi|224065346|ref|XP_002301785.1| predicted protein [Populus tric...   197   1e-48   
gi|471227559|ref|XP_004034690.1| hypothetical protein IMG5_11590...   197   1e-48   
gi|3914535|sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal p...   197   2e-48   
gi|116781756|gb|ABK22228.1| unknown [Picea sitchensis] >gi|11678...   197   2e-48   
gi|118481501|gb|ABK92693.1| unknown [Populus trichocarpa] >gi|11...   196   2e-48   
gi|67624381|ref|XP_668473.1| 60S ribosomal protein L13a [Cryptos...   196   2e-48   
gi|66357740|ref|XP_626048.1| 60S ribosomal protein L13A [Cryptos...   196   3e-48   
gi|237838515|ref|XP_002368555.1| 60s ribosomal protein L13a, put...   196   3e-48   
gi|146181945|ref|XP_001023662.2| ribosomal protein L13 containin...   196   4e-48   
gi|403224075|dbj|BAM42205.1| 60S ribosomal protein L13 [Theileri...   196   4e-48   
gi|307109605|gb|EFN57843.1| hypothetical protein CHLNCDRAFT_1754...   195   5e-48   
gi|340536252|gb|AEK48263.1| ribosomal protein L13 [Cochliomyia h...   195   5e-48   
gi|358060830|dbj|GAA93601.1| hypothetical protein E5Q_00245 [Mix...   195   6e-48   
gi|353678066|sp|P0DJ15.1|RL13A_TETTS RecName: Full=60S ribosomal...   194   8e-48   
gi|401402638|ref|XP_003881298.1| hypothetical protein NCLIV_0433...   194   1e-47   
gi|294898838|ref|XP_002776400.1| 60S ribosomal protein L13A, put...   194   1e-47   
gi|303270921|ref|XP_003054822.1| predicted protein [Micromonas p...   193   2e-47   


>gi|384486984|gb|EIE79164.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
          Length = 202

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/194 (59%), Positives = 148/194 (76%), Gaps = 3/194 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+I+AK+ L+GQ+VVVVRCE +N+SG  FRNKLKY  +L KRC
Sbjct: 4   FEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRC 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
            VNP RGPFH R+PS+I ++ +RGMVPHKTARGAAAL ++K+FEG+P PYD++K      
Sbjct: 64  LVNPTRGPFHFRAPSRILYKAIRGMVPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPD 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T +GR+SHEVGWKYQD +  LE+KR  +++AY +RK ALA I +KA 
Sbjct: 124 ALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAV 183

Query: 186 E---QSNKEVTTPL 196
           E    S KEV T +
Sbjct: 184 ESKADSVKEVNTAI 197



>gi|384500502|gb|EIE90993.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
          Length = 202

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 148/194 (76%), Gaps = 3/194 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+I+AK+ L+GQ+VVVVRCE +N+SG  FRNKLKY  +L KRC
Sbjct: 4   FEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRC 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
            VNP RGPFH R+PS+I ++ +RGMVPHKTARGAAAL ++K+FEG+P PYD++K      
Sbjct: 64  LVNPTRGPFHFRAPSRILYKAIRGMVPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPD 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T +GR+SHEVGWKYQD +  LE+KR  +++AY +RK ALA I +KA 
Sbjct: 124 ALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAV 183

Query: 186 E---QSNKEVTTPL 196
           E    S KEV + +
Sbjct: 184 ESKADSVKEVNSAI 197



>gi|326432054|gb|EGD77624.1| ribosomal protein L13Ae [Salpingoeca sp. ATCC 50818]
          Length = 198

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 135/166 (81%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           +FE+R+VID +GHLLGRLA+IVAKEILSGQ VVVVRCE INISGS +RNKLKY++FL KR
Sbjct: 1   MFEKRIVIDARGHLLGRLASIVAKEILSGQHVVVVRCEQINISGSFYRNKLKYKEFLRKR 60

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
           CNVNPARGPFHLR+PS+IFWR VRGM+PHK A+GAAAL +LK FEG+PPPYDK+K     
Sbjct: 61  CNVNPARGPFHLRAPSRIFWRVVRGMLPHKKAKGAAALGRLKCFEGVPPPYDKVKRVVVP 120

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAY 170
                   +P R+F  VGRLSHE+GWKY+D ++ LE KR +RA  Y
Sbjct: 121 GALRVLRLRPDRKFCTVGRLSHEMGWKYKDIVEKLEAKRSMRAKEY 166



>gi|511008880|gb|EPB90135.1| 60S ribosomal protein L16 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 202

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 142/182 (78%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ V+IDGKGHLLGRLA+I++K+ L+GQ+VVVVRCE +N+SG  FRNKLKY  +L KRC
Sbjct: 4   FEKTVIIDGKGHLLGRLASIISKQALNGQKVVVVRCEALNVSGEFFRNKLKYHAYLNKRC 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
            VNP RGPFH R+PS+I ++ +RGMVPHKTARGAAAL ++K+FEG+P PYD++K      
Sbjct: 64  LVNPTRGPFHFRAPSRILYKAIRGMVPHKTARGAAALDRIKLFEGVPAPYDRMKRMVIPA 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T +GR+SHEVGWKYQD +  LE+KR  +++AY +RK ALA I +KA 
Sbjct: 124 ALRVLRLKPGRKYTTIGRISHEVGWKYQDVVAKLEEKRKAKSAAYYQRKSALAAIQKKAV 183

Query: 186 EQ 187
           E 
Sbjct: 184 ES 185



>gi|384486333|gb|EIE78513.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
          Length = 202

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 149/194 (76%), Gaps = 3/194 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+I++K+ L+GQ+VVVVRCE +N+SG  FRNKLKY  +L KRC
Sbjct: 4   FEKVVVIDGKGHLLGRLASIISKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRC 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
            VNP RGPFH R+PS+I ++ +RGM+PHKTARGAAAL ++K+FEG+P PYD++K      
Sbjct: 64  LVNPTRGPFHFRAPSRILYKAIRGMIPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPD 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T +GR+SHEVGWKYQD +  LE+KR  +++AY +RK ALA I +KA 
Sbjct: 124 ALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAV 183

Query: 186 E---QSNKEVTTPL 196
           E   +S KE+ + +
Sbjct: 184 EAKAESVKEINSSI 197



>gi|470509002|ref|XP_004349662.1| ribosomal protein L13, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440801556|gb|ELR22573.1| ribosomal protein L13, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 204

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/193 (62%), Positives = 145/193 (75%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDG+GHLLGRLA+IVAK+IL+GQR+VVVRCE IN+SGS FRNKLKY  FL K  NV P
Sbjct: 10  LVIDGRGHLLGRLASIVAKQILNGQRLVVVRCEEINVSGSFFRNKLKYLSFLKKCSNVRP 69

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
             GP+H R+PSKIFWRTVRGMV HKTARGA AL +LKVFEG+PPPYDK+K          
Sbjct: 70  THGPYHYRAPSKIFWRTVRGMVAHKTARGAEALGRLKVFEGVPPPYDKMKRMVCPAALRV 129

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KPGR +TV+GRLS EVGWK+  T+K LE+KR VR++AY ERKKALA++  KA     
Sbjct: 130 LRLKPGRAYTVIGRLSEEVGWKHAATVKKLEEKRKVRSAAYYERKKALARLQTKALANRT 189

Query: 190 KEVTTPLLQKTGY 202
           +++   L   T Y
Sbjct: 190 EQLKPVLETLTAY 202



>gi|511009345|gb|EPB90589.1| 60S ribosomal protein L16 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 202

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ +VID KGHLLGRLA+I+AK+ L+GQ+VVVVRCE +N+SG  FRNKLKY  +L KRC
Sbjct: 4   FEKTLVIDSKGHLLGRLASIIAKQALNGQKVVVVRCEALNVSGEFFRNKLKYHAYLNKRC 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
            VNP RGPFH R+PS+I ++ +RGM+PHKTARGAAAL ++K+FEG+P PYD++K      
Sbjct: 64  LVNPTRGPFHFRAPSRILYKAIRGMIPHKTARGAAALDRIKLFEGVPAPYDRMKRMVIPA 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T +GR+SHEVGWKYQD +  LE+KR  +++AY +RK ALA I +KA 
Sbjct: 124 ALRVLRLKPGRKYTTIGRISHEVGWKYQDVVAKLEEKRKAKSAAYYQRKTALAAIQKKAV 183

Query: 186 EQ 187
           E 
Sbjct: 184 ES 185



>gi|61654640|gb|AAX48846.1| L13a [Suberites domuncula]
          Length = 199

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 143/191 (74%), Gaps = 5/191 (2%)

Query: 8   RRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNV 67
           R+V+IDGKGHLLGRLA+IVAK IL GQR+V+VRCE INISGS +RNKLKY  FL  RCNV
Sbjct: 2   RQVLIDGKGHLLGRLASIVAKCILQGQRIVIVRCEDINISGSFYRNKLKYLKFLNLRCNV 61

Query: 68  NPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXX 127
           NP RGPFH R+PS+IFWRTVRGMVPHKT RG  AL++LKVFEGIPPPYDK K        
Sbjct: 62  NPKRGPFHFRAPSRIFWRTVRGMVPHKTKRGMEALNRLKVFEGIPPPYDKQKRMVVPNAL 121

Query: 128 XXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQ 187
                KPGR++  +GR+SHE+GWKY+D +K LE+KR  RA+ + +RKK + +   KA   
Sbjct: 122 RVLRLKPGRKYCDIGRISHEIGWKYKDVVKTLEEKRKARATEFYQRKKQVLRFKAKA--- 178

Query: 188 SNKEVTTPLLQ 198
             ++V  P L+
Sbjct: 179 --EDVCKPRLE 187



>gi|196006053|ref|XP_002112893.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190584934|gb|EDV25003.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 202

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/181 (63%), Positives = 135/181 (74%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M FE+ ++IDG+ HLLGRLA+ +AK ILSGQRVVVVRCE +NISG  +RNKLKY DFL K
Sbjct: 1   MGFEKAIIIDGRNHLLGRLASTIAKTILSGQRVVVVRCEELNISGGFYRNKLKYLDFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           RCNVNP RGPFH R+PS+I WRTVRGMVPHKT RG  AL++LK FEGIP PYDK+K    
Sbjct: 61  RCNVNPRRGPFHFRAPSRILWRTVRGMVPHKTKRGEEALNRLKTFEGIPAPYDKMKRLVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KP R+FTVVG+LS EVGWKY D I  LE+KR  +A A+ E K+ L K  R+
Sbjct: 121 PAALRVVQLKPRRKFTVVGKLSSEVGWKYNDIISTLEEKRKAKAKAFYENKRRLQKFKRE 180

Query: 184 A 184
           A
Sbjct: 181 A 181



>gi|167535340|ref|XP_001749344.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772210|gb|EDQ85865.1| predicted protein [Monosiga brevicollis MX1]
          Length = 203

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (76%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           ++  FE+++VIDG+GHLLGRLA+IVAK+IL+GQ VVVVR EL+ ISGS +RNKLKY++FL
Sbjct: 1   MSCSFEKQIVIDGRGHLLGRLASIVAKQILNGQNVVVVRSELLQISGSFYRNKLKYKEFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PS+IFWR VRGMVPHKT RGA AL +LKVFEG+P PYDKIK  
Sbjct: 61  RKRCNVNPARGPFHFRAPSRIFWRVVRGMVPHKTPRGAEALKRLKVFEGVPSPYDKIKKM 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KP R+F  V RLS E GW+Y+D ++ LE KR  +A+ Y  +KK LA + 
Sbjct: 121 VVPEALKVIRLKPERKFCTVQRLSAEFGWRYKDIVETLEDKRRAKAAEYYTQKKKLAALR 180

Query: 182 RKA 184
           RKA
Sbjct: 181 RKA 183



>gi|161661015|gb|ABX75375.1| 60S ribosomal protein L13A [Lycosa singoriensis]
          Length = 205

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   E+ +VIDG+GHLLGRLAA+ AK +L+GQ+VVVVRCE INISGS FR+KLKY  FL
Sbjct: 1   MTGFSEKAIVIDGRGHLLGRLAALTAKTLLNGQKVVVVRCEGINISGSFFRSKLKYLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKIFWRTVRGM+PHKT RG AAL +LK FEGIPPPYDK K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKIFWRTVRGMLPHKTKRGEAALDRLKAFEGIPPPYDKKKRM 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                       P R++  + RLSHEVGWKYQ+ I  LE KR  +AS +  RKK   KI 
Sbjct: 121 VVPSALRVLKLHPRRKYCSLSRLSHEVGWKYQNVISTLELKRKAKASVFYARKKRDEKIK 180

Query: 182 RKAYEQSNK--EVTTPLLQKTGY 202
           + A E+  K  E    +LQ  GY
Sbjct: 181 QLAVEKVAKLIEPHRKILQSYGY 203



>gi|469664413|gb|AGH70161.1| 60S ribosomal protein L13a [Placozoa sp. H4]
          Length = 201

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 140/191 (73%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M FE+ ++IDG+ HLLGRLA+ +AK ILSGQRVVVVRCEL+NISG  +RNKLKY DFL K
Sbjct: 1   MGFEKAIIIDGRDHLLGRLASAIAKTILSGQRVVVVRCELLNISGGFYRNKLKYLDFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           RCNVNP RGPFH R+PS+I WRTVRGMVPHKT RG  AL++LK FEGIP PYDK+K    
Sbjct: 61  RCNVNPKRGPFHFRAPSRILWRTVRGMVPHKTKRGEEALNRLKAFEGIPAPYDKMKRMVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KP R+FTV+G+LS EVGWKY + I  LE+KR  +A A+ E K+ + K  R+
Sbjct: 121 PAALRVVRLKPRRKFTVLGKLSGEVGWKYGEIISTLEEKRKAKAKAFYEHKRKIQKCRRE 180

Query: 184 AYEQSNKEVTT 194
           A  +   ++ +
Sbjct: 181 AEAEKADQLKS 191



>gi|156377756|ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gi|156217840|gb|EDO38749.1| predicted protein [Nematostella vectensis]
          Length = 201

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 142/199 (71%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M FE+++VIDG GHLLGRLA+ VAK ILSGQRVVVVRCE I ISG+ +RNKLKY DFL K
Sbjct: 1   MGFEKQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           R N  P+ GPFH R+PS+IFWRTVRGM+PHKT +G  A++++KVF+G+PPPYDK K    
Sbjct: 61  RTNTKPSHGPFHFRAPSRIFWRTVRGMIPHKTKKGTEAMNRMKVFDGVPPPYDKEKRMVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR+F V+GRLSHEVGWKYQD ++ LE+KR  ++  Y E KK + K+ + 
Sbjct: 121 PSALKVIRLKPGRKFCVLGRLSHEVGWKYQDILETLEEKRKAKSKLYFEHKKKVQKLKQT 180

Query: 184 AYEQSNKEVTTPLLQKTGY 202
           A      E+ +      GY
Sbjct: 181 AELNKADELKSVNKTLAGY 199



>gi|197210359|gb|ACH48187.1| 60S ribosomal protein L13a [Haplopelma schmidti]
          Length = 205

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 142/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   E+  VIDG+GHLLGRLAAIVAK +L GQRVVVVRCE INISGS FRNKLKY  FL
Sbjct: 1   MTGFTEKATVIDGQGHLLGRLAAIVAKTLLIGQRVVVVRCEGINISGSFFRNKLKYLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGP+H R+P KIFWRTVRGM+PHKT RG  AL +LKV+EGIPPPYDK K  
Sbjct: 61  RKRCNVNPARGPYHFRAPGKIFWRTVRGMLPHKTKRGDTALERLKVYEGIPPPYDKKKRM 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                       P R++  + RLSHEVGWKYQ+ I  LE KR  +A+AY  +KK   K+ 
Sbjct: 121 VVPSALRVLKLHPRRKYCSLSRLSHEVGWKYQNVISTLEMKRKAKAAAYYGKKKKDQKLI 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
             A E+  K ++    +L+  GY
Sbjct: 181 ELAKEKVAKRISPHKEVLRSFGY 203



>gi|340514499|gb|EGR44761.1| ribosomal protein L16, L13 family [Trichoderma reesei QM6a]
          Length = 202

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 117/199 (58%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK-ITRK 183
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+ +T  
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLTDA 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
               S KE T   L   GY
Sbjct: 184 KKNASVKEETAKALAAYGY 202



>gi|242784707|ref|XP_002480444.1| 60S ribosomal protein L16 [Talaromyces stipitatus ATCC 10500]
 gi|218720591|gb|EED20010.1| ribosomal protein L16a [Talaromyces stipitatus ATCC 10500]
          Length = 202

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 135/173 (78%), Gaps = 1/173 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKAT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKAL 177
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA+
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSSAYYERKKAI 176



>gi|212527810|ref|XP_002144062.1| 60S ribosomal protein L16 [Talaromyces marneffei ATCC 18224]
 gi|210073460|gb|EEA27547.1| ribosomal protein L16a [Talaromyces marneffei ATCC 18224]
          Length = 202

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 135/173 (78%), Gaps = 1/173 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKAT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKAL 177
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA+
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSSAYYERKKAI 176



>gi|457867069|emb|CCQ18645.1| 60S ribosomal protein L13a [Sycon ciliatum]
          Length = 201

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 142/198 (71%), Gaps = 5/198 (2%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           MVFER ++IDG+ HLLGRLA+ +AK +LSGQRVVVVRCE INISGS +RNKLKY  +L  
Sbjct: 1   MVFERLILIDGRNHLLGRLASTIAKALLSGQRVVVVRCEEINISGSFYRNKLKYLKYLRL 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           RCNV P+RGPFH R+PSK+  R VRGM+PHK+ RGAAA+ +LKVFEG+PPPYD++K    
Sbjct: 61  RCNVKPSRGPFHFRAPSKMLVRVVRGMIPHKSVRGAAAMKRLKVFEGVPPPYDQMKKMVI 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    +PGR+F  +GR++HEVGWKYQD +  LE+KR  +A  Y E KK   KI R+
Sbjct: 121 PSALRVIRLRPGRKFCRLGRIAHEVGWKYQDVVSTLEEKRKAKALVYYENKK---KILRR 177

Query: 184 AYEQSNKEVT--TPLLQK 199
                 +E T   PL Q+
Sbjct: 178 KAAAEKREATKLAPLNQQ 195



>gi|91082991|ref|XP_974304.1| PREDICTED: similar to ribosomal protein L13a [Tribolium castaneum]
 gi|270007030|gb|EFA03478.1| hypothetical protein TcasGA2_TC013477 [Tribolium castaneum]
          Length = 204

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 144/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   E+ ++IDG+GHLLGRLA IVAK +L G +V++VRCE +NISG+ +RNKLKY  FL
Sbjct: 1   MTGFSEKAILIDGRGHLLGRLATIVAKTLLEGNKVIIVRCEQLNISGNFYRNKLKYLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PS+IFW+TVRGM+PHKT RG  AL +LK +EG+PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSRIFWKTVRGMLPHKTERGKQALRRLKTYEGVPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR+F  VGRLSHEVGWKYQ  ++ LE KR V+A     ++  L K+T
Sbjct: 121 VVPGALRVICLKPGRKFCHVGRLSHEVGWKYQSVVRTLESKRKVKAVLSIRKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A  +  K+V   T ++   GY
Sbjct: 181 KEASTKVAKQVAPFTAVINSYGY 203



>gi|358381799|gb|EHK19473.1| hypothetical protein TRIVIDRAFT_111666 [Trichoderma virens Gv29-8]
          Length = 202

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK-ITRK 183
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+ +T  
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLTDA 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
               S KE T   L   GY
Sbjct: 184 KKNASVKEETAKALAAYGY 202



>gi|46110435|ref|XP_382275.1| RL16_NEUCR 60S ribosomal protein L16 [Fusarium graminearum PH-1]
 gi|408400127|gb|EKJ79212.1| hypothetical protein FPSE_00523 [Fusarium pseudograminearum CS3096]
          Length = 202

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+IVAK++LSGQ++V+VRCE +NISG  FR KLKY   L K  
Sbjct: 4   FEQVVVIDGKGHLLGRLASIVAKQLLSGQKIVIVRCEALNISGEFFRAKLKYHAHLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKTKKVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR+F  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+    A
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKIAARQLADA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +  KE T+  L   GY
Sbjct: 184 KKNATVKEETSKALANYGY 202



>gi|156544548|ref|XP_001607858.1| PREDICTED: 60S ribosomal protein L13a-like [Nasonia vitripennis]
          Length = 204

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   E+ ++IDG+GHLLGRLAAI+AK IL G RV+VVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSEKPILIDGRGHLLGRLAAIIAKTILQGNRVIVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LK +EG PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKTYEGCPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  ++ LE KR V++    +++  L K+T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVKSIVEVQKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A E   K+    T ++   GY
Sbjct: 181 KQAGEAVAKQTAPYTQIINSFGY 203



>gi|358400158|gb|EHK49489.1| hypothetical protein TRIATDRAFT_297491 [Trichoderma atroviride IMI
           206040]
          Length = 202

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VV+DGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+    A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLSDA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + ++ KE T   L   GY
Sbjct: 184 KKNASVKEETAKALAAYGY 202



>gi|158187860|gb|ABW23219.1| ribosomal protein rpl13a [Eurythoe complanata]
          Length = 202

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 136/184 (73%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M   + +VID +GH+LGRLA+IVAK IL GQ VV+VRCE INISG+ +RNKLKY DFL K
Sbjct: 1   MGLTKPIVIDARGHMLGRLASIVAKTILQGQNVVIVRCEGINISGNFYRNKLKYLDFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           RCN  P+RGP+H R+PSKIFWRTVRGM+PHK  RG  AL ++KVFEGIPPPYDK K    
Sbjct: 61  RCNTKPSRGPYHYRAPSKIFWRTVRGMLPHKLKRGKEALDRMKVFEGIPPPYDKEKRMVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KP R+F V+GRLSHEVGWKYQ+ I  LE KR V++  + E++K + K+ ++
Sbjct: 121 PAALKVLRVKPRRKFCVLGRLSHEVGWKYQNVIATLEAKRKVKSKKFYEKRKNVEKLKKQ 180

Query: 184 AYEQ 187
           A E+
Sbjct: 181 ATEK 184



>gi|367025231|ref|XP_003661900.1| hypothetical protein MYCTH_2314728 [Myceliophthora thermophila ATCC
           42464]
 gi|347009168|gb|AEO56655.1| hypothetical protein MYCTH_2314728 [Myceliophthora thermophila ATCC
           42464]
          Length = 202

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 143/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKAT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD ++ LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVERLEERRKAKGAAYYERKKLAARQLSEA 183

Query: 185 YEQSNKEV-TTPLLQKTGY 202
            + +  +  T   LQ  GY
Sbjct: 184 KKTAKVDPKTAEALQAYGY 202



>gi|494826410|gb|EON63492.1| 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218]
          Length = 202

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 115/200 (57%), Positives = 142/200 (71%), Gaps = 2/200 (1%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKYQ F+ K+
Sbjct: 3   TFEPIVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYQAFMRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARGAAA+ +LK FEGIPPPYD  K    
Sbjct: 63  TRFNPTRGGPFHFRAPSKMFWRTVRGMMPHKTARGAAAMERLKTFEGIPPPYDHKKRMVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKA  +   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAE 182

Query: 184 AYEQSN-KEVTTPLLQKTGY 202
           A + ++  E T   L + GY
Sbjct: 183 AQKSASVDEKTKTQLAEYGY 202



>gi|264667421|gb|ACY71296.1| ribosomal protein L13A [Chrysomela tremula]
          Length = 204

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   E+ ++IDG+GHLLGRLAAIV+K +L G +V VVRCE +NISG+ +RNKLK+  FL
Sbjct: 1   MTGFSEKAILIDGRGHLLGRLAAIVSKTLLQGNKVTVVRCEQLNISGNFYRNKLKFLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PS+IFW+TVRGM+PHKT RG  AL +LK +EGIPPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSRIFWKTVRGMLPHKTERGKQALRRLKAYEGIPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKYQ  ++ LE KR V+A     ++  L KIT
Sbjct: 121 VVPGALRVICLKPGRKYCHVGRLSHEVGWKYQSVVRTLESKRKVKAVLSIRKRDKLKKIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           + A E+  K+    T ++   GY
Sbjct: 181 KAASEKVAKKTQPFTAVINSYGY 203



>gi|169844141|ref|XP_001828792.1| 60S ribosomal protein L16 [Coprinopsis cinerea okayama7#130]
 gi|116510163|gb|EAU93058.1| ribosomal protein L16a [Coprinopsis cinerea okayama7#130]
          Length = 200

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 114/194 (58%), Positives = 144/194 (74%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IV+K+ILSGQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIVSKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLNKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAIKLRQKA--TA 186

Query: 189 NKEVTTPLLQKTGY 202
           +   + P L + GY
Sbjct: 187 DNSSSFPQLTQLGY 200



>gi|116198555|ref|XP_001225089.1| 60S ribosomal protein L16 [Chaetomium globosum CBS 148.51]
 gi|88178712|gb|EAQ86180.1| 60S ribosomal protein L16 [Chaetomium globosum CBS 148.51]
          Length = 202

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++V+VRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVIVRCEDLNISGEFFRAKLKYHAYLRKAT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKLAARQLSEA 183

Query: 185 YEQSNKEV-TTPLLQKTGY 202
            + +  +  T+  LQ  GY
Sbjct: 184 KKTAKVDTKTSEALQAFGY 202



>gi|406867770|gb|EKD20808.1| 60S ribosomal protein L13 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 202

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  + IDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FENVITIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHK+ARGAAA+ +LKVFEG+PPPYDK+K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKSARGAAAMERLKVFEGVPPPYDKVKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ +AY +RKKA  +    A
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGAAYYQRKKAARRQLSDA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +N  E T   L + GY
Sbjct: 184 QKSANVDEKTKTQLAEYGY 202



>gi|451847125|gb|EMD60433.1| hypothetical protein COCSADRAFT_184241 [Bipolaris sorokiniana
           ND90Pr]
 gi|451997948|gb|EMD90413.1| hypothetical protein COCHEDRAFT_1225895 [Bipolaris maydis C5]
 gi|477592304|gb|ENI09375.1| hypothetical protein COCC4DRAFT_187061 [Bipolaris maydis ATCC
           48331]
          Length = 202

 Score =  232 bits (591), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/191 (58%), Positives = 138/191 (72%), Gaps = 1/191 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARGAAA+ +LK FEGIP PYDK K    
Sbjct: 63  TRFNPTRGGPFHFRAPSKMFWRTVRGMIPHKTARGAAAMERLKTFEGIPAPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKAL +   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAE 182

Query: 184 AYEQSNKEVTT 194
           A + +N +  T
Sbjct: 183 AKKTANVDSKT 193



>gi|256087799|ref|XP_002580051.1| 60S ribosomal protein L13a [Schistosoma mansoni]
 gi|360045055|emb|CCD82603.1| putative 60s ribosomal protein L13a [Schistosoma mansoni]
          Length = 203

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 150/203 (73%), Gaps = 5/203 (2%)

Query: 4   MVFERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLT 62
           M F+++ ++ID +GHLLGRLA++VAK +L+GQ+VVVVRCE INISGS +RNKLKY DFL 
Sbjct: 1   MSFQKKPIIIDAQGHLLGRLASVVAKTLLNGQKVVVVRCESINISGSFYRNKLKYLDFLR 60

Query: 63  KRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXX 122
           KR N NP+RGP+H R+P+KIFWRTVRGM+PHK  RG  AL KLKVFEGIPPPYDK K   
Sbjct: 61  KRMNTNPSRGPYHFRAPAKIFWRTVRGMLPHKLHRGKQALDKLKVFEGIPPPYDKKKRMV 120

Query: 123 XXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITR 182
                     KPGR+F+V+ RLS++VGWKY++ I+ +E +R  +A+ + +RKK L K + 
Sbjct: 121 VPSALRAIRLKPGRKFSVLSRLSNDVGWKYKNIIEKMENRRKAKAAVWYKRKKLLKKPSE 180

Query: 183 KAYEQSNKEVTTP---LLQKTGY 202
            A  ++ KE   P   +L++ GY
Sbjct: 181 AARGRA-KEAIAPYQAILKQYGY 202



>gi|340371027|ref|XP_003384047.1| PREDICTED: 60S ribosomal protein L13a-like [Amphimedon
           queenslandica]
          Length = 202

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M F++ +++D K HLLGRLA+IVAK++L+GQ++V++RCE INISGS +RNK+KY  FL  
Sbjct: 1   MGFQKVIIVDAKDHLLGRLASIVAKQLLNGQKIVILRCEYINISGSIYRNKVKYLKFLRL 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           RCNV P+RGPFH R+PSKIFWRTVRGM+PHKT RG AAL +L V+EGIPP Y K K    
Sbjct: 61  RCNVKPSRGPFHFRAPSKIFWRTVRGMLPHKTERGKAALGRLSVYEGIPPMYIKKKRVVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR+F V+GRLSHEVGWKY+D +K LE+KR  R + Y E+K  LA++  +
Sbjct: 121 PQALRILRLKPGRKFCVLGRLSHEVGWKYRDVMKTLEEKRQAREAIYYEKKIKLARLRTR 180

Query: 184 AYEQSNKEVT 193
           A + +  ++ 
Sbjct: 181 ATKDAQPKIA 190



>gi|302897600|ref|XP_003047678.1| 60S ribosomal protein L16 [Nectria haematococca mpVI 77-13-4]
 gi|256728609|gb|EEU41965.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 202

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 117/199 (58%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY   L K  
Sbjct: 4   FEQVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAHLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE +R  +A+AY ERKK  A+    A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDIVGRLEDRRKAKAAAYYERKKIAARQLSDA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +  K+ TT  L   GY
Sbjct: 184 KKTAAVKDETTKALAAFGY 202



>gi|289472558|gb|ADC97464.1| putative 60S ribosomal protein L13a [Amblyomma maculatum]
          Length = 203

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 139/188 (73%), Gaps = 1/188 (0%)

Query: 6   FERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           F R+ +VIDG+GHLLGRL+A+VAK +L GQ+VVVVRCE I ISGS FRNKLKY  FL KR
Sbjct: 4   FSRKPLVIDGQGHLLGRLSALVAKTLLHGQKVVVVRCEGICISGSFFRNKLKYLSFLRKR 63

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
           CNVNPARGP+H R+PSKI WRTVRGM+PHKT RG+ AL +LK+FEG+PPPY + K     
Sbjct: 64  CNVNPARGPYHFRAPSKILWRTVRGMLPHKTKRGSLALDRLKMFEGVPPPYHRTKRMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                    P RR+  +GRL HEVGWKYQ  I++LE KR  +++ Y + KKA  K+  KA
Sbjct: 124 SALRVLRLNPRRRYCTLGRLGHEVGWKYQSVIESLELKRKAKSALYYKAKKADRKLLAKA 183

Query: 185 YEQSNKEV 192
            E S+K+V
Sbjct: 184 KELSSKQV 191



>gi|425769666|gb|EKV08153.1| Ribosomal protein L16a [Penicillium digitatum Pd1]
 gi|425771256|gb|EKV09704.1| Ribosomal protein L16a [Penicillium digitatum PHI26]
          Length = 202

 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+I ++ +RGM+PHKTARGAAAL +LKVFEGIPPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVFEGIPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R V++ AY ERKKA  ++  KA
Sbjct: 124 QALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYERKKAARRVLAKA 183

Query: 185 YEQSNKEVTTPL-LQKTGY 202
            + +N +  T   L + GY
Sbjct: 184 EQGANVDSKTKTQLAQFGY 202



>gi|429856676|gb|ELA31573.1| 60s ribosomal protein l16 [Colletotrichum gloeosporioides Nara gc5]
          Length = 202

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VV+DGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPPPYDKQKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKK-ALAKITRK 183
                   +PGR+F  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK A  +IT  
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAQRQITDA 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
                  + T   L+  GY
Sbjct: 184 KKNAKVDQKTAQALEAFGY 202



>gi|367038147|ref|XP_003649454.1| 60S ribosomal protein L16 [Thielavia terrestris NRRL 8126]
 gi|346996715|gb|AEO63118.1| hypothetical protein THITE_70134 [Thielavia terrestris NRRL 8126]
          Length = 202

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 133/175 (76%), Gaps = 1/175 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                   +PGR++  VGRLSHEVGWKYQD ++ LE++R  + +AY ERKK  A+
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVERLEERRKAKGAAYYERKKLAAR 178



>gi|261197579|ref|XP_002625192.1| 60S ribosomal protein L16 [Ajellomyces dermatitidis SLH14081]
 gi|239595822|gb|EEQ78403.1| 60S ribosomal protein L16 [Ajellomyces dermatitidis SLH14081]
 gi|239606819|gb|EEQ83806.1| 60S ribosomal protein L13 [Ajellomyces dermatitidis ER-3]
 gi|327351288|gb|EGE80145.1| 60S ribosomal protein L16-B [Ajellomyces dermatitidis ATCC 18188]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 144/199 (72%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHK+ARGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKSARGAAAMERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA  +   +A
Sbjct: 124 QALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLVQA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +N  + T   L + GY
Sbjct: 184 QKTANVDQKTKAQLAEYGY 202



>gi|240281531|gb|EER45034.1| 60S ribosomal protein L13a [Ajellomyces capsulatus H143]
 gi|325087677|gb|EGC40987.1| 60S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 144/199 (72%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHK+ARGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKSARGAAAMERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA  +   +A
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLVQA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +N  + T   L + GY
Sbjct: 184 QKTANVDQKTKTQLAEYGY 202



>gi|485924264|gb|EOD49135.1| putative 60s ribosomal protein l16 protein [Neofusicoccum parvum
           UCRNP2]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 142/197 (72%), Gaps = 3/197 (1%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARGAAA+ +LK FEGIP PYD +K    
Sbjct: 63  TRYNPTRGGPFHFRAPSKMFWRTVRGMIPHKTARGAAAMERLKTFEGIPQPYDHMKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKAL +   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKALRRSLGE 182

Query: 184 AYEQS--NKEVTTPLLQ 198
           A + +  N++V T L +
Sbjct: 183 AQKTAKVNEKVKTQLAE 199



>gi|255935209|ref|XP_002558631.1| Pc13g01870 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583251|emb|CAP91256.1| Pc13g01870 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+I ++ +RGM+PHKTARGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRILYKAIRGMIPHKTARGAAAMERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R V++ AY ERKKA  ++  KA
Sbjct: 124 QALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYERKKAARRVLAKA 183

Query: 185 YEQSNKEVTTPL-LQKTGY 202
            + +N +  T   L + GY
Sbjct: 184 EQGANVDSKTKTQLAQYGY 202



>gi|500255353|gb|EON98747.1| putative 60s ribosomal protein l16 protein [Togninia minima UCRPA7]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD ++ LE++R  + +AY ERKK   +   +A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVERLEERRKAKGAAYYERKKLAQRQLSEA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   + T   L+  GY
Sbjct: 184 KKNTKVDKKTASALESYGY 202



>gi|440640148|gb|ELR10067.1| 60S ribosomal protein L16 [Geomyces destructans 20631-21]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/173 (61%), Positives = 131/173 (75%), Gaps = 1/173 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE+ + IDGKGHLLGRLA+ VAK++L GQ++VVVRCE +NISG  FR KLKY  +L K 
Sbjct: 3   TFEQVITIDGKGHLLGRLASTVAKQLLEGQKIVVVRCEALNISGEFFRAKLKYHAYLRKM 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEG+P PYDK+K    
Sbjct: 63  TRYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPAPYDKVKRMVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                    KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKA 175



>gi|402081475|gb|EJT76620.1| 60S ribosomal protein L16 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 202

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKK-ALAKITRK 183
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK A  +++  
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKLAQRQVSES 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
               +  E T   L+  GY
Sbjct: 184 KKNATVDEKTAEALKAYGY 202



>gi|260791482|ref|XP_002590758.1| hypothetical protein BRAFLDRAFT_280074 [Branchiostoma floridae]
 gi|229275954|gb|EEN46769.1| hypothetical protein BRAFLDRAFT_280074 [Branchiostoma floridae]
          Length = 204

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 134/189 (70%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M   + ++ID   HLLGRLAA+VAK IL GQ++VVVRCE INISGS +RNKLKY +FL K
Sbjct: 1   MAVGKVLIIDANNHLLGRLAAVVAKSILQGQKIVVVRCEGINISGSFYRNKLKYLEFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           R N  P+RGPFHLR+PS+IFWRTVRGM+PHKT RGA AL +LKVFEGIPPPYDK K    
Sbjct: 61  RTNTKPSRGPFHLRAPSRIFWRTVRGMLPHKTTRGAQALERLKVFEGIPPPYDKQKRLVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                     P RRF  +GRLSHEVGWKY++ +  LE KR  RA  Y + KK   K+  +
Sbjct: 121 PSALRVIRLMPNRRFCSLGRLSHEVGWKYKEVVDTLEAKRSARAKLYWQNKKKTMKMRTQ 180

Query: 184 AYEQSNKEV 192
           A +  +K++
Sbjct: 181 AMQNLSKKL 189



>gi|399169320|emb|CCE29838.1| probable ribosomal protein l13a [Claviceps purpurea 20.1]
          Length = 203

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           ++  FE  VV+DGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FR KLKY  +L
Sbjct: 1   MSSSFEPVVVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYL 60

Query: 62  TKRCNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKX 120
            K    NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYD  K 
Sbjct: 61  RKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDTQKK 120

Query: 121 XXXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKI 180
                       +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+ 
Sbjct: 121 MVVPQALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQ 180

Query: 181 TRKAYEQSN-KEVTTPLLQKTGY 202
              A + ++ K  TT  L   GY
Sbjct: 181 LSDAKKNASVKAETTKALASFGY 203



>gi|171692595|ref|XP_001911222.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946246|emb|CAP73047.1| unnamed protein product [Podospora anserina S mat+]
          Length = 202

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQQIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKLAARQLSEA 183

Query: 185 YEQSNKEV-TTPLLQKTGY 202
            + +  +  TT  L   GY
Sbjct: 184 KKTAKVDSKTTEALAAFGY 202



>gi|353237126|emb|CCA69106.1| probable ribosomal protein L13a [Piriformospora indica DSM 11827]
          Length = 200

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 142/194 (73%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDGKGHLLGRLA+I+AK+ILSGQ++ VVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IIIDGKGHLLGRLASIIAKQILSGQKITVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R VRGM+PHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAVRGMIPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A+A+ ERK A AK+ +KA+   
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAAAFYERKLAAAKLRQKAHADH 188

Query: 189 NKEVTTPLLQKTGY 202
           +       L   GY
Sbjct: 189 SSSYAE--LSNLGY 200



>gi|295670798|ref|XP_002795946.1| 60S ribosomal protein L16 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284079|gb|EEH39645.1| 60S ribosomal protein L16 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226288713|gb|EEH44225.1| 60S ribosomal protein L16 [Paracoccidioides brasiliensis Pb18]
          Length = 202

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 144/199 (72%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHK++RGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKSSRGAAAMERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA  +   +A
Sbjct: 124 QALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAQA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +N  + T   L + GY
Sbjct: 184 QKTANVDQKTKDQLAEYGY 202



>gi|310769831|gb|ADP21473.1| ribosomal protein L13A [Antheraea yamamai]
          Length = 204

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G RVVVVRCE INISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNRVVVVRCEQINISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG +AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRSYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY++ ++ LE KR V+A      ++ L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKVKAVRQISYERKLKKIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A E+  K     T ++Q  GY
Sbjct: 181 KEAGEKVAKATAPFTTIVQSYGY 203



>gi|31340318|sp|Q962U0.1|RL13A_SPOFR RecName: Full=60S ribosomal protein L13a
 gi|15213762|gb|AAK92156.1|AF400184_1 ribosomal protein L13A [Spodoptera frugiperda]
 gi|288226777|gb|ADC44873.1| 60S ribosomal protein L13a [Spodoptera littoralis]
          Length = 204

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE INISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG +AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR V++      +K L +IT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLENKRKVKSVKLMAYEKKLKRIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           +++ E+  K     T ++Q  GY
Sbjct: 181 KESGEKVAKTTAPFTAVIQSYGY 203



>gi|340905182|gb|EGS17550.1| 60S ribosomal protein L16-like protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 204

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 132/175 (75%), Gaps = 1/175 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKLAAR 178



>gi|225681570|gb|EEH19854.1| 60S ribosomal protein L16-B [Paracoccidioides brasiliensis Pb03]
          Length = 270

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 144/200 (72%), Gaps = 2/200 (1%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K 
Sbjct: 71  TFEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKI 130

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PS+IF++ VRGM+PHK++RGAAA+ +LKVFEG+PPPYDK K    
Sbjct: 131 TRFNPTRGGPFHFRAPSRIFYKAVRGMIPHKSSRGAAAMERLKVFEGVPPPYDKKKRVVV 190

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA  +   +
Sbjct: 191 PQALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAQ 250

Query: 184 AYEQSN-KEVTTPLLQKTGY 202
           A + +N  + T   L + GY
Sbjct: 251 AQKTANVDQKTKDQLAEYGY 270



>gi|407924252|gb|EKG17306.1| Ribosomal protein L13 eukaryotic/archaeal [Macrophomina phaseolina
           MS6]
          Length = 202

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 130/174 (74%), Gaps = 1/174 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARGAAA+ +LK FEG+P PYD +K    
Sbjct: 63  TRYNPTRGGPFHFRAPSKMFWRTVRGMIPHKTARGAAAMERLKTFEGVPQPYDHMKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKAL 177
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKAL
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVSRLEERRKVKGAAYYERKKAL 176



>gi|258576693|ref|XP_002542528.1| 60S ribosomal protein L16 [Uncinocarpus reesii 1704]
 gi|237902794|gb|EEP77195.1| 60S ribosomal protein L16 [Uncinocarpus reesii 1704]
          Length = 201

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 138/192 (71%), Gaps = 5/192 (2%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K 
Sbjct: 3   TFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKI 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PS+IF++ VRGM+PHKT RGAAA+ +LKVFEG+PPPYDK K    
Sbjct: 63  TRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAAMERLKVFEGVPPPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA----LAK 179
                    KPGR++  VGRLSHEVGWKYQD +  LE++R  ++SAY ERKKA    LA+
Sbjct: 123 PQALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKSSAYYERKKATRKQLAQ 182

Query: 180 ITRKAYEQSNKE 191
             R A  Q  KE
Sbjct: 183 AQRSAAGQQAKE 194



>gi|154312810|ref|XP_001555732.1| 60S ribosomal protein L16 [Botryotinia fuckeliana B05.10]
 gi|347839766|emb|CCD54338.1| similar to 60S ribosomal protein L16 [Botryotinia fuckeliana T4]
          Length = 202

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 1/175 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  + ID KGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVITIDAKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEG+PPPYDK+K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPPPYDKVKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+++AY ERKKA  K
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSAAYYERKKAARK 178



>gi|482813490|gb|EOA90181.1| hypothetical protein SETTUDRAFT_158798 [Setosphaeria turcica Et28A]
          Length = 733

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 136/186 (73%), Gaps = 1/186 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFHLR+PSK+FWRTVRGM+PHKTARG AA+ +LK FEG+P PYDK K    
Sbjct: 63  TRYNPTRGGPFHLRAPSKMFWRTVRGMIPHKTARGQAAMERLKTFEGVPAPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKAL +   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGTAYYERKKALRRQLAE 182

Query: 184 AYEQSN 189
           A + +N
Sbjct: 183 AKKTAN 188



>gi|400593955|gb|EJP61841.1| 60S ribosomal protein L16 [Beauveria bassiana ARSEF 2860]
          Length = 202

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 140/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VV+DGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FR+KLKY  +L K  
Sbjct: 4   FEPVVVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRSKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK-ITRK 183
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERK+  A+ I   
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKRVAARQIADA 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
               + K   T  L   GY
Sbjct: 184 KKTAAGKSQATKKLAALGY 202



>gi|501295729|dbj|BAN20926.1| ribosomal protein L13A [Riptortus pedestris]
          Length = 204

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   ++ ++IDGKGHLLGRLAAIVAK  L+G R+VVVR E INISG+ FR+KLKY  FL
Sbjct: 1   MTGFSDKPILIDGKGHLLGRLAAIVAKAALNGNRIVVVRTEQINISGNFFRSKLKYLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI +RT+RGMVPHK  RG AAL ++K+FEGIPPPYDK K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILYRTIRGMVPHKIERGKAALRRIKLFEGIPPPYDKRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR +  +GRLS EVGWKY+D ++ALE KR VRA     ++  L K+T
Sbjct: 121 VVPTAMRVLCLKPGRAYCHLGRLSSEVGWKYKDVVRALETKRKVRAVLEIRKRNGLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A ++ +K     T ++   GY
Sbjct: 181 KQAKQKMSKANARYTAVINSYGY 203



>gi|115389400|ref|XP_001212205.1| serine palmitoyltransferase 2 [Aspergillus terreus NIH2624]
 gi|114194601|gb|EAU36301.1| serine palmitoyltransferase 2 [Aspergillus terreus NIH2624]
          Length = 893

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 107/173 (61%), Positives = 133/173 (76%), Gaps = 1/173 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           +  +RVVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K 
Sbjct: 694 IVRQRVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKM 753

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PS+IF++ VRGM+PHKTARGAAA+ +LKVFEG+PPPYDK K    
Sbjct: 754 TRFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAMERLKVFEGVPPPYDKKKRVVV 813

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                    +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA
Sbjct: 814 PQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKA 866



>gi|268306366|gb|ACY95304.1| ribosomal protein L13A [Manduca sexta]
          Length = 204

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE INISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG +AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY++ ++ LE KR V+A      ++ L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKVKAVKRVAYERKLKKIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           + A E+  K     T ++Q  GY
Sbjct: 181 KDAGEKVVKATAPFTSVIQSYGY 203



>gi|302697987|ref|XP_003038672.1| 60S ribosomal protein L16 [Schizophyllum commune H4-8]
 gi|300112369|gb|EFJ03770.1| ribosomal protein L13A [Schizophyllum commune H4-8]
          Length = 200

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 108/181 (59%), Positives = 139/181 (76%), Gaps = 1/181 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I+AK+ILSGQ++VVVRCE INISGS FRNKL+Y +FL K+  VNP
Sbjct: 9   IVIDGKGHLLGRLASIIAKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLHKKHLVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R++RGM+PHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKNGPFHFRAPSKILYRSIRGMIPHKTARGAAALERLKLFEGVPPPYDRKKKMVVPDALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKVAALKLRQKAVAST 188

Query: 189 N 189
           +
Sbjct: 189 S 189



>gi|170084017|ref|XP_001873232.1| 60S ribosomal protein L16 [Laccaria bicolor S238N-H82]
 gi|164650784|gb|EDR15024.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 200

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/176 (62%), Positives = 136/176 (77%), Gaps = 1/176 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+ILSGQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHK+ARGAAAL +LK+FEG+PPPYDK K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKSARGAAALERLKLFEGVPPPYDKKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
               KPGR+F  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA
Sbjct: 129 VLRLKPGRKFCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAVKLRQKA 184



>gi|85103730|ref|XP_961587.1| 60S ribosomal protein L16 [Neurospora crassa OR74A]
 gi|30316294|sp|Q9P720.1|RL16_NEUCR RecName: Full=60S ribosomal protein L16
 gi|7635796|emb|CAB88562.1| probable ribosomal protein l13a [Neurospora crassa]
 gi|28923134|gb|EAA32351.1| 60S ribosomal protein L16 [Neurospora crassa OR74A]
          Length = 202

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR+F  VGRLS EVGWKY+D +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVSRLEERRKAKGAAYYERKKVAARQLSEA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   + T   L++ GY
Sbjct: 184 KKSAKVNDKTAEALKEFGY 202



>gi|320587705|gb|EFX00180.1| 60S ribosomal protein l16 [Grosmannia clavigera kw1407]
          Length = 202

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/199 (55%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++V+VRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVIVRCEALNISGEFFRAKLKYHSYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKT+RGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTSRGAAALERLKVFEGVPPPYDKQKKVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLSEA 183

Query: 185 YEQSNKEV-TTPLLQKTGY 202
            + +  +  T   L+  GY
Sbjct: 184 KKNAKVDPKTAKALEAFGY 202



>gi|169622968|ref|XP_001804892.1| hypothetical protein SNOG_14710 [Phaeosphaeria nodorum SN15]
 gi|111056782|gb|EAT77902.1| hypothetical protein SNOG_14710 [Phaeosphaeria nodorum SN15]
          Length = 202

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 107/173 (61%), Positives = 129/173 (74%), Gaps = 1/173 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  F+ K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFMRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARG AA+ +LK FEGIPPPYDK K    
Sbjct: 63  TRYNPTRGGPFHFRAPSKMFWRTVRGMIPHKTARGNAAMERLKTFEGIPPPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKA
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKA 175



>gi|336472697|gb|EGO60857.1| hypothetical protein NEUTE1DRAFT_115903 [Neurospora tetrasperma
           FGSC 2508]
 gi|350294067|gb|EGZ75152.1| putative ribosomal protein l13a [Neurospora tetrasperma FGSC 2509]
          Length = 202

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR+F  VGRLS EVGWKY+D +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVARLEERRKAKGAAYYERKKLAARQLSEA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   + T   L++ GY
Sbjct: 184 KKSAKVNDKTAEALKELGY 202



>gi|94732930|emb|CAK04157.1| ribosomal protein L13a [Danio rerio]
          Length = 205

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 143/198 (72%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + ++IDG+GHLLGRL+AIVAK++L G ++VVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLIIDGRGHLLGRLSAIVAKQVLLGHKIVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK   K+T++A 
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLRYSKKKVEMKLTKQAE 184

Query: 186 E--QSNKEVTTPLLQKTG 201
           +  +S   V T +L+K G
Sbjct: 185 KNVESKIAVYTDVLKKYG 202



>gi|389625313|ref|XP_003710310.1| 60S ribosomal protein L16 [Magnaporthe oryzae 70-15]
 gi|291195741|gb|ADD84587.1| probable ribosomal protein L13a [Magnaporthe oryzae]
 gi|351649839|gb|EHA57698.1| 60S ribosomal protein L16 [Magnaporthe oryzae 70-15]
 gi|440470865|gb|ELQ39907.1| 60S ribosomal protein L16 [Magnaporthe oryzae Y34]
 gi|440486870|gb|ELQ66697.1| 60S ribosomal protein L16 [Magnaporthe oryzae P131]
          Length = 202

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L GQ++VVVRCE +NISG  FR KLKY   L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLEGQKIVVVRCEALNISGEFFRAKLKYHAHLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS++F++ VRGM+PHKTARG AAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRVFYKAVRGMMPHKTARGTAALERLKVFEGVPPPYDKQKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  +A AY ERKK +A+   ++
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKAGAYYERKKLVARQRSES 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +N  + T   LQ  GY
Sbjct: 184 KKTANVDKKTAETLQAYGY 202



>gi|350413093|ref|XP_003489877.1| PREDICTED: 60S ribosomal protein L13a-like [Bombus impatiens]
          Length = 204

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 141/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRLAAI+AK IL G RV+VVR E +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNRVIVVRSEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LKV+EG PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKVYEGCPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  ++ LE KR VR+    +++  L K+T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSIVEVQKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A +   K     T ++   GY
Sbjct: 181 KQAGQTVAKATAPYTAIINNFGY 203



>gi|56759068|gb|AAW27674.1| SJCHGC04249 protein [Schistosoma japonicum]
          Length = 203

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 150/203 (73%), Gaps = 5/203 (2%)

Query: 4   MVFERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLT 62
           M F+++ ++ID +GHLLGRLAA+VAK +L+GQ+VVVVRCE +NISGS +RNKLKY DFL 
Sbjct: 1   MSFQKKPIIIDAQGHLLGRLAAVVAKTLLNGQKVVVVRCENLNISGSFYRNKLKYLDFLR 60

Query: 63  KRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXX 122
           KR N NP+RGP+H R+P+KIFWRTVRGM+PHK  RG  AL +LKVFEGIPPPYDK K   
Sbjct: 61  KRMNTNPSRGPYHFRAPAKIFWRTVRGMLPHKLHRGKQALDRLKVFEGIPPPYDKKKRMV 120

Query: 123 XXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITR 182
                     KPGR+F+V+ +LS++VGWKY++ I+ +E +R  +A+ + +RKK L K + 
Sbjct: 121 VPSALRVIRLKPGRKFSVLSQLSNDVGWKYKNVIEKMENRRKAKAAVWYKRKKLLKKPSE 180

Query: 183 KAYEQSNKEVTTP---LLQKTGY 202
            A  ++ KE   P   +L++ GY
Sbjct: 181 VARGRA-KEAIAPYQAILKQYGY 202



>gi|225556668|gb|EEH04956.1| AMP dependent synthetase and ligase [Ajellomyces capsulatus G186AR]
          Length = 735

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 140/190 (73%), Gaps = 1/190 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHK+ARGAAA+ +LKVFEG+PPPYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKAVRGMIPHKSARGAAAMERLKVFEGVPPPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ SAY ERKKA  +   +A
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLVQA 183

Query: 185 YEQSNKEVTT 194
            + +N +  T
Sbjct: 184 QKTANVDQKT 193



>gi|242004232|ref|XP_002436282.1| ribosomal protein L13A, putative [Ixodes scapularis]
 gi|215499618|gb|EEC09112.1| ribosomal protein L13A, putative [Ixodes scapularis]
          Length = 205

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T +  + ++IDG+GHLLGRL+A++AK +L GQRVVVVRCE I ISGS FR+KLKY  FL
Sbjct: 1   MTGISSKPIIIDGQGHLLGRLSALIAKTLLHGQRVVVVRCEGICISGSFFRSKLKYLSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNP RGP+H R+PSKI WRTVRGMVPHKT RGA AL +LK+FEG+PPPYD+ K  
Sbjct: 61  RKRCNVNPKRGPYHFRAPSKILWRTVRGMVPHKTKRGALALDRLKMFEGVPPPYDRKKRM 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                       P R++  +GRL HEVGWKYQ+ I++LE KR  +A+ Y + KK   K+ 
Sbjct: 121 VVPSALRVLRLNPRRKYCTLGRLGHEVGWKYQNVIESLEMKRKAKAALYYKDKKRDRKLF 180

Query: 182 RKAYEQSNKEV--TTPLLQKTGY 202
            +A  Q  K++     ++Q  GY
Sbjct: 181 AEAKVQLAKQIEPMQKVIQSYGY 203



>gi|390604813|gb|EIN14204.1| ribosomal protein L16a [Punctularia strigosozonata HHB-11173 SS5]
          Length = 200

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 144/194 (74%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+IL+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEGIPPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILFRAIRGMVPHKTARGAAALERLKLFEGIPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ + A +++
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKVAAVKLRQTATKEA 188

Query: 189 NKEVTTPLLQKTGY 202
           +   + P L   GY
Sbjct: 189 S--TSFPKLAALGY 200



>gi|336266622|ref|XP_003348078.1| 60S ribosomal protein L16 [Sordaria macrospora k-hell]
 gi|380091013|emb|CCC11219.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 202

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR+F  VGRLS EVGWKY+D +  LE++R  + +AY ERKK  A+   +A
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVARLEERRKAKGAAYYERKKLAARQLSEA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   + T   L++ GY
Sbjct: 184 KKSAKVNDKTAEALKEFGY 202



>gi|393218414|gb|EJD03902.1| ribosomal protein L16a [Fomitiporia mediterranea MF3/22]
          Length = 200

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 143/194 (73%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IVAK++LSGQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIVAKQVLSGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI ++ +RGM+PHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILFKAIRGMIPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPAALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A AK+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFYERKLAAAKLRQKAI--A 186

Query: 189 NKEVTTPLLQKTGY 202
           +   +   L   GY
Sbjct: 187 DNSASFEKLTSLGY 200



>gi|50548325|ref|XP_501632.1| 60S ribosomal protein L16 [Yarrowia lipolytica]
 gi|49647499|emb|CAG81935.1| YALI0C09218p [Yarrowia lipolytica CLIB122]
          Length = 200

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 135/197 (68%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK+IL GQ +VVVRCE +NIS   FR+KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQILDGQNIVVVRCEALNISQEFFRSKLKYAAYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N   GPFH R+PS+IF++ VRGM+PHKTARG AAL +LKVFEGIPPPYDK K      
Sbjct: 64  RFNRTHGPFHFRAPSRIFYKAVRGMIPHKTARGKAALERLKVFEGIPPPYDKKKRMVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++  VGR+SHE GWKYQD +  LE+KR V+++AY  +K AL+K T+ A+
Sbjct: 124 ALRVLRLKPGRKYCTVGRVSHEFGWKYQDVVANLEEKRKVKSAAYYAKKSALSKKTKAAH 183

Query: 186 EQSNKEVTTPLLQKTGY 202
            Q         L   GY
Sbjct: 184 AQIADSEAAKALAALGY 200



>gi|348531543|ref|XP_003453268.1| PREDICTED: 60S ribosomal protein L13a-like [Oreochromis niloticus]
          Length = 205

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 110/198 (55%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PSKIFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSKIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  ++     +KK L  +T+KA 
Sbjct: 125 ALKVVRLKPSRKFALLGRLAHEVGWKYQAITATLEEKRKEKSKLRYTKKKTLINLTKKAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    ++   T +L++ G
Sbjct: 185 KNVESKIAKYTDVLKQYG 202



>gi|225711696|gb|ACO11694.1| 60S ribosomal protein L13A [Caligus rogercresseyi]
          Length = 206

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 129/175 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDG+GHL+GRLA+IVAK IL+G RVVVVRCE IN+SG+ +RNKLKY  FL  RCNV P
Sbjct: 9   VVIDGRGHLMGRLASIVAKFILNGNRVVVVRCEGINMSGNFYRNKLKYLKFLRLRCNVKP 68

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGPFH R+PSKIF RTVRGMVPHK+ RG  AL +L+ FEG+PPPYDK K          
Sbjct: 69  SRGPFHFRAPSKIFLRTVRGMVPHKSERGKEALKRLQTFEGVPPPYDKKKKMVIPSALKV 128

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
              KPGR+F  VGRLSH+VGWKYQD +  LE KR V++ AY   K  L K+ R+ 
Sbjct: 129 MRLKPGRKFCSVGRLSHDVGWKYQDVVSTLEAKRRVKSEAYYNTKVKLMKLKREV 183



>gi|470326355|ref|XP_004364677.1| ribosomal protein L16a [Capsaspora owczarzaki ATCC 30864]
 gi|320166866|gb|EFW43765.1| ribosomal protein L16a [Capsaspora owczarzaki ATCC 30864]
          Length = 200

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 143/184 (77%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           +FE+ VVIDG GHLLGRLA+IVAKE+L GQ+VVV+R E INISGS  RNK+KYQ FL K+
Sbjct: 1   MFEKVVVIDGAGHLLGRLASIVAKELLLGQKVVVLRTEDINISGSFIRNKIKYQAFLRKK 60

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             +NP++GPFHLRSPS+IFWR  RGM+PHKTARGAAAL +LKVFEG+PPPYD+IK     
Sbjct: 61  KQINPSKGPFHLRSPSRIFWRVTRGMLPHKTARGAAALERLKVFEGVPPPYDRIKRVVVP 120

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +P RRF  +GRLSHEVGWKYQD +  LE KR  +A+AY ++K++LAK+  +A
Sbjct: 121 SALRVLRLRPKRRFCRLGRLSHEVGWKYQDVVSTLEAKRKAKAAAYHKQKQSLAKLRTQA 180

Query: 185 YEQS 188
             +S
Sbjct: 181 VAKS 184



>gi|449551272|gb|EMD42236.1| hypothetical protein CERSUDRAFT_79830 [Ceriporiopsis subvermispora
           B]
          Length = 200

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 141/194 (72%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IVAK+IL+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIVAKQILNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHK+ARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKSARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR V+A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKVKAQAFHERKTAALKLRQKAIADT 188

Query: 189 NKEVTTPLLQKTGY 202
                   L + GY
Sbjct: 189 ASSFEN--LTQLGY 200



>gi|148234180|ref|NP_001080130.1| ribosomal protein L13a [Xenopus laevis]
 gi|27697097|gb|AAH43976.1| Rpl13a-prov protein [Xenopus laevis]
          Length = 231

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 142/194 (73%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 35  LIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 94

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 95  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKI 154

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + K+ R+A +   
Sbjct: 155 VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIGKLRRQAEKNVE 214

Query: 190 KEVT--TPLLQKTG 201
            +++  T +L++ G
Sbjct: 215 SKISKYTDVLKQYG 228



>gi|471570790|gb|EMR69805.1| putative 60s ribosomal protein l16 protein [Eutypa lata UCREL1]
          Length = 202

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  +VIDGKGHLLGRLA+IVAK++L+GQ++VVVR E +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVIVIDGKGHLLGRLASIVAKQLLNGQKIVVVRTEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKK-ALAKITRK 183
                   +PGR+F  VGRLSHEVGWKYQD ++ LE++R  + +AY ERKK AL + T  
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSHEVGWKYQDVVERLEERRKAKGAAYYERKKLALRQQTDA 183

Query: 184 AYEQSNKEVTTPLLQKTGY 202
               S    T   L+  GY
Sbjct: 184 KKNASVNAKTEEALKAYGY 202



>gi|393248182|gb|EJD55689.1| 60S ribosomal protein L13a [Auricularia delicata TFB-10046 SS5]
          Length = 198

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 139/188 (73%), Gaps = 1/188 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDGKGHLLGRLA+I+AK+IL+GQ++ VVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IIIDGKGHLLGRLASIIAKQILNGQKITVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R VRGMVPHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAVRGMVPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPAALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA  ++
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKTAAIKLRQKAITEN 188

Query: 189 NKEVTTPL 196
                T L
Sbjct: 189 ASAHLTEL 196



>gi|386783753|gb|AFJ24771.1| 60S ribosomal protein L13a [Schmidtea mediterranea]
          Length = 202

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 140/200 (70%), Gaps = 2/200 (1%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           V E+ +VID  GHLLGRLA  VAK  L GQRVV+VR E +NISGS +RNKLKYQ+FL KR
Sbjct: 3   VSEKVLVIDCAGHLLGRLATAVAKASLQGQRVVLVRTEDVNISGSFYRNKLKYQEFLKKR 62

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
            N NP+RGPFHLRSPSKI WRT+RGM+PHKT RGA AL K+KVFEG+P PYDK+K     
Sbjct: 63  MNTNPSRGPFHLRSPSKIVWRTIRGMIPHKTKRGAGALDKIKVFEGVPAPYDKMKKSCIP 122

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KP R+F  +GRLSHEVGWKYQ  +  LE+KR  +A+ +  ++K   K+  KA
Sbjct: 123 SALRVVRLKPNRKFCQLGRLSHEVGWKYQSVVSTLEEKRKAKAALWYSKQKESKKLKEKA 182

Query: 185 YEQSNKEVT--TPLLQKTGY 202
              ++++V     +L K G+
Sbjct: 183 VLATSEKVAKYNEILAKFGH 202



>gi|378729297|gb|EHY55756.1| 60S ribosomal protein L16 [Exophiala dermatitidis NIH/UT8656]
          Length = 201

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 140/198 (70%), Gaps = 1/198 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+P++IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYDK +     
Sbjct: 64  RFNPTRGGPFHFRAPARIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDKKQRMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRL+HEVGWKYQD +  LE++R V+ +AY ERKK   +   +A
Sbjct: 124 QALRVLRLKPGRKYCTVGRLAHEVGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEA 183

Query: 185 YEQSNKEVTTPLLQKTGY 202
            + S    T   L   GY
Sbjct: 184 QKTSADAKTKEKLAALGY 201



>gi|189188534|ref|XP_001930606.1| 60S ribosomal protein L16 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|330912861|ref|XP_003296096.1| 60S ribosomal protein L16 [Pyrenophora teres f. teres 0-1]
 gi|187972212|gb|EDU39711.1| 60S ribosomal protein L16-B [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|311332024|gb|EFQ95806.1| hypothetical protein PTT_04845 [Pyrenophora teres f. teres 0-1]
          Length = 202

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 139/197 (70%), Gaps = 7/197 (3%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PSK+FWRTVRGM+PHKTARG AA+ +LK FEG+P PYDK K    
Sbjct: 63  TRYNPTRGGPFHFRAPSKMFWRTVRGMIPHKTARGKAAMERLKTFEGVPAPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKAL------ 177
                    KPGR++  VGRL HE GWKYQD +  LE++R V+ +AY ERKKA+      
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKAIRRQMAE 182

Query: 178 AKITRKAYEQSNKEVTT 194
           AK T     ++ +E+T+
Sbjct: 183 AKKTATVDSKTQEELTS 199



>gi|342877686|gb|EGU79132.1| hypothetical protein FOXB_10370 [Fusarium oxysporum Fo5176]
 gi|475668368|gb|EMT66155.1| 60S ribosomal protein L16 [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477514547|gb|ENH66925.1| 60S ribosomal protein L16 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 202

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 141/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+IVAK++LSGQ++V+VRCE +NISG  FR KLKY   L K  
Sbjct: 4   FEQVVVIDGKGHLLGRLASIVAKQLLSGQKIVIVRCEALNISGEFFRAKLKYHAHLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKTKKVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR+F  VGRLS EVGWKY+D +  LE++R  + +A+ ERKK  A+    A
Sbjct: 124 QALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVARLEERRKAKGAAFYERKKIAARQLADA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + ++ KE T   L   GY
Sbjct: 184 KKNASVKEETAKALANYGY 202



>gi|320580562|gb|EFW94784.1| cytosolic ribosomal protein L16, putative [Ogataea parapolymorpha
           DL-1]
          Length = 200

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 138/192 (71%), Gaps = 1/192 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+ +AKE+L+GQ++VVVRCE +NISG  FRNKLKY D+L KR 
Sbjct: 4   FEKVVVIDGKGHLLGRLASTIAKELLNGQKIVVVRCEALNISGEFFRNKLKYHDYLRKRT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N  RGPFH R+PS+I ++ VRGM+ HKTARG AAL +LKVFEG+PPPYDK K      
Sbjct: 64  RFNANRGPFHFRAPSRILYKAVRGMISHKTARGKAALERLKVFEGVPPPYDKKKRVVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA-LAKITRKA 184
                  KPGR++T +G+LS  VGWKY+  + ALE+KR VR++ Y  +KKA L K+T   
Sbjct: 124 ALRVLRLKPGRKYTTLGKLSSSVGWKYESVVDALEEKRKVRSAEYYAKKKAQLRKVTAAK 183

Query: 185 YEQSNKEVTTPL 196
              +  E ++ L
Sbjct: 184 SAVATSEASSKL 195



>gi|410898551|ref|XP_003962761.1| PREDICTED: 60S ribosomal protein L13a-like [Takifugu rubripes]
          Length = 228

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/198 (55%), Positives = 143/198 (72%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +V+DG+GHLLGRL+AIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 28  FNKVLVLDGRGHLLGRLSAIVAKQLLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 87

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 88  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPA 147

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F V+GRL+HEVGWKYQ     LE+KR  +A     +KK + K+T++A 
Sbjct: 148 ALKIVRLKPSRKFAVLGRLAHEVGWKYQAITATLEEKRKEKAKLRYAKKKTVRKLTKQAE 207

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    ++   T +L++ G
Sbjct: 208 KNVEAKIAKYTDVLKQYG 225



>gi|289472560|gb|ADC97465.1| putative 60S ribosomal protein L13a [Amblyomma hebraeum]
          Length = 203

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 1/188 (0%)

Query: 6   FERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           F R+ +VIDG+GHLLGRL+A+VAK +L GQ+VVVVRCE I ISGS FRNKLKY  FL KR
Sbjct: 4   FSRKPLVIDGQGHLLGRLSALVAKTLLHGQKVVVVRCEGICISGSFFRNKLKYLSFLRKR 63

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
           CNV+PARGP+H R+PSKI WRTVRGM+PHKT RG+ AL +LKV EG+PPPY + K     
Sbjct: 64  CNVDPARGPYHFRAPSKILWRTVRGMLPHKTKRGSLALDRLKVLEGVPPPYHRTKRMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                    P RR+  +GRL HEVGWKYQ  I++LE KR  +++ Y + KKA  K+  +A
Sbjct: 124 SALRVLRLNPRRRYCTLGRLGHEVGWKYQSVIESLELKRKAKSALYYKAKKADRKLLAQA 183

Query: 185 YEQSNKEV 192
            E S+K+V
Sbjct: 184 KELSSKQV 191



>gi|67527912|ref|XP_661806.1| RL16_NEUCR 60S ribosomal protein L16 [Aspergillus nidulans FGSC A4]
 gi|5853244|gb|AAD54383.1|AF178537_1 ribosomal protein L16a [Emericella nidulans]
 gi|40740111|gb|EAA59301.1| RL16_NEUCR 60S ribosomal protein L16 [Aspergillus nidulans FGSC A4]
 gi|259481193|tpe|CBF74493.1| TPA: RL16_NEUCR 60S ribosomal protein L16Ribosomal protein L16a ;
           [Source:UniProtKB/TrEMBL;Acc:Q9UVN8] [Aspergillus
           nidulans FGSC A4]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/187 (58%), Positives = 136/187 (72%), Gaps = 5/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKITRYNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA     R+    +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKA----ARRQLAHA 183

Query: 189 NKEVTTP 195
            K  + P
Sbjct: 184 QKSASVP 190



>gi|145255027|ref|XP_001398840.1| 60S ribosomal protein L16 [Aspergillus niger CBS 513.88]
 gi|134084427|emb|CAK97419.1| unnamed protein product [Aspergillus niger]
 gi|350630652|gb|EHA19024.1| rpl16 ribosomal protein [Aspergillus niger ATCC 1015]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 140/195 (71%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKTARGAAA+ +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAMERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +    A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLVHAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
              E T   L + GY
Sbjct: 188 GVNEQTKSQLAQYGY 202



>gi|505852913|ref|XP_004619892.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Sorex araneus]
          Length = 203

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 137/184 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS++FWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRMFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++T
Sbjct: 187 KKIT 190



>gi|169764939|ref|XP_001816941.1| 60S ribosomal protein L16 [Aspergillus oryzae RIB40]
 gi|238503790|ref|XP_002383127.1| 60S ribosomal protein L16 [Aspergillus flavus NRRL3357]
 gi|83764795|dbj|BAE54939.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220690598|gb|EED46947.1| ribosomal protein L16a [Aspergillus flavus NRRL3357]
 gi|391863212|gb|EIT72523.1| 60S ribosomal protein L13a [Aspergillus oryzae 3.042]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 130/168 (77%), Gaps = 1/168 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKTARGAAA+ +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAMERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKA 175



>gi|406606146|emb|CCH42506.1| 60S ribosomal protein L16-A [Wickerhamomyces ciferrii]
          Length = 200

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 137/192 (71%), Gaps = 1/192 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VV+DGKGHLLGRLA+ VAK+IL+GQ+VVVVRCE +NISG  FR KLKY D+L K  
Sbjct: 4   FEPVVVVDGKGHLLGRLASTVAKQILNGQKVVVVRCESLNISGEFFRTKLKYHDYLRKGT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N   GPFH R+PS+IF++ VRGM+ HKTARGAAAL +LKVFEG+PPPYDK K      
Sbjct: 64  RFNKTHGPFHFRAPSRIFYKAVRGMIAHKTARGAAALERLKVFEGVPPPYDKKKRVVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T VG+LS  VGWKY++ +  LE KR VRA+ Y  +KKAL K    A 
Sbjct: 124 ALRVLRLKPGRKYTTVGQLSAAVGWKYENIVSKLEDKRRVRAAEYYAKKKALTKKVESAK 183

Query: 186 E-QSNKEVTTPL 196
           + Q+N EV+  L
Sbjct: 184 QSQANSEVSQKL 195



>gi|498933781|ref|XP_004540518.1| PREDICTED: 60S ribosomal protein L13a-like [Maylandia zebra]
          Length = 205

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PSKIFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSKIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  ++     +KK L  +T++A 
Sbjct: 125 ALKVVRLKPSRKFALLGRLAHEVGWKYQAITATLEEKRKEKSKLRYTKKKTLINLTKQAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    ++   T +L++ G
Sbjct: 185 KNVESKIAKYTDVLKQYG 202



>gi|346227222|ref|NP_001230997.1| ribosomal protein L13a isoform 1 [Sus scrofa]
          Length = 204

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 142/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 8   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 67

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 68  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 127

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 128 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 187

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 188 KKIDRFTEVLKTHGF 202



>gi|296824912|ref|XP_002850731.1| 60S ribosomal protein L16 [Arthroderma otae CBS 113480]
 gi|238838285|gb|EEQ27947.1| 60S ribosomal protein L16 [Arthroderma otae CBS 113480]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 131/172 (76%), Gaps = 1/172 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEGIP PYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMDRLKVFEGIPEPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ +AY ERKKA
Sbjct: 124 QALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGAAYHERKKA 175



>gi|315115437|gb|ADT80691.1| ribosomal protein L13A [Euphydryas aurinia]
          Length = 204

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/204 (53%), Positives = 141/204 (69%), Gaps = 4/204 (1%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +V+VVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVIVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR  +       +K L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVAYEKKLQKIT 180

Query: 182 RKAYEQSNKEVTTPL---LQKTGY 202
           ++A E+  K VT P    +Q  GY
Sbjct: 181 KEAGEKVAK-VTAPFNAVMQSYGY 203



>gi|358366768|dbj|GAA83388.1| serine palmitoyltransferase 2 [Aspergillus kawachii IFO 4308]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKTARGAAA+ +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAMERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +    A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLVHAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
              E T   L   GY
Sbjct: 188 GVNEQTKSQLASLGY 202



>gi|326470919|gb|EGD94928.1| 60S ribosomal protein L16 [Trichophyton tonsurans CBS 112818]
          Length = 202

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 131/172 (76%), Gaps = 1/172 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEGIP PYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGIPEPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ +AY ERKKA
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGAAYYERKKA 175



>gi|2500261|sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a
 gi|1743007|emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
          Length = 200

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/176 (59%), Positives = 132/176 (75%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           +FE+ VV+D +GHLLGRLAA +AKE+L+GQRVV VR E INISGS FRNKLK+  FL KR
Sbjct: 1   MFEKVVVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKR 60

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
            N NP RGPFH RSP++I WRT+RGM+PHKT RGAAAL +LK FEG+PPPYDK+K     
Sbjct: 61  MNTNPRRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIP 120

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKI 180
                   KPGR+F V+GRL+ EVGW++ D +  LE+KR  +++A+  RKK L  +
Sbjct: 121 QALRVLRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFYARKKTLVNL 176



>gi|432936812|ref|XP_004082291.1| PREDICTED: 60S ribosomal protein L13a-like isoform 1 [Oryzias
           latipes]
          Length = 205

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + ++IDG+GHLLGRLAAIVAK++L G +VV+VRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLIDGRGHLLGRLAAIVAKQVLLGHKVVIVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRVVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A  +  +KK L K+++ A 
Sbjct: 125 ALKIVRLKPSRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLHYVKKKTLVKLSKLAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    ++   T +L++ G
Sbjct: 185 KNVEGKIAKYTDVLKQYG 202



>gi|346227224|ref|NP_001230998.1| ribosomal protein L13a isoform 2 [Sus scrofa]
          Length = 203

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 142/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 187 KKIDRFTEVLKTHGF 201



>gi|66500885|ref|XP_623813.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Apis mellifera]
 gi|380022152|ref|XP_003694917.1| PREDICTED: 60S ribosomal protein L13a-like isoform 1 [Apis florea]
          Length = 204

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 141/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRLAAI+AK IL G +V+VVR E +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNKVIVVRSEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LKV+EG PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKVYEGCPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  ++ LE KR VR+    +++  L K+T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSILEVQKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A +   K     T ++   GY
Sbjct: 181 KQAGQTVAKATAPYTAIINNFGY 203



>gi|322708490|gb|EFZ00068.1| 60S ribosomal protein L16 [Metarhizium anisopliae ARSEF 23]
          Length = 202

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (69%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++ VRGM+PHKTARGAAA+ +LKVFEG+PPPYD  K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAMERLKVFEGVPPPYDTKKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+    A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLSDA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +  K  T   L   GY
Sbjct: 184 KKNATVKAGTAKALAAYGY 202



>gi|507981697|ref|XP_004694340.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Condylura
           cristata]
          Length = 203

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 136/184 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++ 
Sbjct: 187 KKIN 190



>gi|466015254|ref|XP_004271087.1| PREDICTED: 60S ribosomal protein L13a [Orcinus orca]
 gi|470616237|ref|XP_004317277.1| PREDICTED: 60S ribosomal protein L13a [Tursiops truncatus]
          Length = 203

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 142/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE 186

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 187 KKIDRFTEVLKTHGF 201



>gi|389751574|gb|EIM92647.1| 60S ribosomal protein L13a [Stereum hirsutum FP-91666 SS1]
          Length = 200

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K++L+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQVLNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEGIPPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILFRAIRGMVPHKTARGAAALERLKLFEGIPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKTAAVKLRQKA 184



>gi|315055347|ref|XP_003177048.1| 60S ribosomal protein L16 [Arthroderma gypseum CBS 118893]
 gi|311338894|gb|EFQ98096.1| 60S ribosomal protein L16 [Arthroderma gypseum CBS 118893]
          Length = 202

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 131/172 (76%), Gaps = 1/172 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEGIP PYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGIPEPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ +AY ERKKA
Sbjct: 124 QALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGAAYHERKKA 175



>gi|238606250|ref|XP_002396666.1| hypothetical protein MPER_03052 [Moniliophthora perniciosa FA553]
 gi|215469656|gb|EEB97596.1| hypothetical protein MPER_03052 [Moniliophthora perniciosa FA553]
          Length = 201

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 135/176 (76%), Gaps = 1/176 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IV+K+ILSGQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 10  IVIDGKGHLLGRLASIVSKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 69

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGM PHKT RGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 70  KKSGPFHHRAPSKILYRAIRGMTPHKTPRGAAALERLKLFEGVPPPYDRKKRMVVPEALR 129

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A AK+ +KA
Sbjct: 130 VLRLKPGRKYCTVKRLSHEVGWGYKDIVDRLEEKRKIKAQAFHERKLAAAKLRQKA 185



>gi|159130823|gb|EDP55936.1| ribosomal protein L16a [Aspergillus fumigatus A1163]
          Length = 202

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 141/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKT RGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +   +A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLVQAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
           +  E T   L + GY
Sbjct: 188 SIDEKTKSQLAEYGY 202



>gi|62858175|ref|NP_001016486.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 gi|89272927|emb|CAJ83235.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 gi|134025441|gb|AAI35477.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gi|170284455|gb|AAI60997.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gi|195540012|gb|AAI68111.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gi|195540203|gb|AAI68117.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
          Length = 231

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 142/194 (73%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 35  LIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 94

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 95  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKI 154

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + K+ ++A +   
Sbjct: 155 VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIVKLRKQAEKNVE 214

Query: 190 KEVT--TPLLQKTG 201
            +++  T +L++ G
Sbjct: 215 SKISKYTDVLKQYG 228



>gi|146322483|ref|XP_750349.2| ribosomal protein L16a [Aspergillus fumigatus Af293]
 gi|129557039|gb|EAL88311.2| ribosomal protein L16a [Aspergillus fumigatus Af293]
          Length = 202

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 141/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKT RGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +   +A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEEQRKVKSSAYYERKKAARRQLVQAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
           +  E T   L + GY
Sbjct: 188 SIDEKTKSQLAEYGY 202



>gi|452988355|gb|EME88110.1| hypothetical protein MYCFIDRAFT_209709 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 200

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 1/195 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG P+H R+P+K+FWRTVRGM+PHKT RGA A+ +LKVFEGIPPPYD  K    
Sbjct: 63  TRYNPTRGGPWHFRTPAKMFWRTVRGMIPHKTERGAKAMERLKVFEGIPPPYDHKKRMVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+  AY E+K+A  K   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGQAYYEKKRAARKNLVE 182

Query: 184 AYEQSNKEVTTPLLQ 198
           A  + + +VT  L Q
Sbjct: 183 AQSKVSSDVTKQLAQ 197



>gi|119187609|ref|XP_001244411.1| 60S ribosomal protein L16 [Coccidioides immitis RS]
 gi|303316912|ref|XP_003068458.1| 60S ribosomal protein L16 [Coccidioides posadasii C735 delta SOWgp]
 gi|240108139|gb|EER26313.1| 60S ribosomal protein L16, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320038319|gb|EFW20255.1| 60S ribosomal protein L13a [Coccidioides posadasii str. Silveira]
 gi|392871130|gb|EAS32998.2| 60S ribosomal protein L16 [Coccidioides immitis RS]
          Length = 202

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 141/197 (71%), Gaps = 7/197 (3%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K 
Sbjct: 3   TFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKI 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG PFH R+PS+IF++ VRGM+PHKT RGAAA+ +LKVFEG+PPPYDK K    
Sbjct: 63  TRFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAAMERLKVFEGVPPPYDKKKRVVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRLSHEVGWKYQD +  LE++R  ++SAY ERKKA    TR+
Sbjct: 123 PQALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKSSAYYERKKA----TRR 178

Query: 184 AYEQSNKEVTTPLLQKT 200
              Q+ +  T  + Q+T
Sbjct: 179 QLAQAQR--TASVSQQT 193



>gi|429884774|gb|AGA17991.1| ribosomal protein L13A, partial [Agrotis ipsilon]
          Length = 190

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           LT    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE INISG+ FRNKLK+  FL
Sbjct: 1   LTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG +AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR V++      +K L +IT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLENKRKVKSVKLMAYEKKLKRIT 180

Query: 182 RKAYEQSNK 190
           +++ E+  K
Sbjct: 181 KESGEKVAK 189



>gi|156051676|ref|XP_001591799.1| 60S ribosomal protein L16 [Sclerotinia sclerotiorum 1980 UF-70]
 gi|154705023|gb|EDO04762.1| 60S ribosomal protein L16 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 202

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/175 (60%), Positives = 132/175 (75%), Gaps = 1/175 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  + ID KGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVITIDAKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEG+P PYDK+K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPQPYDKVKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+++AY ERKKA  K
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSAAYYERKKAARK 178



>gi|112984370|ref|NP_001037156.1| ribosomal protein L13A [Bombyx mori]
 gi|54609219|gb|AAV34825.1| ribosomal protein L13A [Bombyx mori]
          Length = 204

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 140/203 (68%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE INISG+ FRNKLK   FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +L+ ++G PPP+D  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKNALRRLRTYDGCPPPFDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR +  VGRLSHE+GWKY+D ++ LE KR  +A      +K L +IT
Sbjct: 121 VVPAALRVFCLKPGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVAYEKKLKRIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           + A E+ +K  T  T ++Q  GY
Sbjct: 181 KDAGEKVSKATTPFTTIIQSYGY 203



>gi|392571216|gb|EIW64388.1| 60S ribosomal protein L13a [Trametes versicolor FP-101664 SS1]
          Length = 200

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 141/191 (73%), Gaps = 6/191 (3%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+IL+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR V++ A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKVKSQAFHERKTAALKLRQKALTDA 188

Query: 189 NKEVTTPLLQK 199
                TP  +K
Sbjct: 189 -----TPSFEK 194



>gi|403418460|emb|CCM05160.1| predicted protein [Fibroporia radiculosa]
          Length = 200

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+IL+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAIKLRQKA 184



>gi|75077219|sp|Q4R8Z2.3|RL13A_MACFA RecName: Full=60S ribosomal protein L13a
 gi|67967894|dbj|BAE00429.1| unnamed protein product [Macaca fascicularis]
          Length = 203

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTTTLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|296234343|ref|XP_002762391.1| PREDICTED: 60S ribosomal protein L13a-like isoform 1 [Callithrix
           jacchus]
          Length = 203

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 141/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K++   T +L+  G
Sbjct: 187 KKINKYTEVLKTHG 200



>gi|504174964|ref|XP_004597042.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Ochotona
           princeps]
          Length = 203

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 136/184 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++ 
Sbjct: 187 KKIN 190



>gi|116004215|ref|NP_001070466.1| 60S ribosomal protein L13a [Bos taurus]
 gi|91207338|sp|Q3SZ90.3|RL13A_BOVIN RecName: Full=60S ribosomal protein L13a
 gi|74268378|gb|AAI03040.1| Ribosomal protein L13a [Bos taurus]
 gi|296477541|tpg|DAA19656.1| TPA: 60S ribosomal protein L13a [Bos taurus]
          Length = 203

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 142/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE 186

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 187 KKIGKFTEVLKTHGF 201



>gi|511895529|ref|XP_004767370.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius
           furo]
 gi|511988018|ref|XP_004811758.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius
           furo]
          Length = 203

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|163658449|gb|ABY28364.1| ribosomal protein L13A [Oncorhynchus masou formosanus]
          Length = 205

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PSKIFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSKIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK + K+++ A 
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKARIRYTKKKTVTKLSKLAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    +++  T +L++ G
Sbjct: 185 KNVESKISKYTAVLKQYG 202



>gi|306482619|ref|NP_001182348.1| ribosomal protein L13a [Macaca mulatta]
 gi|402906308|ref|XP_003915944.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Papio anubis]
 gi|402906310|ref|XP_003915945.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Papio anubis]
 gi|90075280|dbj|BAE87320.1| unnamed protein product [Macaca fascicularis]
          Length = 203

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|149757870|ref|XP_001491926.1| PREDICTED: 60S ribosomal protein L13a-like [Equus caballus]
          Length = 203

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|471396052|ref|XP_004381707.1| PREDICTED: 60S ribosomal protein L13a [Trichechus manatus
           latirostris]
          Length = 203

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 136/184 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++ 
Sbjct: 187 KKIN 190



>gi|512192851|gb|EPE08609.1| 60s ribosomal protein l16 [Ophiostoma piceae UAMH 11346]
          Length = 225

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 140/196 (71%), Gaps = 2/196 (1%)

Query: 9   RVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVN 68
           +VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    N
Sbjct: 30  QVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYN 89

Query: 69  PARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXX 127
           P RG PFH R+PS+I ++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K        
Sbjct: 90  PTRGGPFHFRAPSRILYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVPQAL 149

Query: 128 XXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQ 187
                +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK  A+   +A + 
Sbjct: 150 RVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAARQLTEAKKN 209

Query: 188 SNKEV-TTPLLQKTGY 202
           +  +  T   L+  GY
Sbjct: 210 AKVDTKTAKALESFGY 225



>gi|38114878|gb|AAH04900.2| RPL13A protein, partial [Homo sapiens]
          Length = 201

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 5   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 64

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 65  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 124

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 125 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 184

Query: 190 KEV 192
           K++
Sbjct: 185 KKI 187



>gi|6912634|ref|NP_036555.1| 60S ribosomal protein L13a isoform 1 [Homo sapiens]
 gi|114678451|ref|XP_512821.2| PREDICTED: 60S ribosomal protein L13a isoform 15 [Pan troglodytes]
 gi|297697518|ref|XP_002825903.1| PREDICTED: 60S ribosomal protein L13a-like isoform 2 [Pongo abelii]
 gi|397486519|ref|XP_003814375.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Pan paniscus]
 gi|397486521|ref|XP_003814376.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Pan paniscus]
 gi|397486523|ref|XP_003814377.1| PREDICTED: 60S ribosomal protein L13a isoform 3 [Pan paniscus]
 gi|410054266|ref|XP_003953607.1| PREDICTED: 60S ribosomal protein L13a [Pan troglodytes]
 gi|426389599|ref|XP_004061207.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Gorilla gorilla
           gorilla]
 gi|426389601|ref|XP_004061208.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Gorilla gorilla
           gorilla]
 gi|426389603|ref|XP_004061209.1| PREDICTED: 60S ribosomal protein L13a isoform 3 [Gorilla gorilla
           gorilla]
 gi|730451|sp|P40429.2|RL13A_HUMAN RecName: Full=60S ribosomal protein L13a; AltName: Full=23 kDa
           highly basic protein
 gi|485601424|pdb|3J3B|O Chain O, Structure Of The Human 60s Ribosomal Proteins
 gi|23691|emb|CAA40254.1| 23 kD highly basic protein [Homo sapiens]
 gi|6552365|dbj|BAA88214.1| ribosomal protein L13a [Homo sapiens]
 gi|12653485|gb|AAH00514.1| Ribosomal protein L13a [Homo sapiens]
 gi|12804529|gb|AAH01675.1| Ribosomal protein L13a [Homo sapiens]
 gi|12804789|gb|AAH01836.1| Ribosomal protein L13a [Homo sapiens]
 gi|38566191|gb|AAH62537.1| Ribosomal protein L13a [Homo sapiens]
 gi|40850880|gb|AAH65236.1| Ribosomal protein L13a [Homo sapiens]
 gi|47682891|gb|AAH70223.1| Ribosomal protein L13a [Homo sapiens]
 gi|48734868|gb|AAH71929.1| Ribosomal protein L13a [Homo sapiens]
 gi|119572880|gb|EAW52495.1| ribosomal protein L13a, isoform CRA_a [Homo sapiens]
 gi|158255676|dbj|BAF83809.1| unnamed protein product [Homo sapiens]
 gi|190689373|gb|ACE86461.1| ribosomal protein L13a protein [synthetic construct]
 gi|190690735|gb|ACE87142.1| ribosomal protein L13a protein [synthetic construct]
 gi|261861334|dbj|BAI47189.1| ribosomal protein L13a [synthetic construct]
 gi|312151360|gb|ADQ32192.1| ribosomal protein L13a [synthetic construct]
          Length = 203

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|507577548|ref|XP_004672300.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Jaculus jaculus]
          Length = 203

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 136/184 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++ 
Sbjct: 187 KKIN 190



>gi|395334661|gb|EJF67037.1| 60S ribosomal protein L13a [Dichomitus squalens LYAD-421 SS1]
          Length = 200

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 6/191 (3%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+IL+GQ++ VVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILNGQKITVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK+FEG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTARGAAALERLKLFEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR V+A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKVKAQAFHERKTAALKLRQKALADA 188

Query: 189 NKEVTTPLLQK 199
                TP  +K
Sbjct: 189 -----TPSFEK 194



>gi|392597311|gb|EIW86633.1| ribosomal protein L16a [Coniophora puteana RWD-64-598 SS2]
          Length = 200

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/194 (56%), Positives = 142/194 (73%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IV+K++LSGQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIVSKQVLSGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARG AAL +LK++EG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILFRAIRGMVPHKTARGTAALERLKLYEGVPPPYDRKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA  ++
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAVKLRQKATAEA 188

Query: 189 NKEVTTPLLQKTGY 202
           +       L + GY
Sbjct: 189 SSSFQQ--LTQLGY 200



>gi|440898008|gb|ELR49590.1| 60S ribosomal protein L13a, partial [Bos grunniens mutus]
          Length = 199

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 142/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 123 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE 182

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 183 KKIGKFTEVLKTHGF 197



>gi|301764969|ref|XP_002917886.1| PREDICTED: 60S ribosomal protein L13a-like [Ailuropoda melanoleuca]
 gi|345786084|ref|XP_003432774.1| PREDICTED: 60S ribosomal protein L13a [Canis lupus familiaris]
 gi|327239284|gb|AEA39509.1| ribosomal protein L13A [Ailuropoda melanoleuca]
 gi|327239388|gb|AEA39561.1| ribosomal protein L13A [Ailuropoda melanoleuca]
          Length = 203

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|355756040|gb|EHH59787.1| hypothetical protein EGM_09978, partial [Macaca fascicularis]
          Length = 199

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 123 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 182

Query: 190 KEV 192
           K++
Sbjct: 183 KKI 185



>gi|472381083|ref|XP_004409938.1| PREDICTED: 60S ribosomal protein L13a [Odobenus rosmarus divergens]
          Length = 203

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|478532374|ref|XP_004440337.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Ceratotherium
           simum simum]
          Length = 203

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|383862429|ref|XP_003706686.1| PREDICTED: 60S ribosomal protein L13a-like [Megachile rotundata]
          Length = 204

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 140/203 (68%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRLAAI+AK IL G +V+VVR E +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNKVIVVRSEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LK++EG PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKIYEGCPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  +  LE KR VR+    +++  L K+T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVHTLENKRRVRSILEVQKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A +   K     T ++   GY
Sbjct: 181 KQAGQTVTKATAPYTAIINDFGY 203



>gi|47086477|ref|NP_997949.1| 60S ribosomal protein L13a [Danio rerio]
 gi|28838762|gb|AAH47855.1| Ribosomal protein L13a [Danio rerio]
          Length = 205

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 110/198 (55%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + ++IDG+GHLLGRL+AIVAK++L G ++VVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLIIDGRGHLLGRLSAIVAKQVLLGHKIVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RG +H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K      
Sbjct: 65  NTNPSRGSYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK   K+T++A 
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLRYSKKKVEMKLTKQAE 184

Query: 186 E--QSNKEVTTPLLQKTG 201
           +  +S   V T +L+K G
Sbjct: 185 KNVESKIAVYTDVLKKYG 202



>gi|281348356|gb|EFB23940.1| hypothetical protein PANDA_006273 [Ailuropoda melanoleuca]
          Length = 199

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 123 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 182

Query: 190 KEV 192
           K++
Sbjct: 183 KKI 185



>gi|389608161|dbj|BAM17692.1| ribosomal protein L13A [Papilio xuthus]
          Length = 204

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 141/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRLAA++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIIIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR  +A      ++ L +IT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRRFKAIHKVAFERRLKRIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A E+  K     T ++Q  GY
Sbjct: 181 KEAGEKVAKATAPFTSIIQSYGY 203



>gi|340709161|ref|XP_003393181.1| PREDICTED: 60S ribosomal protein L13a-like [Bombus terrestris]
          Length = 204

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 141/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRLAAI+AK IL G +++V+R E +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNKIIVIRSEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LKV+EG PPPYD+ K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLKVYEGCPPPYDRRKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  ++ LE KR VR+    +++  L K+T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSILEVQKRDKLKKLT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A +   K     T ++   GY
Sbjct: 181 KQAGQTVAKATAPYTAIINNFGY 203



>gi|166952291|gb|ABZ04228.1| ribosomal protein rpl13a [Lineus viridis]
          Length = 203

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++ID +GHLLGRLA+IVAK IL+GQRVV++RCE INISGS +RNKLKY DF+ KRCNVNP
Sbjct: 8   IIIDARGHLLGRLASIVAKTILNGQRVVILRCEEINISGSFYRNKLKYLDFIKKRCNVNP 67

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFH R+PSKIFWRTVRGMVPHK +RG  AL +LKVFEGIP PYDK K          
Sbjct: 68  KRGPFHFRAPSKIFWRTVRGMVPHKLSRGKEALDRLKVFEGIPQPYDKEKRMVVPAALKV 127

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
               P R+   +GR+SHE+GWKYQ+ +  LE +R  +++ +  RKKA      KA E   
Sbjct: 128 LRLHPRRKSCRLGRISHEIGWKYQNVVNTLEGRRRAKSAEFYRRKKAETIWRTKATENVK 187

Query: 190 KEVTTP--LLQKTGY 202
            ++ +   +++  GY
Sbjct: 188 AKIASQQKIIESYGY 202



>gi|395858350|ref|XP_003801534.1| PREDICTED: 60S ribosomal protein L13a [Otolemur garnettii]
          Length = 203

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALRV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|296414579|ref|XP_002836976.1| 60S ribosomal protein L16 [Tuber melanosporum Mel28]
 gi|295632823|emb|CAZ81167.1| unnamed protein product [Tuber melanosporum]
          Length = 198

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 142/199 (71%), Gaps = 6/199 (3%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR+KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASAVAKQLLNGQKIVVVRCEDLNISGEFFRSKLKYHAYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N  RGPFH R+PS+IF++TVRGMV HKTARG AAL +LKVFEGIPPPYD  K      
Sbjct: 64  RYNKTRGPFHFRAPSRIFYKTVRGMVSHKTARGQAALERLKVFEGIPPPYDTKKRMVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++  VGRLSHEVGWKYQD ++ LE++R  +++A+  RKKAL K    A 
Sbjct: 124 ALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVERLEERRKAKSTAFYARKKALVKKLAIAA 183

Query: 186 EQ--SNKEVTTPLLQKTGY 202
           ++  +NKE     L K GY
Sbjct: 184 DKTSTNKEE----LVKLGY 198



>gi|342356425|gb|AEL28871.1| ribosomal protein L13A [Heliconius melpomene cythera]
          Length = 204

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 140/204 (68%), Gaps = 4/204 (1%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSK+ W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKVLWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR  +       +K L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVSYEKKLKKIT 180

Query: 182 RKAYEQSNKEVTTPL---LQKTGY 202
           ++A E+  K  T P    +Q  GY
Sbjct: 181 KEAGEKVAK-ATAPFNAVMQSYGY 203



>gi|149445952|ref|XP_001507007.1| PREDICTED: 60S ribosomal protein L13a-like [Ornithorhynchus
           anatinus]
          Length = 203

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 141/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  RKK   ++ ++A +   
Sbjct: 127 VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRRKKKQTRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
            +++  T +L++ G
Sbjct: 187 SKISKYTEVLKQHG 200



>gi|507708723|ref|XP_004646507.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Octodon degus]
 gi|512857924|ref|XP_004888972.1| PREDICTED: 60S ribosomal protein L13a-like isoform X2
           [Heterocephalus glaber]
 gi|513011139|ref|XP_004866976.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Heterocephalus
           glaber]
          Length = 203

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 142/194 (73%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K+++  T +L+  G
Sbjct: 187 KKISKFTEVLKTHG 200



>gi|351702733|gb|EHB05652.1| 60S ribosomal protein L13a, partial [Heterocephalus glaber]
          Length = 199

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 142/194 (73%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 123 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 182

Query: 190 KEVT--TPLLQKTG 201
           K+++  T +L+  G
Sbjct: 183 KKISKFTEVLKTHG 196



>gi|402221819|gb|EJU01887.1| ribosomal protein L13 [Dacryopinax sp. DJM-731 SS1]
          Length = 187

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 138/182 (75%), Gaps = 1/182 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           ++ +F   +VIDGKGHLLGR+A+I+AK+ILSGQ++VV+RCE INISGS FRNKL+Y +FL
Sbjct: 1   MSQIFSAPIVIDGKGHLLGRIASIIAKQILSGQKIVVLRCEEINISGSFFRNKLRYHNFL 60

Query: 62  TKRCNVNPAR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKX 120
            KR  VNP + GPFH R+PS+I +R VRGM PHKTARGAAAL +L+++EG+PPPYDK K 
Sbjct: 61  HKRHIVNPKKSGPFHERAPSRILYRAVRGMTPHKTARGAAALKRLQLYEGVPPPYDKKKK 120

Query: 121 XXXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKI 180
                       KPGR++  + RLSHEVGW Y+D +  LE+KR V+A A+ ERK  LA +
Sbjct: 121 MVVPEALRVLRLKPGRKYCTIKRLSHEVGWGYKDVVDKLEEKRKVKAQAFFERKVGLAVL 180

Query: 181 TR 182
           +R
Sbjct: 181 SR 182



>gi|410050483|ref|XP_003952917.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
          Length = 208

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAA+VAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 12  LVLDGRGHLLGRLAAMVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 71

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 72  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 131

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 132 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVE 191

Query: 190 KEV 192
           K++
Sbjct: 192 KKI 194



>gi|327283014|ref|XP_003226237.1| PREDICTED: 60S ribosomal protein L13a-like [Anolis carolinensis]
          Length = 203

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 141/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  ++  +  +KK L K+ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAITATLEEKRKQKSKLHYAKKKQLMKLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
            ++   T +L++ G
Sbjct: 187 PKIAKYTDILKQYG 200



>gi|354493134|ref|XP_003508699.1| PREDICTED: 60S ribosomal protein L13a-like [Cricetulus griseus]
          Length = 203

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 141/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKV +GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKVHYRKKKQLLRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K+++  T +L+  G
Sbjct: 187 KKISKFTEVLKTNG 200



>gi|119496591|ref|XP_001265069.1| 60S ribosomal protein L16 [Neosartorya fischeri NRRL 181]
 gi|119413231|gb|EAW23172.1| 60S ribosomal protein L13a [Neosartorya fischeri NRRL 181]
          Length = 202

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 129/168 (76%), Gaps = 1/168 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKT RGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKA 175



>gi|426235490|ref|XP_004011713.1| PREDICTED: 60S ribosomal protein L13a-like [Ovis aries]
          Length = 203

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 141/195 (72%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L GQ+VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGQKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP  +F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPACKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE 186

Query: 190 KEVT--TPLLQKTGY 202
           K++   T +L+  G+
Sbjct: 187 KKIGKFTEVLKTHGF 201



>gi|326478481|gb|EGE02491.1| 60S ribosomal protein L16 [Trichophyton equinum CBS 127.97]
          Length = 202

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 130/172 (75%), Gaps = 1/172 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  V IDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVYIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKIT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEGIP PYDK K     
Sbjct: 64  RFNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGIPEPYDKKKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKA 176
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ +AY ERKKA
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKGAAYYERKKA 175



>gi|114663280|ref|XP_001167494.1| PREDICTED: 60S ribosomal protein L13a-like isoform 4 [Pan
           troglodytes]
 gi|410050485|ref|XP_003952918.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
          Length = 203

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAA+VAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAMVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|397509354|ref|XP_003825090.1| PREDICTED: 60S ribosomal protein L13a-like [Pan paniscus]
          Length = 203

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGWKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|121702595|ref|XP_001269562.1| 60S ribosomal protein L16 [Aspergillus clavatus NRRL 1]
 gi|119397705|gb|EAW08136.1| 60S ribosomal protein L13a [Aspergillus clavatus NRRL 1]
          Length = 202

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 140/195 (71%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKITRFNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKT RGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +   +A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLVQAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
              E T   L + GY
Sbjct: 188 GVDEKTKSQLAEYGY 202



>gi|310790306|gb|EFQ25839.1| ribosomal protein L13 [Glomerella graminicola M1.001]
          Length = 202

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (69%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVR E +NISG  FR KLKY  +L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRTEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYD  K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDTQKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK   +    A
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAQRQLSDA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   E T   L+  GY
Sbjct: 184 KKNAKVDEKTAQALEAFGY 202



>gi|332864827|ref|XP_001154037.2| PREDICTED: 60S ribosomal protein L13a-like isoform 2 [Pan
           troglodytes]
 gi|410058663|ref|XP_003951010.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
 gi|410058665|ref|XP_003951011.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
 gi|410058667|ref|XP_003951012.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
 gi|410058669|ref|XP_003951013.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
 gi|410058671|ref|XP_003951014.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
          Length = 203

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGWKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 MRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLWKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|62897053|dbj|BAD96467.1| ribosomal protein L13a variant [Homo sapiens]
          Length = 203

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL  LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDHLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|409083452|gb|EKM83809.1| hypothetical protein AGABI1DRAFT_81534 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426201504|gb|EKV51427.1| ribosomal protein L13 [Agaricus bisporus var. bisporus H97]
          Length = 200

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 139/194 (71%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+ILSGQ++VVVRCE IN+SGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILSGQKIVVVRCEEINVSGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKT RGAAAL +LK+FEG+PPPYDK K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTPRGAAALERLKLFEGVPPPYDKKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE KR ++A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEDKRKLKAQAFHERKVAALKLRQKAVSDA 188

Query: 189 NKEVTTPLLQKTGY 202
                   L + GY
Sbjct: 189 TPSFQQ--LAQLGY 200



>gi|225717546|gb|ACO14619.1| 60S ribosomal protein L13A [Caligus clemensi]
          Length = 206

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 106/175 (60%), Positives = 129/175 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDG+GHLLGRL++IVAK +L+G RVVVVRCE IN+SG+ +RNKLKY  FL  RCNV P
Sbjct: 9   VVIDGRGHLLGRLSSIVAKFLLNGNRVVVVRCEGINLSGNFYRNKLKYLKFLRLRCNVKP 68

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGPFH R+PSKIF RTVRGM+PHK+ RG  AL +L+ FEG+PPPYDK K          
Sbjct: 69  SRGPFHFRAPSKIFLRTVRGMMPHKSERGKDALKRLETFEGVPPPYDKKKKMVIPSALKV 128

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
              KPGR+F  VGRLSH+VGWKYQD +  LE KR V++ AY   K  L K+ ++ 
Sbjct: 129 MRLKPGRKFCTVGRLSHDVGWKYQDVVATLEAKRRVKSEAYFNNKVKLMKLKKEV 183



>gi|344269432|ref|XP_003406556.1| PREDICTED: 60S ribosomal protein L13a-like [Loxodonta africana]
          Length = 260

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 142/196 (72%), Gaps = 2/196 (1%)

Query: 8   RRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNV 67
           R +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N 
Sbjct: 62  RVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 121

Query: 68  NPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXX 127
           NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K        
Sbjct: 122 NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 181

Query: 128 XXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQ 187
                KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A + 
Sbjct: 182 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKN 241

Query: 188 SNKEVT--TPLLQKTG 201
             K++   T +L+  G
Sbjct: 242 VEKKINRYTEVLKTHG 257



>gi|389610885|dbj|BAM19053.1| ribosomal protein L13A [Papilio polytes]
          Length = 204

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + ++IDG+GHLLGRL+A++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIIIDGRGHLLGRLSAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR  +A      ++ L +IT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKAVHKVAFERRLKRIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A E+  K     T ++Q  GY
Sbjct: 181 KEAGEKVAKATAPFTSIIQSYGY 203



>gi|348559516|ref|XP_003465562.1| PREDICTED: 60S ribosomal protein L13a-like [Cavia porcellus]
          Length = 203

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|242213173|ref|XP_002472416.1| 60S ribosomal protein L13a [Postia placenta Mad-698-R]
 gi|220728492|gb|EED82385.1| 60S ribosomal protein L13a [Postia placenta Mad-698-R]
          Length = 200

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 141/194 (72%), Gaps = 3/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K++L+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQVLNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGMVPHKTARGAAAL +LK++EG+PPPYD+ K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMVPHKTARGAAALERLKLYEGVPPPYDRKKRMVIPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK A  K+ +KA   +
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAIKLRQKAVADT 188

Query: 189 NKEVTTPLLQKTGY 202
                   L + GY
Sbjct: 189 ASSFEN--LTQLGY 200



>gi|488566004|ref|XP_004472671.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Dasypus
           novemcinctus]
          Length = 203

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           +++
Sbjct: 187 RKI 189



>gi|449304843|gb|EMD00850.1| hypothetical protein BAUCODRAFT_60972 [Baudoinia compniacensis UAMH
           10762]
          Length = 202

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/199 (55%), Positives = 140/199 (70%), Gaps = 2/199 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR+KLKY  FL K+ 
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRSKLKYSAFLRKQT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             N  RG P+H R+P+K+FWRTVRGM+PHKT RGA AL +LKVFEGIPPPYD+ K     
Sbjct: 64  RFNATRGGPWHYRTPAKMFWRTVRGMMPHKTERGAKALERLKVFEGIPPPYDRKKRMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                   KPGR++  VGRL HE GWKY+D ++ LE++R V+  AY ERKKA  K+   A
Sbjct: 124 AALRVLRLKPGRKYCTVGRLGHEFGWKYRDVVERLEERRKVKGQAYYERKKAARKMLADA 183

Query: 185 YEQSN-KEVTTPLLQKTGY 202
            + +   + T   L+  GY
Sbjct: 184 KQNAGVSDETKQQLESLGY 202



>gi|302405445|ref|XP_003000559.1| 60S ribosomal protein L16 [Verticillium albo-atrum VaMs.102]
 gi|261360516|gb|EEY22944.1| 60S ribosomal protein L16 [Verticillium albo-atrum VaMs.102]
 gi|346972588|gb|EGY16040.1| 60S ribosomal protein L16 [Verticillium dahliae VdLs.17]
          Length = 202

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/201 (55%), Positives = 143/201 (71%), Gaps = 6/201 (2%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVR E +NISG  FR KLKY  +L K  
Sbjct: 4   FESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRAEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS++F++ VRGM+PHKTARGAAAL +LKVFEG+PPPYDK K     
Sbjct: 64  RYNPTRGGPFHFRAPSRVFFKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK---IT 181
                   +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK   +    +
Sbjct: 124 QALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAQRQLADS 183

Query: 182 RKAYEQSNKEVTTPLLQKTGY 202
           +K+ +  +K  TT  L+  GY
Sbjct: 184 KKSAKVDDK--TTKALEAFGY 202



>gi|150981986|gb|ABR87195.1| large subunit ribosomal protein 16 [Pristionchus sp. 10 RS5133]
          Length = 198

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/187 (59%), Positives = 132/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+IVAK+IL GQ++VVVR E I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIVAKQILLGQKIVVVRAEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSP++IFWRTVRGMVPHKT RG AAL  LK FEG P PYDK K          
Sbjct: 63  RRGPFHLRSPNRIFWRTVRGMVPHKTIRGTAALKNLKCFEGCPSPYDKKKKLVVPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + Y   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGAVYYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|507680614|ref|XP_004710493.1| PREDICTED: 60S ribosomal protein L13a [Echinops telfairi]
          Length = 203

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 132/175 (75%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQA 181



>gi|355703776|gb|EHH30267.1| hypothetical protein EGK_10889, partial [Macaca mulatta]
          Length = 199

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LK F+GIPPPYDK K          
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKAFDGIPPPYDKKKRMVVPAALKV 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 123 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 182

Query: 190 KEV 192
           K++
Sbjct: 183 KKI 185



>gi|357602430|gb|EHJ63396.1| 60S ribosomal protein L13a [Danaus plexippus]
          Length = 204

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 139/203 (68%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSK+ W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKVLWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      +PGR++  VGRLSHEVGWKY+D ++ LE KR  +       +  L KIT
Sbjct: 121 VVPAALRVFCLRPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVAYENKLKKIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           ++A E+  K     T ++Q  GY
Sbjct: 181 KEAGEKVAKTTAPFTAIMQSYGY 203



>gi|198285633|gb|ACH85355.1| ribosomal protein L13a [Salmo salar]
          Length = 203

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 3   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 62

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 63  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPA 122

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK + K+++ A 
Sbjct: 123 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYAKKKTVTKLSKLAE 182

Query: 186 EQSNKEVT--TPLLQKTG 201
           +     ++  T +L++ G
Sbjct: 183 KNVESTISKYTAVLKQYG 200



>gi|223646380|gb|ACN09948.1| 60S ribosomal protein L13a [Salmo salar]
 gi|223672227|gb|ACN12295.1| 60S ribosomal protein L13a [Salmo salar]
          Length = 248

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 48  FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 107

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 108 NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPA 167

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK + K+++ A 
Sbjct: 168 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYAKKKTVTKLSKLAE 227

Query: 186 EQSNKEVT--TPLLQKTG 201
           +     ++  T +L++ G
Sbjct: 228 KNVESTISKYTAVLKQYG 245



>gi|223647244|gb|ACN10380.1| 60S ribosomal protein L13a [Salmo salar]
 gi|223673121|gb|ACN12742.1| 60S ribosomal protein L13a [Salmo salar]
          Length = 205

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK + K+++ A 
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYAKKKTVTKLSKLAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +     ++  T +L++ G
Sbjct: 185 KNVESTISKYTAVLKQYG 202



>gi|255718289|ref|XP_002555425.1| 60S ribosomal protein L16 [Lachancea thermotolerans]
 gi|238936809|emb|CAR24988.1| KLTH0G09042p [Lachancea thermotolerans CBS 6340]
          Length = 200

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 135/197 (68%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+ VAK++L+GQ++VVVR E +NISG  FRNKLKY DFL K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAESLNISGEFFRNKLKYHDFLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N  RGPFH R+PS+IF++ VRGMV HKTARG AA+ +LKVFEG+PPPYDK K      
Sbjct: 64  AFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAAMERLKVFEGVPPPYDKKKRVVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KPGR++T VG+LS  VGWKY+D +  LE+KR VR++ Y  +KKA  K    A 
Sbjct: 124 ALRVLRLKPGRKYTTVGKLSTSVGWKYEDVVAKLEEKRKVRSAEYYAKKKAFNKKVTAAK 183

Query: 186 EQSNKEVTTPLLQKTGY 202
             +++      L   GY
Sbjct: 184 AATSESEAAQKLATLGY 200



>gi|507622344|ref|XP_004625632.1| PREDICTED: 60S ribosomal protein L13a-like [Octodon degus]
          Length = 203

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/184 (56%), Positives = 137/184 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFW+TVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWQTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K+++
Sbjct: 187 KKIS 190



>gi|403299252|ref|XP_003940403.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Saimiri
           boliviensis boliviensis]
 gi|403299254|ref|XP_003940404.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 203

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG  AL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQTALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFADLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|197099650|ref|NP_001125810.1| 60S ribosomal protein L13a [Pongo abelii]
 gi|73914070|sp|Q5RA38.3|RL13A_PONAB RecName: Full=60S ribosomal protein L13a
 gi|55729273|emb|CAH91372.1| hypothetical protein [Pongo abelii]
          Length = 203

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N +P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTSP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|33337718|gb|AAQ13495.1|AF109186_1 FWP004 [Homo sapiens]
          Length = 203

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRL AIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLRAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|77404207|ref|NP_775462.2| 60S ribosomal protein L13a [Rattus norvegicus]
 gi|55778547|gb|AAH86382.1| Ribosomal protein L13A [Rattus norvegicus]
 gi|149055977|gb|EDM07408.1| rCG53885, isoform CRA_d [Rattus norvegicus]
 gi|163869618|gb|ABY47887.1| neuroprotective protein 11 [Rattus norvegicus]
          Length = 203

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 140/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKV +GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K++   T +L+  G
Sbjct: 187 KKICKFTEVLKTNG 200



>gi|507686941|ref|XP_004640903.1| PREDICTED: 60S ribosomal protein L13a-like [Octodon degus]
          Length = 203

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 141/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIV K++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVVKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VHLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K+++  T +L+  G
Sbjct: 187 KKISKFTEVLKTHG 200



>gi|431920762|gb|ELK18535.1| 60S ribosomal protein L13a [Pteropus alecto]
          Length = 448

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 145/204 (71%), Gaps = 11/204 (5%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           +V  + +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL K
Sbjct: 121 LVSSQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRK 180

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           R N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K    
Sbjct: 181 RMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVV 240

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L  +T +
Sbjct: 241 PAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQL--MTER 298

Query: 184 AYE------QSNKEVTTPLLQKTG 201
           AY+      Q+ K V   LL +TG
Sbjct: 299 AYQKQPTIFQNKKRV---LLGETG 319



>gi|380471255|emb|CCF47368.1| 60S ribosomal protein L16, partial [Colletotrichum higginsianum]
          Length = 195

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 111/195 (56%), Positives = 138/195 (70%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+IVAK++L+GQ++VVVR E +NISG  FR KLKY  +L K    NP
Sbjct: 1   VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRTEALNISGEFFRAKLKYHAYLRKMTRYNP 60

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PPPYDK K         
Sbjct: 61  TRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVPQALR 120

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKK-ALAKITRKAYEQ 187
               +PGR++  VGRLSHEVGWKYQD +  LE++R  + +AY ERKK A  ++T      
Sbjct: 121 VLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYERKKVAQRQLTDAKKNA 180

Query: 188 SNKEVTTPLLQKTGY 202
              + T   L+  GY
Sbjct: 181 KVDQKTAQALEAFGY 195



>gi|31340317|sp|Q8MUR4.1|RL13A_CHOPR RecName: Full=60S ribosomal protein L13a
 gi|21435720|gb|AAM53949.1|AF514334_1 ribosomal protein L13A [Choristoneura parallela]
          Length = 204

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 140/203 (68%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKI W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRSYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY++ ++ LE KR  +A      ++ L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKFKAVHKVAYERKLKKIT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           + A  + +K     T ++Q  GY
Sbjct: 181 KDAGAKVSKATAPFTAVIQSYGY 203



>gi|444705748|gb|ELW47139.1| Aldehyde dehydrogenase family 16 member A1 [Tupaia chinensis]
          Length = 1274

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 136/183 (74%)

Query: 10   VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
            +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 926  LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 985

Query: 70   ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 986  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 1045

Query: 130  XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
               KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 1046 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 1105

Query: 190  KEV 192
            K++
Sbjct: 1106 KKI 1108



>gi|62083489|gb|AAX62469.1| ribosomal protein L13a [Lysiphlebus testaceipes]
          Length = 204

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 138/203 (67%), Gaps = 2/203 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T   ++ ++IDG+GHLLGRLAAIV+K IL G  V+VVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFTQKPILIDGRGHLLGRLAAIVSKTILQGNTVIVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSKIFW+TVRGMVPHKT RG  AL +LK +EG P PYD  K  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKIFWKTVRGMVPHKTERGKQALRRLKCYEGCPAPYDARKRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+  ++ LE KR V+     +++  L ++T
Sbjct: 121 VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKSVVRTLENKRKVKTIINIQKRDKLKELT 180

Query: 182 RKAYEQSNKEVT--TPLLQKTGY 202
           + A  +  K     T ++   GY
Sbjct: 181 QTAGTKVAKTTAPYTAIINSYGY 203



>gi|311334488|emb|CBN08625.1| small nucleolar RNA, C/D box 32A [Microcosmus squamiger]
          Length = 206

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 130/188 (69%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F++  VID   HLLGRL+A+VAK IL+GQRVVVVRCE + ISG+ +RNKLKY  FL KR 
Sbjct: 5   FQKVKVIDANNHLLGRLSAVVAKTILNGQRVVVVRCEGLLISGNFYRNKLKYLAFLRKRI 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP RGPFH R+PSKI WRTVRGM+PHK  RG AAL +LKVFEGIP PYDK K      
Sbjct: 65  NTNPKRGPFHFRAPSKILWRTVRGMLPHKLKRGEAALDRLKVFEGIPSPYDKKKRVIVPS 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP RRF  + RLSHEVGWKY+D + ALE KR  R+  Y ERK+ LA + +KA 
Sbjct: 125 ALKVVKLKPQRRFAPLSRLSHEVGWKYRDVVSALEDKRKARSKIYWERKQHLAGLRKKAI 184

Query: 186 EQSNKEVT 193
                ++ 
Sbjct: 185 SNVQSKIA 192



>gi|55050|emb|CAA35908.1| tum- transplantation antigen P198 [Mus musculus]
          Length = 203

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 140/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKV +GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTTTLEEKRKEKAKMHYRKKKQILRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K++   T +L+  G
Sbjct: 187 KKICKFTEVLKTNG 200



>gi|31981945|ref|NP_033464.2| 60S ribosomal protein L13a [Mus musculus]
 gi|136478|sp|P19253.4|RL13A_MOUSE RecName: Full=60S ribosomal protein L13a; AltName:
           Full=Transplantation antigen P198; AltName:
           Full=Tum-P198 antigen
 gi|12841255|dbj|BAB25132.1| unnamed protein product [Mus musculus]
 gi|52078403|gb|AAH82289.1| Ribosomal protein L13A [Mus musculus]
 gi|56541254|gb|AAH86896.1| Ribosomal protein L13A [Mus musculus]
 gi|71059667|emb|CAJ18377.1| Rpl13a [Mus musculus]
 gi|74217617|dbj|BAE33555.1| unnamed protein product [Mus musculus]
 gi|74220084|dbj|BAE40618.1| unnamed protein product [Mus musculus]
 gi|74223160|dbj|BAE40717.1| unnamed protein product [Mus musculus]
 gi|74226857|dbj|BAE27073.1| unnamed protein product [Mus musculus]
 gi|148690859|gb|EDL22806.1| mCG23455, isoform CRA_e [Mus musculus]
          Length = 203

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 140/194 (72%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKV +GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K++   T +L+  G
Sbjct: 187 KKICKFTEVLKTNG 200



>gi|470318844|gb|EMR10485.1| hypothetical protein PNEG_01198 [Pneumocystis murina B123]
          Length = 197

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 143/201 (71%), Gaps = 6/201 (2%)

Query: 4   MVFERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLT 62
           M+F++  +V+DGKGHLLGRLA++VAK++L+GQ++V+VRCE INISG  FRNKLK   FL 
Sbjct: 1   MLFQKEPIVVDGKGHLLGRLASVVAKQLLNGQKIVIVRCEEINISGEFFRNKLKMHAFLR 60

Query: 63  KRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXX 122
           KR   N  RGPFH R+PS+I +R +RGM+PHK ARG++AL +LKVFEGIPPPYDK K   
Sbjct: 61  KRTRFNATRGPFHFRAPSRIMYRAIRGMIPHKMARGSSALERLKVFEGIPPPYDKKKRMV 120

Query: 123 XXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITR 182
                     KPGR+F  VGRLS E+GWKY++ I  LE+KR +R+ AY   K A      
Sbjct: 121 VPEALRVLRLKPGRKFCTVGRLSKEIGWKYENIISKLEEKRKIRSHAYYTTKVA----KE 176

Query: 183 KAYEQSNKEVTTP-LLQKTGY 202
           K + ++ K V+T  +L++ GY
Sbjct: 177 KKFLEAKKNVSTSKILEEFGY 197



>gi|297667473|ref|XP_002812003.1| PREDICTED: 60S ribosomal protein L13a-like isoform 3 [Pongo abelii]
          Length = 203

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 135/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VV+VRCE INISGS +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVIVRCEGINISGSFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +L+VF+GIPPPY K K          
Sbjct: 67  SRGPYHFRTPSRIFWRTVRGMLPHKTKRGQAALDRLRVFDGIPPPYHKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|160550223|gb|ABX44816.1| putative 60S ribosomal protein RPL13A [Flustra foliacea]
          Length = 173

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 104/166 (62%), Positives = 123/166 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           V+ID +GHLLGRLA+I+AK +L GQRVVVVRCE INISGS +RNKLKY DF+ KRCN NP
Sbjct: 8   VLIDARGHLLGRLASIIAKTLLRGQRVVVVRCEEINISGSFYRNKLKYLDFMRKRCNTNP 67

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+HLR+PSKI WR +RGMVPHKT RG  AL   + FEGIP PYDK+K          
Sbjct: 68  SRGPYHLRAPSKILWRVIRGMVPHKTNRGKEALYLFRSFEGIPAPYDKMKRMVIPSALKI 127

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKK 175
              KP RR+  +GRLSHEVGWKYQ  I  LE+KR VR+  Y  +K+
Sbjct: 128 TRMKPTRRYCRLGRLSHEVGWKYQSVIATLEEKRKVRSEKYYLQKR 173



>gi|154091237|gb|ABS57429.1| ribosomal protein L13a [Heliconius melpomene]
          Length = 196

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 136/195 (69%), Gaps = 1/195 (0%)

Query: 2   LTMVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFL 61
           +T    + +VIDG+GHLLGRLAA++AK +L G +VVVVRCE +NISG+ FRNKLK+  FL
Sbjct: 1   MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFL 60

Query: 62  TKRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXX 121
            KRCNVNPARGPFH R+PSK+ W+TVRGM+PHKT RG  AL +L+ ++G PPPYD  +  
Sbjct: 61  RKRCNVNPARGPFHFRAPSKVLWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRV 120

Query: 122 XXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKIT 181
                      KPGR++  VGRLSHEVGWKY+D ++ LE KR  +       +K L KIT
Sbjct: 121 VVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVSYEKKLKKIT 180

Query: 182 RKAYEQSNKEVTTPL 196
           ++A E+  K  T P 
Sbjct: 181 KEAGEKVAK-ATAPF 194



>gi|421975934|gb|AFX72999.1| 60S ribosomal protein L13a [Spirometra erinaceieuropaei]
          Length = 202

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (70%), Gaps = 3/202 (1%)

Query: 4   MVFERR-VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLT 62
           M+F+R+ ++ID +GHLLGRLA+IVAK +L GQ+VVVVRCE INISGS +RNKLKY++FL 
Sbjct: 1   MIFQRKAIIIDARGHLLGRLASIVAKTLLQGQKVVVVRCEQINISGSFYRNKLKYREFLR 60

Query: 63  KRCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXX 122
           KR N NP+ GP+H RSP+KIFWRTVRGM+PHK  RG  AL KLK +EGIPPPYDK K   
Sbjct: 61  KRMNTNPSHGPYHYRSPAKIFWRTVRGMLPHKLYRGKEALGKLKCYEGIPPPYDKKKRVA 120

Query: 123 XXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITR 182
                     K  R+F V+ RLSHEVGWKYQ+ I+ +E +R  +A+ + ++KK  A   +
Sbjct: 121 VPSALRVLRLKQRRKFCVLSRLSHEVGWKYQNVIEKMEGRRKAKAAVWYKKKKVDAVPDQ 180

Query: 183 KAYEQSNKEVT--TPLLQKTGY 202
            A  Q+   +     +L+K GY
Sbjct: 181 AARGQAKAAIAPYKAILRKYGY 202



>gi|298714763|emb|CBJ25662.1| 60S ribosomal protein L13a [Ectocarpus siliculosus]
          Length = 198

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 137/198 (69%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
           +FE  V +DG+GHLLGRLA++VAKE+L GQ+VVVVRCE I ISGS  RNK+KY  +  KR
Sbjct: 1   MFEAPVTVDGRGHLLGRLASVVAKELLGGQKVVVVRCEQITISGSLVRNKVKYMQYKKKR 60

Query: 65  CNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
            N NP RGP+H RSP++IFWRTVRGM+P KTARG  AL++L  FEGIP PYDK K     
Sbjct: 61  HNTNPKRGPYHFRSPARIFWRTVRGMLPRKTARGEEALARLSCFEGIPAPYDKKKRMVVP 120

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                    PGRRF V+GRLS EVGW + + IK LE +R +++ AY   KKA  ++  KA
Sbjct: 121 NALQVIRMAPGRRFCVLGRLSEEVGWPHAELIKRLEAQRKIKSEAYYVDKKAAKQLKDKA 180

Query: 185 YEQSNKEVTTPLLQKTGY 202
             ++N     P+L++ G+
Sbjct: 181 TAEANLAAVAPVLEEYGF 198



>gi|209733998|gb|ACI67868.1| 60S ribosomal protein L13a [Salmo salar]
 gi|223646856|gb|ACN10186.1| 60S ribosomal protein L13a [Salmo salar]
 gi|223672717|gb|ACN12540.1| 60S ribosomal protein L13a [Salmo salar]
          Length = 205

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK   K+++ A 
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYTKKKTEIKLSKLAE 184

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    +++  T +L++ G
Sbjct: 185 KNVESKISKYTAVLKQYG 202



>gi|504133232|ref|XP_004579204.1| PREDICTED: 60S ribosomal protein L13a-like [Ochotona princeps]
          Length = 203

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 104/184 (56%), Positives = 135/184 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG GHLLGRLAAI+AK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGHGHLLGRLAAIMAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT +G AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKQGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K++ 
Sbjct: 187 KKIN 190



>gi|198285601|gb|ACH85339.1| ribosomal protein L13a [Salmo salar]
          Length = 204

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 2/198 (1%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK++L G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 4   FNKVLLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 64  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPA 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A     +KK   K+++ A 
Sbjct: 124 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYTKKKTEIKLSKLAE 183

Query: 186 EQSNKEVT--TPLLQKTG 201
           +    +++  T +L++ G
Sbjct: 184 KNVESKISKYTAVLKQYG 201



>gi|390365124|ref|XP_003730751.1| PREDICTED: 60S ribosomal protein L13a-like isoform 1
           [Strongylocentrotus purpuratus]
 gi|390365126|ref|XP_003730752.1| PREDICTED: 60S ribosomal protein L13a-like isoform 2
           [Strongylocentrotus purpuratus]
          Length = 203

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +VIDG+GHLLGRLA+IVAK +L GQ+VVVVRCELINISGS +RNKLKY  F+ KR 
Sbjct: 4   FAKVLVIDGRGHLLGRLASIVAKNLLQGQKVVVVRCELINISGSFYRNKLKYMQFMRKRT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N  P+RGP+HLRSPS++FWR +RGM+PHK  RG  AL +LKVFEG P PYD+ K      
Sbjct: 64  NTKPSRGPYHLRSPSRMFWRVIRGMLPHKRTRGKDALERLKVFEGCPAPYDRKKRFVVPS 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                  KP R+F V+GRL+HEVGWKY++ I+ALE+KR  RA  + +++   + + RKA
Sbjct: 124 ALRVMRLKPNRKFCVLGRLAHEVGWKYKNIIEALEEKRKARAHLHYQKELRKSALRRKA 182



>gi|72044438|ref|XP_784515.1| PREDICTED: 60S ribosomal protein L13a-like isoform 3
           [Strongylocentrotus purpuratus]
          Length = 203

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +VIDG+GHLLGRLA+IVAK +L GQ+VVVVRCELINISGS +RNKLKY  F+ KR 
Sbjct: 4   FAKVLVIDGRGHLLGRLASIVAKNLLQGQKVVVVRCELINISGSFYRNKLKYMQFMRKRT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N  P+RGP+HLRSPS++FWR +RGM+PHK  RG  AL +LKVFEG P PYD+ K      
Sbjct: 64  NTKPSRGPYHLRSPSRMFWRVIRGMLPHKRTRGKDALERLKVFEGCPAPYDRKKRFVVPS 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
                  KP R+F V+GRL+HEVGWKY++ I+ALE+KR  RA  + +++   + + RKA
Sbjct: 124 ALRVMRLKPNRKFCVLGRLAHEVGWKYKNIIEALEEKRKARAHLHYQKELRKSALRRKA 182



>gi|409051687|gb|EKM61163.1| hypothetical protein PHACADRAFT_247592 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 200

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 134/176 (76%), Gaps = 1/176 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+I++K+IL+GQ++VVVRCE INISGS FRNKL+Y +FL KR  VNP
Sbjct: 9   IVIDGKGHLLGRLASIISKQILNGQKIVVVRCEEINISGSFFRNKLRYHNFLHKRHIVNP 68

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PSKI +R +RGM+PHKTARGAAAL +LK+FEG+PPPYD  K         
Sbjct: 69  KKSGPFHHRAPSKILYRAIRGMLPHKTARGAAALERLKLFEGVPPPYDSKKRMVVPEALR 128

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKA 184
               KPGR++  V RLSHEVGW Y+D +  LE+KR ++A A+ ERK    K+ +KA
Sbjct: 129 VLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLVSIKLRQKA 184



>gi|307207585|gb|EFN85250.1| 60S ribosomal protein L13a [Harpegnathos saltator]
          Length = 197

 Score =  221 bits (564), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDG+GHLLGRLAAI+AK IL G +V+VVR E +NISG+ FRNKLK+  FL KRCNVNP
Sbjct: 2   ILIDGRGHLLGRLAAIIAKTILEGNKVIVVRSEQLNISGNFFRNKLKFMSFLRKRCNVNP 61

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           ARGPFH R+PSKI W+TVRGM+PHKT RG  AL +LKV+EG PPPYD+ K          
Sbjct: 62  ARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKVYEGCPPPYDRRKRVVVPGAMRV 121

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
              KPGR++  VGRLSHEVGWKY+  ++ LE KR VR+    +++  L K+T++
Sbjct: 122 MCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSILEIQKRNKLKKLTKQ 175



>gi|226490975|ref|NP_001147262.1| 60S ribosomal protein L13a-2 [Zea mays]
 gi|195609234|gb|ACG26447.1| 60S ribosomal protein L13a-2 [Zea mays]
          Length = 202

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 111/195 (56%), Positives = 139/195 (71%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           VVIDGKGHLLGRLA+ VAK++L+GQ++VVVRC  +NISG  FR KLKY  +L K    NP
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCVALNISGEFFRAKLKYHAYLRKITRFNP 67

Query: 70  ARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            RG PFH R+PS+IF++ VRGM+PHKT RGAAAL +LKVFEG+PPPYDK K         
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQS 188
               +PGR++  VGRLSHEVGWKYQD +  LE++R V++SAY ERKKA  +   +A + +
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLVQAQKSA 187

Query: 189 N-KEVTTPLLQKTGY 202
              E T   L + GY
Sbjct: 188 GVDEKTKSQLAEYGY 202



>gi|478261744|gb|ENN80891.1| hypothetical protein YQE_02680, partial [Dendroctonus ponderosae]
          Length = 854

 Score =  221 bits (564), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 138/198 (69%), Gaps = 2/198 (1%)

Query: 7   ERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCN 66
            + ++ID KGHLLGRLA +VAK +L+G +VVVVRCE +NISG+ FRNKLK+  FL KRCN
Sbjct: 656 HKAILIDAKGHLLGRLATVVAKLLLNGDKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCN 715

Query: 67  VNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXX 126
           VNPARGPFH R+PS+IFWRTVRGM+PHKT RG  AL KLK +EGIP PY   K       
Sbjct: 716 VNPARGPFHFRAPSRIFWRTVRGMLPHKTVRGKDALRKLKSYEGIPEPYSAKKRLVVPGA 775

Query: 127 XXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYE 186
                 KPGR+F  VGRLS+EVGWKYQ  ++A+E KR V      +++  + K+T +A E
Sbjct: 776 LRVICLKPGRKFCHVGRLSNEVGWKYQRVVRAVETKRKVNEVLSIKKRDKVRKLTAQASE 835

Query: 187 QSNKEVT--TPLLQKTGY 202
           +  K+V   T ++   GY
Sbjct: 836 KVAKQVKPFTAIINSYGY 853



>gi|332373202|gb|AEE61742.1| unknown [Dendroctonus ponderosae]
          Length = 213

 Score =  221 bits (564), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 137/195 (70%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++ID KGHLLGRLA +VAK +L+G +VVVVRCE +NISG+ FRNKLK+  FL KRCNVNP
Sbjct: 18  ILIDAKGHLLGRLATVVAKLLLNGDKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNP 77

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           ARGPFH R+PS+IFWRTVRGM+PHKT RG  AL KLK +EGIP PY   K          
Sbjct: 78  ARGPFHFRAPSRIFWRTVRGMLPHKTVRGKDALRKLKSYEGIPEPYSAKKRLVVPGALRV 137

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KPGR+F  VGRLS+EVGWKYQ  ++A+E KR V      +++  + K+T +A E+  
Sbjct: 138 ICLKPGRKFCHVGRLSNEVGWKYQRVVRAVETKRKVNEVLSIKKRDKVRKLTAQASEKVA 197

Query: 190 KEVT--TPLLQKTGY 202
           K+V   T ++   GY
Sbjct: 198 KQVKPFTAIINSYGY 212



>gi|365983664|ref|XP_003668665.1| ribosomal protein L16 [Naumovozyma dairenensis CBS 421]
 gi|343767432|emb|CCD23422.1| hypothetical protein NDAI_0B03880 [Naumovozyma dairenensis CBS 421]
          Length = 200

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 128/174 (73%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE   V+DGKGHLLGRLA+IVAK+IL+GQ+VVVVR E +NISG  FRNKLKY D+L K  
Sbjct: 4   FEPVFVVDGKGHLLGRLASIVAKQILNGQKVVVVRAEALNISGEFFRNKLKYHDYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N  RGPFH R+PS+IF++ VRGMV HKTARG AAL +LKVFEGIPPPYDK K      
Sbjct: 64  RFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVVPN 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                  KPGR++T +G+LS  VGWKY+D +  LE+KR VR++ Y  +K+A  K
Sbjct: 124 ALRVLRLKPGRKYTTLGKLSSSVGWKYEDVVSKLEEKRKVRSAEYYAKKRAFNK 177



>gi|548747|sp|P35427.2|RL13A_RAT RecName: Full=60S ribosomal protein L13a
 gi|460776|emb|CAA48343.1| rat ribosomal protein L13a [Rattus norvegicus]
          Length = 203

 Score =  221 bits (563), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (71%), Gaps = 2/194 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+ HLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKV +GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVE 186

Query: 190 KEVT--TPLLQKTG 201
           K++   T +L+  G
Sbjct: 187 KKICKFTEVLKTNG 200



>gi|76573377|gb|ABA46793.1| 60S ribosomal protein L13A [Mytilus edulis]
          Length = 203

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 129/171 (75%)

Query: 7   ERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCN 66
           E+ ++ID +GHLLGRLAAIV+K IL GQRVVVVRCE INISG+ FR+KLKY D+L KRCN
Sbjct: 5   EKPIIIDARGHLLGRLAAIVSKTILQGQRVVVVRCEGINISGNFFRSKLKYLDYLKKRCN 64

Query: 67  VNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXX 126
           V P+RGPFH R+PSK+F++TVRGMVPHK  RG  AL++LKVFEG+PPPYDK K       
Sbjct: 65  VKPSRGPFHFRAPSKVFYKTVRGMVPHKQPRGKDALARLKVFEGVPPPYDKQKRQVVPSA 124

Query: 127 XXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKAL 177
                  P R++  + RLSHEVGWKYQ  + +LE +R V++  + ERKK +
Sbjct: 125 LKVLRLNPMRKYCDLNRLSHEVGWKYQRVVSSLEARRKVKSKRFYERKKKI 175



>gi|398412115|ref|XP_003857387.1| 60S ribosomal protein L16 [Zymoseptoria tritici IPO323]
 gi|339477272|gb|EGP92363.1| hypothetical protein MYCGRDRAFT_102406 [Zymoseptoria tritici
           IPO323]
          Length = 202

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/200 (54%), Positives = 136/200 (68%), Gaps = 2/200 (1%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              NP RG P+H R+P+K+FWRTVRGM+PHKT RGA AL +LK FEG+PPPYD  K    
Sbjct: 63  TRFNPTRGGPWHFRAPAKMFWRTVRGMIPHKTERGAKALERLKTFEGVPPPYDHKKRMVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+  AY ERK A  K   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGQAYYERKSAARKNLVE 182

Query: 184 AYEQSN-KEVTTPLLQKTGY 202
           A + +   E     L++ GY
Sbjct: 183 AKKNAKVPEAVQKQLEQYGY 202



>gi|150981998|gb|ABR87201.1| large subunit ribosomal protein 16 [Koerneria sp. RS1982]
          Length = 198

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/195 (54%), Positives = 139/195 (71%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA++VAK++L GQRVVVVR E I ISG+  R+KLKY  FL KR N+NP
Sbjct: 3   LVIDGKDHLLGRLASVVAKQLLLGQRVVVVRAEEIAISGNFHRSKLKYLSFLRKRLNINP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+HLRSP+KIFWRTVRGM+PHKT RG  AL  LK +EG+PPPYD+ K          
Sbjct: 63  SRGPYHLRSPNKIFWRTVRGMLPHKTVRGYNALLHLKAYEGVPPPYDRTKKLVLPSAIRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ +AY E KK +AK+  +A + + 
Sbjct: 123 IALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGAAYHEEKKKVAKLHTQALKNAA 182

Query: 190 KEVT--TPLLQKTGY 202
            ++     +++  GY
Sbjct: 183 PKIAKYQKIIESLGY 197



>gi|410083427|ref|XP_003959291.1| hypothetical protein KAFR_0J00880 [Kazachstania africana CBS 2517]
 gi|372465882|emb|CCF60156.1| hypothetical protein KAFR_0J00880 [Kazachstania africana CBS 2517]
          Length = 200

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 129/174 (74%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+ VVIDGKGHLLGRLA+IVAKE+L+GQ+VVVVR E +N+SG  FRNKLKY D+L K  
Sbjct: 4   FEKVVVIDGKGHLLGRLASIVAKELLNGQKVVVVRAEALNVSGEFFRNKLKYHDYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N  RGPFH R+PS+IF++ VRGM+ HKTARG AA+ +LKVFEG+PPPYDK K      
Sbjct: 64  IFNKTRGPFHFRAPSRIFYKAVRGMIAHKTARGKAAMERLKVFEGVPPPYDKKKRVVVPN 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                  KPGR++T + +LS  VGWKY+D +  LE+KR VR++ Y  +KKA  K
Sbjct: 124 ALRVLRLKPGRKYTTLSKLSSSVGWKYEDVVAKLEEKRKVRSAEYYAKKKAFNK 177



>gi|150981992|gb|ABR87198.1| large subunit ribosomal protein 16 [Pristionchus sp. 13 RS5231]
          Length = 198

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  ++ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTNALKNMRGYEGCPAPYDKKKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + Y   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVATLEAKRKVKGALYYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|187609308|pdb|2ZKR|JJ Chain j, Structure Of A Mammalian Ribosomal 60s Subunit Within An
           80s Complex Obtained By Docking Homology Models Of The
           Rna And Proteins Into An 8.7 A Cryo-Em Map
          Length = 203

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 134/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKL Y  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLNYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+  R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYDFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|325530312|sp|Q9XSU0.2|RL13A_CANFA RecName: Full=60S ribosomal protein L13a
          Length = 203

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 134/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKL Y  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLNYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+  R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYDFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|507619095|ref|XP_004624823.1| PREDICTED: 60S ribosomal protein L13a-like [Octodon degus]
          Length = 203

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 137/184 (74%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GH+LGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHVLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           +RGP+H R+PS+IFW+TVRGM+PHKT +G AAL +LKVF+GIPPPYDK K          
Sbjct: 67  SRGPYHFRAPSRIFWQTVRGMLPHKTKQGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK + ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE 186

Query: 190 KEVT 193
           K+++
Sbjct: 187 KKIS 190



>gi|345562379|gb|EGX45447.1| hypothetical protein AOL_s00169g53 [Arthrobotrys oligospora ATCC
           24927]
          Length = 199

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 134/194 (69%), Gaps = 4/194 (2%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEEVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEDLNISGEFFRAKLKYHAYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N   GPFH R+PS+IF++ VRGM+PHKTARG AA+ +LKVFEG+PPPYDK K      
Sbjct: 64  RFNKTHGPFHFRAPSRIFYKAVRGMMPHKTARGTAAMERLKVFEGVPPPYDKKKRMVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAY 185
                  +PGR++  VGRLS EVGWKY D +  LE++R V+ +AY  RKKA  K      
Sbjct: 124 ALRVLRLRPGRKYCSVGRLSKEVGWKYADVVSKLEERRKVKGAAYYARKKAQIKTL---- 179

Query: 186 EQSNKEVTTPLLQK 199
            Q+ K  TT   +K
Sbjct: 180 SQAQKATTTAADEK 193



>gi|150981972|gb|ABR87188.1| large subunit ribosomal protein 16 [Pristionchus sp. 3 CZ3975]
          Length = 198

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 136/195 (69%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  L+ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTNALKNLRGYEGCPAPYDKKKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+  +A +   
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLEEQARKNVA 182

Query: 190 KEVTT--PLLQKTGY 202
            ++ +   +++ +GY
Sbjct: 183 SKIASYQKIIEGSGY 197



>gi|114649907|ref|XP_001137817.1| PREDICTED: 60S ribosomal protein L13a-like isoform 4 [Pan
           troglodytes]
 gi|410047796|ref|XP_003952450.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
 gi|410047799|ref|XP_003952451.1| PREDICTED: 60S ribosomal protein L13a-like [Pan troglodytes]
          Length = 203

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 134/183 (73%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++  G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVPLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  FRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYWKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|453088978|gb|EMF17018.1| 60S ribosomal protein L16-B [Mycosphaerella populorum SO2202]
          Length = 213

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 135/191 (70%), Gaps = 1/191 (0%)

Query: 9   RVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVN 68
           ++V+DGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKYQ F+ K+   N
Sbjct: 20  QIVVDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYQAFMRKQTRYN 79

Query: 69  PARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXX 127
             RG P+H RSP+K+FWRTVRGM+PHKT RGA AL +LK FEG+PPPYD  K        
Sbjct: 80  ATRGGPWHYRSPAKMFWRTVRGMIPHKTERGAKALERLKTFEGVPPPYDHKKRQVVPQAL 139

Query: 128 XXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQ 187
                KPGR++  VGRL HE GWKYQD +  LE++R V+  AY E+KKA  K   +A  +
Sbjct: 140 RVLRLKPGRKYCTVGRLGHEFGWKYQDVVSRLEERRKVKGQAYYEKKKAARKNLVEAQSK 199

Query: 188 SNKEVTTPLLQ 198
            + +V + L +
Sbjct: 200 VSSDVQSKLAE 210



>gi|512206266|gb|EPE35086.1| Ribosomal protein L13 [Glarea lozoyensis ATCC 20868]
          Length = 202

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 1/163 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE+++VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKY  +L K  
Sbjct: 4   FEQQIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMT 63

Query: 66  NVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXX 124
             NP RG PFH R+PS+IF++TVRGM+PHKTARGAAA+ +LKVFEG+PPPYD +K     
Sbjct: 64  RYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPPPYDHVKRVVVP 123

Query: 125 XXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRA 167
                   KPGR++  VGRLSHEVGWKYQD +  LE++R V+ 
Sbjct: 124 QALRVLRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKG 166



>gi|150981994|gb|ABR87199.1| large subunit ribosomal protein 16 [Pristionchus sp. 14 RS5230]
          Length = 198

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  L+ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTNALKNLRGYEGCPAPYDKKKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|126273925|ref|XP_001387342.1| 60S ribosomal protein L16 [Scheffersomyces stipitis CBS 6054]
 gi|126213212|gb|EAZ63319.1| 60S large subunit ribosomal protein [Scheffersomyces stipitis CBS
           6054]
          Length = 200

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/192 (55%), Positives = 134/192 (69%), Gaps = 1/192 (0%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ++V+VR E +NISG  FRNKLKY D+L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQVLNGQKIVIVRAEALNISGEFFRNKLKYHDYLRKST 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N   GPFH R+PS+IF++ VRGM+PHKTARG AAL +LKVFEG+PPPYDK K      
Sbjct: 64  RFNKTHGPFHFRAPSRIFYKAVRGMIPHKTARGKAALERLKVFEGVPPPYDKKKRVVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALA-KITRKA 184
                  K GR++T VG+LS  VGWKY+  +  LE+KR ++A+ Y  +KKAL  KIT   
Sbjct: 124 ALRVLRLKQGRKYTTVGKLSSAVGWKYESVVGKLEEKRKLQAAEYYAKKKALTKKITAAK 183

Query: 185 YEQSNKEVTTPL 196
              +  EV   L
Sbjct: 184 ASTAESEVAQQL 195



>gi|459176842|ref|XP_004226142.1| PREDICTED: 60S ribosomal protein L13a-like [Ciona intestinalis]
          Length = 206

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 130/184 (70%)

Query: 11  VIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNPA 70
           +ID K HLLGRLAA++AK +L+GQ++VVVRCE I ISG+ +RNKLKY DFL KR   NP 
Sbjct: 10  IIDAKDHLLGRLAALIAKNLLNGQKIVVVRCESILISGNFYRNKLKYLDFLRKRIRTNPK 69

Query: 71  RGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXXX 130
           RGPFH R+PSKI WRTVRGM+PHK  RGA AL +LKVFEG+PPPYDK K           
Sbjct: 70  RGPFHFRAPSKILWRTVRGMLPHKLKRGAEALDRLKVFEGVPPPYDKKKRMVVPSCMKVV 129

Query: 131 XXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSNK 190
             KP R+F ++ RLS EVGWKY D I+ALE+KR  ++  Y ++K++  KI ++A      
Sbjct: 130 KLKPKRKFALLSRLSSEVGWKYNDVIQALEEKRKAKSKLYWDKKQSNLKIRKEAIANVQD 189

Query: 191 EVTT 194
           ++  
Sbjct: 190 QIAD 193



>gi|150981970|gb|ABR87187.1| large subunit ribosomal protein 16 [Pristionchus uniformis]
          Length = 198

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 130/187 (69%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRT+RGMVPHKT RG  AL   + +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTIRGMVPHKTIRGTNALKNFRGYEGCPAPYDKKKKLVIPTANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + Y   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALYYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|392874348|gb|AFM86006.1| 60S ribosomal protein L13a [Callorhinchus milii]
          Length = 205

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 126/165 (76%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK+IL G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQILLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAY 170
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A+ +
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKAKANLH 169



>gi|452848315|gb|EME50247.1| hypothetical protein DOTSEDRAFT_68952 [Dothistroma septosporum
           NZE10]
          Length = 202

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/185 (56%), Positives = 132/185 (71%), Gaps = 1/185 (0%)

Query: 5   VFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKR 64
            FE  +VIDGKGHLLGRLA+ VAK++L+GQ++VVVRCE +NISG  FR KLKYQ FL K+
Sbjct: 3   TFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYQAFLRKQ 62

Query: 65  CNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
              N  RG P+H R+P+K+FWRTVRGM+PHKT RGA AL +LK FEG+PPPYD  K    
Sbjct: 63  TRYNATRGGPWHYRAPAKMFWRTVRGMIPHKTDRGAKALERLKTFEGVPPPYDHKKRMVV 122

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++  VGRL HE GWKYQD +  LE++R V+  AY E+K+A  K   +
Sbjct: 123 PQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGQAYYEKKRAARKSLAE 182

Query: 184 AYEQS 188
           A E++
Sbjct: 183 AKEKA 187



>gi|477534346|gb|ENH85897.1| 60s ribosomal protein l16 [Colletotrichum orbiculare MAFF 240422]
          Length = 213

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 107/182 (58%), Positives = 131/182 (71%), Gaps = 12/182 (6%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNK----------- 54
           FE+ VV+DGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FR K           
Sbjct: 4   FEQVVVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKRMSTPTPTVAP 63

Query: 55  LKYQDFLTKRCNVNPARG-PFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPP 113
           +KY  +L K    NP RG PFH R+PS+IF++TVRGM+PHKTARGAAAL +LKVFEG+PP
Sbjct: 64  IKYHAYLRKMTRYNPTRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAALERLKVFEGVPP 123

Query: 114 PYDKIKXXXXXXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAER 173
           PYDK K             +PGR+F  VGRLS EVGWKYQD +  LE++R  + +AY ER
Sbjct: 124 PYDKQKKMVVPQALRVLRLQPGRKFCTVGRLSSEVGWKYQDVVARLEERRKAKGAAYYER 183

Query: 174 KK 175
           KK
Sbjct: 184 KK 185



>gi|426375599|ref|XP_004054617.1| PREDICTED: 60S ribosomal protein L13a-like [Gorilla gorilla
           gorilla]
          Length = 203

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 133/183 (72%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +V+DG+GHLLGRLAAIVAK++L G++VVVVRCE INISG+ +RNKLKY  FL KR N NP
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
             GP+H R+PS+IFW TVRGM+PHKT RG AAL +LKVF+GIPPPYDK K          
Sbjct: 67  PPGPYHFRAPSRIFWLTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  +GRL+HEVGWKYQ     LE+KR  +A  +  +KK L ++ ++A +   
Sbjct: 127 VRLKPTRKFACLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVE 186

Query: 190 KEV 192
           K++
Sbjct: 187 KKI 189



>gi|150981982|gb|ABR87193.1| large subunit ribosomal protein 16 [Pristionchus pauli]
          Length = 198

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  ++ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTNALKNMRGYEGCPAPYDKKKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|344304398|gb|EGW34630.1| 60S large subunit ribosomal protein [Spathaspora passalidarum NRRL
           Y-27907]
          Length = 198

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (73%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           FE  VVIDGKGHLLGRLA+IVAK++L+GQ+VVVVRCE +NISG  FRNKLKY D+L K  
Sbjct: 4   FEPVVVIDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRNKLKYHDYLRKAT 63

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
             N   GPFH R+PS+I ++ +RGM+PHKTARG AAL +LKVFEGIPPPYDK K      
Sbjct: 64  RFNKTHGPFHFRAPSRILYKAIRGMIPHKTARGKAALERLKVFEGIPPPYDKKKRVVVPQ 123

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
                  K GR++T VG+LS  VGWKY+  +  LE+KR ++++ Y  +KKAL K
Sbjct: 124 ALRVLRLKQGRKYTTVGKLSSAVGWKYESVVDKLEEKRKLQSAEYYAKKKALTK 177



>gi|151943033|gb|EDN61368.1| ribosomal protein L16A [Saccharomyces cerevisiae YJM789]
 gi|190406344|gb|EDV09611.1| ribosomal protein L16A [Saccharomyces cerevisiae RM11-1a]
 gi|392298783|gb|EIW09879.1| Rpl16ap [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 199

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/199 (53%), Positives = 134/199 (67%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M  E  VVIDGKGHL+GRLA++VAK++L+GQ++VVVR E +NISG  FRNKLKY DFL K
Sbjct: 1   MSVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
               N  RGPFH R+PS+IF++ +RGMV HKTARG AAL +LKVFEGIPPPYDK K    
Sbjct: 61  ATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KPGR++T +G+LS  VGWKY+D +  LE KR VR++ Y  +K+A  K    
Sbjct: 121 PQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVRSAEYYAKKRAFTKKVAS 180

Query: 184 AYEQSNKEVTTPLLQKTGY 202
           A   + +      L   GY
Sbjct: 181 ANATAAESDVAKQLAALGY 199



>gi|390135481|gb|AFL56721.1| large subunit ribosomal protein 16, partial [Pristionchus arcanus]
          Length = 198

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+IVAK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIVAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRT+RGMVPHKT RG  AL  ++ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTIRGMVPHKTIRGTQALKLMRGYEGCPAPYDKTKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|390135433|gb|AFL56697.1| large subunit ribosomal protein 16, partial [Pristionchus
           exspectatus]
          Length = 198

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  ++ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTQALKLMRGYEGCPAPYDKTKKLVIPSANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|150981988|gb|ABR87196.1| large subunit ribosomal protein 16 [Pristionchus sp. 11 RS5228]
          Length = 198

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 131/187 (70%), Gaps = 4/187 (2%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGK HLLGRLA+I+AK+IL GQ+VVVVRCE I ISG+  R+KLKY  FL KRCNVNP
Sbjct: 3   LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP 62

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
            RGPFHLRSPS+I WRTVRGMVPHKT RG  AL  ++ +EG P PYDK K          
Sbjct: 63  RRGPFHLRSPSRILWRTVRGMVPHKTIRGTNALKLMRGYEGCPAPYDKTKKLVIPTANRH 122

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KP R+F  VGRL+HEVGW+Y+D +  LE KR V+ + +   KK LAK+     EQ+ 
Sbjct: 123 NALKPRRKFCTVGRLAHEVGWQYKDVVAKLEAKRKVKGALFYSDKKKLAKLE----EQAR 178

Query: 190 KEVTTPL 196
           K V + +
Sbjct: 179 KNVASKI 185



>gi|307188111|gb|EFN72943.1| 60S ribosomal protein L13a [Camponotus floridanus]
          Length = 196

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 107/195 (54%), Positives = 137/195 (70%), Gaps = 2/195 (1%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           ++IDG+GHLLGRLAA VAK  L G +V+VVR E +NISG+ FRNKLK+  FL KRCNVNP
Sbjct: 1   ILIDGRGHLLGRLAATVAKTTLQGNKVIVVRSEQLNISGNFFRNKLKFMSFLRKRCNVNP 60

Query: 70  ARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXXX 129
           ARGPFH R+PSKIF +TVRGM+PHKT RG  AL +LKV+EG PPPY++ K          
Sbjct: 61  ARGPFHFRAPSKIFRKTVRGMIPHKTQRGKDALRRLKVYEGCPPPYNRRKRVVVPGAMRV 120

Query: 130 XXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRKAYEQSN 189
              KPGR++  VGRLSHEVGWKY+  ++ LE KR V+     +++  L K+T++A E  +
Sbjct: 121 MCLKPGRKYCHVGRLSHEVGWKYKSVVRTLENKRRVKEILDIQKRNKLKKLTKQAGEAVS 180

Query: 190 K--EVTTPLLQKTGY 202
           K  E  T ++   GY
Sbjct: 181 KAAEPYTKIINDFGY 195



>gi|472587889|gb|EMS25385.1| 60S ribosomal protein l16 [Rhodosporidium toruloides NP11]
          Length = 201

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 104/171 (60%), Positives = 132/171 (77%), Gaps = 1/171 (0%)

Query: 10  VVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRCNVNP 69
           +VIDGKGHLLGRLA+IVAK++L+GQ+VVVVRCE IN SGS FR KL+Y +FL KR  VNP
Sbjct: 7   IVIDGKGHLLGRLASIVAKQLLNGQKVVVVRCEEINCSGSFFRAKLRYHEFLNKRHLVNP 66

Query: 70  AR-GPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXXXXX 128
            + GPFH R+PS+I +RT+RGMVPHKT+RGAAA+ +LKV+EG+PPPYD+ K         
Sbjct: 67  KKSGPFHHRAPSRILYRTIRGMVPHKTSRGAAAMERLKVYEGVPPPYDRKKRVVVPQALR 126

Query: 129 XXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAK 179
               KPGR++  + RLSHEVGW Y+D +  LE+KR V+A+A+ ERK A  K
Sbjct: 127 VLRLKPGRKYCTIKRLSHEVGWSYRDVVDRLEEKRKVKAAAFHERKVASQK 177



>gi|350535877|ref|NP_001232687.1| putative ribosomal protein L13A [Taeniopygia guttata]
 gi|197128902|gb|ACH45400.1| putative ribosomal protein L13A [Taeniopygia guttata]
 gi|197128904|gb|ACH45402.1| putative ribosomal protein L13A [Taeniopygia guttata]
 gi|197128905|gb|ACH45403.1| putative ribosomal protein L13A [Taeniopygia guttata]
          Length = 203

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 145/200 (72%), Gaps = 2/200 (1%)

Query: 4   MVFERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTK 63
           M   R +VIDG+GHLLGRLAAIVAK++L G+RVVVVRCE INISG+ +RNKLK+  FL K
Sbjct: 1   MAEPRVLVIDGRGHLLGRLAAIVAKQVLLGRRVVVVRCEGINISGNFYRNKLKFLAFLRK 60

Query: 64  RCNVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXX 123
           R N NP+RGPFH R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+GIPPPYDK K    
Sbjct: 61  RMNTNPSRGPFHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVV 120

Query: 124 XXXXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAYAERKKALAKITRK 183
                    KP R+F V+GRL+HEVGWKY+D  +ALE+KR  +A     +K+ +  + R+
Sbjct: 121 PAALKIIRLKPTRKFAVLGRLAHEVGWKYRDVTEALEEKRKEKAKIRYNKKRKMMSLRRR 180

Query: 184 AYEQSNKEVT--TPLLQKTG 201
           A   + K+    T +L++ G
Sbjct: 181 AERSAEKKAAPFTAVLRQHG 200



>gi|387914352|gb|AFK10785.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392873984|gb|AFM85824.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874056|gb|AFM85860.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874420|gb|AFM86042.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874462|gb|AFM86063.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874740|gb|AFM86202.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874816|gb|AFM86240.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392874902|gb|AFM86283.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392875062|gb|AFM86363.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392875106|gb|AFM86385.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392875546|gb|AFM86605.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876176|gb|AFM86920.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876342|gb|AFM87003.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876596|gb|AFM87130.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876796|gb|AFM87230.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876962|gb|AFM87313.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392876964|gb|AFM87314.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392877132|gb|AFM87398.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392878638|gb|AFM88151.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392880220|gb|AFM88942.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392881154|gb|AFM89409.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392882758|gb|AFM90211.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392882990|gb|AFM90327.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392883722|gb|AFM90693.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392883882|gb|AFM90773.1| 60S ribosomal protein L13a [Callorhinchus milii]
 gi|392883922|gb|AFM90793.1| 60S ribosomal protein L13a [Callorhinchus milii]
          Length = 205

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (76%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK+IL G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQILLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRA 167
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKAKA 166



>gi|392883676|gb|AFM90670.1| 60S ribosomal protein L13a [Callorhinchus milii]
          Length = 205

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (76%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK+IL G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FNKVLLLDGRGHLLGRLAAIVAKQILLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRA 167
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKAKA 166



>gi|392877418|gb|AFM87541.1| 60S ribosomal protein L13a [Callorhinchus milii]
          Length = 205

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (75%)

Query: 6   FERRVVIDGKGHLLGRLAAIVAKEILSGQRVVVVRCELINISGSHFRNKLKYQDFLTKRC 65
           F + +++DG+GHLLGRLAAIVAK+IL G +VVVVRCE INISG+ +RNKLKY  FL KR 
Sbjct: 5   FHKVLLLDGRGHLLGRLAAIVAKQILLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRM 64

Query: 66  NVNPARGPFHLRSPSKIFWRTVRGMVPHKTARGAAALSKLKVFEGIPPPYDKIKXXXXXX 125
           N NP+RGP+H R+PS+IFWRTVRGM+PHKT RG AAL +LKVF+G+PPPYDK K      
Sbjct: 65  NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGVPPPYDKRKRMVVPA 124

Query: 126 XXXXXXXKPGRRFTVVGRLSHEVGWKYQDTIKALEQKRVVRASAY 170
                  KP R+F ++GRL+HEVGWKYQ     LE+KR  +A  +
Sbjct: 125 ALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKAKAKLH 169