BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10101_c0_seq1-m.34 5prime_partial 1-1725(+) 575 (+)
         (574 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|393243412|gb|EJD50927.1| 2-oxoglutarate dehydrogenase complex...   832   0.0     Auricularia subglabra TFB-10046 SS5
gi|395331547|gb|EJF63928.1| 2-oxoglutarate dehydrogenase complex...   827   0.0     Dichomitus squalens LYAD-421 SS1
gi|511006403|gb|EPB87715.1| oxoglutarate dehydrogenase (succinyl...   826   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|390602959|gb|EIN12351.1| 2-oxoglutarate dehydrogenase complex...   823   0.0     Punctularia strigosozonata HHB-11173 SS5
gi|392562638|gb|EIW55818.1| 2-oxoglutarate dehydrogenase E1 comp...   822   0.0     Trametes versicolor FP-101664 SS1
gi|471868491|emb|CCO37403.1| 2-oxoglutarate dehydrogenase E1 com...   819   0.0     Rhizoctonia solani AG-1 IB
gi|336369751|gb|EGN98092.1| hypothetical protein SERLA73DRAFT_12...   818   0.0     Serpula lacrymans var. lacrymans S7.3
gi|471868206|emb|CCO37492.1| 2-oxoglutarate dehydrogenase E1 com...   816   0.0     Rhizoctonia solani AG-1 IB
gi|392591928|gb|EIW81255.1| 2-oxoglutarate dehydrogenase E1 comp...   816   0.0     Coniophora puteana RWD-64-598 SS2
gi|409078704|gb|EKM79066.1| hypothetical protein AGABI1DRAFT_113...   814   0.0     Agaricus bisporus var. burnettii JB137-S8
gi|511008406|gb|EPB89672.1| oxoglutarate dehydrogenase (succinyl...   811   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|299743948|ref|XP_001836087.2| oxoglutarate dehydrogenase [Cop...   811   0.0     Coprinopsis cinerea okayama7#130
gi|443923012|gb|ELU42340.1| 2-oxoglutarate dehydrogenase E1 comp...   809   0.0     Rhizoctonia solani AG-1 IA
gi|449548762|gb|EMD39728.1| 2-oxoglutarate dehydrogenase complex...   809   0.0     Gelatoporia subvermispora B
gi|353241509|emb|CCA73320.1| probable KGD1-alpha-ketoglutarate d...   808   0.0     Serendipita indica DSM 11827
gi|392593304|gb|EIW82629.1| 2-oxoglutarate dehydrogenase E1 comp...   806   0.0     Coniophora puteana RWD-64-598 SS2
gi|409042069|gb|EKM51553.1| hypothetical protein PHACADRAFT_2617...   805   0.0     Phanerochaete carnosa HHB-10118-sp
gi|170089717|ref|XP_001876081.1| 2-oxoglutarate dehydrogenase co...   801   0.0     Laccaria bicolor S238N-H82
gi|389744649|gb|EIM85831.1| 2-oxoglutarate dehydrogenase complex...   800   0.0     Stereum hirsutum FP-91666 SS1
gi|392565940|gb|EIW59116.1| 2-oxoglutarate dehydrogenase E1 comp...   799   0.0     Trametes versicolor FP-101664 SS1
gi|58262862|ref|XP_568841.1| oxoglutarate dehydrogenase (succiny...   798   0.0     Cryptococcus neoformans var. neoformans JEC21
gi|384493565|gb|EIE84056.1| oxoglutarate dehydrogenase (succinyl...   798   0.0     Rhizopus delemar RA 99-880
gi|392576482|gb|EIW69613.1| hypothetical protein TREMEDRAFT_3915...   798   0.0     Tremella mesenterica DSM 1558
gi|405118405|gb|AFR93179.1| oxoglutarate dehydrogenase [Cryptoco...   797   0.0     Cryptococcus neoformans var. grubii H99
gi|393212457|gb|EJC97957.1| 2-oxoglutarate dehydrogenase complex...   796   0.0     Fomitiporia mediterranea MF3/22
gi|321252061|ref|XP_003192274.1| oxoglutarate dehydrogenase (suc...   795   0.0     Cryptococcus gattii WM276
gi|302689387|ref|XP_003034373.1| hypothetical protein SCHCODRAFT...   795   0.0     Schizophyllum commune H4-8
gi|345566586|gb|EGX49528.1| hypothetical protein AOL_s00078g17 [...   788   0.0     Arthrobotrys oligospora ATCC 24927
gi|402223016|gb|EJU03081.1| 2-oxoglutarate dehydrogenase E1 comp...   785   0.0     Dacryopinax primogenitus
gi|403419426|emb|CCM06126.1| predicted protein [Fibroporia radic...   783   0.0     Fibroporia radiculosa
gi|402223019|gb|EJU03084.1| oxoglutarate dehydrogenase [Dacryopi...   782   0.0     Dacryopinax primogenitus
gi|398405248|ref|XP_003854090.1| 2-oxoglutarate dehydrogenase E1...   778   0.0     Zymoseptoria tritici IPO323
gi|212542331|ref|XP_002151320.1| alpha-ketoglutarate dehydrogena...   778   0.0     Talaromyces marneffei ATCC 18224
gi|242768620|ref|XP_002341606.1| alpha-ketoglutarate dehydrogena...   776   0.0     Talaromyces stipitatus ATCC 10500
gi|401883061|gb|EJT47297.1| oxoglutarate dehydrogenase (succinyl...   775   0.0     Trichosporon asahii var. asahii CBS 2479
gi|406700340|gb|EKD03512.1| oxoglutarate dehydrogenase (succinyl...   775   0.0     Trichosporon asahii var. asahii CBS 8904
gi|378734322|gb|EHY60781.1| 2-oxoglutarate dehydrogenase, mitoch...   773   0.0     Exophiala dermatitidis NIH/UT8656
gi|452984644|gb|EME84401.1| hypothetical protein MYCFIDRAFT_1526...   772   0.0     Cercospora fijiensis CIRAD86
gi|115391169|ref|XP_001213089.1| 2-oxoglutarate dehydrogenase E1...   772   0.0     Aspergillus terreus NIH2624
gi|358057683|dbj|GAA96448.1| hypothetical protein E5Q_03115 [Mix...   771   0.0     Mixia osmundae IAM 14324
gi|70993636|ref|XP_751665.1| alpha-ketoglutarate dehydrogenase c...   771   0.0     Aspergillus fumigatus Af293
gi|159125413|gb|EDP50530.1| alpha-ketoglutarate dehydrogenase co...   771   0.0     Aspergillus fumigatus A1163
gi|367055070|ref|XP_003657913.1| hypothetical protein THITE_2124...   770   0.0     Thielavia terrestris NRRL 8126
gi|389638422|ref|XP_003716844.1| 2-oxoglutarate dehydrogenase [M...   769   0.0     Magnaporthe oryzae 70-15
gi|116204753|ref|XP_001228187.1| conserved hypothetical protein ...   769   0.0     Chaetomium globosum CBS 148.51
gi|296416600|ref|XP_002837963.1| hypothetical protein [Tuber mel...   769   0.0     Tuber melanosporum Mel28
gi|303311281|ref|XP_003065652.1| 2-oxoglutarate dehydrogenase E1...   769   0.0     Coccidioides posadasii C735 delta SOWgp
gi|392862937|gb|EAS36382.2| oxoglutarate dehydrogenase (succinyl...   769   0.0     
gi|320039481|gb|EFW21415.1| 2-oxoglutarate dehydrogenase E1 comp...   768   0.0     Coccidioides posadasii str. Silveira
gi|119500216|ref|XP_001266865.1| alpha-ketoglutarate dehydrogena...   768   0.0     Aspergillus fischeri NRRL 181
gi|384498867|gb|EIE89358.1| oxoglutarate dehydrogenase (succinyl...   768   0.0     Rhizopus delemar RA 99-880
gi|402076607|gb|EJT72030.1| 2-oxoglutarate dehydrogenase [Gaeuma...   768   0.0     Gaeumannomyces graminis var. tritici R3-111a-1
gi|317144488|ref|XP_001820159.2| 2-oxoglutarate dehydrogenase [A...   768   0.0     Aspergillus oryzae RIB40
gi|391871651|gb|EIT80808.1| 2-oxoglutarate dehydrogenase, E1 sub...   768   0.0     Aspergillus oryzae 3.042
gi|121708090|ref|XP_001272026.1| alpha-ketoglutarate dehydrogena...   768   0.0     Aspergillus clavatus NRRL 1
gi|452843789|gb|EME45724.1| hypothetical protein DOTSEDRAFT_7142...   768   0.0     Dothistroma septosporum NZE10
gi|258567766|ref|XP_002584627.1| oxoglutarate dehydrogenase (suc...   768   0.0     Uncinocarpus reesii 1704
gi|500262017|gb|EOO04293.1| putative oxoglutarate dehydrogenase ...   767   0.0     Phaeoacremonium minimum UCRPA7
gi|83768018|dbj|BAE58157.1| unnamed protein product [Aspergillus...   767   0.0     Aspergillus oryzae RIB40
gi|145257753|ref|XP_001401841.1| 2-oxoglutarate dehydrogenase [A...   767   0.0     Aspergillus niger CBS 513.88
gi|171690254|ref|XP_001910052.1| hypothetical protein [Podospora...   767   0.0     Podospora anserina S mat+
gi|340516342|gb|EGR46591.1| 2-oxoglutarate dehydrogenase-like pr...   766   0.0     Trichoderma reesei QM6a
gi|358366279|dbj|GAA82900.1| 2-oxoglutarate dehydrogenase E1 com...   766   0.0     Aspergillus kawachii IFO 4308
gi|501753174|emb|CCG83091.1| putative Alpha-ketoglutarate dehydr...   765   0.0     Taphrina deformans PYCC 5710
gi|367035534|ref|XP_003667049.1| hypothetical protein MYCTH_2312...   765   0.0     Myceliophthora thermophila ATCC 42464
gi|512191710|gb|EPE07471.1| oxoglutarate dehydrogenase [Ophiosto...   762   0.0     Ophiostoma piceae UAMH 11346
gi|471574013|gb|EMR72012.1| putative oxoglutarate dehydrogenase ...   760   0.0     Eutypa lata UCREL1
gi|341038445|gb|EGS23437.1| mitochondrial 2-oxoglutarate dehydro...   760   0.0     Chaetomium thermophilum var. thermophilum DSM 1495
gi|226290128|gb|EEH45612.1| 2-oxoglutarate dehydrogenase E1 [Par...   760   0.0     Paracoccidioides brasiliensis Pb18
gi|67538802|ref|XP_663175.1| hypothetical protein AN5571.2 [Aspe...   760   0.0     Aspergillus nidulans FGSC A4
gi|320589923|gb|EFX02379.1| alpha-ketoglutarate dehydrogenase co...   759   0.0     Grosmannia clavigera kw1407
gi|322707674|gb|EFY99252.1| 2-oxoglutarate dehydrogenase E1 comp...   759   0.0     Metarhizium robertsii ARSEF 23
gi|501307063|dbj|GAC96051.1| hypothetical protein PHSY_003630 [P...   759   0.0     Pseudozyma hubeiensis SY62
gi|361124980|gb|EHK97042.1| putative 2-oxoglutarate dehydrogenas...   759   0.0     Glarea lozoyensis 74030
gi|453082529|gb|EMF10576.1| 2-oxoglutarate dehydrogenase E1 comp...   758   0.0     Sphaerulina musiva SO2202
gi|343425736|emb|CBQ69270.1| probable KGD1-alpha-ketoglutarate d...   758   0.0     Sporisorium reilianum SRZ2
gi|322694072|gb|EFY85912.1| putative oxoglutarate dehydrogenase ...   758   0.0     Metarhizium acridum CQMa 102
gi|342320257|gb|EGU12199.1| Oxoglutarate dehydrogenase [Rhodotor...   757   0.0     Rhodotorula toruloides ATCC 204091
gi|406864700|gb|EKD17744.1| oxoglutarate dehydrogenase [Marssoni...   757   0.0     Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|472585435|gb|EMS22989.1| 2-oxoglutarate dehydrogenase E1 comp...   757   0.0     Rhodotorula toruloides NP11
gi|225682695|gb|EEH20979.1| 2-oxoglutarate dehydrogenase E1 [Par...   756   0.0     Paracoccidioides brasiliensis Pb03
gi|346319577|gb|EGX89178.1| 2-oxoglutarate dehydrogenase E1 comp...   756   0.0     Cordyceps militaris CM01
gi|346976937|gb|EGY20389.1| 2-oxoglutarate dehydrogenase E1 [Ver...   756   0.0     Verticillium dahliae VdLs.17
gi|302418878|ref|XP_003007270.1| 2-oxoglutarate dehydrogenase E1...   756   0.0     Verticillium alfalfae VaMs.102
gi|295669416|ref|XP_002795256.1| 2-oxoglutarate dehydrogenase E1...   755   0.0     Paracoccidioides lutzii Pb01
gi|400595073|gb|EJP62883.1| oxoglutarate dehydrogenase [Beauveri...   754   0.0     Beauveria bassiana ARSEF 2860
gi|407919803|gb|EKG13026.1| Dehydrogenase E1 component [Macropho...   754   0.0     Macrophomina phaseolina MS6
gi|156054172|ref|XP_001593012.1| hypothetical protein SS1G_05934...   754   0.0     Sclerotinia sclerotiorum 1980 UF-70
gi|443897124|dbj|GAC74466.1| 2-oxoglutarate dehydrogenase, E1 su...   753   0.0     Moesziomyces antarcticus T-34
gi|449302313|gb|EMC98322.1| hypothetical protein BAUCODRAFT_3234...   753   0.0     Baudoinia panamericana UAMH 10762
gi|336468640|gb|EGO56803.1| 2-oxoglutarate dehydrogenase E1 comp...   753   0.0     Neurospora tetrasperma FGSC 2508
gi|429849455|gb|ELA24845.1| alpha-ketoglutarate dehydrogenase co...   753   0.0     Colletotrichum gloeosporioides Nara gc5
gi|472241505|gb|EMR86223.1| putative oxoglutarate dehydrogenase ...   753   0.0     Botrytis cinerea BcDW1
gi|310796732|gb|EFQ32193.1| oxoglutarate dehydrogenase [Glomerel...   753   0.0     Colletotrichum graminicola M1.001
gi|440638797|gb|ELR08716.1| oxoglutarate dehydrogenase, E1 compo...   753   0.0     Pseudogymnoascus destructans 20631-21
gi|388855381|emb|CCF51045.1| probable KGD1-alpha-ketoglutarate d...   753   0.0     Ustilago hordei
gi|388583356|gb|EIM23658.1| 2-oxoglutarate dehydrogenase complex...   753   0.0     Wallemia mellicola CBS 633.66
gi|399169329|emb|CCE29847.1| probable oxoglutarate dehydrogenase...   752   0.0     Claviceps purpurea 20.1
gi|505757660|gb|EOR01781.1| hypothetical protein J056_004017 [Wa...   752   0.0     Wallemia ichthyophaga EXF-994
gi|164424833|ref|XP_963248.2| 2-oxoglutarate dehydrogenase E1 co...   751   0.0     
gi|16416078|emb|CAB91484.2| probable oxoglutarate dehydrogenase ...   751   0.0     Neurospora crassa
gi|302502401|ref|XP_003013191.1| hypothetical protein ARB_00375 ...   751   0.0     Arthroderma benhamiae CBS 112371
gi|239608649|gb|EEQ85636.1| 2-oxoglutarate dehydrogenase E1 comp...   751   0.0     Blastomyces dermatitidis ER-3
gi|261191769|ref|XP_002622292.1| 2-oxoglutarate dehydrogenase E1...   751   0.0     Blastomyces gilchristii SLH14081
gi|296808057|ref|XP_002844367.1| 2-oxoglutarate dehydrogenase E1...   750   0.0     Arthroderma otae CBS 113480
gi|326485345|gb|EGE09355.1| 2-oxoglutarate dehydrogenase E1 comp...   750   0.0     Trichophyton equinum CBS 127.97
gi|485921101|gb|EOD46907.1| putative alpha-ketoglutarate dehydro...   749   0.0     Neofusicoccum parvum UCRNP2
gi|225559813|gb|EEH08095.1| 2-oxoglutarate dehydrogenase [Ajello...   749   0.0     Histoplasma capsulatum G186AR
gi|326475719|gb|EGD99728.1| 2-oxoglutarate dehydrogenase E1 comp...   749   0.0     Trichophyton tonsurans CBS 112818
gi|71020737|ref|XP_760599.1| hypothetical protein UM04452.1 [Ust...   749   0.0     
gi|327295470|ref|XP_003232430.1| oxoglutarate dehydrogenase [Tri...   749   0.0     Trichophyton rubrum CBS 118892
gi|325089830|gb|EGC43140.1| 2-oxoglutarate dehydrogenase [Ajello...   749   0.0     Histoplasma capsulatum H88
gi|380491979|emb|CCF34932.1| oxoglutarate dehydrogenase [Colleto...   748   0.0     Colletotrichum higginsianum
gi|315042810|ref|XP_003170781.1| 2-oxoglutarate dehydrogenase E1...   748   0.0     Microsporum gypseum CBS 118893
gi|358387451|gb|EHK25046.1| hypothetical protein TRIVIDRAFT_8492...   748   0.0     Trichoderma virens Gv29-8
gi|477536242|gb|ENH87715.1| 2-oxoglutarate dehydrogenase e1 comp...   747   0.0     Colletotrichum orbiculare MAFF 240422
gi|358397995|gb|EHK47353.1| hypothetical protein TRIATDRAFT_2907...   747   0.0     Trichoderma atroviride IMI 206040
gi|255947496|ref|XP_002564515.1| Pc22g04770 [Penicillium chrysog...   745   0.0     Penicillium rubens Wisconsin 54-1255
gi|328863203|gb|EGG12303.1| hypothetical protein MELLADRAFT_1151...   745   0.0     Melampsora larici-populina 98AG31
gi|425768887|gb|EKV07398.1| Alpha-ketoglutarate dehydrogenase co...   745   0.0     Penicillium digitatum PHI26
gi|425776391|gb|EKV14610.1| Alpha-ketoglutarate dehydrogenase co...   744   0.0     Penicillium digitatum Pd1
gi|475664584|gb|EMT62378.1| 2-oxoglutarate dehydrogenase, mitoch...   743   0.0     Fusarium oxysporum f. sp. cubense race 4
gi|396492716|ref|XP_003843865.1| similar to 2-oxoglutarate dehyd...   739   0.0     Leptosphaeria maculans JN3
gi|482815122|gb|EOA91797.1| hypothetical protein SETTUDRAFT_4074...   739   0.0     Setosphaeria turcica Et28A
gi|164661599|ref|XP_001731922.1| hypothetical protein MGL_1190 [...   738   0.0     Malassezia globosa CBS 7966
gi|452001107|gb|EMD93567.1| hypothetical protein COCHEDRAFT_1171...   738   0.0     Bipolaris maydis C5
gi|189190882|ref|XP_001931780.1| 2-oxoglutarate dehydrogenase E1...   737   0.0     Pyrenophora tritici-repentis Pt-1C-BFP
gi|388579271|gb|EIM19597.1| 2-oxoglutarate dehydrogenase, E1 com...   735   0.0     Wallemia mellicola CBS 633.66
gi|342876357|gb|EGU77980.1| hypothetical protein FOXB_11498 [Fus...   735   0.0     Fusarium oxysporum Fo5176
gi|330915031|ref|XP_003296878.1| hypothetical protein PTT_07092 ...   734   0.0     Pyrenophora teres f. teres 0-1
gi|451854945|gb|EMD68237.1| hypothetical protein COCSADRAFT_1781...   734   0.0     Bipolaris sorokiniana ND90Pr
gi|302901631|ref|XP_003048478.1| predicted protein [Nectria haem...   733   0.0     Nectria haematococca mpVI 77-13-4
gi|494832942|gb|EON69053.1| oxoglutarate dehydrogenase (succinyl...   733   0.0     Coniosporium apollinis CBS 100218
gi|505755135|gb|EOQ99366.1| hypothetical protein J056_001922 [Wa...   732   0.0     Wallemia ichthyophaga EXF-994
gi|408395837|gb|EKJ75010.1| hypothetical protein FPSE_04830 [Fus...   730   0.0     Fusarium pseudograminearum CS3096
gi|46116934|ref|XP_384485.1| hypothetical protein FG04309.1 [Fus...   730   0.0     
gi|465792746|emb|CCU97988.1| unnamed protein product [Malassezia...   728   0.0     Malassezia sympodialis ATCC 42132
gi|154287386|ref|XP_001544488.1| 2-oxoglutarate dehydrogenase E1...   728   0.0     Histoplasma capsulatum NAm1
gi|470316446|gb|EMR08200.1| oxoglutarate dehydrogenase (succinyl...   725   0.0     Pneumocystis murina B123
gi|430811116|emb|CCJ31407.1| unnamed protein product [Pneumocyst...   720   0.0     Pneumocystis jirovecii
gi|19112564|ref|NP_595772.1| alpha-ketoglutarate dehydrogenase [...   708   0.0     Schizosaccharomyces pombe 972h-
gi|448085949|ref|XP_004195984.1| Piso0_005419 [Millerozyma farin...   707   0.0     Millerozyma farinosa CBS 7064
gi|448081469|ref|XP_004194897.1| Piso0_005419 [Millerozyma farin...   704   0.0     Millerozyma farinosa CBS 7064
gi|354543523|emb|CCE40242.1| hypothetical protein CPAR2_102800 [...   702   0.0     Candida parapsilosis
gi|344232738|gb|EGV64611.1| 2-oxoglutarate dehydrogenase, E1 com...   697   0.0     Candida tenuis ATCC 10573
gi|448516366|ref|XP_003867551.1| Kgd1 2-oxoglutarate dehydrogena...   697   0.0     Candida orthopsilosis Co 90-125
gi|190347141|gb|EDK39362.2| hypothetical protein PGUG_03460 [Mey...   694   0.0     Meyerozyma guilliermondii ATCC 6260
gi|210076290|ref|XP_504734.2| YALI0E33517p [Yarrowia lipolytica]...   694   0.0     Yarrowia lipolytica CLIB122
gi|146416219|ref|XP_001484079.1| hypothetical protein PGUG_03460...   694   0.0     Meyerozyma guilliermondii ATCC 6260
gi|240276310|gb|EER39822.1| 2-oxoglutarate dehydrogenase E1 comp...   694   0.0     Histoplasma capsulatum H143
gi|213405791|ref|XP_002173667.1| 2-oxoglutarate dehydrogenase E1...   691   0.0     Schizosaccharomyces japonicus yFS275
gi|260940997|ref|XP_002615338.1| conserved hypothetical protein ...   688   0.0     Clavispora lusitaniae ATCC 42720
gi|50425085|ref|XP_461134.1| DEHA2F17798p [Debaryomyces hansenii...   688   0.0     Debaryomyces hansenii CBS767
gi|149245522|ref|XP_001527238.1| 2-oxoglutarate dehydrogenase E1...   686   0.0     Lodderomyces elongisporus NRRL YB-4239
gi|320581271|gb|EFW95492.1| Component of the mitochondrial alpha...   685   0.0     
gi|255729610|ref|XP_002549730.1| 2-oxoglutarate dehydrogenase E1...   682   0.0     Candida tropicalis MYA-3404
gi|50288623|ref|XP_446741.1| hypothetical protein [Candida glabr...   682   0.0     Candida glabrata CBS 138
gi|150866747|ref|XP_001386444.2| alpha-ketoglutarate dehydrogena...   682   0.0     Scheffersomyces stipitis CBS 6054
gi|254567720|ref|XP_002490970.1| Component of the mitochondrial ...   679   0.0     Komagataella phaffii GS115
gi|430811677|emb|CCJ30874.1| unnamed protein product, partial [P...   678   0.0     Pneumocystis jirovecii
gi|459367061|gb|EMG46177.1| 2-oxoglutarate dehydrogenase E1 comp...   678   0.0     Candida maltosa Xu316
gi|328774065|gb|EGF84102.1| hypothetical protein BATDEDRAFT_3409...   678   0.0     Batrachochytrium dendrobatidis JAM81
gi|403215943|emb|CCK70441.1| hypothetical protein KNAG_0E01790 [...   677   0.0     Kazachstania naganishii CBS 8797
gi|444320587|ref|XP_004180950.1| hypothetical protein TBLA_0E037...   677   0.0     Tetrapisispora blattae CBS 6284
gi|403160615|ref|XP_003321098.2| oxoglutarate dehydrogenase (suc...   675   0.0     Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|366990679|ref|XP_003675107.1| hypothetical protein NCAS_0B065...   674   0.0     Naumovozyma castellii CBS 4309
gi|241952613|ref|XP_002419028.1| 2-oxoglutarate dehydrogenase E1...   673   0.0     Candida dubliniensis CD36
gi|367012107|ref|XP_003680554.1| hypothetical protein TDEL_0C045...   672   0.0     Torulaspora delbrueckii
gi|406606545|emb|CCH42044.1| 2-oxoglutarate dehydrogenase E1 com...   669   0.0     Wickerhamomyces ciferrii
gi|50310525|ref|XP_455282.1| hypothetical protein [Kluyveromyces...   669   0.0     Kluyveromyces lactis NRRL Y-1140
gi|401841723|gb|EJT44068.1| KGD1-like protein [Saccharomyces kud...   669   0.0     Saccharomyces kudriavzevii IFO 1802
gi|401625342|gb|EJS43355.1| kgd1p [Saccharomyces arboricola H-6]      667   0.0     Saccharomyces arboricola H-6
gi|513034202|gb|AGO14168.1| AaceriAER374Cp [Saccharomycetaceae s...   667   0.0     Saccharomycetaceae sp. 'Ashbya aceri'
gi|6322066|ref|NP_012141.1| alpha-ketoglutarate dehydrogenase KG...   666   0.0     Saccharomyces cerevisiae S288c
gi|171785|gb|AAA34721.1| alpha-ketoglutarate dehydrogenase [Sacc...   665   0.0     Saccharomyces cerevisiae [brewer's yeast]
gi|151943041|gb|EDN61376.1| conserved protein [Saccharomyces cer...   665   0.0     Saccharomyces cerevisiae YJM789
gi|392298792|gb|EIW09888.1| Kgd1p [Saccharomyces cerevisiae CEN....   665   0.0     Saccharomyces cerevisiae CEN.PK113-7D
gi|71064093|gb|AAZ22502.1| Kgd1p [Saccharomyces cerevisiae]           665   0.0     Saccharomyces cerevisiae [brewer's yeast]
gi|349578831|dbj|GAA23995.1| K7_Kgd1p [Saccharomyces cerevisiae ...   665   0.0     Saccharomyces cerevisiae Kyokai no. 7
gi|68491108|ref|XP_710646.1| hypothetical protein CaO19.6165 [Ca...   664   0.0     Candida albicans SC5314
gi|365765073|gb|EHN06587.1| Kgd1p [Saccharomyces cerevisiae x Sa...   664   0.0     Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|336263898|ref|XP_003346728.1| hypothetical protein SMAC_04160...   664   0.0     Sordaria macrospora k-hell
gi|365983650|ref|XP_003668658.1| hypothetical protein NDAI_0B038...   662   0.0     Naumovozyma dairenensis CBS 421
gi|302308342|ref|NP_985230.2| AER374Cp [Ashbya gossypii ATCC 108...   662   0.0     Eremothecium gossypii ATCC 10895
gi|255718309|ref|XP_002555435.1| KLTH0G09262p [Lachancea thermot...   661   0.0     Lachancea thermotolerans CBS 6340
gi|344301023|gb|EGW31335.1| hypothetical protein SPAPADRAFT_6740...   661   0.0     Spathaspora passalidarum NRRL Y-27907
gi|410083577|ref|XP_003959366.1| hypothetical protein KAFR_0J016...   656   0.0     Kazachstania africana CBS 2517
gi|167538236|ref|XP_001750783.1| hypothetical protein [Monosiga ...   656   0.0     Monosiga brevicollis MX1
gi|254576895|ref|XP_002494434.1| ZYRO0A01386p [Zygosaccharomyces...   656   0.0     Zygosaccharomyces rouxii CBS 732
gi|385305753|gb|EIF49704.1| 2-oxoglutarate dehydrogenase e1 mito...   652   0.0     Brettanomyces bruxellensis AWRI1499
gi|482548272|gb|EOA12466.1| hypothetical protein CARUB_v10025801...   652   0.0     Capsella rubella
gi|367002636|ref|XP_003686052.1| hypothetical protein TPHA_0F013...   650   0.0     Tetrapisispora phaffii CBS 4417
gi|156846476|ref|XP_001646125.1| hypothetical protein Kpol_1039p...   650   0.0     Vanderwaltozyma polyspora DSM 70294
gi|363753514|ref|XP_003646973.1| hypothetical protein Ecym_5401 ...   649   0.0     Eremothecium cymbalariae DBVPG#7215
gi|297794187|ref|XP_002864978.1| E1 subunit of 2-oxoglutarate de...   649   0.0     Arabidopsis lyrata subsp. lyrata
gi|15239128|ref|NP_201376.1| 2-oxoglutarate dehydrogenase, E1 co...   646   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|110740037|dbj|BAF01922.1| 2-oxoglutarate dehydrogenase, E1 co...   646   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|460382059|ref|XP_004236757.1| PREDICTED: 2-oxoglutarate dehyd...   645   0.0     Solanum lycopersicum
gi|4210330|emb|CAA11552.1| 2-oxoglutarate dehydrogenase, E1 subu...   644   0.0     Arabidopsis thaliana [mouse-ear cress]
gi|224100929|ref|XP_002312072.1| predicted protein [Populus tric...   644   0.0     
gi|326494940|dbj|BAJ85565.1| predicted protein [Hordeum vulgare ...   642   0.0     Hordeum vulgare subsp. vulgare [barley]
gi|293331403|ref|NP_001169536.1| uncharacterized protein LOC1003...   642   0.0     Zea mays [maize]
gi|413943020|gb|AFW75669.1| hypothetical protein ZEAMMB73_452342...   642   0.0     Zea mays [maize]
gi|293335820|ref|NP_001169698.1| hypothetical protein [Zea mays]...   642   0.0     Zea mays [maize]
gi|297602611|ref|NP_001052638.2| Os04g0390000 [Oryza sativa Japo...   642   0.0     
gi|222628767|gb|EEE60899.1| hypothetical protein OsJ_14584 [Oryz...   642   0.0     Oryza sativa Japonica Group [Japonica rice]
gi|224109580|ref|XP_002315242.1| predicted protein [Populus tric...   641   0.0     Populus trichocarpa [western balsam poplar]
gi|218194753|gb|EEC77180.1| hypothetical protein OsI_15669 [Oryz...   641   0.0     Oryza sativa Indica Group [Indian rice]
gi|475607556|gb|EMT26751.1| 2-oxoglutarate dehydrogenase E1 comp...   641   0.0     Aegilops tauschii
gi|359486641|ref|XP_002279332.2| PREDICTED: 2-oxoglutarate dehyd...   641   0.0     
gi|116309350|emb|CAH66433.1| OSIGBa0096P03.7 [Oryza sativa Indic...   641   0.0     Oryza sativa Indica Group [Indian rice]
gi|242072740|ref|XP_002446306.1| hypothetical protein SORBIDRAFT...   640   0.0     Sorghum bicolor [broomcorn]
gi|242072742|ref|XP_002446307.1| hypothetical protein SORBIDRAFT...   640   0.0     Sorghum bicolor [broomcorn]
gi|357163093|ref|XP_003579623.1| PREDICTED: 2-oxoglutarate dehyd...   639   0.0     Brachypodium distachyon [annual false brome]
gi|413918140|gb|AFW58072.1| hypothetical protein ZEAMMB73_255234...   639   e-180   Zea mays [maize]
gi|302793194|ref|XP_002978362.1| hypothetical protein SELMODRAFT...   638   e-180   Selaginella moellendorffii
gi|115474297|ref|NP_001060747.1| Os07g0695800 [Oryza sativa Japo...   638   e-180   
gi|356575371|ref|XP_003555815.1| PREDICTED: 2-oxoglutarate dehyd...   636   e-180   Glycine max [soybeans]
gi|255575120|ref|XP_002528465.1| 2-oxoglutarate dehydrogenase, p...   635   e-180   Ricinus communis
gi|449483889|ref|XP_004156723.1| PREDICTED: 2-oxoglutarate dehyd...   635   e-179   
gi|449459928|ref|XP_004147698.1| PREDICTED: 2-oxoglutarate dehyd...   635   e-179   
gi|357163090|ref|XP_003579622.1| PREDICTED: 2-oxoglutarate dehyd...   635   e-179   Brachypodium distachyon [annual false brome]
gi|470325460|ref|XP_004364462.1| 2-oxoglutarate dehydrogenase [C...   635   e-179   Capsaspora owczarzaki ATCC 30864
gi|168001944|ref|XP_001753674.1| predicted protein [Physcomitrel...   635   e-179   Physcomitrella patens
gi|449449970|ref|XP_004142737.1| PREDICTED: 2-oxoglutarate dehyd...   634   e-179   Cucumis sativus [cucumbers]
gi|475675094|gb|EMT72174.1| 2-oxoglutarate dehydrogenase, mitoch...   632   e-179   Fusarium oxysporum f. sp. cubense race 4
gi|297816834|ref|XP_002876300.1| hypothetical protein ARALYDRAFT...   632   e-178   Arabidopsis lyrata subsp. lyrata
gi|482559249|gb|EOA23440.1| hypothetical protein CARUB_v10016624...   632   e-178   Capsella rubella
gi|474193779|gb|EMS58258.1| 2-oxoglutarate dehydrogenase, mitoch...   632   e-178   Triticum urartu
gi|502121391|ref|XP_004497299.1| PREDICTED: 2-oxoglutarate dehyd...   631   e-178   Cicer arietinum [garbanzo]
gi|28416717|gb|AAO42889.1| At3g55410 [Arabidopsis thaliana] >gi|...   631   e-178   Arabidopsis thaliana [mouse-ear cress]
gi|30694242|ref|NP_191101.2| 2-oxoglutarate dehydrogenase, E1 co...   631   e-178   Arabidopsis thaliana [mouse-ear cress]
gi|110739609|dbj|BAF01713.1| 2-oxoglutarate dehydrogenase, E1 su...   630   e-178   Arabidopsis thaliana [mouse-ear cress]
gi|508726332|gb|EOY18229.1| 2-oxoglutarate dehydrogenase, E1 com...   630   e-178   Theobroma cacao [chocolate]
gi|477522236|gb|ENH74305.1| 2-oxoglutarate dehydrogenase, mitoch...   629   e-178   Fusarium oxysporum f. sp. cubense race 1
gi|302773560|ref|XP_002970197.1| hypothetical protein SELMODRAFT...   629   e-177   Selaginella moellendorffii
gi|470143788|ref|XP_004307550.1| PREDICTED: 2-oxoglutarate dehyd...   629   e-177   Fragaria vesca subsp. vesca
gi|462417372|gb|EMJ22109.1| hypothetical protein PRUPE_ppa000728...   628   e-177   Prunus persica
gi|326531426|dbj|BAJ94174.1| predicted protein [Hordeum vulgare ...   625   e-176   Hordeum vulgare subsp. vulgare [barley]
gi|470143790|ref|XP_004307551.1| PREDICTED: 2-oxoglutarate dehyd...   624   e-176   Fragaria vesca subsp. vesca
gi|356568971|ref|XP_003552681.1| PREDICTED: 2-oxoglutarate dehyd...   624   e-176   Glycine max [soybeans]
gi|428172820|gb|EKX41726.1| hypothetical protein GUITHDRAFT_1417...   623   e-176   Guillardia theta CCMP2712
gi|475536576|gb|EMT08930.1| 2-oxoglutarate dehydrogenase E1 comp...   622   e-176   Aegilops tauschii
gi|356499661|ref|XP_003518655.1| PREDICTED: 2-oxoglutarate dehyd...   622   e-175   Glycine max [soybeans]
gi|66806367|ref|XP_636906.1| 2-oxoglutarate dehydrogenase, E1 su...   622   e-175   Dictyostelium discoideum AX4
gi|358371467|dbj|GAA88075.1| alpha-ketoglutarate dehydrogenase c...   621   e-175   Aspergillus kawachii IFO 4308
gi|302776648|ref|XP_002971476.1| hypothetical protein SELMODRAFT...   621   e-175   Selaginella moellendorffii
gi|296086274|emb|CBI31715.3| unnamed protein product [Vitis vini...   619   e-175   Vitis vinifera
gi|508726340|gb|EOY18237.1| 2-oxoglutarate dehydrogenase, E1 com...   619   e-175   Theobroma cacao [chocolate]
gi|302765184|ref|XP_002966013.1| hypothetical protein SELMODRAFT...   619   e-175   Selaginella moellendorffii
gi|474174426|gb|EMS57708.1| 2-oxoglutarate dehydrogenase, mitoch...   618   e-174   Triticum urartu
gi|357503061|ref|XP_003621819.1| Oxoglutarate dehydrogenase - li...   617   e-174   
gi|302899706|ref|XP_003048110.1| hypothetical protein NECHADRAFT...   613   e-173   Nectria haematococca mpVI 77-13-4
gi|452823405|gb|EME30416.1| 2-oxoglutarate dehydrogenase E1 comp...   613   e-173   Galdieria sulphuraria
gi|115442688|ref|XP_001218151.1| hypothetical protein ATEG_09529...   613   e-173   Aspergillus terreus NIH2624
gi|462416749|gb|EMJ21486.1| hypothetical protein PRUPE_ppa000730...   613   e-173   Prunus persica
gi|308801643|ref|XP_003078135.1| putative 2-oxoglutarate dehydro...   612   e-172   Ostreococcus tauri
gi|326432233|gb|EGD77803.1| 2-oxoglutarate dehydrogenase [Salpin...   609   e-172   Salpingoeca rosetta
gi|330805041|ref|XP_003290496.1| hypothetical protein DICPUDRAFT...   608   e-171   Dictyostelium purpureum
gi|7076784|emb|CAB75899.1| 2-oxoglutarate dehydrogenase, E1 subu...   608   e-171   Arabidopsis thaliana [mouse-ear cress]
gi|168003650|ref|XP_001754525.1| predicted protein [Physcomitrel...   608   e-171   Physcomitrella patens
gi|145344821|ref|XP_001416923.1| predicted protein [Ostreococcus...   604   e-170   Ostreococcus lucimarinus CCE9901
gi|158295752|ref|XP_316396.4| AGAP006366-PC [Anopheles gambiae s...   603   e-170   Anopheles gambiae str. PEST
gi|158295748|ref|XP_001688857.1| AGAP006366-PE [Anopheles gambia...   603   e-170   Anopheles gambiae str. PEST
gi|158295750|ref|XP_001688858.1| AGAP006366-PB [Anopheles gambia...   603   e-170   Anopheles gambiae str. PEST
gi|350630271|gb|EHA18644.1| hypothetical protein ASPNIDRAFT_4724...   602   e-169   Aspergillus niger ATCC 1015
gi|281208341|gb|EFA82517.1| 2-oxoglutarate dehydrogenase [Polysp...   601   e-169   Polysphondylium pallidum PN500
gi|428169499|gb|EKX38432.1| hypothetical protein GUITHDRAFT_1652...   600   e-169   Guillardia theta CCMP2712
gi|321468640|gb|EFX79624.1| hypothetical protein DAPPUDRAFT_1974...   598   e-168   Daphnia pulex
gi|470236030|ref|XP_004349963.1| 2-oxoglutarate dehydrogenase [D...   596   e-168   Dictyostelium fasciculatum
gi|159469438|ref|XP_001692870.1| 2-oxoglutarate dehydrogenase, E...   596   e-168   Chlamydomonas reinhardtii
gi|424513241|emb|CCO66825.1| predicted protein [Bathycoccus pras...   596   e-168   Bathycoccus prasinos
gi|449504905|ref|XP_002193100.2| PREDICTED: 2-oxoglutarate dehyd...   595   e-167   
gi|302838682|ref|XP_002950899.1| E1 subunit of 2-oxoglutarate de...   595   e-167   Volvox carteri f. nagariensis
gi|156372817|ref|XP_001629232.1| predicted protein [Nematostella...   595   e-167   Nematostella vectensis
gi|395506941|ref|XP_003757787.1| PREDICTED: 2-oxoglutarate dehyd...   593   e-167   
gi|395506943|ref|XP_003757788.1| PREDICTED: 2-oxoglutarate dehyd...   593   e-167   
gi|395506939|ref|XP_003757786.1| PREDICTED: 2-oxoglutarate dehyd...   593   e-167   Sarcophilus harrisii
gi|395506937|ref|XP_003757785.1| PREDICTED: 2-oxoglutarate dehyd...   592   e-167   Sarcophilus harrisii
gi|71897293|ref|NP_001026553.1| 2-oxoglutarate dehydrogenase, mi...   592   e-166   
gi|471409151|ref|XP_004386153.1| PREDICTED: 2-oxoglutarate dehyd...   592   e-166   
gi|119194445|ref|XP_001247826.1| 2-oxoglutarate dehydrogenase E1...   591   e-166   
gi|158295746|ref|XP_001688856.1| AGAP006366-PA [Anopheles gambia...   591   e-166   
gi|344293832|ref|XP_003418624.1| PREDICTED: 2-oxoglutarate dehyd...   591   e-166   
gi|478528424|ref|XP_004438388.1| PREDICTED: 2-oxoglutarate dehyd...   591   e-166   
gi|170042886|ref|XP_001849140.1| conserved hypothetical protein ...   590   e-166   
gi|478528428|ref|XP_004438390.1| PREDICTED: 2-oxoglutarate dehyd...   590   e-166   
gi|157114119|ref|XP_001652168.1| 2-oxoglutarate dehydrogenase [A...   590   e-166   
gi|478528422|ref|XP_004438387.1| PREDICTED: 2-oxoglutarate dehyd...   590   e-166   
gi|478528426|ref|XP_004438389.1| PREDICTED: 2-oxoglutarate dehyd...   590   e-166   
gi|507548557|ref|XP_004658103.1| PREDICTED: 2-oxoglutarate dehyd...   590   e-166   
gi|213983053|ref|NP_001135687.1| oxoglutarate (alpha-ketoglutara...   589   e-166   
gi|478528432|ref|XP_004438392.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|507548555|ref|XP_004658102.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|326923298|ref|XP_003207875.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|507548559|ref|XP_004658104.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|478528430|ref|XP_004438391.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|505774144|ref|XP_004601844.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-166   
gi|507548561|ref|XP_004658105.1| PREDICTED: 2-oxoglutarate dehyd...   589   e-165   
gi|505774154|ref|XP_004601847.1| PREDICTED: 2-oxoglutarate dehyd...   588   e-165   
gi|512907388|ref|XP_004926429.1| PREDICTED: 2-oxoglutarate dehyd...   588   e-165   
gi|505774147|ref|XP_004601845.1| PREDICTED: 2-oxoglutarate dehyd...   588   e-165   
gi|334312831|ref|XP_003339785.1| PREDICTED: LOW QUALITY PROTEIN:...   588   e-165   
gi|505774157|ref|XP_004601848.1| PREDICTED: 2-oxoglutarate dehyd...   588   e-165   
gi|505774151|ref|XP_004601846.1| PREDICTED: 2-oxoglutarate dehyd...   588   e-165   
gi|229892296|ref|NP_001153501.1| oxoglutarate (alpha-ketoglutara...   588   e-165   
gi|339239205|ref|XP_003381157.1| oxoglutarate dehydrogenase [Tri...   587   e-165   
gi|410922208|ref|XP_003974575.1| PREDICTED: 2-oxoglutarate dehyd...   587   e-165   
gi|301777322|ref|XP_002924075.1| PREDICTED: 2-oxoglutarate dehyd...   587   e-165   
gi|327277105|ref|XP_003223306.1| PREDICTED: 2-oxoglutarate dehyd...   587   e-165   
gi|348536126|ref|XP_003455548.1| PREDICTED: 2-oxoglutarate dehyd...   587   e-165   
gi|432092635|gb|ELK25170.1| 2-oxoglutarate dehydrogenase, mitoch...   587   e-165   
gi|499042103|ref|XP_004571662.1| PREDICTED: 2-oxoglutarate dehyd...   587   e-165   
gi|347440857|emb|CCD33778.1| hypothetical protein BofuT4_P063800...   587   e-165   
gi|483504475|gb|EOA96550.1| 2-oxoglutarate dehydrogenase E1 comp...   586   e-165   
gi|395850080|ref|XP_003797628.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|499042105|ref|XP_004571663.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|350595461|ref|XP_003134939.3| PREDICTED: LOW QUALITY PROTEIN:...   586   e-165   
gi|507929541|ref|XP_004676018.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|507929545|ref|XP_004676020.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|507929547|ref|XP_004676021.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|507929543|ref|XP_004676019.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|403278487|ref|XP_003930836.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|403278483|ref|XP_003930834.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|62287021|sp|Q60HE2.1|ODO1_MACFA RecName: Full=2-oxoglutarate ...   586   e-165   
gi|466073928|ref|XP_004283030.1| PREDICTED: 2-oxoglutarate dehyd...   586   e-165   
gi|466073931|ref|XP_004283031.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-165   
gi|395850082|ref|XP_003797629.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-165   
gi|499042107|ref|XP_004571664.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-165   
gi|296209203|ref|XP_002751435.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|303286695|ref|XP_003062637.1| predicted protein [Micromonas p...   585   e-164   
gi|296220118|ref|XP_002756166.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|149704812|ref|XP_001496666.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|466073934|ref|XP_004283032.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|51873036|ref|NP_002532.2| 2-oxoglutarate dehydrogenase, mitoc...   585   e-164   
gi|395850084|ref|XP_003797630.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|410951900|ref|XP_003982630.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|355560651|gb|EHH17337.1| hypothetical protein EGK_13726 [Maca...   585   e-164   
gi|355747653|gb|EHH52150.1| hypothetical protein EGM_12546 [Maca...   585   e-164   
gi|259013553|ref|NP_001158508.1| 2-oxoglutarate dehydrogenase, m...   585   e-164   
gi|313747571|ref|NP_001186473.1| 2-oxoglutarate dehydrogenase-li...   585   e-164   
gi|465963194|gb|EMP30026.1| 2-oxoglutarate dehydrogenase [Chelon...   585   e-164   
gi|410951902|ref|XP_003982631.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|338723837|ref|XP_003364806.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|194378950|dbj|BAG58026.1| unnamed protein product [Homo sapiens]   585   e-164   
gi|410951904|ref|XP_003982632.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|449269155|gb|EMC79961.1| 2-oxoglutarate dehydrogenase E1 comp...   585   e-164   
gi|403278485|ref|XP_003930835.1| PREDICTED: 2-oxoglutarate dehyd...   585   e-164   
gi|466073937|ref|XP_004283033.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|335301929|ref|XP_003133157.2| PREDICTED: LOW QUALITY PROTEIN:...   584   e-164   
gi|403278489|ref|XP_003930837.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|426356110|ref|XP_004045434.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|296209205|ref|XP_002751436.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|332865089|ref|XP_003318445.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|402863574|ref|XP_003896082.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|402863578|ref|XP_003896084.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|426356108|ref|XP_004045433.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|391326800|ref|XP_003737899.1| PREDICTED: 2-oxoglutarate dehyd...   584   e-164   
gi|187956864|gb|AAI57972.1| Ogdhl protein [Mus musculus] >gi|187...   584   e-164   
gi|194388154|dbj|BAG65461.1| unnamed protein product [Homo sapiens]   583   e-164   
gi|197102564|ref|NP_001125317.1| 2-oxoglutarate dehydrogenase, m...   583   e-164   
gi|194375834|dbj|BAG57261.1| unnamed protein product [Homo sapiens]   583   e-164   
gi|426364725|ref|XP_004049448.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|124487483|ref|NP_001074599.1| 2-oxoglutarate dehydrogenase-li...   583   e-164   
gi|426364729|ref|XP_004049450.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|189237141|ref|XP_973425.2| PREDICTED: similar to 2-oxoglutara...   583   e-164   
gi|194383022|dbj|BAG59067.1| unnamed protein product [Homo sapiens]   583   e-164   
gi|332239450|ref|XP_003268916.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|410975587|ref|XP_003994212.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|332239448|ref|XP_003268915.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|498955036|ref|XP_004523763.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|488531563|ref|XP_004457535.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|470623103|ref|XP_004319293.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|488531561|ref|XP_004457534.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|410951906|ref|XP_003982633.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|194380878|dbj|BAG64007.1| unnamed protein product [Homo sapiens]   583   e-164   
gi|429847514|gb|ELA23111.1| alpha-ketoglutarate dehydrogenase co...   583   e-164   
gi|29421218|dbj|BAA86604.2| KIAA1290 protein [Homo sapiens]           583   e-164   
gi|511829615|ref|XP_004739513.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|432885310|ref|XP_004074658.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|345792705|ref|XP_003433660.1| PREDICTED: oxoglutarate dehydro...   583   e-164   
gi|119613488|gb|EAW93082.1| oxoglutarate dehydrogenase-like, iso...   583   e-164   
gi|410975589|ref|XP_003994213.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|291394911|ref|XP_002713895.1| PREDICTED: oxoglutarate dehydro...   583   e-164   
gi|488531567|ref|XP_004457537.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|426227851|ref|XP_004008028.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|168275650|dbj|BAG10545.1| oxoglutarate dehydrogenase [synthet...   583   e-164   
gi|498955042|ref|XP_004523764.1| PREDICTED: 2-oxoglutarate dehyd...   583   e-164   
gi|221316661|ref|NP_060715.2| 2-oxoglutarate dehydrogenase-like,...   583   e-164   
gi|242024794|ref|XP_002432811.1| 2-oxoglutarate dehydrogenase, p...   583   e-164   
gi|291394913|ref|XP_002713896.1| PREDICTED: oxoglutarate dehydro...   582   e-164   
gi|472389578|ref|XP_004414110.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-164   
gi|255076061|ref|XP_002501705.1| predicted protein [Micromonas s...   582   e-164   
gi|345792703|ref|XP_534945.3| PREDICTED: oxoglutarate dehydrogen...   582   e-164   
gi|507668555|ref|XP_004708123.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-164   
gi|221316669|ref|NP_001137469.1| 2-oxoglutarate dehydrogenase-li...   582   e-164   
gi|7023145|dbj|BAA91855.1| unnamed protein product [Homo sapiens]     582   e-164   
gi|488531565|ref|XP_004457536.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-164   
gi|507668551|ref|XP_004708122.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-164   
gi|194385772|dbj|BAG65261.1| unnamed protein product [Homo sapiens]   582   e-164   
gi|158261475|dbj|BAF82915.1| unnamed protein product [Homo sapiens]   582   e-164   
gi|426227849|ref|XP_004008027.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|472389576|ref|XP_004414109.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|109066629|ref|XP_001089063.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|297288376|ref|XP_002803330.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|440903063|gb|ELR53770.1| 2-oxoglutarate dehydrogenase, mitoch...   582   e-163   
gi|221316665|ref|NP_001137468.1| 2-oxoglutarate dehydrogenase-li...   582   e-163   
gi|332239454|ref|XP_003268918.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|193704554|ref|XP_001950262.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|194383468|dbj|BAG64705.1| unnamed protein product [Homo sapiens]   582   e-163   
gi|507537884|ref|XP_004652965.1| PREDICTED: 2-oxoglutarate dehyd...   582   e-163   
gi|334314123|ref|XP_003339992.1| PREDICTED: oxoglutarate dehydro...   581   e-163   
gi|126272867|ref|XP_001366138.1| PREDICTED: oxoglutarate dehydro...   581   e-163   
gi|426227853|ref|XP_004008029.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|507537886|ref|XP_004652966.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|472389580|ref|XP_004414111.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|328697388|ref|XP_003240324.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|507537890|ref|XP_004652968.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|507537888|ref|XP_004652967.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|397475276|ref|XP_003809069.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|328697385|ref|XP_003240323.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|327279037|ref|XP_003224265.1| PREDICTED: 2-oxoglutarate dehyd...   581   e-163   
gi|325184868|emb|CCA19360.1| unnamed protein product [Albugo lai...   581   e-163   
gi|149047673|gb|EDM00343.1| similar to oxoglutarate dehydrogenas...   580   e-163   
gi|297288378|ref|XP_002803331.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|507668559|ref|XP_004708124.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|388453253|ref|NP_001252731.1| 2-oxoglutarate dehydrogenase-li...   580   e-163   
gi|507537892|ref|XP_004652969.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|312385485|gb|EFR29971.1| hypothetical protein AND_00717 [Anop...   580   e-163   
gi|402880135|ref|XP_003903668.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|148228448|ref|NP_001085695.1| MGC80496 protein [Xenopus laevi...   580   e-163   
gi|355782757|gb|EHH64678.1| hypothetical protein EGM_17963 [Maca...   580   e-163   
gi|348560112|ref|XP_003465858.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|402880133|ref|XP_003903667.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|355562409|gb|EHH19003.1| hypothetical protein EGK_19621 [Maca...   580   e-163   
gi|115496742|ref|NP_001069498.1| 2-oxoglutarate dehydrogenase, m...   580   e-163   
gi|512907394|ref|XP_004926430.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|62945278|ref|NP_001017461.1| 2-oxoglutarate dehydrogenase, mi...   580   e-163   
gi|348560114|ref|XP_003465859.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|472378477|ref|XP_004408659.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|504139699|ref|XP_004582298.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|511892484|ref|XP_004765915.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|472378481|ref|XP_004408661.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|270008312|gb|EFA04760.1| hypothetical protein TcasGA2_TC03062...   580   e-163   
gi|504139703|ref|XP_004582300.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|504139701|ref|XP_004582299.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|395858727|ref|XP_003801711.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|472378479|ref|XP_004408660.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|125833335|ref|XP_687615.2| PREDICTED: 2-oxoglutarate dehydrog...   580   e-163   
gi|340720185|ref|XP_003398522.1| PREDICTED: 2-oxoglutarate dehyd...   580   e-163   
gi|157114121|ref|XP_001652169.1| 2-oxoglutarate dehydrogenase [A...   579   e-163   
gi|20072238|gb|AAH26320.1| Oxoglutarate dehydrogenase-like [Homo...   579   e-163   
gi|504139705|ref|XP_004582301.1| PREDICTED: 2-oxoglutarate dehyd...   579   e-163   
gi|60360580|dbj|BAD90530.1| mKIAA4192 protein [Mus musculus]          579   e-163   
gi|356582492|ref|NP_001239217.1| 2-oxoglutarate dehydrogenase, m...   579   e-163   
gi|470619155|ref|XP_004318060.1| PREDICTED: 2-oxoglutarate dehyd...   579   e-162   
gi|85861164|ref|NP_035086.2| 2-oxoglutarate dehydrogenase, mitoc...   579   e-162   
gi|356582477|ref|NP_001239211.1| 2-oxoglutarate dehydrogenase, m...   579   e-162   
gi|395858729|ref|XP_003801712.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|466088652|ref|XP_004286430.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|470619158|ref|XP_004318061.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|242013045|ref|XP_002427230.1| 2-oxoglutarate dehydrogenase, p...   578   e-162   
gi|507705878|ref|XP_004716316.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|47210299|emb|CAF94599.1| unnamed protein product [Tetraodon n...   578   e-162   
gi|74211765|dbj|BAE29234.1| unnamed protein product [Mus musculus]    578   e-162   
gi|466088648|ref|XP_004286429.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|189524737|ref|XP_001338181.2| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|356582479|ref|NP_001239212.1| 2-oxoglutarate dehydrogenase, m...   578   e-162   
gi|34785384|gb|AAH57354.1| Ogdh protein [Mus musculus]                578   e-162   
gi|507641502|ref|XP_004630422.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|507641506|ref|XP_004630423.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|507641514|ref|XP_004630425.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|504139707|ref|XP_004582302.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|498988345|ref|XP_004551749.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|471412907|ref|XP_004388002.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|29145087|gb|AAH49104.1| Ogdh protein [Mus musculus]                578   e-162   
gi|507641510|ref|XP_004630424.1| PREDICTED: 2-oxoglutarate dehyd...   578   e-162   
gi|207080140|ref|NP_001128819.1| DKFZP459M2028 protein [Pongo ab...   577   e-162   
gi|148708639|gb|EDL40586.1| oxoglutarate dehydrogenase (lipoamid...   577   e-162   
gi|340382096|ref|XP_003389557.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|160418921|sp|Q5R9L8.2|OGDHL_PONAB RecName: Full=2-oxoglutarat...   577   e-162   
gi|471412909|ref|XP_004388003.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|513026842|ref|XP_004874577.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|505798269|ref|XP_004607447.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|197097422|ref|NP_001126195.1| 2-oxoglutarate dehydrogenase-li...   577   e-162   
gi|531241|dbj|BAA01393.1| 2-oxoglutarate dehydrogenase precursor...   577   e-162   
gi|354465781|ref|XP_003495355.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|513026840|ref|XP_004874576.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|513026837|ref|XP_004874575.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|357608706|gb|EHJ66106.1| hypothetical protein KGM_11297 [Dana...   577   e-162   
gi|149690667|ref|XP_001500219.1| PREDICTED: oxoglutarate dehydro...   577   e-162   
gi|513026844|ref|XP_004874578.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|348671428|gb|EGZ11249.1| hypothetical protein PHYSODRAFT_3476...   577   e-162   
gi|354485273|ref|XP_003504808.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|354485269|ref|XP_003504806.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|348560610|ref|XP_003466106.1| PREDICTED: 2-oxoglutarate dehyd...   577   e-162   
gi|513026849|ref|XP_004874580.1| PREDICTED: 2-oxoglutarate dehyd...   576   e-162   
gi|344252530|gb|EGW08634.1| 2-oxoglutarate dehydrogenase E1 comp...   576   e-162   
gi|301781728|ref|XP_002926280.1| PREDICTED: 2-oxoglutarate dehyd...   576   e-162   
gi|338717134|ref|XP_003363592.1| PREDICTED: oxoglutarate dehydro...   576   e-162   


>gi|393243412|gb|EJD50927.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
            precursor [Auricularia delicata TFB-10046 SS5]
          Length = 1012

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/556 (71%), Positives = 449/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAV FVCQLAA+WR  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 452  YPSDLAKAIDAPIFHVNGDNVEAVTFVCQLAADWRAKYKKDVVIDIVCYRRYGHNETDQP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQPRMYQ I KQ   L +Y + L+  GTFT++DIE+HKKWVW +LE+    + DYVP+
Sbjct: 512  HFTQPRMYQAIEKQPTPLTQYTKFLIDRGTFTEKDIEEHKKWVWGMLEKAAAAAADYVPS 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPKELAE + P   TG+  E L+ +G+ ISSYP+GFNVH  L RIL 
Sbjct: 572  SKEWLSASWQGFPSPKELAENTLPQNNTGAEEETLKRIGKAISSYPQGFNVHRNLARILT 631

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K I EG  IDW TAE LAFGSL LE  HVR+SGQDVERGTFSQRHAVLHDQV E QY
Sbjct: 632  ARGKTIEEGANIDWATAEALAFGSLALEKVHVRVSGQDVERGTFSQRHAVLHDQVTEAQY 691

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLNDL   QA+F VCNSSLSEFG LGFE GYSLV+P SL +WE QFGDF NN+QCIIDQ
Sbjct: 692  VPLNDLGGDQARFVVCNSSLSEFGCLGFELGYSLVSPKSLTMWEAQFGDFVNNAQCIIDQ 751

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQL DDHP+ +P PEKM RQHQ
Sbjct: 752  FIASGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLMDDHPHHFPSPEKMERQHQ 811

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP+ARSSL EMTGDT F R
Sbjct: 812  DCNMQITYPTTPANYFHVLRRQIHRDFRKPLINFFSKSLLRHPLARSSLEEMTGDTHFIR 871

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+PHPE+LA+PE+I RHILCSGQVYY LL+ RE   ++ +AISRLEQI PFPYDLL+ 
Sbjct: 872  YIPEPHPESLAAPEEIKRHILCSGQVYYTLLKEREDRGLNDIAISRLEQIAPFPYDLLTA 931

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNAELIW QEEPLN GAWTYV  RI T  N +E H+G+    A R P++S ATG+
Sbjct: 932  HLDKYPNAELIWCQEEPLNCGAWTYVGTRILTAANRTEHHQGKYPHYAGRAPTSSVATGS 991

Query: 541  KKQHIQEEHDLLSQAL 556
            KK H  E    L +AL
Sbjct: 992  KKAHKLEIEQFLERAL 1007



>gi|395331547|gb|EJF63928.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
            precursor [Dichomitus squalens LYAD-421 SS1]
          Length = 1005

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/556 (69%), Positives = 449/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA+WR  +KKDVVIDIVCYR++GHNE DQP
Sbjct: 448  YPSDIAKAIDAPIFHVNGDNVEAVNFVCQLAADWRAKWKKDVVIDIVCYRRHGHNETDQP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L KY Q L+  GTFT++DIE HKKWVW +LE     +KDYVP+
Sbjct: 508  SFTQPRMYKAIEKQPTTLTKYTQFLVGRGTFTEKDIEDHKKWVWGMLETAAAGAKDYVPS 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPKELAE + P   TGS  + L+H+G+VISS+P GF  H  L RIL 
Sbjct: 568  SKEWLSASWPGFPSPKELAERTLPTRSTGSDEDTLKHIGKVISSFPNGFTPHRNLARILT 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I EG+ IDW TAE LAFGSL LE  HVRLSGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 628  TRGKTIEEGKNIDWATAEALAFGSLALEKIHVRLSGQDVERGTFSQRHAVVHDQENEQQY 687

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLNDL  GQA+F VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 688  VPLNDLGSGQARFVVCNSSLSEFGCLGFELGYSLVSPDALTIWEAQFGDFANNAQCIIDQ 747

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ +PHG+DGQGPEHSSGR+ERFLQLCDDHP+++P PEK+ RQHQ
Sbjct: 748  FIASGERKWLQRTGLVMSMPHGFDGQGPEHSSGRIERFLQLCDDHPHIFPSPEKIERQHQ 807

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPANYFHVLRRQIHRDFRKPL+ F SKSLLRHP ARS L EM GDT F+R
Sbjct: 808  DCNMQIVYPTTPANYFHVLRRQIHRDFRKPLVVFFSKSLLRHPKARSELPEMVGDTHFQR 867

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+PHPE L +PE+I RHILCSGQVYY LL+ RE   +  VAISRLEQI PFPYDLL+ 
Sbjct: 868  YLPEPHPENLVAPEQIRRHILCSGQVYYTLLQEREDKGITDVAISRLEQISPFPYDLLTP 927

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+++W QEEPLN GAWTYV PRI T  N +E H+G+    A R P++S ATG+
Sbjct: 928  HLDKYPNADILWCQEEPLNNGAWTYVGPRILTAANETEHHKGKYPLYAGREPTSSVATGS 987

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H ++    L+ A 
Sbjct: 988  KAIHKKQIEQFLATAF 1003



>gi|511006403|gb|EPB87715.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 1032

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/573 (65%), Positives = 469/573 (81%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK +NAPIFHVNGDD EAV +V QLAA+WRQTF KDVVID+VCYRK+GHNE DQP
Sbjct: 460  YCTDIAKSINAPIFHVNGDDAEAVTYVMQLAADWRQTFHKDVVIDLVCYRKHGHNETDQP 519

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQPRMY+ IAKQ P+ + Y  +L ++G+ T  DI+++KK VW+ILE++Y +SKDY PT
Sbjct: 520  MFTQPRMYEAIAKQKPVAQLYETQLKEEGSLTDSDIKENKKRVWDILEDSYSRSKDYKPT 579

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S EW SSSW GFKSPKELAEE+ P YPTG   E LQ VG+ +S+ P  FN+H  L RIL+
Sbjct: 580  SSEWQSSSWPGFKSPKELAEENLPHYPTGVPLESLQTVGKALSTLPHNFNIHRNLKRILQ 639

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++NEG+ IDW TAE LA+GSLL EGKH+R+SGQDVERGTFSQRHAVLHDQ + ++Y
Sbjct: 640  NREKSLNEGKDIDWSTAEALAWGSLLAEGKHIRVSGQDVERGTFSQRHAVLHDQKDGSKY 699

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              LN + P Q   S+ NSSLSE+G LGFE GYSLVNP+SL++WE QFGDF N +Q I+DQ
Sbjct: 700  TLLNHISPEQGALSISNSSLSEYGVLGFELGYSLVNPDSLVVWEAQFGDFANTAQVIVDQ 759

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+A+GE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ER+LQLCDD+PYVYP  EK++RQHQ
Sbjct: 760  FLAAGEQKWLQRTGLVLSLPHGYDGQGPEHSSSRIERYLQLCDDNPYVYPSAEKLSRQHQ 819

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++ A+TP+ YFHVLRRQI R FRKPLI   SKSLLRHP+A+S+L E+TG+T F+ 
Sbjct: 820  DCNMQVVYASTPSQYFHVLRRQICRQFRKPLIMPFSKSLLRHPLAKSNLEELTGETHFQL 879

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+ HPE L  PEKIT+HI+C+GQVYYALL+AREQNK++ VAISR+EQ+ PFPY+ + +
Sbjct: 880  YLPEEHPEHLVEPEKITKHIMCTGQVYYALLKAREQNKINDVAISRIEQLNPFPYEQVKE 939

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H DKYPNAE++W QEEPLN G W +V PRI T ++ +E H G++ + A R PSAS ATGN
Sbjct: 940  HADKYPNAEIVWCQEEPLNMGVWQHVQPRITTSLSQTEHHAGKSPRYAGRAPSASVATGN 999

Query: 541  KKQHIQEEHDLLSQALIGQIVKPKEIVSGVPVW 573
            KK+H QEE+ LLS+AL G ++KPKE+  GVP+W
Sbjct: 1000 KKKHFQEEYGLLSKALTGDVLKPKEVTQGVPIW 1032



>gi|390602959|gb|EIN12351.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
            precursor [Punctularia strigosozonata HHB-11173 SS5]
          Length = 1002

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/556 (67%), Positives = 456/556 (82%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  +KKDVV+DIVCYR+YGHNE DQP
Sbjct: 446  YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKWKKDVVVDIVCYRRYGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L KY + L++ GTFT++DI  HK WVW +LE     +KDYVPT
Sbjct: 506  SFTQPRMYKAIQKQPTPLTKYTKFLIERGTFTEKDIADHKNWVWGMLENAAKAAKDYVPT 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPK+LAEE  P  PTG+    L+ VG  + S+P+GF VH  L RIL 
Sbjct: 566  SKEWLSTSWQGFPSPKQLAEEVLPQRPTGTDESTLKRVGSALGSFPEGFTVHKNLARILS 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RAKA+ +G+GIDW TAE LAFGSL+L+  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 626  GRAKAVEQGEGIDWSTAEALAFGSLVLQNVHVRVSGQDVERGTFSQRHAVIHDQENEQQY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA+F +CNSSLSE+G LGFE GYSLVNP+SL +WE QFGDF NN+QCIIDQ
Sbjct: 686  VPLNNLGSNQARFVICNSSLSEYGCLGFELGYSLVNPSSLTIWEAQFGDFANNAQCIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP+++P PEK+ RQHQ
Sbjct: 746  FIASGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPHIFPSPEKLERQHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQ++RDFRKPLI F SKSLLRHP+ +S+L+E++G+T F+R
Sbjct: 806  DCNMQVVYPTTPANYFHVLRRQVNRDFRKPLIVFFSKSLLRHPLVKSNLSELSGETHFER 865

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+PHPE LA PE+I RHILC+GQVYY LL+ R++  +  +AISR+EQI PFPYDLL+ 
Sbjct: 866  YLPEPHPEALAPPEEIRRHILCTGQVYYHLLKERDERGIKDIAISRVEQISPFPYDLLTP 925

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNAEL+W QEEPLN GAWTYV PRI+T  N +E H+G+    A R P++S ATG+
Sbjct: 926  HLDKYPNAELLWCQEEPLNNGAWTYVGPRIQTAANETEHHKGKYPSYAGRPPTSSVATGS 985

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH +E  D  + AL
Sbjct: 986  KAQHKKEIEDFTNAAL 1001



>gi|392562638|gb|EIW55818.1| 2-oxoglutarate dehydrogenase E1 component [Trametes versicolor
            FP-101664 SS1]
          Length = 1003

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/556 (68%), Positives = 453/556 (81%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA+WR  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 446  YPSDIAKAIDAPIFHVNGDNVEAVNFVCQLAADWRAKWKKDVVIDIVCYRRYGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L+KY + L+  GTFT++DI++HKKWVW  LE+    +KDYVP+
Sbjct: 506  SFTQPRMYKAIEKQPTTLQKYTKFLVGRGTFTEKDIDEHKKWVWGTLEKAASLAKDYVPS 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPKELAE++ P   TG+S + L+ +G+VIS++P+GF  H  L RIL 
Sbjct: 566  SKEWLSASWPGFPSPKELAEQTLPTRATGASEDTLKRIGKVISTFPEGFKPHRNLARILT 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I+EG  IDW TAE LAFG+L LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 626  NRGKTIDEGSNIDWATAEALAFGTLALENTHVRVSGQDVERGTFSQRHAVIHDQENEQQY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA+F VCNSSLSEFGTLGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 686  VPLNNLGSNQARFVVCNSSLSEFGTLGFELGYSLVSPSSLTIWEAQFGDFANNAQCIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLVV LPHG+DGQGPEHSSGR+ERFLQLCDDHP+VYP PEK+ RQHQ
Sbjct: 746  FIASGERKWLQRTGLVVNLPHGFDGQGPEHSSGRIERFLQLCDDHPHVYPTPEKIERQHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANY+HVLRRQIHRDFRKPLI F SKSLLRHP ARS L+EMTGD+ F+R
Sbjct: 806  DCNMQVVYPTTPANYYHVLRRQIHRDFRKPLIVFFSKSLLRHPKARSDLSEMTGDSHFQR 865

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IPD HPE L  PEKI RHILCSGQVY+ LL+ RE   ++ V ISRLEQ+ PFPYDLL+ 
Sbjct: 866  YIPDSHPENLVEPEKIRRHILCSGQVYHTLLQEREDKGINDVVISRLEQVSPFPYDLLTP 925

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+++W QEEPLN G+WTYV PRI T  N ++ H+G+    A R P++S ATG+
Sbjct: 926  HLDKYPNADILWCQEEPLNNGSWTYVGPRIMTAANETQHHKGKYPLYAGREPTSSVATGS 985

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H ++    L+ A 
Sbjct: 986  KAIHKKQIEKFLATAF 1001



>gi|471868491|emb|CCO37403.1| 2-oxoglutarate dehydrogenase E1 component [Rhizoctonia solani AG-1
           IB]
          Length = 994

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/557 (68%), Positives = 454/557 (81%), Gaps = 1/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YCSD+AK ++APIFHVNGDD EAV FVCQLAA+WR  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 437 YCSDIAKSIDAPIFHVNGDDAEAVTFVCQLAADWRAKYKKDVVIDIVCYRRYGHNETDQP 496

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP+MY+ I KQ   L +Y Q L+K+GTFT++DIE+H+KWVW +LE+    SK+Y P+
Sbjct: 497 AFTQPKMYKAIEKQPTPLTQYTQALIKEGTFTEQDIEEHRKWVWGMLEKAAAASKEYKPS 556

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +EWLSSSW+GF SPKELAE++ P  PTG S E+ + VG  IS+ P+GF  H  L RIL 
Sbjct: 557 PKEWLSSSWDGFPSPKELAEQNLPHRPTGVSEEIHRVVGGTISNVPQGFTPHRNLARILS 616

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++ +G GIDW TAE LAFGSL+LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 617 ARGKSVEQGTGIDWATAEALAFGSLVLEKYHVRISGQDVERGTFSQRHAVIHDQENEAQY 676

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLN+L   QA F VCNSSLSEFGTLGFE GYSLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 677 VPLNNLGHDQAAFKVCNSSLSEFGTLGFELGYSLVSPRNLTMWEAQFGDFANNAQCIIDQ 736

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE+KW+QR+GLV+ LPHGYDGQGPEHSSGR+ERFLQL DDHP ++P PEKM R HQ
Sbjct: 737 FIAAGERKWIQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLVDDHPDIFPAPEKMERVHQ 796

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  TTPANYFHVLRRQ+HRDFRKPLI F SKSLLRHP+ +S L+EMTG+T F+R
Sbjct: 797 DCNMQIVYPTTPANYFHVLRRQVHRDFRKPLIVFFSKSLLRHPLVKSDLSEMTGETHFQR 856

Query: 421 FIPDPHPE-TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
           ++P+PHPE  L +PE+I RHILCSGQVYY LL+ARE   +  VAISRLEQ+ PFPYDLL+
Sbjct: 857 YLPEPHPEDVLVAPEQIRRHILCSGQVYYTLLKAREDRGIKDVAISRLEQLSPFPYDLLT 916

Query: 480 QHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            H+DKYPNAEL++ QEEPLN GAWTYVAPRIRT  N +E H+G   K A R P++S ATG
Sbjct: 917 PHLDKYPNAELMYCQEEPLNCGAWTYVAPRIRTASNETEHHKGTYPKYAGRDPTSSVATG 976

Query: 540 NKKQHIQEEHDLLSQAL 556
           +K +H +E   L+  A 
Sbjct: 977 SKLKHKKEIEQLIEAAF 993



>gi|336369751|gb|EGN98092.1| hypothetical protein SERLA73DRAFT_123478 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382526|gb|EGO23676.1| hypothetical protein SERLADRAFT_408978 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 1000

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/556 (67%), Positives = 448/556 (80%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  +K+DVV+DIVCYR+YGHNE DQP
Sbjct: 443 YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKYKRDVVVDIVCYRRYGHNETDQP 502

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMYQ I KQ   L +Y + L+  GTFT++DIE+HKKWVW +LE+    +KDYVPT
Sbjct: 503 SFTQPRMYQAIEKQPTPLTQYAKFLIGRGTFTEKDIEEHKKWVWGMLEKAAGAAKDYVPT 562

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EWLS+SW GF SP++LAEE+ P   TGS  E L+ +G+ IS YP GF  H  L RIL 
Sbjct: 563 SKEWLSASWQGFPSPRQLAEETLPTRATGSDEETLKRIGKAISQYPSGFTPHRNLARILS 622

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG+ IDW TAE LAFGSL LE  HVR+SGQDVERGTFSQRHAV+HDQVNE QY
Sbjct: 623 TRGKTVEEGRNIDWSTAEALAFGSLALEKIHVRVSGQDVERGTFSQRHAVIHDQVNEQQY 682

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PLNDL   QA+F VCNSSLSE+GTLGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 683 IPLNDLGSNQARFVVCNSSLSEYGTLGFELGYSLVSPSSLTIWEAQFGDFANNAQCIIDQ 742

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP++YP P+K+ RQHQ
Sbjct: 743 FIAAGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPHLYPTPKKIERQHQ 802

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARS L EM GDT F+R
Sbjct: 803 DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFSKSLLRHPRARSDLTEMIGDTHFQR 862

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           +I DPHP  L  PE + RHILC+GQVY+ALL+ RE   +  VAISR+EQ+ PFPYDL++ 
Sbjct: 863 YIGDPHPNDLVQPENVRRHILCTGQVYHALLQEREDKGIKDVAISRIEQLSPFPYDLITP 922

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+L+W QEEPLN GAWTYV PRI T  N ++ H G+    A R P++S ATG+
Sbjct: 923 HLDKYPNADLLWCQEEPLNNGAWTYVGPRILTAANETQYHRGKYPYYAGREPTSSVATGS 982

Query: 541 KKQHIQEEHDLLSQAL 556
           K QH +E  + L+ A 
Sbjct: 983 KIQHKKEIEEFLAAAF 998



>gi|471868206|emb|CCO37492.1| 2-oxoglutarate dehydrogenase E1 component [Rhizoctonia solani AG-1
           IB]
          Length = 994

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/557 (68%), Positives = 454/557 (81%), Gaps = 1/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YCSD+AK ++APIFHVNGDD EAV FVCQLAA+WR  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 437 YCSDIAKSIDAPIFHVNGDDAEAVTFVCQLAADWRAKYKKDVVIDIVCYRRYGHNETDQP 496

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP+MY+ I KQ   L +Y Q L+K+GTFT++DIE+H+KWVW +LE+    SK+Y P+
Sbjct: 497 AFTQPKMYKAIEKQPTPLTQYTQALIKEGTFTEQDIEEHRKWVWGMLEKAAAASKEYKPS 556

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +EWLSSSW+GF SPKELAE++ P  PTG S E+ + VG  IS+ P+GF  H  L RIL 
Sbjct: 557 PKEWLSSSWDGFPSPKELAEQNLPHRPTGVSEEIHRVVGGTISNVPQGFTPHRNLARILS 616

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++ +G GIDW TAE LAFGSL+LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 617 ARGKSVEQGTGIDWATAEALAFGSLVLEKYHVRISGQDVERGTFSQRHAVIHDQQNEAQY 676

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLN+L   QA F VCNSSLSEFGTLGFE GYSLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 677 VPLNNLGHDQAAFKVCNSSLSEFGTLGFELGYSLVSPRNLTMWEAQFGDFANNAQCIIDQ 736

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE+KW+QR+GLV+ LPHGYDGQGPEHSSGR+ERFLQL DDHP ++P PEKM R HQ
Sbjct: 737 FIAAGERKWIQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLVDDHPDIFPAPEKMERVHQ 796

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  TTPANYFHVLRRQ+HRDFRKPLI F SKSLLRHP+ +S L+EMTG+T F+R
Sbjct: 797 DCNMQIVYPTTPANYFHVLRRQVHRDFRKPLIVFFSKSLLRHPLVKSDLSEMTGETHFQR 856

Query: 421 FIPDPHPE-TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
           ++P+PHPE  L +PE+I RHILCSGQVYY LL+ARE   +  VAISRLEQ+ PFPYDLL+
Sbjct: 857 YLPEPHPEDVLVAPEQIRRHILCSGQVYYTLLKAREDRGIKDVAISRLEQLSPFPYDLLT 916

Query: 480 QHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            H+DKYP+AEL++ QEEPLN GAWTYVAPRIRT  N +E H+G   K A R P++S ATG
Sbjct: 917 PHLDKYPSAELMYCQEEPLNCGAWTYVAPRIRTASNETEHHKGTYPKYAGRDPTSSVATG 976

Query: 540 NKKQHIQEEHDLLSQAL 556
           +K +H +E   L+  A 
Sbjct: 977 SKLKHKKEIEQLIEAAF 993



>gi|392591928|gb|EIW81255.1| 2-oxoglutarate dehydrogenase E1 component [Coniophora puteana
           RWD-64-598 SS2]
          Length = 999

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/556 (67%), Positives = 448/556 (80%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  +K+DVVIDIVCYR+YGHNE DQP
Sbjct: 442 YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKYKRDVVIDIVCYRRYGHNETDQP 501

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMYQ I KQ   L +Y + L+  GTFT++DIE+HKKWVW +LE+    +KDYVPT
Sbjct: 502 SFTQPRMYQAIEKQPTPLTQYTKFLVGRGTFTEKDIEEHKKWVWGMLEKAAAGAKDYVPT 561

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EWLS+SW GF SP++LAEE+ P   TGS    L+ VG+ ISSYP+GF  H  L RIL 
Sbjct: 562 SKEWLSASWQGFPSPRQLAEETLPTRATGSDEATLKRVGKAISSYPQGFTPHRNLARILS 621

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EGQ IDW TAE LA GSL LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 622 NRGKTVEEGQNIDWSTAEALAIGSLALEKVHVRVSGQDVERGTFSQRHAVIHDQQNEQQY 681

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PLN+L   QA+F VCNSSLSEFG LGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 682 LPLNNLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDSLTVWEAQFGDFANNAQCIIDQ 741

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP ++P PEK+ RQHQ
Sbjct: 742 FIAAGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPNIFPTPEKIERQHQ 801

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARS L EM GDT F+R
Sbjct: 802 DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFSKSLLRHPQARSELTEMIGDTQFER 861

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           +IP+ HP++L +PE I RHILC+GQVYY LL+AREQ  +  +AISR+EQI PFPYDL++ 
Sbjct: 862 YIPESHPDSLVAPENIRRHILCTGQVYYTLLQAREQRGIKDIAISRIEQISPFPYDLVTP 921

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+D+YPNA+L+W QEEPLN GAWTYV PRI T  N ++ H+G+    A R P++S ATG+
Sbjct: 922 HLDQYPNADLLWCQEEPLNNGAWTYVGPRILTAANETQHHKGKYPHYAGREPTSSVATGS 981

Query: 541 KKQHIQEEHDLLSQAL 556
           K QH +E    L  + 
Sbjct: 982 KTQHKKEIEAFLEASF 997



>gi|409078704|gb|EKM79066.1| hypothetical protein AGABI1DRAFT_113697 [Agaricus bisporus var.
            burnettii JB137-S8]
 gi|426195611|gb|EKV45540.1| hypothetical protein AGABI2DRAFT_193525 [Agaricus bisporus var.
            bisporus H97]
          Length = 1012

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/556 (67%), Positives = 451/556 (81%), Gaps = 1/556 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  FKKDVVIDIVCYR+YGHNE DQP
Sbjct: 448  YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKFKKDVVIDIVCYRRYGHNETDQP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I  Q   L KY + L+  GTFT++DIE+HKKWVW +LE   + +KDYVPT
Sbjct: 508  SFTQPRMYEAIKNQPTPLTKYTKFLVGRGTFTEKDIEEHKKWVWGMLETAANGAKDYVPT 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS++W GF SP++LAE++ P   TGS    L+ +G+ IS++P+GF  H  L RIL 
Sbjct: 568  SKEWLSAAWTGFPSPRQLAEQALPTRATGSDVPTLRQIGKAISTFPQGFTTHRNLARILN 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K + EG  IDW TAE LAFG+L LE  HVRLSGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 628  ARGKTVEEGTNIDWSTAEALAFGTLALEKIHVRLSGQDVERGTFSQRHAVIHDQANEQQY 687

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLNDL   QA+F VCNSSLSEFGTLGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 688  VPLNDLGSNQARFVVCNSSLSEFGTLGFELGYSLVSPDSLTIWEAQFGDFANNAQCIIDQ 747

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLVV LPHGYDGQGPEHSSGR+ERFLQLCDDHP++YP PEK+ RQHQ
Sbjct: 748  FIAAGERKWLQRTGLVVSLPHGYDGQGPEHSSGRIERFLQLCDDHPHIYPSPEKIERQHQ 807

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARSSL EM G+T F+R
Sbjct: 808  DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLIVFFSKSLLRHPKARSSLDEMVGETHFER 867

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+   E L +P+++ RHILCSGQVYYALL+ARE+  +  VAISR+EQ+ PFPYD+++ 
Sbjct: 868  YIPEA-SEDLVAPDQVKRHILCSGQVYYALLQAREERGIKDVAISRIEQLSPFPYDMVTS 926

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+W QEEP+N GAWTY+ PRI T  + ++ H+G+    A R P++S ATG+
Sbjct: 927  HLDKYPNADLLWCQEEPMNNGAWTYIGPRIYTAASRTQNHKGKYPYYAGREPTSSVATGS 986

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH +E    ++ A 
Sbjct: 987  KTQHKKETEAFVNTAF 1002



>gi|511008406|gb|EPB89672.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 1032

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/573 (64%), Positives = 461/573 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK +NAP+FHVNGDD EAV FV QLAA+WRQTF KD VID+VCYRK+GHNE DQP
Sbjct: 460  YCTDIAKSINAPVFHVNGDDAEAVTFVMQLAADWRQTFHKDCVIDLVCYRKHGHNETDQP 519

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MYQ I+K  P+ +KY ++L K+G FT E I+  KK VW ILEE+Y  SK Y P+
Sbjct: 520  MFTQPLMYQAISKMKPVAQKYEEQLQKEGEFTAEQIKNEKKRVWEILEESYTASKTYKPS 579

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLSSSW GFKSPKELA E  P YPTG S E+L  VG+ +++ P+ F  H  + RIL+
Sbjct: 580  SQEWLSSSWPGFKSPKELATEILPQYPTGVSSEVLSQVGKAMTTLPQNFQAHRNISRILQ 639

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K+I  G+ IDW TAEGLA+GSLLLE KHVR+SGQDVERGTFSQRHAVLHDQ ++ + 
Sbjct: 640  AREKSIASGKDIDWSTAEGLAWGSLLLENKHVRVSGQDVERGTFSQRHAVLHDQKSDNRA 699

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              LND+ P Q   S+ NSSLSE+G LGFE GYSLV+PNSL++WE QFGDF N +Q I+DQ
Sbjct: 700  TLLNDISPEQGVLSISNSSLSEYGVLGFELGYSLVDPNSLVIWEAQFGDFANTAQVIVDQ 759

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ER+LQLCD++PY +P  EK+ RQHQ
Sbjct: 760  FLASGEQKWLQRTGLVLSLPHGYDGQGPEHSSARIERYLQLCDENPYAFPSAEKLQRQHQ 819

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++ A+TP+ YFHVLRRQI RD+RKPLI   SKS+LRHP+ARS+L+EMTG+T F+ 
Sbjct: 820  DCNMQVVYASTPSQYFHVLRRQICRDYRKPLILPFSKSMLRHPLARSNLSEMTGNTHFQL 879

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+ HPETL +PE+I +HILCSGQVYYALL+AREQNKM+ +AISR+EQ+ PFP+  + +
Sbjct: 880  YLPESHPETLVAPEQIKKHILCSGQVYYALLKAREQNKMNDIAISRVEQLNPFPFQQIKE 939

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H DKYPNAE++W QEEPLN G W +V PR+ T++  ++ H G++   A R PSAS ATGN
Sbjct: 940  HADKYPNAEIVWCQEEPLNMGPWQHVEPRLTTVLAETQHHAGKSPSYAGRPPSASVATGN 999

Query: 541  KKQHIQEEHDLLSQALIGQIVKPKEIVSGVPVW 573
            KK+H QEE+  LS+ALIGQ  +P+ I +GVPVW
Sbjct: 1000 KKKHYQEEYAFLSKALIGQSTEPRGIEAGVPVW 1032



>gi|299743948|ref|XP_001836087.2| oxoglutarate dehydrogenase [Coprinopsis cinerea okayama7#130]
 gi|298405893|gb|EAU85723.2| oxoglutarate dehydrogenase [Coprinopsis cinerea okayama7#130]
          Length = 1005

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/556 (67%), Positives = 450/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD++EAVNFVCQLAA++R  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 447  YPSDIAKSIDAPIFHVNGDNIEAVNFVCQLAADYRAKWKKDVVIDIVCYRRYGHNETDQP 506

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L +Y + L+  GTFT+ DIE+HKKWVW +LE+    SKDYVPT
Sbjct: 507  SFTQPRMYEAIKKQPTPLTQYAKFLVNRGTFTERDIEEHKKWVWGMLEKAAAASKDYVPT 566

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS++W GF SPK+LAE++ P  PTGS  E L+ +G+VISS+P GF  H  L RIL 
Sbjct: 567  SKEWLSAAWQGFPSPKQLAEKTLPTRPTGSDEETLKRIGKVISSFPTGFTPHRNLARILG 626

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+KA+ EG GIDW TAE LAFGSL LE  HVR+SGQDVERGTFSQRHAV+HDQVNE QY
Sbjct: 627  GRSKAVEEGTGIDWATAEALAFGSLALEKIHVRVSGQDVERGTFSQRHAVIHDQVNEQQY 686

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QAKF VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 687  VPLNNLGSSQAKFVVCNSSLSEFGALGFELGYSLVSPDALTIWEAQFGDFANNAQCIIDQ 746

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLVV LPHGYDGQGPEHSSGR+ERFLQLCDDHP  +P PEK+ RQHQ
Sbjct: 747  FIAAGERKWLQRTGLVVNLPHGYDGQGPEHSSGRIERFLQLCDDHPNQFPSPEKIERQHQ 806

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP A+S L+E  G+T F+R
Sbjct: 807  DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLIVFFSKSLLRHPRAKSDLSEFVGETNFQR 866

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+P  E L +PE+I RHILC+GQVY+ LL+ARE+  +  VAISR+EQI PFPYD+++ 
Sbjct: 867  YIPEPFEEGLVAPEEIKRHILCTGQVYHTLLQAREERGIKDVAISRIEQISPFPYDMITP 926

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA L+W QEEPLN GAW+YV PRI T    ++ H+G+    A R P++S ATG+
Sbjct: 927  HLDKYPNAGLMWCQEEPLNNGAWSYVGPRIYTAAGQTQHHKGKYPLYAGREPTSSVATGS 986

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH +E    ++ A 
Sbjct: 987  KMQHKKEIEAFVNAAF 1002



>gi|443923012|gb|ELU42340.1| 2-oxoglutarate dehydrogenase E1 component [Rhizoctonia solani AG-1
            IA]
          Length = 1099

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/559 (67%), Positives = 451/559 (80%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++APIFHVNGDD EAV FVCQLAA+WR  +KKDVV+DIVCYR+YGHNE DQP
Sbjct: 540  YCSDIAKSIDAPIFHVNGDDAEAVTFVCQLAADWRAKYKKDVVVDIVCYRRYGHNETDQP 599

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP+MY+ I KQ   L +Y Q L+K+GTFT++DIE+H+KWVW +LE+    SK+Y P+
Sbjct: 600  AFTQPKMYKAIEKQPTPLTQYTQALIKEGTFTEQDIEEHRKWVWGMLEKAAAASKEYKPS 659

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWLSSSW+GF SPKELAE++ P  PTG   E+ + +G  IS+ P+GF  H  L RIL 
Sbjct: 660  PKEWLSSSWDGFPSPKELAEQNLPHRPTGVDEEIHRTIGNTISNVPQGFTPHRNLARILS 719

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K++ +G GIDW TAE LAFGSL+LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 720  ARGKSVEQGSGIDWATAEALAFGSLVLEKYHVRISGQDVERGTFSQRHAVIHDQENEAQY 779

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA F VCNSSLSEFGTLGFE GYSLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 780  VPLNNLGHDQAVFKVCNSSLSEFGTLGFELGYSLVSPRNLTMWEAQFGDFANNAQCIIDQ 839

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KW+QR+GLV+ LPHGYDGQGPEHSSGR+ERFLQL DDHP ++P PEKM R HQ
Sbjct: 840  FIAAGERKWVQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLVDDHPDIFPSPEKMERMHQ 899

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKP--LIAFTSKSLLRHPMARSSLAEMTGDTTF 418
            DCNMQI+  TTPANYFHVLRRQ+HRDFRKP  LI F SKSLLRHP+ +S L+EMTG+T F
Sbjct: 900  DCNMQIVYPTTPANYFHVLRRQVHRDFRKPIQLILFFSKSLLRHPLVKSDLSEMTGETHF 959

Query: 419  KRFIPDPHPE-TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
            +R++P+PHPE  L +PE+I RHILCSGQVYY LL+ARE   +  VAISRLEQ+ PFPYDL
Sbjct: 960  QRYLPEPHPEDVLVAPEQIKRHILCSGQVYYTLLKAREDRGVKDVAISRLEQLSPFPYDL 1019

Query: 478  LSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
            L+ H+DKYPNAEL++ QEEPLN G WTYVAPRIRT  N ++ H+G   K A R P++S A
Sbjct: 1020 LTPHLDKYPNAELMYCQEEPLNCGGWTYVAPRIRTASNETQHHKGTYPKYAGRDPTSSVA 1079

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG+K +H +E    L  A 
Sbjct: 1080 TGSKHKHKKEIEQYLDAAF 1098



>gi|449548762|gb|EMD39728.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
            precursor [Ceriporiopsis subvermispora B]
          Length = 1002

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/556 (67%), Positives = 449/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAV FVCQLAA+WR  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 446  YPSDIAKAIDAPIFHVNGDNVEAVTFVCQLAADWRAKWKKDVVIDIVCYRRYGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ IAKQ   L KY + L+  GTFT++DIE+HKKWVW +LE+  + +KDYVPT
Sbjct: 506  SFTQPRMYKAIAKQPTPLTKYSKFLVDRGTFTEKDIEEHKKWVWGMLEKAANGAKDYVPT 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPK+LAEE+ P   TG+  ++L+ +G+ IS++P+GF  H  L RIL 
Sbjct: 566  SKEWLSASWPGFPSPKKLAEETLPTRATGTGEDVLKRIGQAISTFPEGFTPHRNLARILA 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LA G+L LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 626  TRGKTVEEGRNIDWATAEALAIGALALEKIHVRVSGQDVERGTFSQRHAVIHDQENEQQY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN+L   QA+F VCNSSLSEFG LGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 686  IPLNNLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDSLTVWEAQFGDFANNAQCIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHG+DGQGPEHSSGRLERFLQLCDDHP+V+P PEK+ RQHQ
Sbjct: 746  FIASGERKWLQRTGLVMSLPHGFDGQGPEHSSGRLERFLQLCDDHPHVFPTPEKLERQHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQ+HRDFRKPLI F SKSLLRHP ARS L+EM G+T F+R
Sbjct: 806  DCNMQVVYPTTPANYFHVLRRQVHRDFRKPLILFFSKSLLRHPKARSDLSEMVGETHFQR 865

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IPD HPE L +PE+I RHILC+GQVY  LL+ RE   +  V ISR+EQI PFPYDL++ 
Sbjct: 866  YIPDSHPEDLVAPEQIRRHILCTGQVYQTLLQEREDKGIKDVVISRVEQISPFPYDLVTP 925

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+++W QEEPLN GAWTYV PRI T  N ++ H+G+    A R P++S ATG+
Sbjct: 926  HLDKYPNADILWCQEEPLNNGAWTYVGPRILTAANETQHHKGKYPLYAGRDPTSSVATGS 985

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H +E    L+ A 
Sbjct: 986  KAIHKKEIESFLATAF 1001



>gi|353241509|emb|CCA73320.1| probable KGD1-alpha-ketoglutarate dehydrogenase [Piriformospora
           indica DSM 11827]
          Length = 998

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/556 (67%), Positives = 445/556 (80%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YCSD+AK ++APIFHVNGD+VEAV FVCQLAA+WR  +KKDVV+DI+CYR+YGHNE DQP
Sbjct: 440 YCSDIAKAIDAPIFHVNGDNVEAVTFVCQLAADWRAKYKKDVVVDIICYRRYGHNETDQP 499

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMY+ I KQ   L +Y   L K  TFT +DIE+H+KWVW +LE+    +K Y P+
Sbjct: 500 SFTQPRMYKAIEKQPTPLTQYTNFLSKQKTFTDQDIEEHRKWVWGMLEKAAAGAKTYEPS 559

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +EWLSS W  F SPKELAE + P  PTG + E L+H+G+VISSYP+GFNVH  L RIL+
Sbjct: 560 PKEWLSSEWPNFPSPKELAENNLPHLPTGVAEETLKHIGKVISSYPEGFNVHRNLARILQ 619

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG  ID  TAE LA G+L+LE   VR+SGQDVERGTFSQRHAVLHDQ  E QY
Sbjct: 620 TRGKTVEEGTNIDMSTAEALAMGALVLEKIDVRISGQDVERGTFSQRHAVLHDQATERQY 679

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPL +L   QA F+ CNSSLSE+G LGFE GYSLV+P SL++WE QFGDF NN+Q IIDQ
Sbjct: 680 VPLKNLGKDQAAFTACNSSLSEYGVLGFELGYSLVSPASLVIWEAQFGDFANNAQVIIDQ 739

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE+KWLQRTGLV+ +PHGYDGQGPEHSSGR+ERFLQLCDDHP+++PPPEK+ARQHQ
Sbjct: 740 FIASGERKWLQRTGLVMSMPHGYDGQGPEHSSGRIERFLQLCDDHPHIFPPPEKLARQHQ 799

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  TTPANYFHVLRRQIHR+FRKPLI F SKSLLRHP ARS L+EMTG+T F+R
Sbjct: 800 DCNMQIVYPTTPANYFHVLRRQIHREFRKPLILFFSKSLLRHPQARSDLSEMTGETHFQR 859

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++P+PHPE L +PE+I RHILC+GQVYY LL+ RE  +   VAISRLEQ+ PFPYDLL+ 
Sbjct: 860 YLPEPHPEQLVAPEEIRRHILCTGQVYYTLLKEREARQAWDVAISRLEQLSPFPYDLLTP 919

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+L+W QEEPLN GAWTYV  RI T  N +E H+G+    A R P +S ATG+
Sbjct: 920 HLDKYPNADLMWCQEEPLNCGAWTYVGTRILTAANETEHHKGKYPYYAGRPPYSSVATGS 979

Query: 541 KKQHIQEEHDLLSQAL 556
           K QH++E   L+ QA 
Sbjct: 980 KAQHMKEVSQLVEQAF 995



>gi|392593304|gb|EIW82629.1| 2-oxoglutarate dehydrogenase E1 component [Coniophora puteana
            RWD-64-598 SS2]
          Length = 1005

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/556 (67%), Positives = 448/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  FK+DVVIDIVCYRK+GHNE DQP
Sbjct: 449  YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKFKRDVVIDIVCYRKHGHNETDQP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   LE Y Q L+  GTFT++DIE+H+KWVW +L++   ++KDYVPT
Sbjct: 509  SFTQPRMYEAIEKQPTTLEAYTQFLVGRGTFTEKDIEEHRKWVWGMLDKAASEAKDYVPT 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+SW GF SPKEL E   P + TG S ++L+ +G  IS++P  F  H  L RIL 
Sbjct: 569  SQEWLSASWPGFPSPKELKEMKLPTHATGVSEDVLKRIGNAISTWPDKFAPHKNLARILM 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFGSL LE  HVRLSGQDVERGTFSQRHA++HDQ NE QY
Sbjct: 629  QRGKTVQEGKNIDWATAEALAFGSLALEKVHVRLSGQDVERGTFSQRHAIVHDQNNEAQY 688

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA+F+VCNSSLSEFG LGFE GYSLV+PN+L +WE QFGDF NN+QCIIDQ
Sbjct: 689  VPLNELGSSQARFTVCNSSLSEFGALGFELGYSLVSPNNLTIWEAQFGDFANNAQCIIDQ 748

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP VYP  EK+ RQHQ
Sbjct: 749  FIAAGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPLVYPTVEKLERQHQ 808

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARS LAEM GD  F+ 
Sbjct: 809  DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFSKSLLRHPRARSDLAEMVGDIHFQH 868

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+PH  +L +PEK+ RHILCSGQVY+ LL+ARE+  +D VAISRLEQI PFPY+ ++ 
Sbjct: 869  YIPEPHTSSLVAPEKVRRHILCSGQVYHTLLQAREERGIDDVAISRLEQISPFPYEQITP 928

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+W QEEPLN GAWTYV  R++T  + +E H+G+    A R P++S ATG+
Sbjct: 929  HLDKYPNADLLWCQEEPLNNGAWTYVGLRLQTAASKTEHHKGKFPLYAGRDPTSSVATGS 988

Query: 541  KKQHIQEEHDLLSQAL 556
            K +H +E    L++A 
Sbjct: 989  KTRHKKEIETFLNKAF 1004



>gi|409042069|gb|EKM51553.1| hypothetical protein PHACADRAFT_261764 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 999

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/556 (67%), Positives = 449/556 (80%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVNGD+ EAV FVCQLAA++R  +KKDVV+DIVCYR++GHNE DQP
Sbjct: 442 YPSDIAKAIDAPIFHVNGDNAEAVTFVCQLAADYRAKWKKDVVLDIVCYRRHGHNETDQP 501

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMY+ IAKQ   L KY + L++ GTFT+++IE HKKWVW +LE+   K+KDY PT
Sbjct: 502 SFTQPRMYKAIAKQPTPLTKYSKFLVQRGTFTEQEIEDHKKWVWGMLEQAADKAKDYQPT 561

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EWLS+SW GF SPK+LAEE+ P  PTG+  E+L+ VG+ ISS+P GF  H  L RIL 
Sbjct: 562 SKEWLSASWPGFPSPKQLAEETLPTRPTGTDEEVLKRVGKSISSFPPGFTPHKNLARILT 621

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + +G  IDW TAE LAFG+L LE  HVRLSGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 622 TRGKTVEDGNNIDWATAETLAFGTLALEKIHVRLSGQDVERGTFSQRHAVVHDQENEQQY 681

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLNDL   QA+F VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 682 VPLNDLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDNLTIWEAQFGDFANNAQCIIDQ 741

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE+KWLQR+GLV+ LPHG+DGQGPEHSSGR+ERFLQLCDDHP+VYP PEK+ RQHQ
Sbjct: 742 FIASGERKWLQRSGLVMSLPHGFDGQGPEHSSGRIERFLQLCDDHPHVYPTPEKIERQHQ 801

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARS L+EM G+T F+R
Sbjct: 802 DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLIVFFSKSLLRHPKARSDLSEMVGETHFQR 861

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++PD HPE L +PE+I RHILC+GQVY+ LL+ RE   +  V ISR+EQI PFPYDL++ 
Sbjct: 862 YLPDSHPENLVAPEQIRRHILCTGQVYHTLLQEREDKGITDVVISRVEQISPFPYDLVTP 921

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+L+W QEEPLN GAW YVAPRI T  N +E H+G+    A R P++S ATG+
Sbjct: 922 HLDKYPNADLLWCQEEPLNNGAWGYVAPRILTAANETEHHKGKYPLYAGRPPTSSIATGS 981

Query: 541 KKQHIQEEHDLLSQAL 556
           K  H ++    L+++ 
Sbjct: 982 KAVHKKQIEGFLARSF 997



>gi|170089717|ref|XP_001876081.1| 2-oxoglutarate dehydrogenase complex E1 component, mitochondrial
            precursor [Laccaria bicolor S238N-H82]
 gi|164649341|gb|EDR13583.1| 2-oxoglutarate dehydrogenase complex E1 component, mitochondrial
            precursor [Laccaria bicolor S238N-H82]
          Length = 1012

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/559 (66%), Positives = 445/559 (79%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++API HVNGD+VEAVNFVCQLAA++R  +KKDVVIDIVCYR+YGHNE DQP
Sbjct: 447  YPSDLAKTIDAPILHVNGDNVEAVNFVCQLAADYRAKYKKDVVIDIVCYRRYGHNETDQP 506

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L +Y + L+  GTFT++DIE+HK WV  +LE+    +KDYVP+
Sbjct: 507  SFTQPRMYKAIEKQPTPLTQYTKFLVGRGTFTEKDIEEHKTWVLGMLEKAAAGAKDYVPS 566

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS++W+GF  PK+LAE++ P   TGS  E LQ +G+ ISSYP GF  H  L RIL 
Sbjct: 567  SKEWLSAAWSGFPGPKQLAEQTLPTRATGSDAETLQRIGKAISSYPTGFTPHRNLARILG 626

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG  IDW TAE LAFGSL LE  HVR+SGQDVERGTFSQRHAV+HDQ+NE QY
Sbjct: 627  TRGKTVEEGANIDWSTAEALAFGSLALEKIHVRVSGQDVERGTFSQRHAVIHDQINEQQY 686

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLNDL   QA+F +CNSSLSEFGTLGFE GYSLV+P+SL +WE QFGDF NN+QCIIDQ
Sbjct: 687  IPLNDLGSSQARFVICNSSLSEFGTLGFELGYSLVSPDSLTVWEAQFGDFANNAQCIIDQ 746

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLVV LPHGYDGQGPEHSSGR+ERFLQLCDDHP+ +P  EK+ RQHQ
Sbjct: 747  FIAAGERKWLQRTGLVVNLPHGYDGQGPEHSSGRIERFLQLCDDHPHHFPTQEKVERQHQ 806

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARSSL EM GDT F+R
Sbjct: 807  DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFSKSLLRHPKARSSLDEMIGDTHFQR 866

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+PH   L +PE+ITRHILCSGQVY+ LL+ARE+  +  +AISR+EQ+ PFPYDL++ 
Sbjct: 867  YIPEPHDSGLVAPEQITRHILCSGQVYHTLLQAREERGIKDIAISRIEQLSPFPYDLITP 926

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+D YPNA L+W QEEPLN GAW+YV PRI T    ++ H+G+    A R P++S ATG+
Sbjct: 927  HLDLYPNASLLWCQEEPLNNGAWSYVGPRIYTAAGKTQHHKGKYPFYAGREPTSSVATGS 986

Query: 541  KKQHIQEEHDLLSQALIGQ 559
            K QH +E    L  A   Q
Sbjct: 987  KLQHKKEIEAFLDTAFTAQ 1005



>gi|389744649|gb|EIM85831.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
            precursor [Stereum hirsutum FP-91666 SS1]
          Length = 1004

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/556 (67%), Positives = 445/556 (80%), Gaps = 1/556 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAV FVCQLAA++R  FKKDVVIDIVCYR+YGHNE DQP
Sbjct: 448  YPSDIAKSLDAPIFHVNGDNVEAVTFVCQLAADYRAKFKKDVVIDIVCYRRYGHNETDQP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L +Y + L+  GTFT++DIE+H+KWV  +LE   + +KDY PT
Sbjct: 508  SFTQPRMYKAIEKQPTPLTQYTKFLVNRGTFTEKDIEEHRKWVMGMLETAANAAKDYAPT 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLS+ W GF SPK+LAEE+ P  PTG   E L+H+G+ IS+YP  F VH  L RIL 
Sbjct: 568  SKEWLSAPWQGFPSPKQLAEETLPTRPTGVDEETLKHIGQTISTYPPNFKVHRNLSRILN 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EGQ IDW TAE LAFGSL LE KHVR+SGQDVERGTFSQRHA+LHDQ NE QY
Sbjct: 628  GRGKTVQEGQNIDWSTAEALAFGSLALEKKHVRVSGQDVERGTFSQRHAILHDQENEAQY 687

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA+F VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 688  VPLNNLGNNQARFVVCNSSLSEFGALGFELGYSLVSPDALTIWEAQFGDFANNAQCIIDQ 747

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+V+P  EK+ RQHQ
Sbjct: 748  FIASGERKWLQRTGLVMSLPHGYDGQGPEHSSARMERFLQLCDDHPHVFPTAEKIERQHQ 807

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPANYFHVLRRQIHRDFRKPL+ F SKSLLRHP ARSSL EMTG+TTF+R
Sbjct: 808  DCNMQIVYPTTPANYFHVLRRQIHRDFRKPLVVFFSKSLLRHPKARSSLDEMTGETTFQR 867

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+  P+ L +P++I RHILC+GQVY  LL  RE+  +  VAISR+EQI PFPYDL++ 
Sbjct: 868  YLPEESPD-LVAPDQIRRHILCTGQVYQTLLAEREEKGIKDVAISRIEQISPFPYDLVTP 926

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+D+YPNA+L+W QEEPLN GAWTYV PRI T    ++ H+G+    A R P++S ATG+
Sbjct: 927  HLDQYPNADLLWCQEEPLNNGAWTYVGPRIYTAGKETKHHQGKYPLYAGREPTSSVATGS 986

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH +E    L+ A 
Sbjct: 987  KIQHKKEIEAFLATAF 1002



>gi|392565940|gb|EIW59116.1| 2-oxoglutarate dehydrogenase E1 component [Trametes versicolor
            FP-101664 SS1]
          Length = 1004

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/556 (66%), Positives = 445/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  +APIFHVNGDDVEAVNFVCQLAA+WR  +K DV++DIVCYR+YGHNE DQP
Sbjct: 445  YPSDIAKAFDAPIFHVNGDDVEAVNFVCQLAADWRAKWKSDVIVDIVCYRRYGHNETDQP 504

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ   L KY + L++ GTFT+++IE+HK+WVW +LE+    +K Y PT
Sbjct: 505  SFTQPRMYKAIEKQPTTLTKYTKALVERGTFTEKEIEEHKQWVWGVLEKGAEGAKTYEPT 564

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWLSSSW GF SPKEL E++  +  TG+S E+L+HVG+ ISS+P+GF+ H  L RIL 
Sbjct: 565  GKEWLSSSWPGFPSPKELVEKNLASPSTGTSEEVLKHVGKAISSFPEGFHPHRNLARILT 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFG+L LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 625  TRGKTVEEGKNIDWATAEALAFGTLALEKIHVRVSGQDVERGTFSQRHAVIHDQENEQQY 684

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN+L   QA+F VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 685  VPLNNLGNDQARFVVCNSSLSEFGALGFELGYSLVSPSALTIWEAQFGDFVNNAQCIIDQ 744

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KW QRTGLV+ LPHG+DGQGPEHSSGR+ERFLQLCDDHP+V+PPPEK+ RQHQ
Sbjct: 745  FIASGERKWFQRTGLVMNLPHGFDGQGPEHSSGRIERFLQLCDDHPHVFPPPEKIERQHQ 804

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFH LRRQIHR+FRKP+I F SKSLLRHP ARS LA+M GD+ F R
Sbjct: 805  DCNMQVVYPTTPANYFHSLRRQIHREFRKPMILFFSKSLLRHPKARSDLADMAGDSHFLR 864

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IPD HPE + +PE++ RHILCSGQVYY LL+ RE   ++ V ISR+EQI PFPYDLL+ 
Sbjct: 865  YIPDAHPENIVAPEQVRRHILCSGQVYYTLLQEREDKGINDVVISRIEQISPFPYDLLTP 924

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+W QEEPLN GAW+YV PRI T    +  H+ +    A R P++S ATG+
Sbjct: 925  HLDKYPNADLLWCQEEPLNNGAWSYVGPRIHTAAKETAHHKRKYPLYAGREPTSSVATGS 984

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH ++    L+ A 
Sbjct: 985  KAQHKKQIEQFLADAF 1000



>gi|58262862|ref|XP_568841.1| oxoglutarate dehydrogenase (succinyl-transferring) [Cryptococcus
            neoformans var. neoformans JEC21]
 gi|134108436|ref|XP_777169.1| hypothetical protein CNBB4000 [Cryptococcus neoformans var.
            neoformans B-3501A]
 gi|50259854|gb|EAL22522.1| hypothetical protein CNBB4000 [Cryptococcus neoformans var.
            neoformans B-3501A]
 gi|57223491|gb|AAW41534.1| oxoglutarate dehydrogenase (succinyl-transferring), putative
            [Cryptococcus neoformans var. neoformans JEC21]
          Length = 1055

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/547 (66%), Positives = 443/547 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN DDVEAVN+VC LAA+WR TFKKDVVIDIVCYR+YGHNE DQP
Sbjct: 494  YPSDIAKSIDAPIFHVNSDDVEAVNYVCTLAADWRATFKKDVVIDIVCYRRYGHNETDQP 553

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I KQ  +L  Y  KL+K+GTFT+++I++H++WVW +LE+ Y  S+DY P+
Sbjct: 554  SFTQPKMYKAIQKQPTVLSIYTDKLIKEGTFTEKEIDEHRQWVWGMLEKAYDGSRDYKPS 613

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF SPKELAEE  P + TG+S + L+ VG++ISS+P+GF+ H  L RI+ 
Sbjct: 614  PREWLSSSWEGFPSPKELAEEVLPQHHTGASEDALKRVGQIISSFPEGFHPHKNLARIIG 673

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAV+HDQ  E  +
Sbjct: 674  NRGKTVAEGKNIDWSTAEALAFGTLCLEGTHVRISGQDVERGTFSQRHAVVHDQKTEQTH 733

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            + L  L   Q  F+V NS LSEFGTLGFE GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 734  IALKHLDADQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQ 793

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDD P VYP PEK+ RQHQ
Sbjct: 794  FIAAGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDEPRVYPSPEKLERQHQ 853

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQ  RDFRKPLI F SKSLLRHP+ARSSL EM+GD+ F+R
Sbjct: 854  DCNMQVVYPTTPANYFHVLRRQNKRDFRKPLIVFFSKSLLRHPLARSSLEEMSGDSKFQR 913

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+PHPE+L  PEKI RHILC+GQVY+ LL+ RE+  ++ VAISR+EQ+ P PYD L+ 
Sbjct: 914  YIPEPHPESLVEPEKIRRHILCTGQVYFQLLKEREERGINDVAISRIEQLSPLPYDRLTP 973

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+WAQEEPLN GAWTYV PR+ T +  +E H+ +    A R PS+S ATG+
Sbjct: 974  HLDKYPNADLVWAQEEPLNNGAWTYVQPRLITALQETEHHKSKIPFYAGRKPSSSVATGS 1033

Query: 541  KKQHIQE 547
            K  H +E
Sbjct: 1034 KYAHKKE 1040



>gi|384493565|gb|EIE84056.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Rhizopus delemar RA 99-880]
          Length = 1014

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/556 (65%), Positives = 451/556 (81%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK +NAP+FHVNGDD EAV FV QLAA+WRQTF +DVVID+VCYRK+GHNE DQP
Sbjct: 457  YCTDIAKSINAPVFHVNGDDAEAVTFVMQLAADWRQTFHRDVVIDLVCYRKHGHNETDQP 516

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQPRMY+ IAKQ P+ +KY ++L K+G+ T+EDI  +K+ VW ILEE+Y +SKDY P 
Sbjct: 517  MFTQPRMYEAIAKQEPVAKKYEEQLKKEGSLTEEDISANKQRVWGILEESYSRSKDYKPK 576

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S EWLSSSW GFKSPKELAEE+ P YPTG + E LQ VG+ +++ P  FNVH  L RIL+
Sbjct: 577  SSEWLSSSWPGFKSPKELAEENLPHYPTGVALETLQTVGKALTTLPHNFNVHRNLKRILQ 636

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+GIDW TAE LA+GSLL EGKHVR+SGQDVERGTFSQRHAVLHDQ N +++
Sbjct: 637  NRGKSLEEGKGIDWSTAEALAWGSLLAEGKHVRISGQDVERGTFSQRHAVLHDQKNGSRH 696

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              LN + P Q   S+ NSSLSE+G LGFE GYSLVNP+SL++WE QFGDF N +Q IIDQ
Sbjct: 697  TLLNHISPEQGVLSISNSSLSEYGVLGFELGYSLVNPDSLVVWEAQFGDFANTAQVIIDQ 756

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+A+GE+KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLCDD+PY YP PEK+ RQHQ
Sbjct: 757  FLAAGEQKWLQRSGLVLSLPHGYDGQGPEHSSARIERYLQLCDDYPYTYPAPEKLERQHQ 816

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  +TP+ YFHVLRRQI R FRKPLI   SKSLLRHP+ +S L E+ GD+ F+ 
Sbjct: 817  DCNMQIVYPSTPSQYFHVLRRQICRQFRKPLIMPFSKSLLRHPLVKSDLQELIGDSHFQL 876

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+ HPE L  PEKI +H+LC+GQVYYALL+AREQN+++ VAISR+EQ+ PFPY+ + +
Sbjct: 877  YLPEEHPENLVEPEKIRKHVLCTGQVYYALLKAREQNQINDVAISRVEQLNPFPYEQVKE 936

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H DKYPNA+++W QEEPLN GAW +V PRI T ++ ++ H G+    A R PSAS ATGN
Sbjct: 937  HADKYPNADIVWCQEEPLNMGAWQHVQPRIATSLSQTQHHAGKTPIYAGRAPSASVATGN 996

Query: 541  KKQHIQEEHDLLSQAL 556
            KKQH Q+E DLL++AL
Sbjct: 997  KKQHYQQEKDLLAKAL 1012



>gi|392576482|gb|EIW69613.1| hypothetical protein TREMEDRAFT_39155 [Tremella mesenterica DSM 1558]
          Length = 1025

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/547 (66%), Positives = 439/547 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAVNFVC LAA+WR TFK+DVV+DIVCYR+YGHNE DQP
Sbjct: 460  YPSDIAKSIDAPIFHVNGDDVEAVNFVCTLAADWRATFKRDVVVDIVCYRRYGHNETDQP 519

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I KQ  +L  Y  KL+K+GTFT++++++H++WVW +LE+ Y  SKDY P+
Sbjct: 520  SFTQPKMYKAIQKQPTVLSLYTDKLIKEGTFTEKEVDEHREWVWGMLEKAYDGSKDYKPS 579

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF +PKELAE   P +PTG+    L+ VGEVIS++P+GF  H  L RI+ 
Sbjct: 580  PREWLSSSWEGFPTPKELAENVLPHHPTGTDERTLKRVGEVISTFPEGFTPHRNLARIIT 639

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I+EG+ IDW TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAV+HDQ  E  Y
Sbjct: 640  TRGKTISEGENIDWSTAEALAFGALCLEGTHVRISGQDVERGTFSQRHAVVHDQETEGTY 699

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPL  L   Q  F+V NS LSEFGTLGFE GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 700  VPLQHLGSEQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQ 759

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+A+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGRLERFLQLCDD P +YP PEK+ RQHQ
Sbjct: 760  FLAAGERKWLQRTGLVLNLPHGYDGQGPEHSSGRLERFLQLCDDEPRIYPSPEKLDRQHQ 819

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQ  R+FRKPLI F SKSLLRHP+ARS+L EMTGD  F+R
Sbjct: 820  DCNMQVVYPTTPANYFHVLRRQNKREFRKPLILFFSKSLLRHPLARSTLEEMTGDKHFQR 879

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++PD HPE L  PE+I RHILC+GQVYY LL+ RE   +  V ISR+EQ+ P PY+L++ 
Sbjct: 880  YLPDLHPEELVQPEEIRRHILCTGQVYYQLLKEREDRGIKDVVISRVEQLSPLPYELITP 939

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+WAQEEPLN GAWTYV PR+ T +  +E H+G+    A R PS+S ATG+
Sbjct: 940  HLDKYPNADLVWAQEEPLNNGAWTYVQPRLITALQKTEHHKGKVPIYAGRKPSSSVATGS 999

Query: 541  KKQHIQE 547
            K+ H  E
Sbjct: 1000 KQAHKSE 1006



>gi|405118405|gb|AFR93179.1| oxoglutarate dehydrogenase [Cryptococcus neoformans var. grubii H99]
          Length = 1020

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/547 (66%), Positives = 444/547 (81%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAVN+VC LAA+WR TFKKDVVIDIVCYR+YGHNE DQP
Sbjct: 459  YPSDIAKSIDAPIFHVNGDDVEAVNYVCTLAADWRATFKKDVVIDIVCYRRYGHNETDQP 518

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I KQ  +L  Y  KL+K+GTFT+++I++H++WVW +LE+ Y  S+DY P+
Sbjct: 519  SFTQPKMYKAIQKQPTVLSIYTDKLIKEGTFTEKEIDEHRQWVWGMLEKAYDGSRDYKPS 578

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF SPKELAEE  P + TG+S + L+HVG+VISS+P+GF+ H  L RI+ 
Sbjct: 579  PREWLSSSWEGFPSPKELAEEVLPQHHTGASEDALKHVGQVISSFPEGFHPHKNLARIIG 638

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG+ IDW TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAV+HDQ  E  +
Sbjct: 639  NRGKTVSEGKNIDWSTAEALAFGTLCLEGTHVRISGQDVERGTFSQRHAVVHDQKTEQTH 698

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            + L  L   Q  F+V NS LSEFGTLGFE GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 699  IALKHLGAEQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQ 758

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KW QRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDD P VYP PEK+ RQHQ
Sbjct: 759  FIAAGERKWFQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDEPRVYPSPEKLERQHQ 818

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTP+NYFHVLRRQ  R FRKPLI F SKSLLRHP ARS+L EM+G++ F+R
Sbjct: 819  DCNMQIVYPTTPSNYFHVLRRQNKRGFRKPLIVFFSKSLLRHPHARSTLEEMSGESKFQR 878

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+PHPE+L  PEKI RHILC+GQVY+ LL+ RE+  ++ VA+SRLEQ+ P PYDLL+ 
Sbjct: 879  YLPEPHPESLVEPEKIRRHILCTGQVYFQLLKEREERGINDVALSRLEQLSPLPYDLLTP 938

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNA+L+WAQEEPLN GAWTYV PR+ T +  +E H+ +    A R PS+S ATG+
Sbjct: 939  HLDKYPNADLVWAQEEPLNNGAWTYVQPRLITALQETEHHKSKIPIYAGRKPSSSVATGS 998

Query: 541  KKQHIQE 547
            K  H +E
Sbjct: 999  KYAHKKE 1005



>gi|393212457|gb|EJC97957.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
           precursor [Fomitiporia mediterranea MF3/22]
          Length = 994

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/556 (67%), Positives = 445/556 (80%), Gaps = 1/556 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVNGD+VEAV FVCQLAA++R  +KKDVV+DIVCYR+YGHNE DQP
Sbjct: 439 YPSDIAKCIDAPIFHVNGDNVEAVTFVCQLAADYRAKYKKDVVLDIVCYRRYGHNETDQP 498

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMY+ I +Q   L KY + L+  GTFT++DI +HK+WVW +LE+    +KDY PT
Sbjct: 499 SFTQPRMYKAIQRQPTPLTKYTKFLIDRGTFTEKDIAEHKEWVWGMLEKAAAAAKDYTPT 558

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EWLS+SW GF SPK+LAE++ P   TGSS ELL+ +G+ IS+YP+GF VH  L RIL 
Sbjct: 559 SKEWLSASWQGFPSPKQLAEQTLPTRATGSSEELLKRIGKAISTYPEGFTVHRNLARILS 618

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG  IDW TAE LAFGSL+LE  HVR+SGQDVERGTFSQRHAVLHDQ NE QY
Sbjct: 619 NRGKTVEEGTNIDWATAEALAFGSLVLEKTHVRVSGQDVERGTFSQRHAVLHDQENEQQY 678

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLN+L   QA+F VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 679 VPLNNLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDNLTIWEAQFGDFANNAQCIIDQ 738

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           +IASGE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP V+P  +K+ RQHQ
Sbjct: 739 YIASGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPDVFPTAQKIERQHQ 798

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  +TPANYFHVLRRQI RDFRKPLI F SKSLLRHP ARS L EMT DT F+R
Sbjct: 799 DCNMQIVYPSTPANYFHVLRRQIKRDFRKPLILFFSKSLLRHPKARSDLKEMTDDTHFER 858

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++P+   E L +PE I RHILCSGQVYY LL+ R++  +  VAISRLEQI PFPYDL++ 
Sbjct: 859 YLPEAS-EDLVAPEDIRRHILCSGQVYYTLLQERQEKGIKDVAISRLEQISPFPYDLITP 917

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+L+W QEEPLN GAWTYVAPRI T  N +  H+G+    A R P++S ATG+
Sbjct: 918 HLDKYPNADLLWCQEEPLNNGAWTYVAPRILTAANETVHHKGKHPLYAGREPTSSVATGS 977

Query: 541 KKQHIQEEHDLLSQAL 556
           K+ H +E    L+ A 
Sbjct: 978 KQLHYKEIEQFLAAAF 993



>gi|321252061|ref|XP_003192274.1| oxoglutarate dehydrogenase (succinyl-transferring) [Cryptococcus
           gattii WM276]
 gi|317458742|gb|ADV20487.1| Oxoglutarate dehydrogenase (succinyl-transferring), putative
           [Cryptococcus gattii WM276]
          Length = 958

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/547 (66%), Positives = 441/547 (80%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN DDVEAVN+VC LAA+WR TFKKDVVIDIVCYR+YGHNE DQP
Sbjct: 397 YPSDIAKSIDAPIFHVNSDDVEAVNYVCTLAADWRATFKKDVVIDIVCYRRYGHNETDQP 456

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I KQ  +L  Y  KL+K+GTF++++I++H++WVW +LE+ Y  SKDY P+
Sbjct: 457 SFTQPKMYKAIQKQPTVLSIYTDKLIKEGTFSEKEIDEHRQWVWGMLEKAYDGSKDYKPS 516

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            REWLSSSW GF SPKELAEE  P   TG+S + L+ VG+VISS+P GF+ H  L RI+ 
Sbjct: 517 PREWLSSSWEGFPSPKELAEEVLPQLHTGASEDTLKQVGQVISSFPDGFHPHKNLARIIG 576

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K ++EG+ IDW TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAV+HDQ  E  +
Sbjct: 577 NRGKTVSEGKNIDWSTAEALAFGTLCLEGTHVRISGQDVERGTFSQRHAVVHDQETEQTH 636

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           V L  L   Q  F+V NS LSEFGTLGFE GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 637 VALKHLSADQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQ 696

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDD P VYP PEK+ RQHQ
Sbjct: 697 FIAAGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDEPRVYPSPEKLERQHQ 756

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  TTPANYFHVLRRQ  RDFRKPLI F SKSLLRHP+ARS+L EM+GD+ F+R
Sbjct: 757 DCNMQIVYPTTPANYFHVLRRQNKRDFRKPLIVFFSKSLLRHPLARSTLEEMSGDSKFQR 816

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++P+PHPE+L  PEKI RHILC+GQVY+ LL+ RE+  ++ VAISR+EQ+ P PYDLL+ 
Sbjct: 817 YLPEPHPESLIEPEKIRRHILCTGQVYFQLLKEREERGINDVAISRIEQLSPLPYDLLTP 876

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+++WAQEEPLN G WTYV PR+ T +  +E H+ +    A R PS+S ATG 
Sbjct: 877 HLDKYPNADVVWAQEEPLNNGGWTYVQPRLITALKETEHHKSKVPIYAGRKPSSSVATGF 936

Query: 541 KKQHIQE 547
           K  H +E
Sbjct: 937 KYAHKKE 943



>gi|302689387|ref|XP_003034373.1| hypothetical protein SCHCODRAFT_81665 [Schizophyllum commune H4-8]
 gi|300108068|gb|EFI99470.1| hypothetical protein SCHCODRAFT_81665 [Schizophyllum commune H4-8]
          Length = 1001

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/556 (65%), Positives = 445/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA++R  +K+DVV+DIVCYR++GHNE DQP
Sbjct: 445  YPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRAKYKRDVVVDIVCYRRHGHNETDQP 504

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQPRMY+ IAKQ   L KY + L++ GTFT++DIE+HKKWVW +LE+    +KDYVPT
Sbjct: 505  AFTQPRMYKAIAKQPTTLTKYSKFLVERGTFTEKDIEEHKKWVWGMLEKAAAGAKDYVPT 564

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLSS+W GF SPK+LAEE+ P   TGS  E L+ +G+ IS++P GF+ H  L RIL 
Sbjct: 565  SKEWLSSAWQGFPSPKQLAEETLPTRVTGSEEETLKRIGKAISTFPHGFHPHKNLTRILT 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG  IDW TAE LA GSL LEG HVR+SGQDVERGTFSQRHAV+HDQ  E++Y
Sbjct: 625  NRGKTVEEGNNIDWSTAEALALGSLALEGVHVRVSGQDVERGTFSQRHAVVHDQETESKY 684

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLNDL   QA  +VCNSSLSEFG LGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 685  VPLNDLGGNQASVTVCNSSLSEFGCLGFELGYSLVSPDALTIWEAQFGDFANNAQCIIDQ 744

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP V+P P+K+ RQHQ
Sbjct: 745  FIAAGERKWLQRTGLVMSLPHGYDGQGPEHSSARIERFLQLCDDHPNVFPTPDKIERQHQ 804

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQIHRDFRKPLI F SK LLRHP ARS L+EM G+T F+R
Sbjct: 805  DCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFSKQLLRHPRARSELSEMVGETNFQR 864

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IP+ H + L +PE I +HILC+GQVY+ L+  RE   +  VAISR+EQI PFPYDL++ 
Sbjct: 865  YIPEAHTDELVAPEDIRKHILCTGQVYHTLIAEREAKGIKDVAISRVEQISPFPYDLITP 924

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNAEL+W QEEPLN GAW+YV PRI T    ++ H+G+  K A R P++S ATG+
Sbjct: 925  HLDKYPNAELMWCQEEPLNNGAWSYVGPRIYTAGGQTQHHKGKYPKYAGREPTSSVATGS 984

Query: 541  KKQHIQEEHDLLSQAL 556
            K QH +E    L+ A 
Sbjct: 985  KVQHKKEIEAFLADAF 1000



>gi|345566586|gb|EGX49528.1| hypothetical protein AOL_s00078g17 [Arthrobotrys oligospora ATCC
            24927]
          Length = 1031

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/558 (65%), Positives = 447/558 (80%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  FKKDVVIDIVCYRKYGHNE DQP
Sbjct: 471  YCSDIAKAIDAPVFHVNSDDVEAVNFVCQLAADWRAEFKKDVVIDIVCYRKYGHNETDQP 530

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY +IAKQ P L KYV KLL++GTFT+ DI++HKKWVW +LEE++ KS+DY PT
Sbjct: 531  SFTQPLMYDRIAKQEPALSKYVNKLLREGTFTEADIDEHKKWVWGMLEESFAKSRDYQPT 590

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PT      LQH+ EVIS+ PK F VH  L RIL 
Sbjct: 591  SREWLTSAWNGFKSPKELATEVLPHLPTAVPGTTLQHIAEVISNAPKDFTVHKNLTRILG 650

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG G+DW TAE LAFG+L+ +GKHVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 651  NRKKTVDEGSGVDWSTAEALAFGTLVNDGKHVRVSGQDVERGTFSQRHAVLHDQSNENTY 710

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q +F + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 711  TPLQHVSKDQGQFVISNSSLSEFGALGFEYGYSLSSPDALVIWEAQFGDFANNAQCIIDQ 770

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE KWLQR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+PPPEK+ RQHQ
Sbjct: 771  FIAAGETKWLQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPPPEKLDRQHQ 830

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQ++R FRKPL+ F SKSLLRHP+ARS L++ TGD+ F+ 
Sbjct: 831  DCNMQIAYMTTPSNLFHILRRQMNRAFRKPLVIFFSKSLLRHPLARSDLSQFTGDSHFEW 890

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H +TL  P +  R ++C+GQVY AL + R+   +D+VAI+R+EQ+ PFP+  L 
Sbjct: 891  LIPDPEHGKTLKPPSECERVLICTGQVYAALYKGRKDRGIDNVAITRVEQLHPFPWAQLR 950

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              +D+YPNA ++IWAQEEPLN GAWTYV PR++T+ N +  H+G+  + A R PSAS AT
Sbjct: 951  DTLDQYPNAKDIIWAQEEPLNAGAWTYVQPRLQTICNETTHHKGKIVQYAGRNPSASVAT 1010

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE +L+S+AL
Sbjct: 1011 GLKAIHLREEAELVSKAL 1028



>gi|402223016|gb|EJU03081.1| 2-oxoglutarate dehydrogenase E1 component [Dacryopinax sp. DJM-731
            SS1]
          Length = 1017

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/556 (65%), Positives = 441/556 (79%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAV FV QLAA+WR  +KKDVVID+VCYR+YGHNE DQP
Sbjct: 454  YPSDIAKSIDAPIFHVNGDNVEAVTFVAQLAADWRAKYKKDVVIDVVCYRRYGHNETDQP 513

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMYQ I KQ   L +Y + L+ + TF+++DI++HKKWVW +LE+    ++ Y P+
Sbjct: 514  SFTQPRMYQAIEKQPTTLTQYTKSLIDESTFSEKDIDEHKKWVWGMLEKAAAAAEHYKPS 573

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWLSS+WNGF SPKELAE++ P   TG S ++L+ +G+ ISS PKGF+ H  L RIL 
Sbjct: 574  PKEWLSSAWNGFPSPKELAEKNLPQSETGVSEDILKRIGQTISSTPKGFHPHRNLARILA 633

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDWPTAE LAFGSL LE  HVRLSGQDVERGTFSQRHAV+HDQ  E QY
Sbjct: 634  TRGKTVEEGKNIDWPTAEALAFGSLALEKVHVRLSGQDVERGTFSQRHAVIHDQETEQQY 693

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN L   QA F VCNS LSE+G LGFE GYSLV+P+ L +WE QFGDF N +Q IIDQ
Sbjct: 694  IPLNHLGSDQAMFKVCNSHLSEYGVLGFELGYSLVSPDCLTIWEAQFGDFANGAQVIIDQ 753

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            ++A+GE+KW QR+GLV+ LPHG+DGQGPEHSSGRLERFLQLCDD+PY+YP  E ++RQHQ
Sbjct: 754  YLAAGERKWAQRSGLVMSLPHGFDGQGPEHSSGRLERFLQLCDDNPYIYPSEESISRQHQ 813

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI+  +TPAN FHVLRRQ HRDFRKPLI F SKSLLRHPMARSSL EMT DT F+R
Sbjct: 814  DCNLQIVYPSTPANCFHVLRRQTHRDFRKPLIFFWSKSLLRHPMARSSLDEMTDDTQFQR 873

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IPDPHPE+LA PE+I +HILC+GQ+YY LL+ RE   +  VAISR+EQ+ PFPYDLL+ 
Sbjct: 874  YIPDPHPESLAPPEEIKKHILCTGQIYYQLLKEREDRGIKDVAISRVEQLAPFPYDLLTP 933

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNAEL W QEEPLN GAWT+VAPR+RT  + +E H+G+      R P +S ATG+
Sbjct: 934  HLDKYPNAELQWLQEEPLNNGAWTHVAPRLRTACSKTEHHQGKDIAYGGRPPYSSVATGS 993

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H +E  + L+QA 
Sbjct: 994  KSVHKKETQNYLNQAF 1009



>gi|403419426|emb|CCM06126.1| predicted protein [Fibroporia radiculosa]
          Length = 986

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/556 (66%), Positives = 439/556 (78%), Gaps = 17/556 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVNGD+VEAVNFVCQLAA+WR  +KKDVVIDIVCYR++GHNE DQP
Sbjct: 446 YPSDLAKAIDAPIFHVNGDNVEAVNFVCQLAADWRAKWKKDVVIDIVCYRRHGHNETDQP 505

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMY+ I KQ   L +Y + L+  GTFT++DIE+HKKWVW +L++    +KDYVPT
Sbjct: 506 SFTQPRMYKAIEKQPTPLTQYSKFLVDRGTFTEKDIEEHKKWVWGMLDKAASAAKDYVPT 565

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EWLS+SW GF SPK+LAEE+ P   TGSS E+L+ +G+ ISSYP GF  H  L RIL 
Sbjct: 566 SKEWLSASWQGFPSPKQLAEETLPTRDTGSSEEVLKRIGKAISSYPDGFTPHRNLARILN 625

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG+ IDW TAE LAFGSL LE  HVR+SGQDVERGTFSQRHAV+HDQ NE QY
Sbjct: 626 TRGKTVEEGRNIDWATAEALAFGSLALEKIHVRVSGQDVERGTFSQRHAVIHDQANEQQY 685

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLNDL   QA+F VCNSSLSEFGTLGFE GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 686 VPLNDLSSNQARFVVCNSSLSEFGTLGFELGYSLVSPDALTIWEAQFGDFANNAQCIIDQ 745

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE+KWLQRTGLV+ LPHG+DGQGPEHSSGR+ERFLQLCDDHP+ +P  EK+ RQHQ
Sbjct: 746 FIASGERKWLQRTGLVMSLPHGFDGQGPEHSSGRIERFLQLCDDHPHNFPTTEKIERQHQ 805

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI+  TTPANYFHVLRRQIHRDFRKPLI F SKSLLRHP ARS L+EMT +T F+R
Sbjct: 806 DCNMQIVYPTTPANYFHVLRRQIHRDFRKPLIIFFSKSLLRHPRARSDLSEMTEETHFQR 865

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++PDPHPE L +PE+I RHILC+GQVY+ LL+ RE  K++ VAISRLEQI PFPYDL   
Sbjct: 866 YLPDPHPEELVAPEQIKRHILCTGQVYHTLLQEREDKKINDVAISRLEQISPFPYDL--- 922

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
                         EE LN GAWTYVAPRI T  N +E H+G+    A R P++S ATG+
Sbjct: 923 --------------EEGLNNGAWTYVAPRILTAANETEHHKGKYPLYAGRDPTSSVATGS 968

Query: 541 KKQHIQEEHDLLSQAL 556
           K  H ++  + L+ A 
Sbjct: 969 KALHKKQIENFLATAF 984



>gi|402223019|gb|EJU03084.1| oxoglutarate dehydrogenase [Dacryopinax sp. DJM-731 SS1]
          Length = 967

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/556 (64%), Positives = 442/556 (79%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN D+VEAVNFV QLAA+WR  +KKDVVID+VCYR+YGHNE DQP
Sbjct: 405 YPSDIAKTIDAPIFHVNADNVEAVNFVAQLAADWRAKWKKDVVIDLVCYRRYGHNETDQP 464

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMY+ I KQ  +L +Y ++L+ + +F ++DIE+HKKWVW +LE+    S+ Y P+
Sbjct: 465 SFTQPRMYKAIEKQPTVLTQYTKQLIANKSFAEKDIEEHKKWVWGMLEKGAAASEQYKPS 524

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWLSS W GF SPKELAE+  P   TG   ++L+H+G+VISS+P+GFN H  L RIL+
Sbjct: 525 SREWLSSPWQGFPSPKELAEKVLPQSETGVEIDILKHIGKVISSWPEGFNPHRNLARILQ 584

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KAI  G+GIDWPTAE LAFG+L LE  HVRL+GQDVERGTFSQRHAV+HDQ  E QY
Sbjct: 585 TRGKAIEAGEGIDWPTAEALAFGTLALEKIHVRLTGQDVERGTFSQRHAVIHDQQTEQQY 644

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLN+L   QA F V NSSLSE+G LGFE GYSLV+P++L +WE QFGDF N +Q IIDQ
Sbjct: 645 VPLNNLGGDQAAFVVANSSLSEYGALGFELGYSLVSPDALSIWEAQFGDFANGAQVIIDQ 704

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           +IA+GE+KW QRTGLV+ LPHG+DGQGPEHSSGR+ERFLQLCDD P +YP  EK++RQHQ
Sbjct: 705 YIAAGERKWAQRTGLVMSLPHGFDGQGPEHSSGRMERFLQLCDDQPNIYPSEEKLSRQHQ 764

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCN+QI+  TTPAN FHVLRRQI+RDFRKP I F SKSLLRHPMARS L EMTG+T F+R
Sbjct: 765 DCNIQIVYPTTPANLFHVLRRQIYRDFRKPFILFFSKSLLRHPMARSKLEEMTGNTQFQR 824

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           +IPDPHP++L  PE+I +HILC+GQ+YY LL+ RE   +  +AISR+EQ+ PFPYDLL+ 
Sbjct: 825 YIPDPHPDSLVPPEEIRKHILCTGQIYYQLLKEREDRGIKDIAISRVEQLSPFPYDLLTP 884

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNAEL W QEEP N GA+TYVAPR+RT    +E H+G+  +   R P +S ATG+
Sbjct: 885 HLDKYPNAELQWLQEEPFNNGAFTYVAPRLRTAGKATEHHKGKVIQYGGRTPYSSVATGS 944

Query: 541 KKQHIQEEHDLLSQAL 556
           K  H +E    L+QA 
Sbjct: 945 KGVHKKETESYLNQAF 960



>gi|398405248|ref|XP_003854090.1| 2-oxoglutarate dehydrogenase E1 component [Zymoseptoria tritici
            IPO323]
 gi|339473973|gb|EGP89066.1| 2-oxoglutarate dehydrogenase E1 component [Zymoseptoria tritici
            IPO323]
          Length = 1057

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/561 (63%), Positives = 445/561 (79%), Gaps = 6/561 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK V+AP+FHVNGDDVEA+NFVCQ+AA+WR  FKKDV++DIVCYRK GHNE DQP
Sbjct: 486  YCSDLAKFVDAPVFHVNGDDVEALNFVCQMAADWRAEFKKDVIVDIVCYRKQGHNETDQP 545

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I++Q P L+KYV++L+   TFTKED+++HKKWVWN LEE++ KSKDY PT
Sbjct: 546  SFTQPLMYKKISEQVPTLDKYVKQLIDANTFTKEDVDEHKKWVWNTLEESFEKSKDYTPT 605

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+W+GFKSPKELA E  P  PTG   E L+H+ +VI   P+GFNVH  L RIL 
Sbjct: 606  AKEWLTSAWHGFKSPKELATEVLPHLPTGIKAETLKHIAKVIGEPPEGFNVHRNLKRILA 665

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++NEG+ ID  TAE LAFGSL LEGKHVR+SGQDVERGTFSQRHAVLHDQ +E  +
Sbjct: 666  NRTKSVNEGKNIDMSTAEALAFGSLCLEGKHVRVSGQDVERGTFSQRHAVLHDQESEKTH 725

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 726  TPLRNLGDDQGTFVIANSSLSEFGALGFEYGYSLSSPNALVIWEAQFGDFANNAQCIIDQ 785

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQLC++ P ++P P+K+ RQHQ
Sbjct: 786  FIASGEVKWLQRSGLVMNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPKPDKLDRQHQ 845

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPANYFH+LRRQ++R FRKPLI F SKSLLRHP+ARS++ ++ G++ F+ 
Sbjct: 846  DCNMQITYCTTPANYFHILRRQMNRQFRKPLINFFSKSLLRHPLARSNIEDLEGESHFQW 905

Query: 421  FIPDPHPETLA-----SPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
             +PDP  +  A     S +KI R ILCSGQV+ AL + RE NK+   AI+R+EQ+ PFP+
Sbjct: 906  IVPDPAHDANAEFKIDSHDKIKRVILCSGQVFAALFKHREANKLTDTAITRIEQLNPFPW 965

Query: 476  DLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSA 534
              L +++D YPNAE ++W QEEPLN GAW++  PRI TL+N++E H+ +    A R PSA
Sbjct: 966  AQLKENLDSYPNAETIVWCQEEPLNAGAWSFAQPRIETLLNNTEHHDRKHVMYAGRNPSA 1025

Query: 535  SPATGNKKQHIQEEHDLLSQA 555
            S ATG K  H++EE DLL  A
Sbjct: 1026 SVATGLKSSHMKEEQDLLKMA 1046



>gi|212542331|ref|XP_002151320.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Talaromyces marneffei ATCC 18224]
 gi|210066227|gb|EEA20320.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Talaromyces marneffei ATCC 18224]
          Length = 1063

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/558 (63%), Positives = 440/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 496  YCSDIAKAIDAPVFHVNGDDVEAVNYVCQIAADWRAEFKRDVVIDIVCYRKQGHNETDQP 555

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA++   L+ YV KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 556  SFTQPLMYKRIAEKKSQLDIYVDKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 615

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFKSPKELA E  P  PTG   E+L+ +G+ I   P+GFNVH  L RIL 
Sbjct: 616  GKEWLTSAWNGFKSPKELATEVLPHLPTGVDVEILRSIGDKIGGVPEGFNVHRNLKRILG 675

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 676  NRKKAVDEGENIDWATAEALAFGTLVKEGHHVRVSGQDVERGTFSQRHAVLHDQESEATY 735

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  + P Q  F + NSSLSEFG LGFEYGYSL +PN L++WE QFGDF NN+QCIIDQ
Sbjct: 736  TPLQHITPDQGTFVISNSSLSEFGVLGFEYGYSLTSPNGLVMWEAQFGDFANNAQCIIDQ 795

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 796  FIASGEVKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSPEKLERQHQ 855

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  T+P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 856  DCNMQIVCMTSPSNLFHILRRQLNRQFRKPLIIFFSKSLLRHPIARSDIGEFTGDSHFQW 915

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H  ++  PEKI R I+CSGQVY AL++ RE   + + AI+R+EQ+ PFP+  L 
Sbjct: 916  IIPDSAHGASIDEPEKIERVIMCSGQVYAALIKHREAKGIRNTAITRVEQLNPFPWAQLK 975

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW++V PRI TL+N +E H  R    A R PSAS AT
Sbjct: 976  ENLDSYPNAKDIVWAQEEPLNAGAWSFVQPRIETLLNATEHHNRRHVMYAGRAPSASVAT 1035

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE DLL  A 
Sbjct: 1036 GLKASHVKEEQDLLETAF 1053



>gi|242768620|ref|XP_002341606.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Talaromyces stipitatus ATCC 10500]
 gi|218724802|gb|EED24219.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Talaromyces stipitatus ATCC 10500]
          Length = 1057

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 440/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 490  YCSDIAKAIDAPVFHVNGDDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA++   L+ YV KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEKKAQLDIYVDKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFKSPKELA E  P  PTG   E+L+ +G+ I   P GFNVH  L RIL 
Sbjct: 610  GKEWLTSAWNGFKSPKELATEVLPHLPTGVDAEILKSIGDKIGGAPDGFNVHRNLKRILG 669

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KAI++G+ IDW TAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 670  NRKKAIDDGKNIDWATAEALAFGTLVKEGHHVRVSGQDVERGTFSQRHAVLHDQENEATY 729

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 730  TPLQHISQDQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 789

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P P+K+ RQHQ
Sbjct: 790  FIASGEVKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSPDKLDRQHQ 849

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  T+P+N FH+LRRQI+R FRKPLI F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 850  DCNMQIVCMTSPSNLFHILRRQINRQFRKPLIIFFSKSLLRHPIARSDIEEFTGDSHFRW 909

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H  ++  PEKI R I+CSGQVY AL++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 910  IIPDEAHGTSIDEPEKIERVIMCSGQVYAALIKHREANGIRNTAITRVEQLNPFPWAQLK 969

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW++V PRI TL+N +E H  R    A R PSAS AT
Sbjct: 970  ENLDSYPNAKDIVWAQEEPLNAGAWSFVQPRIETLLNATEHHNRRHVLYAGRAPSASVAT 1029

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE DLL  A 
Sbjct: 1030 GLKASHVKEEQDLLEDAF 1047



>gi|401883061|gb|EJT47297.1| oxoglutarate dehydrogenase (succinyl-transferring) [Trichosporon
            asahii var. asahii CBS 2479]
          Length = 1012

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/556 (63%), Positives = 439/556 (78%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVC LAAEWR TFKKDVV+DIVCYR++GHNE DQP
Sbjct: 455  YPSDIAKAIDAPIFHVNGDNVEAVNFVCMLAAEWRATFKKDVVVDIVCYRRHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ  +L KY  +L+K+GTFT ++IE+H++WVW +LE+ +  SK+Y P+
Sbjct: 515  SFTQPRMYKAIQKQPTVLSKYSDQLIKEGTFTAKEIEEHRQWVWGMLEKAFDASKEYTPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF SP+ELA+E  P +PTG S E L+  G+VIS++P+GF  H  L RI++
Sbjct: 575  PREWLSSSWEGFPSPEELAKEVLPHHPTGVSEEKLKEAGKVISTFPEGFTPHKNLARIIQ 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I EG+GIDW TAE LAF +L  EG HVR+SGQDVERGTFSQRHAV+HDQ NE+ Y
Sbjct: 635  NRGKTIAEGKGIDWSTAEALAFATLCTEGTHVRVSGQDVERGTFSQRHAVVHDQENESTY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F+V NS LSE+GT+GFE+GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 695  TFLKHVSPDQGSFTVSNSHLSEYGTMGFEFGYSLVSPNSLTMWEAQFGDFANNAQCIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE+KW QRTGLVV LPHGYDGQGPEHSSGRLERFLQLCDD P V+P PE+M RQHQ
Sbjct: 755  FLASGERKWFQRTGLVVSLPHGYDGQGPEHSSGRLERFLQLCDDDPRVFPTPEQMERQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPANYFHVLRRQ HRDFRKPL+ F SK+LLRHP+A+S L+E TGD+ F+R
Sbjct: 815  DCNMQIVYPTTPANYFHVLRRQQHRDFRKPLVVFFSKNLLRHPLAKSDLSEFTGDSVFQR 874

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+  PE+L  PEK+ R +LCSGQV+  L+  RE+  +  VAI RLEQI P PY  + +
Sbjct: 875  YLPEHAPESLVEPEKVRRVVLCSGQVWTQLVTEREKRGIKDVAIVRLEQISPVPYSAIVE 934

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
             +D+Y NA+++W QEEPLN GAW+Y+ PR+   ++H++ H+G+    + R PSAS ATG+
Sbjct: 935  DLDRYKNADIMWCQEEPLNNGAWSYIGPRLELALDHTQNHKGKRVGYSGRGPSASVATGS 994

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H +E   + + AL
Sbjct: 995  KVAHKREVEAIANDAL 1010



>gi|406700340|gb|EKD03512.1| oxoglutarate dehydrogenase (succinyl-transferring) [Trichosporon
            asahii var. asahii CBS 8904]
          Length = 1012

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/556 (63%), Positives = 439/556 (78%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGD+VEAVNFVC LAAEWR TFKKDVV+DIVCYR++GHNE DQP
Sbjct: 455  YPSDIAKAIDAPIFHVNGDNVEAVNFVCMLAAEWRATFKKDVVVDIVCYRRHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ  +L KY  +L+K+GTFT ++IE+H++WVW +LE+ +  SK+Y P+
Sbjct: 515  SFTQPRMYKAIQKQPTVLSKYSDQLIKEGTFTAKEIEEHRQWVWGMLEKAFDASKEYTPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF SP+ELA+E  P +PTG S E L+  G+VIS++P+GF  H  L RI++
Sbjct: 575  PREWLSSSWEGFPSPEELAKEVLPHHPTGVSEEKLKEAGKVISTFPEGFTPHKNLARIIQ 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I EG+GIDW TAE LAF +L  EG HVR+SGQDVERGTFSQRHAV+HDQ NE+ Y
Sbjct: 635  NRGKTIAEGKGIDWSTAEALAFATLCTEGTHVRVSGQDVERGTFSQRHAVVHDQENESTY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F+V NS LSE+GT+GFE+GYSLV+PNSL +WE QFGDF NN+QCIIDQ
Sbjct: 695  TFLKHVSPDQGSFTVSNSHLSEYGTMGFEFGYSLVSPNSLTMWEAQFGDFANNAQCIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE+KW QRTGLVV LPHGYDGQGPEHSSGRLERFLQLCDD P V+P PE+M RQHQ
Sbjct: 755  FLASGERKWFQRTGLVVSLPHGYDGQGPEHSSGRLERFLQLCDDDPRVFPTPEQMERQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPANYFHVLRRQ HRDFRKPL+ F SK+LLRHP+A+S L+E TGD+ F+R
Sbjct: 815  DCNMQIVYPTTPANYFHVLRRQQHRDFRKPLVVFFSKNLLRHPLAKSDLSEFTGDSVFQR 874

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+  PE+L  PEK+ R +LCSGQV+  L+  RE+  +  VAI RLEQI P PY  + +
Sbjct: 875  YLPEHAPESLVEPEKVRRVVLCSGQVWTQLVTEREKRGIKDVAIVRLEQISPVPYSAIVE 934

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
             +D+Y NA+++W QEEPLN GAW+Y+ PR+   ++H++ H+G+    + R PSAS ATG+
Sbjct: 935  DLDRYKNADIMWCQEEPLNNGAWSYIGPRLELALDHTQNHKGKRVGYSGRGPSASVATGS 994

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H +E   + + AL
Sbjct: 995  KVAHKREVEAIANDAL 1010



>gi|378734322|gb|EHY60781.1| 2-oxoglutarate dehydrogenase, mitochondrial [Exophiala dermatitidis
            NIH/UT8656]
          Length = 1050

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/558 (63%), Positives = 442/558 (79%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVNFVCQLAA+WR  FKKD VIDIVCYRK GHNE DQP
Sbjct: 483  YCSDIAKAIDAPVFHVNGDDVEAVNFVCQLAADWRADFKKDCVIDIVCYRKQGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I++Q P L+KYV++LL++GTF KEDIE+HKKWVW +L +++ +SKDY PT
Sbjct: 543  SFTQPLMYKRISQQKPQLDKYVERLLEEGTFAKEDIEEHKKWVWGMLNDSFDRSKDYQPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+S+WNGFK+PKELA E  P  PTG   ++L  +G+ ISS P+GF+VH  L RIL 
Sbjct: 603  GREWLTSAWNGFKTPKELATEVLPHPPTGVDRDVLSLIGDKISSAPEGFHVHRNLKRILG 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KAI++G GIDW TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 663  GRKKAIDDGTGIDWATAEALAFGTLCLEGHHVRVSGQDVERGTFSQRHAVLHDQENEETY 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PLN+L   Q  F++ NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TPLNNLSKDQGAFTISNSSLSEFGVLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P P+K+ RQHQ
Sbjct: 783  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEEPRVFPSPDKLERQHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   TTPANYFH+LRRQ++R FRKPLI F SKSLLRHP+ARS + +  GD+ F+ 
Sbjct: 843  DCNMQVAYMTTPANYFHILRRQMNRQFRKPLIVFFSKSLLRHPLARSDIDDFIGDSHFQW 902

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H +++  P++I R ILC+GQVY AL + R    + + AI+R+EQ+ PFP+ LL 
Sbjct: 903  IIPETEHGKSINDPDEIDRIILCTGQVYAALHKHRADKGIKNAAITRIEQLNPFPWALLK 962

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D Y NA+ ++W QEEPLN GAW++V PRI TL+N ++ H  R    A R PSAS AT
Sbjct: 963  ENLDTYKNAKTIVWCQEEPLNAGAWSFVQPRIETLLNETQYHNRRHVMYAGRDPSASVAT 1022

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE  LL  A 
Sbjct: 1023 GLKATHVKEEQTLLEDAF 1040



>gi|452984644|gb|EME84401.1| hypothetical protein MYCFIDRAFT_152624 [Pseudocercospora fijiensis
            CIRAD86]
          Length = 1056

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/561 (63%), Positives = 445/561 (79%), Gaps = 6/561 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK V+AP+FHVNGDDVEA+NFVCQLAA+WR  FKKDVV+DIVCYRK GHNE DQP
Sbjct: 485  YCSDIAKFVDAPVFHVNGDDVEALNFVCQLAADWRAEFKKDVVVDIVCYRKQGHNETDQP 544

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I++Q P+L+KYV++LL + TFT+EDI++HK WVW +LEE++ +SKDY PT
Sbjct: 545  SFTQPLMYKRISEQPPVLDKYVKQLLDNKTFTQEDIDEHKSWVWGMLEESFARSKDYQPT 604

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+W+GFKSPKELA E  P  PTG   + L+H+ +VI   P GF+VH  L RIL 
Sbjct: 605  AKEWLTSAWHGFKSPKELATEVLPHLPTGLPADQLKHIAKVIGEPPDGFHVHKNLKRILA 664

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+K +NEG+ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 665  NRSKTVNEGKNIDMSTAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQENEDTY 724

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 725  TPLKHVSKDQGSFVISNSSLSEFGALGFEYGYSLSSPNALVIWEAQFGDFANNAQCIIDQ 784

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ERFLQLC++ P ++P PEK+ RQHQ
Sbjct: 785  FIASGEVKWLQRSGLVVNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPSPEKLERQHQ 844

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPAN FH+LRRQ++R FRKPLI+F SKSLLRHP+ARS++ E TG++ F+ 
Sbjct: 845  DCNMQITVCTTPANNFHILRRQMNRQFRKPLISFFSKSLLRHPLARSNIEEFTGESHFQW 904

Query: 421  FIPDP-HPET----LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
             +PDP H E     + S +KI R ILCSGQV+ AL + R+QN + + AI+R+EQ+ PFP+
Sbjct: 905  IVPDPAHDENAEFKIDSHDKIERVILCSGQVFAALFKYRQQNNLTNTAITRIEQLNPFPW 964

Query: 476  DLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSA 534
              L +++D YPNA+ ++W QEEPLN GAW++  PRI TL+NH+E H+ +    A R PSA
Sbjct: 965  AQLKENLDSYPNAQTIVWCQEEPLNAGAWSFTQPRIETLLNHTEHHDRKHVMYAGRNPSA 1024

Query: 535  SPATGNKKQHIQEEHDLLSQA 555
            S ATG K  H++EE DLL  A
Sbjct: 1025 SVATGLKSSHLKEEQDLLEMA 1045



>gi|115391169|ref|XP_001213089.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Aspergillus terreus NIH2624]
 gi|114194013|gb|EAU35713.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Aspergillus terreus NIH2624]
          Length = 1054

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/558 (63%), Positives = 437/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN VCQ+AA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 487  YCSDIAKSIDAPVFHVNGDDVEAVNHVCQVAADWRAEFKSDVVIDIVCYRKQGHNETDQP 546

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 547  SFTQPLMYKRIAEQKNQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 606

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG    +L H+ ++ S  P+GF +H  L RIL 
Sbjct: 607  SKEWLTSAWNGFKTPKELATEVLPHLPTGVEAPVLAHIADITSGAPEGFTLHRNLKRILA 666

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 667  NRKKAVDEGKNIDWSTAEALAFGSLVKEGYHVRVSGQDVERGTFSQRHAVLHDQENENTY 726

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQ  F++ NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 727  TPLQHISEGQGTFAISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 786

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P  +K+ RQHQ
Sbjct: 787  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRIFPSQDKLDRQHQ 846

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQIHR FRKPL+ F SK+LLRHP+ARSS+ + TGD+ FK 
Sbjct: 847  DCNMQIAYMTEPSNLFHILRRQIHRQFRKPLVIFFSKALLRHPIARSSIEDFTGDSHFKW 906

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILCSGQVY AL++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 907  IIPDPAHGTAIDEPEKIERVILCSGQVYAALVKHREANGIRNTAITRVEQLHPFPWAQLK 966

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA  ++WAQEEPLN G W+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 967  ENLDSYPNARNIVWAQEEPLNAGPWSYAQPRIETLLNETEHHNRRHVLYAGRAPSASVAT 1026

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE + L +A 
Sbjct: 1027 GLKSVHLKEEQEFLEEAF 1044



>gi|358057683|dbj|GAA96448.1| hypothetical protein E5Q_03115 [Mixia osmundae IAM 14324]
          Length = 1029

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/556 (64%), Positives = 445/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDD EAV FVCQLAA+WR  +KKDVVID+VCYR++GHNE DQP
Sbjct: 470  YPSDIAKSIDAPIFHVNGDDPEAVTFVCQLAADWRARWKKDVVIDLVCYRRHGHNETDQP 529

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I++Q P L+KY++ L  + +FT E+I+KHK WVW +L++ Y  SKDYV +
Sbjct: 530  SFTQPKMYRAISEQKPTLDKYIKVLQDEESFTGEEIKKHKDWVWGMLDQAYEASKDYVAS 589

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLSS+W+GF SP+EL E +  A PTG   + L+ VG+ + S+PK F VH  L RILK
Sbjct: 590  SKEWLSSAWDGFPSPRELKENNLEARPTGVKIDTLKDVGKQLGSWPKDFQVHKNLQRILK 649

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+KA+ EG+GID+ TAE LAFG++ LE  HVR+SGQDVERGTFSQRH+VLHDQ  +  Y
Sbjct: 650  NRSKAVEEGKGIDYSTAEALAFGTMSLEKIHVRVSGQDVERGTFSQRHSVLHDQETDDLY 709

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPLN L  GQ K ++CNSSLSEFG LGFE GYSLV+P+ L++WE QFGDF N +Q IIDQ
Sbjct: 710  VPLNHLGSGQHKLTICNSSLSEFGVLGFELGYSLVDPHLLVVWEAQFGDFANGAQIIIDQ 769

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQR+GLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ YP  EK+ RQHQ
Sbjct: 770  FIASGERKWLQRSGLVMSLPHGYDGQGPEHSSARIERFLQLCDDHPFKYPTEEKIQRQHQ 829

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NMQ++  TTPAN FH LRRQIHRDFRKPLI F SKSLLRHP+ARS++ +M   T F+R
Sbjct: 830  DANMQLVYPTTPANVFHALRRQIHRDFRKPLILFFSKSLLRHPLARSNIEDMAEGTQFQR 889

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +IPD HPE+LA P+ I RHILCSGQVYYALL+ARE+ K+D+VAISR+EQ+ P PYDLL+ 
Sbjct: 890  YIPDSHPESLADPDSIKRHILCSGQVYYALLQAREERKIDNVAISRVEQLSPVPYDLLTP 949

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKY NA+L+WAQEEP+N GA+ Y++PR+ T ++ +E H+G+    A R P++S ATG+
Sbjct: 950  HLDKYKNADLMWAQEEPVNNGAYGYLSPRLHTALSQTEHHKGKRVLYAGRGPTSSVATGS 1009

Query: 541  KKQHIQEEHDLLSQAL 556
            KK H  E   +L  A 
Sbjct: 1010 KKVHQAEVKKILDDAF 1025



>gi|70993636|ref|XP_751665.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Aspergillus fumigatus Af293]
 gi|66849299|gb|EAL89627.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Aspergillus fumigatus Af293]
          Length = 1057

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKAQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PT     LL H+ + IS  P+GF VH  L RIL 
Sbjct: 610  GKEWLTSAWNGFKTPKELATEVLPHLPTAVDASLLSHIADKISGAPEGFTVHRNLKRILA 669

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 670  NRKKAVDEGKNIDWATAEALAFGSLVKEGYHVRVSGQDVERGTFSQRHAVLHDQENEATY 729

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 730  TPLKHIAEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 789

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P  +K+ RQHQ
Sbjct: 790  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRQFPTQDKLDRQHQ 849

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 850  DCNMQIAYMTSPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDIEEFTGDSHFRW 909

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H  T+  PEKI R ILCSGQVY  L++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 910  IIPDPAHGSTIDEPEKIERVILCSGQVYATLVKHREANGIRNTAITRVEQLHPFPWAQLK 969

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 970  ENLDSYPNAKDIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRPPSASVAT 1029

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE D L +A 
Sbjct: 1030 GLKSVHAKEEQDFLQEAF 1047



>gi|159125413|gb|EDP50530.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Aspergillus fumigatus A1163]
          Length = 1057

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKAQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PT     LL H+ + IS  P+GF VH  L RIL 
Sbjct: 610  GKEWLTSAWNGFKTPKELATEVLPHLPTAVDASLLSHIADKISGAPEGFTVHRNLKRILA 669

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 670  NRKKAVDEGKNIDWATAEALAFGSLVKEGYHVRVSGQDVERGTFSQRHAVLHDQENEATY 729

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 730  TPLKHIAEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 789

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P  +K+ RQHQ
Sbjct: 790  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRQFPTQDKLDRQHQ 849

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 850  DCNMQIAYMTSPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDIEEFTGDSHFRW 909

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H  T+  PEKI R ILCSGQVY  L++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 910  IIPDPAHGSTIDEPEKIERVILCSGQVYATLVKHREANGIRNTAITRVEQLHPFPWAQLK 969

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 970  ENLDSYPNAKDIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRPPSASVAT 1029

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE D L +A 
Sbjct: 1030 GLKSVHAKEEQDFLQEAF 1047



>gi|367055070|ref|XP_003657913.1| hypothetical protein THITE_2124124 [Thielavia terrestris NRRL 8126]
 gi|347005179|gb|AEO71577.1| hypothetical protein THITE_2124124 [Thielavia terrestris NRRL 8126]
          Length = 1042

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/559 (63%), Positives = 442/559 (79%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLA++WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 474  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQP 533

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++   ++ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 534  SFTQPLMYKRIQEKKSQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 593

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GEVI   P+GFN+H  L RIL 
Sbjct: 594  SKEWTTSAWNGFKSPKELATEVLPHNPTGVDRKTLEHIGEVIGRAPEGFNLHRNLKRILA 653

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ IDW TAE LAFGS++ EG+HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 654  NRTKSVLEGKNIDWSTAEALAFGSMVTEGRHVRVSGQDVERGTFSQRHAVFHDQETEDTY 713

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSE+G LGFEYGYSL +PN  ++WE QFGDF NN+QCIIDQ
Sbjct: 714  TPLQHISKDQGKFVISNSSLSEYGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQ 773

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KW+QRTGLV+ LPHGYDGQGPEHSSGRLERFLQLC++   V+P PEK+ RQHQ
Sbjct: 774  FIASGEQKWVQRTGLVMSLPHGYDGQGPEHSSGRLERFLQLCNEDSRVFPSPEKLHRQHQ 833

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   TTPAN FH+LRRQ++R FRKPLI F SK+LLRHP+ARS++ E TGD+ F+ 
Sbjct: 834  DCNMQVAYMTTPANLFHILRRQMNRQFRKPLILFFSKALLRHPLARSNIEEFTGDSQFRW 893

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  E+  + +PE+I R ILCSGQVY AL + R  +K+D VA +R+EQ+ PFP++ L
Sbjct: 894  IIPDPAHESGEIKAPEEIDRVILCSGQVYAALHKYRADHKIDDVAFTRIEQLHPFPWEQL 953

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H+ +    A R PSAS A
Sbjct: 954  RENLDRYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTKYHDRKHVMYAGRNPSASVA 1013

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1014 TGLKASHKKEEEDLLEMAF 1032



>gi|389638422|ref|XP_003716844.1| 2-oxoglutarate dehydrogenase [Magnaporthe oryzae 70-15]
 gi|351642663|gb|EHA50525.1| 2-oxoglutarate dehydrogenase [Magnaporthe oryzae 70-15]
 gi|440472782|gb|ELQ41619.1| 2-oxoglutarate dehydrogenase E1 [Magnaporthe oryzae Y34]
 gi|440486922|gb|ELQ66745.1| 2-oxoglutarate dehydrogenase E1 [Magnaporthe oryzae P131]
          Length = 1008

 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/559 (63%), Positives = 443/559 (79%), Gaps = 3/559 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+D+AK ++AP+FHVN DDVEAVN++CQLAA+WR  F++DV+ID+VCYRK+GHNE DQP
Sbjct: 440 YCTDIAKAIDAPVFHVNADDVEAVNYMCQLAADWRAEFQQDVIIDLVCYRKHGHNETDQP 499

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++I  +   LE Y++KL++DGTFTKEDIE+HKKWVW +LE+++ KSK+Y PT
Sbjct: 500 SFTQPLMYKKIQSKDSQLETYIKKLIEDGTFTKEDIEEHKKWVWGMLEDSFSKSKEYQPT 559

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EW +S+WNGFKSPKELA E  P  PTG   + LQH+GEVI S P+ FN+H  L RIL 
Sbjct: 560 SKEWTTSAWNGFKSPKELATEVLPHNPTGVDKQTLQHIGEVIGSAPETFNLHRNLKRILT 619

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 620 NRTKTVVEGKNIDWSTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTY 679

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL ++   QAKF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QC+IDQ
Sbjct: 680 TPLQNVSKDQAKFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCVIDQ 739

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P  +P  EK+ RQHQ
Sbjct: 740 FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRDFPTGEKLMRQHQ 799

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI   TTPAN FH+LRRQ+ R FRKPLI F SK+LLRHP+ARS++ + TGD+ F+ 
Sbjct: 800 DCNMQIAYMTTPANLFHILRRQMTRQFRKPLIIFFSKALLRHPLARSNIEDFTGDSQFQW 859

Query: 421 FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
            IPDP  +T  + S E+I R ILC+GQVY AL + R  N++D+VAI+R+EQ+ PFP+D L
Sbjct: 860 IIPDPAHQTGEIKSNEEIDRVILCTGQVYTALHKHRADNQIDNVAITRVEQLHPFPWDAL 919

Query: 479 SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
            +++D+YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H+ +    A R PSAS A
Sbjct: 920 RENLDQYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTQHHDRKHVMYAGRHPSASVA 979

Query: 538 TGNKKQHIQEEHDLLSQAL 556
           TG K  H++EE +LL  A 
Sbjct: 980 TGLKSAHVKEEKELLEMAF 998



>gi|116204753|ref|XP_001228187.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88176388|gb|EAQ83856.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 1041

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/559 (63%), Positives = 437/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 473  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFKQDVIIDMVCYRKHGHNETDQP 532

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P L+ YV KLLK+GTFTKED+E+HK+WVW +LEE++ KSKDY PT
Sbjct: 533  SFTQPLMYKRIQEKNPQLQIYVDKLLKEGTFTKEDVEEHKQWVWGMLEESFSKSKDYQPT 592

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+ EVI S P+GFN H  L RIL 
Sbjct: 593  SKEWTTSAWNGFKSPKELASEVLPHKPTGVDQKTLEHIAEVIGSTPEGFNAHRNLKRILT 652

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ IDW TAE LAFG+L+ EG+HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 653  NRTKSVLEGKNIDWSTAEALAFGTLVTEGRHVRISGQDVERGTFSQRHAVFHDQETEDTY 712

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q KF + NSSLSEFG LGFEYGYSL +PN  ++WE QFGDF NN+QCIIDQ
Sbjct: 713  TPLQHLSKDQGKFVISNSSLSEFGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQ 772

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KW+QRTGLV+ LPHGYDGQGPEHSSGRLERFLQLC++ P V+P  +K+ RQHQ
Sbjct: 773  FIASGEQKWMQRTGLVMSLPHGYDGQGPEHSSGRLERFLQLCNEDPRVFPSDDKLQRQHQ 832

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D N+QI   TTPAN FH+LRRQ++R FRKPLI F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 833  DSNVQIAYMTTPANLFHILRRQMNRQFRKPLILFFSKSLLRHPLARSDIEEFTGDSQFQW 892

Query: 421  FIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP  E   + S ++I R ILCSGQVY AL + R  NK+D+VAI+R+EQ+ PFP++ L
Sbjct: 893  IIADPAHEAGAIKSHDEIDRVILCSGQVYGALHKYRGDNKVDNVAITRIEQLHPFPWEQL 952

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H  +    A R PSAS A
Sbjct: 953  RENLDMYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTQHHHRKHVMYAGRNPSASVA 1012

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1013 TGLKASHTKEEQDLLEMAF 1031



>gi|296416600|ref|XP_002837963.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633857|emb|CAZ82154.1| unnamed protein product [Tuber melanosporum]
          Length = 1047

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/558 (62%), Positives = 439/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++APIFHVN DDVEAVNFVC+LA++WR  FK+DVVID+VCYRKYGHNE DQP
Sbjct: 485  YCSDIAKSIDAPIFHVNADDVEAVNFVCELASDWRAEFKRDVVIDLVCYRKYGHNETDQP 544

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA++ P L++Y+ +L  +GTFT+ DI++HK WVW++LE+++ KSKDY PT
Sbjct: 545  SFTQPLMYRKIAEKQPALDRYISRLKAEGTFTESDIQEHKDWVWSMLEDSFAKSKDYQPT 604

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +REWL+S+WNGFK+PKEL+ E  P  PT      L+H+G VI S P+GFNVH  L RIL 
Sbjct: 605  AREWLASAWNGFKTPKELSTEILPHLPTALEESQLKHIGNVIGSVPEGFNVHKNLSRILS 664

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +NEG GIDW TAE LAFGSLL+EG+HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 665  NRQKVVNEGSGIDWSTAEALAFGSLLMEGQHVRVSGQDVERGTFSQRHAVLHDQENENTY 724

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QAKF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 725  TPLQHLSDTQAKFVISNSSLSEFGVLGFEYGYSLSSPDALVIWEAQFGDFANNAQCIIDQ 784

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQRTG+V+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 785  FIASGESKWLQRTGIVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPREFPDPEKLDRQHQ 844

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T+P+N FHVLRRQ+ R FRKPLI F SKSLLRHP+ARS L+E TGD+ F+ 
Sbjct: 845  DCNMQVTYMTSPSNLFHVLRRQMKRQFRKPLIIFFSKSLLRHPIARSELSEFTGDSHFRW 904

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H + +  PE+  R + CSGQVY AL++ R  + +D VAI+R+EQ+ PFP+  + 
Sbjct: 905  LIPETDHGKGIKDPEECKRLLFCSGQVYAALMKQRAASGIDDVAIARIEQLHPFPWAQIR 964

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++KYPN  E+IW QEEPLN GAWT+V PR+ T++  ++ H  +  K A R PSAS AT
Sbjct: 965  NELEKYPNLDEIIWTQEEPLNAGAWTFVQPRLETILRQTDNHSAKHVKYAGRAPSASVAT 1024

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE  L++ AL
Sbjct: 1025 GMKSTHLKEEQALVNDAL 1042



>gi|303311281|ref|XP_003065652.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor,
            putative [Coccidioides posadasii C735 delta SOWgp]
 gi|240105314|gb|EER23507.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor,
            putative [Coccidioides posadasii C735 delta SOWgp]
          Length = 1063

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 437/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK + AP+FHVN DDVEAVNFVCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 496  YCSDIAKAIEAPVFHVNADDVEAVNFVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 555

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA QT  L+KYV KLL++ TFTKEDIE+HKKWVW +L +++ +SK+Y PT
Sbjct: 556  AFTQPLMYKRIADQTTQLDKYVNKLLQENTFTKEDIEEHKKWVWGMLNDSFDRSKEYQPT 615

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PTG S + L+ +G+ I   P+GF+VH  L RIL 
Sbjct: 616  SREWLTSAWNGFKSPKELATEVLPHLPTGVSRDTLRMIGDKIGETPQGFSVHRNLKRILA 675

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG  IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 676  NRKKTVDEGNNIDWATAEALAFGTLCNEGHHVRVSGQDVERGTFSQRHAVLHDQQNEATY 735

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 736  TPLQHISENQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 795

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P V+P P+K+ RQHQ
Sbjct: 796  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRVFPSPDKIDRQHQ 855

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQI+R FRKPL+ F SKSLLRHP+ RSS+ E TGD+ F+ 
Sbjct: 856  DCNMQIAYMTTPSNLFHILRRQINRQFRKPLVIFFSKSLLRHPLCRSSIEEFTGDSHFRW 915

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H +++A PEKI R ILCSGQV+ AL++ R+ N + + AI+R+EQ+ PFP+  L 
Sbjct: 916  IIPETEHGKSIAEPEKIERVILCSGQVWAALVKHRDANGIKNTAITRIEQLNPFPWQQLK 975

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++W QEEPLN GAW++V PRI TL+N++E H  R    A R PSAS AT
Sbjct: 976  ENLDSYPNAKDIVWCQEEPLNAGAWSFVQPRIETLLNNTEHHNRRHVLYAGRNPSASVAT 1035

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE +LL  A 
Sbjct: 1036 GLKASHIKEEQELLQDAF 1053



>gi|392862937|gb|EAS36382.2| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Coccidioides immitis RS]
          Length = 1063

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 437/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK + AP+FHVN DDVEAVNFVCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 496  YCSDIAKAIEAPVFHVNADDVEAVNFVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 555

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA QT  L+KYV KLL++ TFTKEDIE+HKKWVW +L +++ +SK+Y PT
Sbjct: 556  AFTQPLMYKRIADQTTQLDKYVNKLLQENTFTKEDIEEHKKWVWGMLNDSFDRSKEYQPT 615

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PTG S + L+ +G+ I   P+GF+VH  L RIL 
Sbjct: 616  SREWLTSAWNGFKSPKELATEVLPHLPTGVSRDTLRMIGDKIGETPQGFSVHRNLKRILA 675

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG  IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 676  NRKKTVDEGNNIDWATAEALAFGTLCNEGHHVRVSGQDVERGTFSQRHAVLHDQQNEATY 735

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 736  TPLQHISENQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 795

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P V+P P+K+ RQHQ
Sbjct: 796  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRVFPSPDKIDRQHQ 855

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQI+R FRKPL+ F SKSLLRHP+ RSS+ E TGD+ F+ 
Sbjct: 856  DCNMQIAYMTTPSNLFHILRRQINRQFRKPLVIFFSKSLLRHPLCRSSIEEFTGDSHFRW 915

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H +++A PEKI R ILCSGQV+ AL++ R+ N + + AI+R+EQ+ PFP+  L 
Sbjct: 916  IIPETEHGKSIAEPEKIERVILCSGQVWAALVKHRDANGIKNTAITRIEQLNPFPWQQLK 975

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++W QEEPLN GAW++V PRI TL+N++E H  R    A R PSAS AT
Sbjct: 976  ENLDSYPNAKDIVWCQEEPLNAGAWSFVQPRIETLLNNTEHHNRRHVLYAGRNPSASVAT 1035

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE +LL  A 
Sbjct: 1036 GLKASHIKEEQELLQDAF 1053



>gi|320039481|gb|EFW21415.1| 2-oxoglutarate dehydrogenase E1 component [Coccidioides posadasii
            str. Silveira]
          Length = 1063

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 437/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK + AP+FHVN DDVEAVNFVCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 496  YCSDIAKAIEAPVFHVNADDVEAVNFVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 555

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA QT  L+KYV KLL++ TFTKEDIE+HKKWVW +L +++ +SK+Y PT
Sbjct: 556  AFTQPLMYKRIADQTTQLDKYVNKLLQENTFTKEDIEEHKKWVWGMLNDSFDRSKEYQPT 615

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PTG S + L+ +G+ I   P+GF+VH  L RIL 
Sbjct: 616  SREWLTSAWNGFKSPKELATEVLPHLPTGVSRDTLRMIGDKIGETPQGFSVHRNLKRILA 675

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG  IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 676  NRKKTVDEGNNIDWATAEALAFGTLCNEGHHVRVSGQDVERGTFSQRHAVLHDQQNEATY 735

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 736  TPLQHISENQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 795

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P V+P P+K+ RQHQ
Sbjct: 796  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRVFPSPDKIDRQHQ 855

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQI+R FRKPL+ F SKSLLRHP+ RSS+ E TGD+ F+ 
Sbjct: 856  DCNMQIAYMTTPSNLFHILRRQINRQFRKPLVIFFSKSLLRHPLCRSSIEEFTGDSHFRW 915

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H +++A PEKI R ILCSGQV+ AL++ R+ N + + AI+R+EQ+ PFP+  L 
Sbjct: 916  IIPETEHGKSIAEPEKIERVILCSGQVWAALVKHRDANGIKNTAITRIEQLNPFPWQQLK 975

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++W QEEPLN GAW++V PRI TL+N++E H  R    A R PSAS AT
Sbjct: 976  ENLDSYPNAKDIVWCQEEPLNAGAWSFVQPRIETLLNNTEHHNRRHVLYAGRNPSASVAT 1035

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE +LL  A 
Sbjct: 1036 GLKASHIKEEQELLQDAF 1053



>gi|119500216|ref|XP_001266865.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Neosartorya fischeri NRRL 181]
 gi|119415030|gb|EAW24968.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Neosartorya fischeri NRRL 181]
          Length = 1057

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/558 (63%), Positives = 433/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDVEAVNYVCQIAADWRAEFKRDVVIDIVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKAQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PT     LL H+ + IS  P+GF VH  L RIL 
Sbjct: 610  GKEWLTSAWNGFKTPKELATEVLPHLPTAVDASLLSHIADKISGAPEGFTVHRNLKRILA 669

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 670  NRKKAVDEGKNIDWATAEALAFGSLVKEGYHVRVSGQDVERGTFSQRHAVLHDQENEATY 729

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 730  TPLKHIGEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 789

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P  +K+ RQHQ
Sbjct: 790  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRQFPTQDKLDRQHQ 849

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 850  DCNMQIAYMTSPANLFHILRRQIHRQFRKPLMIFFSKSLLRHPVARSDIEEFTGDSHFRW 909

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILC+GQVY  L++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 910  IIPDPAHGTAIDEPEKIERVILCTGQVYATLVKHREANGIRNTAITRVEQLHPFPWAQLK 969

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 970  ENLDSYPNAKDIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRAPSASVAT 1029

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE D L +A 
Sbjct: 1030 GLKSVHAKEEQDFLQEAF 1047



>gi|384498867|gb|EIE89358.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Rhizopus delemar RA 99-880]
          Length = 1014

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/556 (64%), Positives = 449/556 (80%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK +NAP+FHVNGDD EAV FV QLAA+WRQTF +DVVID+VCYRK+GHNE DQP
Sbjct: 457  YCTDIAKSINAPVFHVNGDDAEAVTFVMQLAADWRQTFHRDVVIDLVCYRKHGHNETDQP 516

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQPRMY+ ++KQ P+ +KY ++L K+G+ T++DI  +K+ VWNILEE+Y +SKDY P 
Sbjct: 517  MFTQPRMYEAVSKQQPVAKKYEEQLKKEGSLTEDDITANKQRVWNILEESYSRSKDYKPE 576

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S EWLSSSW GFKSPKELAEE+ P YPTG + E LQ +G+ +++ P  FNVH  L RIL+
Sbjct: 577  SSEWLSSSWPGFKSPKELAEENLPHYPTGVALEKLQTIGKALTTLPHNFNVHRNLKRILQ 636

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EG+GIDW TAE LA+GSLL EGKHVR+SGQDVERGTFSQRHA+LHDQ N  ++
Sbjct: 637  NREKSIEEGKGIDWATAEALAWGSLLTEGKHVRVSGQDVERGTFSQRHAILHDQKNGNRH 696

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              LN + P Q   S+ NSSLSE+G LGFE GYSLVNP+SL++WE QFGDF N +Q IIDQ
Sbjct: 697  TLLNHISPEQGVISISNSSLSEYGVLGFELGYSLVNPDSLVVWEAQFGDFANTAQVIIDQ 756

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+A+GEKKWLQRTGLV+ LPHGYDGQGPEHSS R+ER+LQLCDD+PY YP PEK+ R HQ
Sbjct: 757  FLAAGEKKWLQRTGLVLSLPHGYDGQGPEHSSARIERYLQLCDDYPYDYPAPEKLERLHQ 816

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  +TPA YFHVLRRQI R FRKPLI   SKSLLRHP+ +S L E+TGD+ F+ 
Sbjct: 817  DCNMQVVYPSTPAQYFHVLRRQICRQFRKPLIMPFSKSLLRHPLVKSDLQELTGDSHFQL 876

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+ HPE L  PEKI +H+LC+GQVYY LL+AREQ++++ VAISR+EQ+ PFPY+ + +
Sbjct: 877  YLPEEHPEGLVEPEKIRKHVLCTGQVYYTLLKAREQHQLNDVAISRVEQLNPFPYEQVKE 936

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H DKYPNA+++W QEEPLN GAW +V PRI T ++ ++ H G+    A R PSAS ATGN
Sbjct: 937  HADKYPNADIVWCQEEPLNMGAWQHVQPRITTSLSQTQHHAGKKPIYAGRAPSASVATGN 996

Query: 541  KKQHIQEEHDLLSQAL 556
            KKQH Q+E D L++AL
Sbjct: 997  KKQHYQQEKDFLAKAL 1012



>gi|402076607|gb|EJT72030.1| 2-oxoglutarate dehydrogenase [Gaeumannomyces graminis var. tritici
            R3-111a-1]
          Length = 1053

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/559 (63%), Positives = 439/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLAA+WR  F++DV+ID++CYRK+GHNE DQP
Sbjct: 485  YCTDIAKAIDAPVFHVNADDVEAVNYVCQLAADWRAEFQQDVIIDLICYRKHGHNETDQP 544

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV +LLKDGTFTK DIE+HK+WVW +LE+++ KSKDY PT
Sbjct: 545  SFTQPLMYKRIQSHEPQIDIYVNQLLKDGTFTKGDIEEHKQWVWGMLEDSFSKSKDYQPT 604

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GEVI + P+GFN+H  L RIL 
Sbjct: 605  SKEWTTSAWNGFKSPKELASEVLPHSPTGVDKQTLEHIGEVIGTAPEGFNLHRNLKRILT 664

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K+++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ +E  Y
Sbjct: 665  ARTKSVHEGKNIDWSTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQESEETY 724

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF V NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 725  TPLQKISKDQGKFVVSNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 784

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+P  EK+ RQHQ
Sbjct: 785  FVASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPAEEKLQRQHQ 844

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NMQI   TTPAN FH+LRRQ++R FRKPLI F SKSLLRHP+ARS + E TGD+ F  
Sbjct: 845  DSNMQIAYMTTPANLFHILRRQMNRQFRKPLIIFFSKSLLRHPLARSDIEEFTGDSQFHW 904

Query: 421  FIPDPHPETLASP--EKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  E  A    ++I R ILCSGQVY AL + R  N++D+VAI+R+EQ+ PFP+ LL
Sbjct: 905  IIPDPAHEAGAIKPHDEIERVILCSGQVYAALHKYRADNQLDNVAITRIEQLHPFPWKLL 964

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D+YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H+ +    A R PSAS A
Sbjct: 965  RDNLDRYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTQHHDRKHVMYAGRNPSASVA 1024

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE +LL  A 
Sbjct: 1025 TGMKSSHTKEEQELLEMAF 1043



>gi|317144488|ref|XP_001820159.2| 2-oxoglutarate dehydrogenase [Aspergillus oryzae RIB40]
          Length = 1061

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/558 (63%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN+VCQ+AA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 494  YCSDIAKSIDAPVFHVNGDDVEAVNYVCQVAADWRAEFKSDVVIDIVCYRKQGHNETDQP 553

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 554  SFTQPLMYKRIAAQKNQLDKYVEKLITEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 613

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PTG    LL+HV + +S  P GF +H  L RIL 
Sbjct: 614  GKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKHVADKVSGAPDGFTLHRNLKRILS 673

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 674  NRKKAVDEGKNIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQENENTY 733

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 734  TPLQHISEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 793

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P  +K+ RQHQ
Sbjct: 794  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRIFPSQDKLDRQHQ 853

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T PAN FH+LRRQIHR FRKPL+ F SK+LLRHP+ARS + + +GD+ F+ 
Sbjct: 854  DCNMQIAYMTEPANLFHILRRQIHRQFRKPLVIFFSKALLRHPIARSDIEDFSGDSHFRC 913

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILCSGQVY +LL+ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 914  IIPDPAHGSAIDEPEKIERVILCSGQVYASLLKHREANGIRNTAITRIEQLHPFPWAQLK 973

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA  ++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 974  ENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRSPSASVAT 1033

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE + L +A 
Sbjct: 1034 GLKGVHLKEEQEFLEEAF 1051



>gi|391871651|gb|EIT80808.1| 2-oxoglutarate dehydrogenase, E1 subunit [Aspergillus oryzae 3.042]
          Length = 1061

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/558 (63%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN+VCQ+AA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 494  YCSDIAKSIDAPVFHVNGDDVEAVNYVCQVAADWRAEFKSDVVIDIVCYRKQGHNETDQP 553

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 554  SFTQPLMYKRIAAQKNQLDKYVEKLITEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 613

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PTG    LL+HV + +S  P GF +H  L RIL 
Sbjct: 614  GKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKHVADKVSGAPDGFTLHRNLKRILS 673

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 674  NRKKAVDEGKNIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQENENTY 733

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 734  TPLQHISEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 793

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P  +K+ RQHQ
Sbjct: 794  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRIFPSQDKLDRQHQ 853

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T PAN FH+LRRQIHR FRKPL+ F SK+LLRHP+ARS + + +GD+ F+ 
Sbjct: 854  DCNMQIAYMTEPANLFHILRRQIHRQFRKPLVIFFSKALLRHPIARSDIEDFSGDSHFRC 913

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILCSGQVY +LL+ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 914  IIPDPAHGSAIDEPEKIERVILCSGQVYASLLKHREANGIRNTAITRIEQLHPFPWAQLK 973

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA  ++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 974  ENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRSPSASVAT 1033

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE + L +A 
Sbjct: 1034 GLKGVHLKEEQEFLEEAF 1051



>gi|121708090|ref|XP_001272026.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Aspergillus clavatus NRRL 1]
 gi|119400174|gb|EAW10600.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Aspergillus clavatus NRRL 1]
          Length = 1056

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/558 (63%), Positives = 435/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEA+N+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 489  YCSDIAKSIDAPVFHVNADDVEALNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 548

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 549  SFTQPLMYKRIAEQKAQLDKYVEKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 608

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PT +   LL  + E IS  P+GF VH  L RIL 
Sbjct: 609  SKEWLTSAWNGFKTPKELATEVLPHLPTAAEPALLSRIAEKISGPPEGFTVHRNLKRILA 668

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG GIDWPTAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 669  NRRKTVEEGTGIDWPTAEALAFGTLVDEGYHVRVSGQDVERGTFSQRHAVLHDQENEGTY 728

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL D+   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 729  TPLQDISDKQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 788

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQHQ
Sbjct: 789  FIASGESKWLQRSGLVISLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSQDKLDRQHQ 848

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS L E TG++ F+ 
Sbjct: 849  DCNMQIACMTSPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDLEEFTGESHFQW 908

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I DP H   +  PEKI R ILCSGQVY AL++ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 909  IIRDPAHGSAIDEPEKIERVILCSGQVYAALVKHREANNIRNTAITRVEQLHPFPWAQLK 968

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA +++WAQEEPLN GAW++  PR+ TL+N +E H  R    A R PSAS AT
Sbjct: 969  ENLDSYPNAKDIVWAQEEPLNAGAWSFAQPRLETLLNATEHHNRRHVLYAGRAPSASVAT 1028

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE + L  A 
Sbjct: 1029 GLKSVHIKEEQEFLEDAF 1046



>gi|452843789|gb|EME45724.1| hypothetical protein DOTSEDRAFT_71424 [Dothistroma septosporum NZE10]
          Length = 1049

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/561 (63%), Positives = 438/561 (78%), Gaps = 6/561 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK V+APIFHVNGDDVEA+NFVCQLA++WR  FKKDVVIDIVCYRK GHNE DQP
Sbjct: 478  YCSDIAKFVDAPIFHVNGDDVEALNFVCQLASDWRAEFKKDVVIDIVCYRKQGHNETDQP 537

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I +Q P+L+KY ++LL   TFTKEDIE+HKKWVW +LEE++ KSKDY PT
Sbjct: 538  SFTQPLMYKRINEQPPVLDKYTKQLLDANTFTKEDIEEHKKWVWGMLEESFAKSKDYQPT 597

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PT    + L+HVGEVI + PK F+ H  L RIL 
Sbjct: 598  SREWLTSAWNGFKSPKELATEILPHEPTAVDVDTLKHVGEVIGTPPKDFHAHKNLKRILA 657

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +NEG+ ID  T E LAFG+L+LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 658  NRTKTVNEGKNIDMSTGEALAFGTLVLEGHHVRVSGQDVERGTFSQRHAVLHDQESEATY 717

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSE+GTLGFEYGYSL +P +L++WE QFGDF NN+QCIIDQ
Sbjct: 718  TPLKHVSKDQGSFVITNSSLSEYGTLGFEYGYSLSSPTALVIWEAQFGDFANNAQCIIDQ 777

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ERFLQLC++ P ++P P+K+ RQHQ
Sbjct: 778  FIASGEVKWLQRSGLVVNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPSPDKLDRQHQ 837

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPAN FH+LRRQ++R FRKPLI+F SKSLLRHP+ARSS+ + TG++ F+ 
Sbjct: 838  DCNMQIVACTTPANSFHILRRQMNRQFRKPLISFFSKSLLRHPLARSSIEDFTGESHFQW 897

Query: 421  FIPDPHPETLASPE-----KITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
             I DP  +  A  +      I R ILCSGQV+ AL + R+QN +   AI+R+EQ+ PFP+
Sbjct: 898  IIADPAHDQDAEFKINEHHDIKRVILCSGQVFAALFKYRQQNNLTDTAITRIEQLNPFPW 957

Query: 476  DLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSA 534
              L +++D YP+AE ++W QEEPLN GAW++  PRI TL+NH+E H+ +    A R PSA
Sbjct: 958  AQLKENLDSYPHAETVVWCQEEPLNAGAWSFTQPRIETLLNHTEHHDRKHVMYAGRNPSA 1017

Query: 535  SPATGNKKQHIQEEHDLLSQA 555
            S ATG K  H++EE DLL  A
Sbjct: 1018 SVATGLKSSHLKEEQDLLEMA 1038



>gi|258567766|ref|XP_002584627.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Uncinocarpus reesii 1704]
 gi|237906073|gb|EEP80474.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Uncinocarpus reesii 1704]
          Length = 1063

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 436/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK + AP+FHVN DDVEAVNFVCQ+AA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 496  YCSDIAKAIEAPVFHVNADDVEAVNFVCQMAADWRAQFKSDVVIDIVCYRKQGHNETDQP 555

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA QT  LEKYV KLL + +FTKEDIE+HKKWVW +L +++ +SKDY PT
Sbjct: 556  AFTQPLMYKRIADQTSQLEKYVDKLLSENSFTKEDIEEHKKWVWGMLNDSFDRSKDYQPT 615

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PTG S+E L+ +G+ IS  P+GFNVH  L RIL 
Sbjct: 616  SREWLTSAWNGFKSPKELATEVLPHLPTGVSHENLRTIGDKISEAPEGFNVHRNLKRILA 675

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG+ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 676  NRKKTVDEGKNIDWATAEALAFGTLCNEGHHVRVSGQDVERGTFSQRHAVLHDQESEATY 735

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 736  TPLQHISENQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 795

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P P+K+ RQHQ
Sbjct: 796  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPRVFPSPDKLDRQHQ 855

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPAN FH+LRRQI+R FRKPLI F SK+LLRHP+ RSS+ + TGD+ F  
Sbjct: 856  DCNMQIAYMTTPANLFHILRRQINRQFRKPLIIFFSKALLRHPICRSSIEDFTGDSHFNW 915

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H +++A PE+I R ILC+GQVY AL++ RE   + + AI+R+EQ+ PFP+  L 
Sbjct: 916  IIPETEHGKSIAEPEQIDRVILCTGQVYAALVKHREAQGIKNTAITRIEQLNPFPWQQLK 975

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ++D YPNA +++W QEEPLN GAW++V PRI TL+N++E H  R    A R  SAS AT
Sbjct: 976  DNLDSYPNAKDIVWCQEEPLNAGAWSFVQPRIETLLNNTEHHNRRHVLYAGRNQSASVAT 1035

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE +LL  A 
Sbjct: 1036 GLKASHIKEEQELLHDAF 1053



>gi|500262017|gb|EOO04293.1| putative oxoglutarate dehydrogenase protein [Togninia minima UCRPA7]
          Length = 1051

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/559 (62%), Positives = 438/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F++DV++D+VCYRK+GHNE DQP
Sbjct: 483  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQQDVIVDLVCYRKHGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV++LLKDGTFTKEDIE+HK+WVW +LE+++ KSK+Y PT
Sbjct: 543  SFTQPLMYKRIQSHDPQIDIYVEQLLKDGTFTKEDIEEHKQWVWGMLEDSFAKSKEYQPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GEVI S P+GFNVH  L RIL 
Sbjct: 603  SKEWTTSAWNGFKSPKELATEVLPHNPTGVDQKTLEHIGEVIGSAPEGFNVHRNLKRILS 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ IDW TAE LAFG+L+ EG HVR+SGQDVERGTFSQRH+V HDQ  E  Y
Sbjct: 663  NRTKSVVEGKNIDWSTAEALAFGTLVTEGHHVRVSGQDVERGTFSQRHSVFHDQETEDTY 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P ++P  EK+ RQHQ
Sbjct: 783  FIASGEIKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRLFPSEEKLNRQHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPAN FH+LRRQ++R FRKPL+ F SKSLLRHP+ARS + E TGD+ F  
Sbjct: 843  DCNMQIAYMTTPANLFHILRRQMNRQFRKPLVIFFSKSLLRHPLARSDIEEFTGDSQFHW 902

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  E+  + SPE+I R ILCSGQVY AL + R  N ++ VAI+R+EQ+ PFP+  L
Sbjct: 903  IIPDPAHESGAIKSPEEIDRVILCSGQVYAALHKYRADNNINDVAITRVEQLHPFPWQQL 962

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS A
Sbjct: 963  KENLDTYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSASVA 1022

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE + L  A 
Sbjct: 1023 TGLKASHTKEEQEFLKMAF 1041



>gi|83768018|dbj|BAE58157.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 1019

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/558 (63%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVN+VCQ+AA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 452  YCSDIAKSIDAPVFHVNGDDVEAVNYVCQVAADWRAEFKSDVVIDIVCYRKQGHNETDQP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 512  SFTQPLMYKRIAAQKNQLDKYVEKLITEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PTG    LL+HV + +S  P GF +H  L RIL 
Sbjct: 572  GKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKHVADKVSGAPDGFTLHRNLKRILS 631

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 632  NRKKAVDEGKNIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQENENTY 691

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 692  TPLQHISEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 751

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P  +K+ RQHQ
Sbjct: 752  FIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRIFPSQDKLDRQHQ 811

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T PAN FH+LRRQIHR FRKPL+ F SK+LLRHP+ARS + + +GD+ F+ 
Sbjct: 812  DCNMQIAYMTEPANLFHILRRQIHRQFRKPLVIFFSKALLRHPIARSDIEDFSGDSHFRC 871

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILCSGQVY +LL+ RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 872  IIPDPAHGSAIDEPEKIERVILCSGQVYASLLKHREANGIRNTAITRIEQLHPFPWAQLK 931

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA  ++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS AT
Sbjct: 932  ENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRSPSASVAT 991

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE + L +A 
Sbjct: 992  GLKGVHLKEEQEFLEEAF 1009



>gi|145257753|ref|XP_001401841.1| 2-oxoglutarate dehydrogenase [Aspergillus niger CBS 513.88]
 gi|134058755|emb|CAK38739.1| unnamed protein product [Aspergillus niger]
 gi|350632323|gb|EHA20691.1| hypothetical protein ASPNIDRAFT_212992 [Aspergillus niger ATCC 1015]
          Length = 1055

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/560 (64%), Positives = 438/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 486  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 545

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV KL+++GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 546  SFTQPLMYKRIAQQKSQLDKYVNKLIEEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 605

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS--YPKGFNVHSGLVRI 178
            S+EWL+S+WNGFK+PKELA E  P  PTG    LL+ V + IS    P+GF +H  L RI
Sbjct: 606  SKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKDVADKISGGGSPEGFTLHKNLKRI 665

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
            L  R KA++EGQGIDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ NE 
Sbjct: 666  LANRKKAVDEGQGIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQENEG 725

Query: 239  QYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             Y PL ++   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCII
Sbjct: 726  TYTPLQNISENQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCII 785

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQ 358
            DQFIA+GE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQ
Sbjct: 786  DQFIAAGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPEGDKLDRQ 845

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTF 418
            HQDCNMQI+  T+PAN FHVLRRQIHR FRKPL+ F SKSLLRHP+ARS +   TGD+ F
Sbjct: 846  HQDCNMQIVCMTSPANLFHVLRRQIHRQFRKPLVIFFSKSLLRHPLARSDIESFTGDSHF 905

Query: 419  KRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
            +  IPDP H + +  PEKI R ILCSGQVY AL + RE + + + AI+R+EQ+ PFP+  
Sbjct: 906  QWIIPDPAHGKEIDEPEKIERVILCSGQVYAALTKHREAHGIRNTAITRVEQLHPFPWAQ 965

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA  ++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS 
Sbjct: 966  LKENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRAPSASV 1025

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H++EE + L  A 
Sbjct: 1026 ATGLKSVHLKEEQEFLQDAF 1045



>gi|171690254|ref|XP_001910052.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945075|emb|CAP71186.1| unnamed protein product [Podospora anserina S mat+]
          Length = 1043

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/559 (62%), Positives = 439/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVE+VNFVCQLAA+WR  FK+DVVID+VCYRK+GHNE DQP
Sbjct: 475  YCTDIAKAIDAPVFHVNADDVESVNFVCQLAADWRAEFKQDVVIDLVCYRKHGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P +E YV +LLK+GTFTKED+E+HK+WVW +LEE++ KSKDY PT
Sbjct: 535  SFTQPLMYKRIQEKNPQIEIYVDQLLKEGTFTKEDVEEHKQWVWGMLEESFAKSKDYQPT 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WN FKSPKELA E  P  PTG   + L+H+G VI + P+GFNVH  L RIL 
Sbjct: 595  SKEWTTSAWNNFKSPKELATEVLPHNPTGVDRQTLEHIGTVIGTVPEGFNVHRNLKRILA 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ IDW TAE LAFG+L+ EGKHVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 655  NRTKSVVEGKNIDWSTAEALAFGTLVTEGKHVRISGQDVERGTFSQRHAVFHDQETEDIF 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSE+G LGFEYGYSL +PN  ++WE QFGDF NN+Q + DQ
Sbjct: 715  TPLQHVGKDQGKFVISNSSLSEYGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQVVFDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLVV LPHGYDGQGPEHSSGRLERFLQLC++ P +YP  EK+ RQHQ
Sbjct: 775  FIASGETKWMQRTGLVVSLPHGYDGQGPEHSSGRLERFLQLCNEDPRLYPSAEKLDRQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   TTPAN FH+LRRQ++R FRKPLI F SK+LLRHP+ARS++ E  G+T F+ 
Sbjct: 835  DCNMQVAYMTTPANLFHILRRQMNRQFRKPLILFFSKALLRHPLARSNIEEFIGETQFQW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ++  + +PE+I R ILCSGQVY  L + R  NK+D+VAI+R+EQ+ PFP++ L
Sbjct: 895  IIPDPAHQSGEIKAPEEIDRVILCSGQVYAGLHKYRADNKIDNVAITRIEQLHPFPWEQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H+ +    A R PSAS A
Sbjct: 955  RENLDQYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNSTQHHDRKHVMYAGRNPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1015 TGLKSSHTKEEQDLLESAF 1033



>gi|340516342|gb|EGR46591.1| 2-oxoglutarate dehydrogenase-like protein [Trichoderma reesei QM6a]
          Length = 1036

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/560 (63%), Positives = 440/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 467  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 526

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 527  SFTQPLMYKRIQEKVPQIDIYVDKLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 586

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T      L H+GEVI S P+GF++H  L RIL 
Sbjct: 587  SKEWTTSAWNGFKSPKELATEVLPHNDTSVDRASLNHIGEVIGSAPEGFHIHRNLKRILN 646

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL  EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 647  NRTKSVTEGKNIDFPTAEALAFGSLATEGYHVRVSGQDVERGTFSQRHAVFHDQETEETY 706

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 707  TPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 766

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+PP +K+ RQHQ
Sbjct: 767  FIASGEAKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPPEDKLPRQHQ 826

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI+  TTPAN FHVLRRQ+HR FRKPL+ F SKSLLRHP+ARS++ E TG D  FK
Sbjct: 827  DCNMQIVYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEEFTGPDAGFK 886

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +T  + SPE+I R ILC+GQV+ +L + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 887  WIIPDPEHQTGNIKSPEEIDRVILCTGQVWASLHKYRADNKIDNVAFTRIEQLNPFPWQQ 946

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 947  LKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSASV 1006

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H++EE +LL  A 
Sbjct: 1007 ATGLKTMHMKEEQELLEMAF 1026



>gi|358366279|dbj|GAA82900.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Aspergillus kawachii IFO 4308]
          Length = 1053

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/560 (64%), Positives = 439/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 484  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 543

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV KL+++GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 544  SFTQPLMYKRIAQQKSQLDKYVNKLIEEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 603

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS--YPKGFNVHSGLVRI 178
            S+EWL+S+WNGFK+PKELA E  P  PTG    LL++V E IS    P+GF +H  L RI
Sbjct: 604  SKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKNVAEKISGGGSPEGFTLHKNLKRI 663

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
            L  R KA++EGQGIDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ  E 
Sbjct: 664  LANRKKAVDEGQGIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQETEG 723

Query: 239  QYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             Y PL ++   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCII
Sbjct: 724  TYTPLQNISENQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCII 783

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQ 358
            DQFIA+GE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQ
Sbjct: 784  DQFIAAGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPEGDKLDRQ 843

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTF 418
            HQDCNMQI+  T+PAN FHVLRRQIHR FRKPL+ F SKSLLRHP+ARS +   TGD+ F
Sbjct: 844  HQDCNMQIVCMTSPANLFHVLRRQIHRQFRKPLVIFFSKSLLRHPIARSDIEGFTGDSHF 903

Query: 419  KRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
            +  IPDP H + +  PEKI R ILCSGQVY AL + RE + + + AI+R+EQ+ PFP+  
Sbjct: 904  QWIIPDPAHGKEIDEPEKIERVILCSGQVYAALTKHREAHGIRNTAITRVEQLHPFPWAQ 963

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA  ++WAQEEPLN GAW+Y  PRI TL+N +E H  R    A R PSAS 
Sbjct: 964  LKENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRAPSASV 1023

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H++EE + L+ A 
Sbjct: 1024 ATGLKSVHLKEEQEFLNDAF 1043



>gi|501753174|emb|CCG83091.1| putative Alpha-ketoglutarate dehydrogenase complex subunit Kgd1
            [Taphrina deformans PYCC 5710]
          Length = 1262

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/557 (62%), Positives = 441/557 (79%), Gaps = 4/557 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++APIFHVNGDDVEAV F+C+LA+EWR TFKKDVV+DIVCYRK+GHNE DQP
Sbjct: 703  YCSDIAKSIDAPIFHVNGDDVEAVTFICKLASEWRATFKKDVVVDIVCYRKHGHNETDQP 762

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+  P L+ Y+++L K+ TFT  DIE+HKKWVW+ILEEN+ KSKDY P+
Sbjct: 763  SFTQPLMYKKIAEHKPTLDLYIEQLTKEKTFTAADIEEHKKWVWDILEENFQKSKDYEPS 822

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S++WL+++WNGF SPK+LA +  P  PT     LL+H+G+VIS++PK F VH  L RI++
Sbjct: 823  SKDWLTAAWNGFASPKDLATKVLPHLPTSIEEPLLKHLGKVISTFPKDFTVHKNLKRIIE 882

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++ G+GIDW T E LAFGSLL EG H+R+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 883  NRGKTVDAGEGIDWATGEALAFGSLLTEGHHIRVSGQDVERGTFSQRHAVLHDQENEKTY 942

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            V LN + P QA F + NS LSEFG LG+EYGYSL +PN+L++WEGQFGDF NN+QCI+DQ
Sbjct: 943  VNLNAVDPKQASFVIVNSHLSEFGVLGYEYGYSLSSPNALVMWEGQFGDFANNAQCIVDQ 1002

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQL +D P +YP P+K+ RQHQ
Sbjct: 1003 FIASGENKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLNNDDPRIYPSPDKLDRQHQ 1062

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPAN FHVLRRQIHR+FRKPLI F SK+LLRHP+A+S  A+  GD+ F+R
Sbjct: 1063 DCNMQVVYPTTPANLFHVLRRQIHREFRKPLILFFSKALLRHPLAKSPAADFLGDSHFQR 1122

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
             I +   + + +PE+  R ++CSGQVY AL +AR+ NK+D +AI R+EQ  PFP++ L +
Sbjct: 1123 VISE--TDKIKAPEECKRLVMCSGQVYAALYKARQDNKIDDIAIIRVEQFMPFPWERLHE 1180

Query: 481  HIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
              DKY N  E++W QEEPLNGGAWTY+ PR  TL+  +  H+ +  + A R P+ S ATG
Sbjct: 1181 EFDKYKNVKEIVWCQEEPLNGGAWTYLHPRFETLLAKTA-HKDKRVRFAGRAPTGSVATG 1239

Query: 540  NKKQHIQEEHDLLSQAL 556
            NKKQH+ E+  L+ +AL
Sbjct: 1240 NKKQHMNEQQALVEEAL 1256



>gi|367035534|ref|XP_003667049.1| hypothetical protein MYCTH_2312383 [Myceliophthora thermophila ATCC
            42464]
 gi|347014322|gb|AEO61804.1| hypothetical protein MYCTH_2312383 [Myceliophthora thermophila ATCC
            42464]
          Length = 1041

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/559 (62%), Positives = 440/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 473  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFKQDVIIDLVCYRKHGHNETDQP 532

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P L+ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 533  SFTQPLMYKRIQEKVPQLDIYVNQLLKEGTFTKEDIEEHKQWVWGMLEESFAKSKDYQPT 592

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GEVI + P+GFN+H  L RIL 
Sbjct: 593  SKEWTTSAWNGFKSPKELATEILPHTPTGVDRKTLEHIGEVIGTAPEGFNLHRNLKRILA 652

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ IDW TAE LAFG+++ EG+HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 653  NRTKSVLEGKNIDWSTAEALAFGTMVTEGRHVRVSGQDVERGTFSQRHAVFHDQETEDTY 712

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSE+G LGFEYGYSL +PN  ++WE QFGDF NN+QCIIDQ
Sbjct: 713  TPLQHVSKDQGKFVISNSSLSEYGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQ 772

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KW+QRTGLV+ LPHGYDGQGPEHSSGRLERFLQLC++ P V+P  EK+ RQHQ
Sbjct: 773  FIASGEQKWMQRTGLVMSLPHGYDGQGPEHSSGRLERFLQLCNEDPRVFPSAEKLQRQHQ 832

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+Q+   +TPAN FH+LRRQ++R FRKPLI F SKSLLRHP+ARS++ E TGD+ F+ 
Sbjct: 833  DCNIQVAYPSTPANLFHILRRQMNRQFRKPLILFFSKSLLRHPLARSNIEEFTGDSQFQW 892

Query: 421  FIPDPHPETLASP--EKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP  ET A    ++I R I+C+GQVY AL + R + ++D VA +R+EQ+ PFP++LL
Sbjct: 893  VIADPAHETGAIKPHDQIDRVIICTGQVYAALHKYRAEKQIDDVAFTRIEQLHPFPWELL 952

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H  +    A R PSAS A
Sbjct: 953  RENLDMYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTKHHHRKHVMYAGRNPSASVA 1012

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1013 TGLKASHTKEEQDLLEMAF 1031



>gi|512191710|gb|EPE07471.1| oxoglutarate dehydrogenase [Ophiostoma piceae UAMH 11346]
          Length = 1049

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/559 (62%), Positives = 438/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLA++WR  FK+DV++D+VCYRKYGHNE DQP
Sbjct: 481  YCTDIAKAIDAPVFHVNADDVEAVNYVCQLASDWRAEFKQDVIVDLVCYRKYGHNETDQP 540

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV+KLLK+GTFTKED+E+HK+WVW++LE+++ KSK+Y PT
Sbjct: 541  SFTQPLMYKRINAHRPQIDIYVEKLLKEGTFTKEDVEEHKQWVWSMLEDSFSKSKEYQPT 600

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GE+I + P+GF VH  L RIL 
Sbjct: 601  SKEWTTSAWNGFKSPKELATEILPHNPTGVDKKTLEHIGEIIGTAPEGFTVHRNLKRILS 660

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K++ +G+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRH+V HDQ  E  Y
Sbjct: 661  ARTKSVLDGKNIDWSTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHSVFHDQETEDIY 720

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL ++   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 721  TPLKNISKDQGKFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 780

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  YP  EK+ RQHQ
Sbjct: 781  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPREYPSIEKLDRQHQ 840

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPAN FH+LRRQ++R FRKPLI F SKSLLRHP+ARS++ + TGD+ F  
Sbjct: 841  DCNMQIAYMTTPANLFHILRRQMNRQFRKPLIIFFSKSLLRHPIARSNIEDFTGDSQFNW 900

Query: 421  FIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP  E   L +  +I R ILCSGQVY AL + R  NK+D VAI+R+EQ+ PFP+  +
Sbjct: 901  IITDPAHEEGALKAHSEIDRVILCSGQVYAALNKYRIDNKIDDVAITRVEQLHPFPWQQV 960

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ ++WAQEEPLN GAWT+  PR+ T++N +E H+ +    A R PSAS A
Sbjct: 961  KENLDSYPNAKTIVWAQEEPLNAGAWTFTQPRLETVLNQTEHHDHKHIMYAGRNPSASVA 1020

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1021 TGTKSSHTKEEQDLLEMAF 1039



>gi|471574013|gb|EMR72012.1| putative oxoglutarate dehydrogenase protein [Eutypa lata UCREL1]
          Length = 1039

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/560 (63%), Positives = 438/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+VCYRKYGHNE DQP
Sbjct: 470  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQSDVVIDLVCYRKYGHNETDQP 529

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I +  P ++ YV+KLL+DGTFTKED+E+H++WVW +LE+++ KSKDY PT
Sbjct: 530  SFTQPLMYKRINEHNPQIDIYVEKLLEDGTFTKEDVEEHRQWVWGMLEDSFSKSKDYQPT 589

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PT    + L+H+ EVI S P+ F++H  L RIL 
Sbjct: 590  SKEWTTSAWNGFKSPKELASEVLPHNPTNVEKQTLEHIAEVIGSAPEDFHLHRNLKRILA 649

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+K + EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRH+V HDQ  E  Y
Sbjct: 650  NRSKTVLEGKNIDWSTAEALAFGSLVAEGHHVRVSGQDVERGTFSQRHSVFHDQETENTY 709

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   QAKF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 710  TPLQHISKDQAKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 769

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGR+ER+LQL ++ P V+PP +++ RQHQ
Sbjct: 770  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRIERYLQLSNEDPRVFPPEDRLERQHQ 829

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQ++  TTPAN FHVLRRQ+HR FRKPLI F SKSLLRHP+ARS++ E+TG D  F+
Sbjct: 830  DCNMQVVYMTTPANLFHVLRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEELTGPDAGFQ 889

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPD    T  +  PE+I R ILCSGQVY AL + R  NK+D+VAI+R+EQ+ PFP+  
Sbjct: 890  WIIPDTEHATGSIKGPEEIDRVILCSGQVYAALHKYRVDNKIDNVAITRIEQLNPFPWKQ 949

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D Y NA+ ++W QEEPLN GAW++  PRI TL+NH+E H+ +    A R PSAS 
Sbjct: 950  LKENLDTYQNAKTVVWCQEEPLNAGAWSFTQPRIETLLNHTEHHDRKHVIYAGRNPSASV 1009

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE DLL  A 
Sbjct: 1010 ATGLKSTHKKEEEDLLEAAF 1029



>gi|341038445|gb|EGS23437.1| mitochondrial 2-oxoglutarate dehydrogenase E1 component-like protein
            [Chaetomium thermophilum var. thermophilum DSM 1495]
          Length = 1042

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/559 (62%), Positives = 441/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK + AP+FHVN DDVEAVNFVCQLAA+WR  FK+DV+ID+VCYRK GHNE DQP
Sbjct: 474  YCTDIAKTIEAPVFHVNADDVEAVNFVCQLAADWRAEFKQDVIIDLVCYRKRGHNETDQP 533

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I+++   L+ YV +LL++G FTKEDI++H  WVW++LEE++ +SKDY PT
Sbjct: 534  SFTQPLMYKRISEKKTQLDIYVNQLLQEGIFTKEDIQEHMNWVWSMLEESFARSKDYQPT 593

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+G VI + P+GFN+H  L RIL 
Sbjct: 594  SKEWTTSAWNGFKSPKELATEILPHPPTGVDRKTLEHIGAVIGTAPEGFNLHPNLKRILN 653

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+K + EG+ IDWPTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 654  NRSKTVLEGKNIDWPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTY 713

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSE+G LGFEYGYSL +PN+ ++WE QFGDF NN+QCIIDQ
Sbjct: 714  TPLQHISKDQGKFVISNSSLSEYGALGFEYGYSLTDPNAFVMWEAQFGDFANNAQCIIDQ 773

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KW+QRTGLVV LPHG+DGQGPEHSSGRLERFLQLC++   V+P PEK+ RQHQ
Sbjct: 774  FIAAGEQKWMQRTGLVVSLPHGFDGQGPEHSSGRLERFLQLCNEDSRVFPAPEKLNRQHQ 833

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T+P+N FH+LRRQI R FRKPLI F SKSLLRHP+ARS++ E  G+++F+ 
Sbjct: 834  DCNMQVAYPTSPSNLFHLLRRQIKRQFRKPLILFFSKSLLRHPIARSNIEEFIGESSFRW 893

Query: 421  FIPDPHPETLASP--EKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ET A    ++I R ILCSGQVY AL++ R  N +D+VAI+R+EQ+ PFP++ L
Sbjct: 894  IIPDPAHETGAIKPHDQIDRLILCSGQVYAALVKYRADNGLDNVAITRIEQLHPFPWEQL 953

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ ++WAQEEPLN GAW+Y  PRI TL+N ++ H+ +    A R PSASPA
Sbjct: 954  RENLDSYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNCTKYHDRKHVMYAGRNPSASPA 1013

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG KK H++EE +LL  A 
Sbjct: 1014 TGVKKNHVREEQELLEMAF 1032



>gi|226290128|gb|EEH45612.1| 2-oxoglutarate dehydrogenase E1 [Paracoccidioides brasiliensis Pb18]
          Length = 1072

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 439/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 503  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 562

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA+QT  L+KYV KL+K+ TFT EDIE+HKKWVW +L +++ +SKDY P+
Sbjct: 563  AFTQPLMYKRIAEQTNQLDKYVDKLIKEKTFTHEDIEEHKKWVWGMLNDSFDRSKDYQPS 622

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFKSPKELA E  P  PTG   + L+ +G+V+ + P+ F VH  L RIL 
Sbjct: 623  SKEWLTSAWNGFKSPKELATEVLPHPPTGVPADTLKKIGDVLGNVPENFTVHRNLKRILA 682

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 683  NRKKTVEEGENIDWSTAEALAFGTLCAEGHHVRVSGQDVERGTFSQRHAVLHDQENETTY 742

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 743  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 802

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+PPP+++ RQHQ
Sbjct: 803  FIASGETKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPPPDRIDRQHQ 862

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L+   GD+ F+ 
Sbjct: 863  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSSFIGDSHFQW 922

Query: 421  FIPDPHPETLA--SPEKITRHILCSGQVYYALLRAREQNK-MDHVAISRLEQICPFPYDL 477
             IPDP   T A  SP+ I R ILCSGQVY AL + R  N+ + + AI+R+EQ+ PFP+ +
Sbjct: 923  IIPDPEHATGAINSPKSIERVILCSGQVYAALHKHRAANESLKNTAITRIEQMHPFPWQM 982

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++W QEEPLN GAW+Y+ PRI TL+N ++ H  R    A R PSAS 
Sbjct: 983  LKENLDGYPNAKNIVWCQEEPLNAGAWSYMQPRIETLLNETKHHNRRHVLYAGRNPSASV 1042

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATGNK  H++EE +LL+ A 
Sbjct: 1043 ATGNKGSHLKEEEELLTDAF 1062



>gi|67538802|ref|XP_663175.1| hypothetical protein AN5571.2 [Aspergillus nidulans FGSC A4]
 gi|40743086|gb|EAA62276.1| hypothetical protein AN5571.2 [Aspergillus nidulans FGSC A4]
 gi|259484969|tpe|CBF81643.1| TPA: oxoglutarate dehydrogenase (succinyl-transferring) (Eurofung)
            [Aspergillus nidulans FGSC A4]
          Length = 1048

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/558 (62%), Positives = 434/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVIDIVCYRK GHNE DQP
Sbjct: 481  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP 540

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+++A++   L+ YV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 541  SFTQPLMYKRVAEKKLQLDMYVEKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT 600

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWL+S+WNGFK+PKELA E  P  PT     +L++V + IS  P+GF +H  L RIL 
Sbjct: 601  GKEWLTSAWNGFKTPKELATEVLPHLPTAVEPPILKNVADKISGAPEGFTLHRNLKRILG 660

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 661  NRKKTVEEGKNIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQETEATY 720

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 721  TPLQHISKDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 780

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQHQ
Sbjct: 781  FIASGESKWLQRSGLVLSLPHGYDGQGPEHSSGRMERYLQLCNEEPRVFPSQDKLDRQHQ 840

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T+PAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 841  DCNMQVAYMTSPANLFHLLRRQIHRQFRKPLVIFFSKSLLRHPLARSSIEEFTGDSHFQW 900

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H   +  PEKI R ILCSGQVY AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 901  IIPDPAHGTAIDEPEKIERVILCSGQVYAALTKHREANNIRNTAITRVEQLHPFPWAQLK 960

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA  ++WAQEEPLN G+W+YV PRI TL+N +E H  R    A R PSAS AT
Sbjct: 961  ENLDSYPNARNIVWAQEEPLNAGSWSYVQPRIETLLNETEHHNRRHVMYAGRPPSASVAT 1020

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE ++L +A 
Sbjct: 1021 GLKSVHVKEEQEMLEEAF 1038



>gi|320589923|gb|EFX02379.1| alpha-ketoglutarate dehydrogenase complex subunit [Grosmannia
            clavigera kw1407]
          Length = 1050

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/559 (62%), Positives = 438/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK  +AP+FHVN DDVEAVNFV QLAA+WR  FK+DV+ID+VCYRKYGHNE DQP
Sbjct: 482  YCTDIAKANDAPVFHVNADDVEAVNFVSQLAADWRAEFKQDVIIDLVCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV +LLK+GTFTKEDI++HKKWVW +LE+++ +SK+Y P 
Sbjct: 542  SFTQPLMYKRIQVHEPQIDIYVDQLLKEGTFTKEDIDEHKKWVWGMLEDSFSQSKEYQPH 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   + L+H+GEVI S P+GFN+H  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEILPHNPTGVDQKTLEHIGEVIGSAPEGFNLHRNLKRILN 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K++ EG  IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRH+V HDQ  E  Y
Sbjct: 662  ARTKSVVEGNNIDWSTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHSVFHDQETEDTY 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P  +P P+K+ RQHQ
Sbjct: 782  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRQFPTPDKLDRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI   T+P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARSS+ E TG++ F  
Sbjct: 842  DCNIQIAYMTSPSNLFHILRRQMNRQFRKPLIIFFSKSLLRHPLARSSIEEFTGESQFHW 901

Query: 421  FIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPD   +  ++ +PE+I+R ILCSGQVY AL + R  N++  VAI+R+EQ+ PFP+  L
Sbjct: 902  IIPDTAHQDGSIKAPEEISRVILCSGQVYAALQKYRVDNQITDVAITRVEQLHPFPWQQL 961

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++WAQEEPLN GAWT+  PRI T++N ++ H+ +    A R PSAS A
Sbjct: 962  KENLDQYPNAQTIVWAQEEPLNAGAWTFTQPRIETILNQTQYHDHKHVMYAGRNPSASVA 1021

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EEHDLL  A 
Sbjct: 1022 TGTKATHNKEEHDLLEMAF 1040



>gi|322707674|gb|EFY99252.1| 2-oxoglutarate dehydrogenase E1 component [Metarhizium anisopliae
            ARSEF 23]
          Length = 1049

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/560 (62%), Positives = 440/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 480  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLL++GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 540  SFTQPLMYKRIQQKEPQIDVYVNKLLREGTFTKEDIEEHKQWVWGMLEESFDKSKDYTPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P + TG   + L HVGEVI S P+GF +H  L RIL 
Sbjct: 600  SKEWTTSAWNGFKSPKELATEILPHHATGVDRKTLDHVGEVIGSAPEGFQIHRNLKRILT 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV H+Q NE  Y
Sbjct: 660  NRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHEQENEKTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLQSPNALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P ++P  EK+ARQHQ
Sbjct: 780  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPTEEKLARQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI   TTPAN FHVLRRQ+HR FRKPL+ F SKSLLRHP+ARS++ + +G D  F+
Sbjct: 840  DCNMQIAYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEDFSGKDAGFQ 899

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +T  + +PE+I R ILC+GQV+ AL + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 900  WIIPDPEHQTGAIKAPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQLNPFPWQQ 959

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 960  LKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSASV 1019

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE D L  A 
Sbjct: 1020 ATGAKHLHKKEEEDFLEMAF 1039



>gi|501307063|dbj|GAC96051.1| hypothetical protein PHSY_003630 [Pseudozyma hubeiensis SY62]
          Length = 1040

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/560 (63%), Positives = 428/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAV FV QLAA+WR TFKKDVVID+VCYR++GHNE DQP
Sbjct: 469  YPSDIAKSIDAPIFHVNGDDVEAVTFVSQLAADWRATFKKDVVIDLVCYRRHGHNETDQP 528

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY  IAKQ P L+KY  +L+++G+FTK DIE+H+KWVW +LEE Y KSK+Y P 
Sbjct: 529  SFTQPRMYNAIAKQEPTLQKYSARLVEEGSFTKSDIEEHQKWVWGMLEEAYDKSKNYRPE 588

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSS+W GF SPKELAE+      TG   + L+H+G+ +SSYP+ F VH  L RILK
Sbjct: 589  EREWLSSAWEGFPSPKELAEQILDHKDTGVKEDTLRHIGKTVSSYPEDFTVHRNLGRILK 648

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  T E LAFGSL LEG +VRLSGQDVERGTFSQRH+VLHDQ NE  Y
Sbjct: 649  TRGKTVEEGKNIDMSTGEALAFGSLALEGNYVRLSGQDVERGTFSQRHSVLHDQENEATY 708

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQA F VCNSSLSEFG +GFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 709  TPLQHVGEGQAPFVVCNSSLSEFGCMGFELGFSLVSPQNLTIWEAQFGDFANNAQCIIDQ 768

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ +P PEK  RQHQ
Sbjct: 769  FIASGERKWLQRTGLVLNLPHGYDGQGPEHSSARIERFLQLCDDHPFKFPTPEKSNRQHQ 828

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPANYFHVLRRQ+HRDFRKPL+ F SKSLLRHP ARS+L +    T F+R
Sbjct: 829  DSNMAVVYCTTPANYFHVLRRQVHRDFRKPLVNFFSKSLLRHPEARSNLEDFLPGTGFQR 888

Query: 421  FIPDPHP----ETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            FIPDPH     + L +PE+I RHIL  GQ Y+ LL+ R +N +  VAISR+EQ+ P  Y+
Sbjct: 889  FIPDPHASEGKDELVAPEQIKRHILTFGQTYFELLKHRRENNIKDVAISRIEQLSPLHYE 948

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q +DKYPNA+L++ QEEPLN GAW+Y+ PR+RT   H++ H+      A+R PS+S 
Sbjct: 949  AVVQALDKYPNADLVFCQEEPLNNGAWSYLQPRLRTACRHTQHHKNDIVILASRPPSSSV 1008

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+K  H  E    L  A 
Sbjct: 1009 ATGSKIAHKAEVEAYLKDAF 1028



>gi|361124980|gb|EHK97042.1| putative 2-oxoglutarate dehydrogenase, mitochondrial [Glarea
            lozoyensis 74030]
 gi|512203411|gb|EPE32235.1| Thiamin diphosphate-binding fold (THDP-binding) [Glarea lozoyensis
            ATCC 20868]
          Length = 1049

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/558 (62%), Positives = 437/558 (78%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLAA+WR  F+KDVVID+VCYRKYGHNE DQP
Sbjct: 482  YCTDIAKSIDAPVFHVNADDVEAVNYVCQLAADWRAEFQKDVVIDLVCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I      ++ Y+ +LLK+G+FTK+DIE+H+KWVW +LE+++ KSKDY P+
Sbjct: 542  SFTQPLMYKKIQAHPSQIDLYIDQLLKEGSFTKDDIEEHRKWVWGMLEDSFAKSKDYKPS 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG + + L+H+G  I + P+GFNVH  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEVLPHLPTGVNQKTLEHIGTEIGTAPEGFNVHRNLKRILT 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +NEG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ NE  Y
Sbjct: 662  NRIKTVNEGKNIDWSTAEALAFGSLVNEGHHVRVSGQDVERGTFSQRHAVFHDQENEKTY 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQHISKDQGKFVISNSSLSEFGCLGFEYGYSLSSPNALVIWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P PEK+ RQHQ
Sbjct: 782  FIASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPEKLDRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FHVLRRQ++R FRKPLI F SKSLLRHP+ARS + E TG++ F+ 
Sbjct: 842  DCNMQIAYMTEPSNLFHVLRRQMNRQFRKPLIIFFSKSLLRHPLARSPIEEFTGESQFQW 901

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H + +  PEKI R ILC+GQVY  L + R +  + + AI+R+EQ+ PFP+  L 
Sbjct: 902  IIPDPEHGKAIEEPEKIDRIILCTGQVYVQLHKYRAEKGIKNTAITRIEQLNPFPWQQLK 961

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++DKYPNA+ ++WAQEEPLN GAW++  PRI TL+N++E H+ +    A R PSAS AT
Sbjct: 962  ENLDKYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNNTEHHDRKHVMYAGRNPSASVAT 1021

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE +LL  A 
Sbjct: 1022 GLKASHTKEEAELLEVAF 1039



>gi|453082529|gb|EMF10576.1| 2-oxoglutarate dehydrogenase E1 component mitochondrial precursor
            [Mycosphaerella populorum SO2202]
          Length = 1053

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/562 (63%), Positives = 430/562 (76%), Gaps = 6/562 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK V APIFHVNGDDVEA+NFVCQLAA+WR  FKKDVV+DIVCYRK GHNE DQP
Sbjct: 482  YCSDLAKFVEAPIFHVNGDDVEALNFVCQLAADWRAEFKKDVVVDIVCYRKQGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I +Q P+L+KY Q+LL   TFTKEDIE+HK WVW +LEE++ KSKDY P 
Sbjct: 542  SFTQPLMYKKINEQLPVLDKYTQQLLDAKTFTKEDIEEHKSWVWGMLEESFAKSKDYQPN 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFKSPKELA E  P  PT    + L+ V +VI   P+GF VH  L RIL 
Sbjct: 602  SREWLTSAWNGFKSPKELATEILPHEPTAVDADTLKQVAKVIGQPPEGFQVHKNLKRILA 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID  T E LAFG+L+ EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 662  NRTKSVEEGKNIDMSTGEALAFGTLVKEGHHVRVSGQDVERGTFSQRHAVLHDQESEGTY 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSE+G LGFEYGYSL +P +L++WE QFGDF NN+QC+IDQ
Sbjct: 722  TPLKHISEDQGSFVIANSSLSEYGALGFEYGYSLSSPTALVIWEAQFGDFANNAQCVIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQLC++ P ++P PEK+ RQHQ
Sbjct: 782  FIASGEVKWLQRSGLVMNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPAPEKLDRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+  TTPAN FH+LRRQ++R FRKPLI+F SKSLLRHP+ARS + + TGD+ F+ 
Sbjct: 842  DCNMQIVYCTTPANSFHILRRQMNRQFRKPLISFFSKSLLRHPLARSKIEDFTGDSAFQW 901

Query: 421  FIPDPHPETLA-----SPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
             IPDP  E  A     S +KI R ILCSGQV+ AL + RE N + + AI RLEQ+ PFP+
Sbjct: 902  IIPDPAHEADAAFQIDSHDKIERVILCSGQVFAALFKHRETNDIKNTAIVRLEQLNPFPW 961

Query: 476  DLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSA 534
              L +++D YPNA+ ++W QEEPLN GAW++  PRI TL+NH+E H+ +    A R PSA
Sbjct: 962  AQLKENLDSYPNAQNIVWCQEEPLNAGAWSFTQPRIETLLNHTEHHDRKHVMYAGRNPSA 1021

Query: 535  SPATGNKKQHIQEEHDLLSQAL 556
            S ATG K  H+ EE  LL  A 
Sbjct: 1022 SVATGLKSSHLLEEKRLLEDAF 1043



>gi|343425736|emb|CBQ69270.1| probable KGD1-alpha-ketoglutarate dehydrogenase [Sporisorium
            reilianum SRZ2]
          Length = 1039

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/560 (63%), Positives = 427/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAV FV QLAA+WR TFKKDVVID+VCYR++GHNE DQP
Sbjct: 469  YPSDIAKSIDAPIFHVNGDDVEAVTFVSQLAADWRATFKKDVVIDLVCYRRHGHNETDQP 528

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY  IAKQ P L KY  +L+++G+FTK DIE+H+KWVW +LEE + KSK+Y P 
Sbjct: 529  SFTQPRMYAAIAKQEPTLSKYAARLVEEGSFTKSDIEEHQKWVWGMLEEAFDKSKNYRPE 588

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSS+W GF SPKELAE+      TG   E L+H+G+ +S+YP  F VH  L RILK
Sbjct: 589  EREWLSSAWEGFPSPKELAEQILDHKDTGVKEETLKHIGKTVSTYPDDFTVHRNLGRILK 648

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  T E LAFGSL LEG +VRLSGQDVERGTFSQRH+VLHDQ NE  Y
Sbjct: 649  TRLKTVEEGKNIDMSTGEALAFGSLALEGNYVRLSGQDVERGTFSQRHSVLHDQENEGTY 708

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQA F VCNSSLSEFG +GFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 709  TPLQHVGEGQAPFVVCNSSLSEFGCMGFELGFSLVSPQNLTIWEAQFGDFANNAQCIIDQ 768

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ +P PEK  RQHQ
Sbjct: 769  FIASGERKWLQRTGLVLNLPHGYDGQGPEHSSARIERFLQLCDDHPFKFPTPEKSNRQHQ 828

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPANYFHVLRRQ+HRDFRKPL+ F SKSLLRHP ARS+L +    T F+R
Sbjct: 829  DSNMAVVYCTTPANYFHVLRRQVHRDFRKPLVNFFSKSLLRHPEARSNLEDFLPGTGFQR 888

Query: 421  FIPDPHP----ETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            FIP+PH     + L +PE+I RHIL  GQ Y+ LL+ R +NK+  VAISR+EQ+ P  Y+
Sbjct: 889  FIPEPHATEGKDELVAPEQIKRHILTFGQTYFELLKHRRENKIKDVAISRIEQLSPLHYE 948

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q +DKYPNA+L++ QEEPLN GAW+Y+ PR+RT   H+E H+      A+R PS+S 
Sbjct: 949  AIVQALDKYPNADLVFCQEEPLNNGAWSYLQPRLRTACRHTEHHKKDIVSLASRPPSSSV 1008

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+K  H  E    L  A 
Sbjct: 1009 ATGSKVAHKAEVEAYLRDAF 1028



>gi|322694072|gb|EFY85912.1| putative oxoglutarate dehydrogenase precursor [Metarhizium acridum
            CQMa 102]
          Length = 1049

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 440/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 480  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLL++GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 540  SFTQPLMYKRIQQKEPQIDVYVNKLLREGTFTKEDIEEHKQWVWGMLEESFDKSKDYTPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P + TG   + L HVGEVI S P+GF +H  L RIL 
Sbjct: 600  SKEWTTSAWNGFKSPKELATEILPHHATGVDRKTLDHVGEVIGSAPEGFQIHRNLKRILT 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV H+Q NE  Y
Sbjct: 660  NRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHEQENEKTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLQSPNALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGL++ LPHGYDGQGPEHSSGRLER+LQL ++ P ++P  EK+ARQHQ
Sbjct: 780  FIASGEVKWMQRTGLIMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPTEEKLARQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI   TTPAN FHVLRRQ+HR FRKPL+ F SKSLLRHP+ARS++ + +G D  F+
Sbjct: 840  DCNMQIAYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEDFSGEDAGFQ 899

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +T  + +PE+I R ILC+GQV+ AL + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 900  WIIPDPEHQTGAIKAPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQLNPFPWQQ 959

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 960  LKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTKYHDRKHVMYAGRNPSASV 1019

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE + L  A 
Sbjct: 1020 ATGAKHLHKKEEEEFLEMAF 1039



>gi|342320257|gb|EGU12199.1| Oxoglutarate dehydrogenase [Rhodotorula glutinis ATCC 204091]
          Length = 1141

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/556 (62%), Positives = 426/556 (76%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDD EAV FVCQLAA+WR  FKKDVVID++CYR++GHNE DQP
Sbjct: 566  YPSDIAKAIDAPIFHVNGDDAEAVTFVCQLAADWRAKFKKDVVIDLICYRRHGHNEGDQP 625

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP+MY+ I  +   L+ Y ++L+K+ TF+ E+ EKHK WVW ++EE+Y KSK+Y PT
Sbjct: 626  MFTQPKMYETIKNKPTTLQIYTEQLVKEKTFSDEETEKHKSWVWGLMEESYEKSKEYKPT 685

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLSSSW+GF SP+EL E    A  TG  ++ L+ VG+ I+S P+GFNVH  L RILK
Sbjct: 686  SKEWLSSSWDGFPSPRELKENVLEARATGVDFDTLKSVGKAIASTPEGFNVHRNLQRILK 745

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R +++ EG+ ID+ TAE LAFG+L LE  HVR+SGQDVERGTFSQRHAV+HDQ  +  +
Sbjct: 746  TRGQSVEEGKNIDYATAEALAFGTLALEKVHVRVSGQDVERGTFSQRHAVIHDQKTDETF 805

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA  ++CNSSLSEFG LGFE GYSLV+P  L++WE QFGDF N +Q +IDQ
Sbjct: 806  TPLRHLSDSQAPVTICNSSLSEFGVLGFELGYSLVDPALLVIWEAQFGDFANGAQIMIDQ 865

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP++YP  EK ARQ Q
Sbjct: 866  FIAAGERKWLQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPFIYPSAEKQARQIQ 925

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQII  T P+N FH LRRQIHRD+RKPLI F SK+LLRHP ARSSL E   +T F+R
Sbjct: 926  DCNMQIIYPTVPSNIFHALRRQIHRDYRKPLIVFFSKNLLRHPQARSSLDEFGPETLFQR 985

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +I +P PE  A PE++ RHILC+GQVYY LL  RE+  + +VAISR+EQ+ P PYDL++ 
Sbjct: 986  YIAEPEPEGFAKPEEVVRHILCAGQVYYTLLAEREKRGLTNVAISRIEQLSPLPYDLITP 1045

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+D+YPNA   W QEEP+N GAWTYV PRI T M  +E H+ R    A R P++S ATG+
Sbjct: 1046 HLDRYPNATTYWVQEEPINNGAWTYVQPRIETAMRETENHKTRRCYFAGRGPTSSVATGS 1105

Query: 541  KKQHIQEEHDLLSQAL 556
            KKQH  E    L  A 
Sbjct: 1106 KKQHALEIQQFLDAAF 1121



>gi|406864700|gb|EKD17744.1| oxoglutarate dehydrogenase [Marssonina brunnea f. sp. 'multigermtubi'
            MB_m1]
          Length = 1047

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/558 (62%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  F+KDVVID+VCYRK+GHNE DQP
Sbjct: 480  YCTDIAKAIDAPVFHVNADDVEAVNYVCQMAADWRAEFRKDVVIDLVCYRKHGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV +LLKDG+FTKEDIE+HKKWVW +LE+++ KSKDY PT
Sbjct: 540  SFTQPLMYKRIQAHEPQIDIYVNQLLKDGSFTKEDIEEHKKWVWGMLEDSFTKSKDYQPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG     L+H+G  I + P+GFNVH  L RIL 
Sbjct: 600  SKEWTTSAWNGFKSPKELANEVLPHNPTGVPLGTLEHIGTTIGTAPEGFNVHRNLKRILA 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            +R K + EG  IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 660  SRVKTVTEGTNIDWSTAEALAFGSLVQEGHHVRVSGQDVERGTFSQRHAVFHDQETEKTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLQHISKDQGKFVISNSSLSEFGCLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQL ++ P +YP PEK+ RQHQ
Sbjct: 780  FVASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLSNEDPRIYPAPEKLDRQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQ+ R+FRKPL+ F SKSLLRHP+ARS + E TG++ FK 
Sbjct: 840  DCNMQIAYMTTPSNLFHILRRQMRREFRKPLVIFFSKSLLRHPLARSPIEEFTGNSQFKW 899

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPDP H +++A P+ I R ILCSGQVY AL + R        AI+R+EQ+ PFP+  L 
Sbjct: 900  IIPDPEHGKSIAEPDDIDRVILCSGQVYAALHKYRADKGFKKTAITRIEQLNPFPWQQLK 959

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D Y NA+ ++W QEEPLN GAW++  PRI TL+N +E H+ +    A R PSAS AT
Sbjct: 960  ENLDTYKNAKTIVWCQEEPLNAGAWSFTQPRIETLLNQTEFHDRKHVMYAGRNPSASVAT 1019

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE DLL  A 
Sbjct: 1020 GLKASHTKEEADLLEIAF 1037



>gi|472585435|gb|EMS22989.1| 2-oxoglutarate dehydrogenase E1 component (succinyl-transferring)
            [Rhodosporidium toruloides NP11]
          Length = 1023

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/556 (62%), Positives = 426/556 (76%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDD EAV FVCQLAA+WR  FKKDVVID++CYR++GHNE DQP
Sbjct: 448  YPSDIAKAIDAPIFHVNGDDAEAVTFVCQLAADWRAKFKKDVVIDLICYRRHGHNEGDQP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP+MY+ I  +   L+ Y ++L+K+ TF+ E+ EKHK WVW ++EE+Y KSK+Y PT
Sbjct: 508  MFTQPKMYETIKNKPTTLQIYTEQLVKEKTFSDEETEKHKSWVWGLMEESYEKSKEYKPT 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWLSSSW+GF SP+EL E    A  TG  ++ L+ VG+ I+S P+GFNVH  L RILK
Sbjct: 568  SKEWLSSSWDGFPSPRELKENVLEARATGVDFDTLKGVGKAIASTPEGFNVHRNLQRILK 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R +++ EG+ ID+ TAE LAFG+L LE  HVR+SGQDVERGTFSQRHAV+HDQ  +  +
Sbjct: 628  TRGQSVEEGKNIDYATAEALAFGTLALEKVHVRVSGQDVERGTFSQRHAVIHDQKTDETF 687

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA  ++CNSSLSEFG LGFE GYSLV+P  L++WE QFGDF N +Q +IDQ
Sbjct: 688  TPLRHLSDSQAPVTICNSSLSEFGVLGFELGYSLVDPALLVIWEAQFGDFANGAQIMIDQ 747

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE+KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQLCDDHP++YP  EK ARQ Q
Sbjct: 748  FIAAGERKWLQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLCDDHPFIYPSAEKQARQIQ 807

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQII  T P+N FH LRRQIHRD+RKPLI F SK+LLRHP ARSSL E   +T F+R
Sbjct: 808  DCNMQIIYPTIPSNIFHALRRQIHRDYRKPLIVFFSKNLLRHPQARSSLDEFGPETLFQR 867

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            +I +P PE  A PE++ RHILC+GQVYY LL  RE+  + +VAISR+EQ+ P PYDL++ 
Sbjct: 868  YIAEPEPEGFAKPEEVVRHILCAGQVYYTLLAEREKRGLTNVAISRIEQLSPLPYDLITP 927

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+D+YPNA   W QEEP+N GAWTYV PRI T M  +E H+ R    A R P++S ATG+
Sbjct: 928  HLDRYPNATTYWVQEEPINNGAWTYVQPRIETAMRETENHKTRRCYFAGRGPTSSVATGS 987

Query: 541  KKQHIQEEHDLLSQAL 556
            KKQH  E    L  A 
Sbjct: 988  KKQHALEIQQFLDAAF 1003



>gi|225682695|gb|EEH20979.1| 2-oxoglutarate dehydrogenase E1 [Paracoccidioides brasiliensis Pb03]
          Length = 1072

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/560 (62%), Positives = 438/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 503  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 562

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA+QT  L+KYV KL+K+ TFT EDIE+HKKWVW +L +++ +SKDY P+
Sbjct: 563  AFTQPLMYKRIAEQTNQLDKYVDKLIKEKTFTHEDIEEHKKWVWGMLNDSFDRSKDYQPS 622

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFKSPKELA E  P  PTG   + L+ +G+V+ + P+ F VH  L RIL 
Sbjct: 623  SKEWLTSAWNGFKSPKELATEVLPHPPTGVPADTLKKIGDVLGNVPENFTVHRNLKRILA 682

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 683  NRKKTVEEGENIDWSTAEALAFGTLCAEGHHVRVSGQDVERGTFSQRHAVLHDQENETTY 742

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 743  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 802

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P P+++ RQHQ
Sbjct: 803  FIASGETKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPSPDRIDRQHQ 862

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L+   GD+ F+ 
Sbjct: 863  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSSFIGDSHFQW 922

Query: 421  FIPDPHPETLA--SPEKITRHILCSGQVYYALLRAREQNK-MDHVAISRLEQICPFPYDL 477
             IPDP   T A  +P+ I R ILCSGQVY AL + R  N+ + + AI+R+EQ+ PFP+ +
Sbjct: 923  IIPDPEHATGAINAPKSIERVILCSGQVYAALHKHRAANESLKNTAITRIEQMHPFPWQM 982

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++W QEEPLN GAW+Y+ PRI TL+N ++ H  R    A R PSAS 
Sbjct: 983  LKENLDGYPNAKNIVWCQEEPLNAGAWSYMQPRIETLLNETKHHNRRHVLYAGRNPSASV 1042

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATGNK  H++EE +LL+ A 
Sbjct: 1043 ATGNKGSHLKEEEELLTDAF 1062



>gi|346319577|gb|EGX89178.1| 2-oxoglutarate dehydrogenase E1 component [Cordyceps militaris CM01]
          Length = 1048

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 438/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 479  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 538

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I  Q P ++ YV+KLLK+GTFTKEDI++HK+WVW +LEE++ KSKDY PT
Sbjct: 539  SFTQPLMYKRINTQVPQIDVYVEKLLKEGTFTKEDIDEHKQWVWGMLEESFAKSKDYTPT 598

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PT    + L+H+G++I S P+GF VH  L RI+ 
Sbjct: 599  SKEWTTSAWNGFKSPKELATEILPHNPTNVDKKTLEHIGQIIGSAPEGFTVHRNLKRIIN 658

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ +G HVR+SGQDVERGTFSQRHAV HDQ NE  Y
Sbjct: 659  NRTKSVVEGKNIDFPTAEALAFGSLVTDGYHVRVSGQDVERGTFSQRHAVFHDQENEATY 718

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 719  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 778

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSS R+ER+LQL ++ P V+P  +K+ARQHQ
Sbjct: 779  FIASGEVKWMQRSGLVMSLPHGYDGQGPEHSSARIERYLQLSNEDPRVFPNEDKLARQHQ 838

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI   TTPAN FH LRRQ+ R FRKPLI F SKSLLRHP+ARSSL E T  D  F+
Sbjct: 839  DCNMQIAYMTTPANLFHALRRQMERQFRKPLIIFFSKSLLRHPLARSSLEEFTAEDAGFQ 898

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +T  + SPE+I R ILC+GQV+ AL + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 899  WIIPDPEHQTGAIKSPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQMNPFPWQQ 958

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 959  LKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNETKYHDRKHVMYAGRNPSASV 1018

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE +LL +A 
Sbjct: 1019 ATGLKHVHSKEEKELLERAF 1038



>gi|346976937|gb|EGY20389.1| 2-oxoglutarate dehydrogenase E1 [Verticillium dahliae VdLs.17]
          Length = 1047

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 431/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV++D+VCYRK+GHNE DQP
Sbjct: 479  YCTDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIVDLVCYRKHGHNETDQP 538

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I      +  YV KL+KDGTFTKED+E+HK+WVW +LEE++ KSK+Y PT
Sbjct: 539  SFTQPLMYKRIQSHKSQIAIYVDKLIKDGTFTKEDVEEHKQWVWGMLEESFTKSKEYQPT 598

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T    + L+H+GEVI S  +GFNVH  L RIL 
Sbjct: 599  SKEWTTSAWNGFKSPKELATEVLPHNTTSVDKKTLEHIGEVIGSTSEGFNVHRNLKRILS 658

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFS+RHAV HDQ  E  Y
Sbjct: 659  NRTKSVVEGKNIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSERHAVFHDQETEDTY 718

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL ++   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 719  TPLQNISKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 778

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 779  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSPEKLERQHQ 838

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTPAN FH LRRQ+HR FRKPLI F SKSLLRHP+ARS++ E   ++ F+ 
Sbjct: 839  DCNMQIAYFTTPANLFHALRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEEFVDESHFQW 898

Query: 421  FIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  E  T+  PE+I R +LC+GQV+ AL + R  NK+D  A +R+EQ+ PFP+  L
Sbjct: 899  IIPDPEHEAGTIKKPEEIKRVVLCTGQVWAALHKYRADNKIDDTAFTRIEQLNPFPWQQL 958

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNAE ++WAQEEPLN GAW++  PRI TL+N +E H  +    A R PSAS A
Sbjct: 959  KENLDQYPNAETIVWAQEEPLNAGAWSFTQPRIETLLNQTEHHNRKHVMYAGRNPSASVA 1018

Query: 538  TGNKKQHIQEEHDLLSQAL 556
             G K  H +EE + L  A 
Sbjct: 1019 AGTKGLHTKEEQEFLEMAF 1037



>gi|302418878|ref|XP_003007270.1| 2-oxoglutarate dehydrogenase E1 [Verticillium albo-atrum VaMs.102]
 gi|261354872|gb|EEY17300.1| 2-oxoglutarate dehydrogenase E1 [Verticillium albo-atrum VaMs.102]
          Length = 920

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 430/559 (76%), Gaps = 3/559 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV++D+VCYRK+GHNE DQP
Sbjct: 352 YCTDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIVDLVCYRKHGHNETDQP 411

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++I      +  YV KL+KDGTFTKED+E+HK+WVW +LEE++ KSK+Y PT
Sbjct: 412 SFTQPLMYKRIQSHKSQIAIYVDKLIKDGTFTKEDVEEHKQWVWGMLEESFTKSKEYQPT 471

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           S+EW +S+WNGFKSPKELA E  P   T    + L+H+GEVI S  +GFNVH  L RIL 
Sbjct: 472 SKEWTTSAWNGFKSPKELATEVLPHNTTSVDKKTLEHIGEVIGSTSEGFNVHRNLKRILS 531

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K++  G+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 532 NRTKSVVGGENIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTY 591

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL ++   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 592 TPLQNISKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 651

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 652 FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSPEKLERQHQ 711

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQI   TTPAN FH LRRQ+HR FRKPLI F SKSLLRHP+ARS++ E   ++ F+ 
Sbjct: 712 DCNMQIAYFTTPANLFHALRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEEFVDESHFQW 771

Query: 421 FIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
            IPDP  E  T+  PE+I R +LC+GQV+ AL + R  NK+D  A +R+EQ+ PFP+  L
Sbjct: 772 IIPDPEHEAGTIKKPEEIKRVVLCTGQVWAALHKYRADNKIDDTAFTRIEQLNPFPWQQL 831

Query: 479 SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
            +++D+YPNAE ++WAQEEPLN GAW++  PRI TL+N +E H  +    A R PSAS A
Sbjct: 832 KENLDQYPNAETIVWAQEEPLNAGAWSFTQPRIETLLNQTEHHNRKHVMYAGRNPSASVA 891

Query: 538 TGNKKQHIQEEHDLLSQAL 556
            G K  H +EE + L  A 
Sbjct: 892 AGTKGLHTKEEQEFLEMAF 910



>gi|295669416|ref|XP_002795256.1| 2-oxoglutarate dehydrogenase E1 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285190|gb|EEH40756.1| 2-oxoglutarate dehydrogenase E1 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 1072

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/560 (62%), Positives = 437/560 (78%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 503  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 562

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA+QT  L+KYV KL+K+ TFT EDIE+HKKWVW +L +++ +SKDY P+
Sbjct: 563  AFTQPLMYKRIAEQTNQLDKYVDKLIKEKTFTHEDIEEHKKWVWGMLNDSFDRSKDYQPS 622

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFKSPKELA E  P  PTG   + L+ +G+V+ + P+ F VH  L RIL 
Sbjct: 623  SKEWLTSAWNGFKSPKELATEVLPHPPTGVPADTLKKIGDVLGNVPENFTVHRNLKRILA 682

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 683  NRKKTVEEGENIDWSTAEALAFGTLCAEGHHVRVSGQDVERGTFSQRHAVLHDQENETTY 742

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 743  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 802

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P P+++ RQHQ
Sbjct: 803  FIASGETKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPSPDRIDRQHQ 862

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L+   GD+ F+ 
Sbjct: 863  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSSFIGDSHFQW 922

Query: 421  FIPDPHPETLA--SPEKITRHILCSGQVYYALLRAREQN-KMDHVAISRLEQICPFPYDL 477
             IPDP   T A  +P+ I R ILCSGQVY AL + R  N  + + AI+R+EQ+ PFP+ +
Sbjct: 923  IIPDPDHATGAINAPKSIERVILCSGQVYAALHKHRAANDSLKNTAITRIEQMHPFPWQM 982

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++W QEEPLN GAW+Y+ PRI TL+N ++ H  R    A R PSAS 
Sbjct: 983  LKENLDGYPNAKNIVWCQEEPLNAGAWSYMQPRIETLLNETKHHNRRHVLYAGRNPSASV 1042

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATGNK  H++EE +LL+ A 
Sbjct: 1043 ATGNKGSHLKEEEELLADAF 1062



>gi|400595073|gb|EJP62883.1| oxoglutarate dehydrogenase [Beauveria bassiana ARSEF 2860]
          Length = 1047

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 436/560 (77%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 478  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 537

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I  Q P ++ YV KLLK+GTFTKEDI++HK+WVW +LEE++ KSKDY  T
Sbjct: 538  SFTQPLMYKRINSQVPQIDVYVDKLLKEGTFTKEDIDEHKQWVWGMLEESFAKSKDYTAT 597

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PT    + ++H+GEVI S P+GF VH  L RIL 
Sbjct: 598  SKEWTTSAWNGFKSPKELATEILPHNPTNVDKKTIEHIGEVIGSAPEGFTVHRNLKRILN 657

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ +G HVR+SGQDVERGTFSQRHAV HDQ NE  Y
Sbjct: 658  NRTKSVVEGKNIDFPTAEALAFGSLVTDGYHVRVSGQDVERGTFSQRHAVFHDQENEATY 717

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 718  TPLQHISKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 777

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QR+G+V+ LPHGYDGQGPEHSS R+ER+LQL ++ P V+P  +K+ARQHQ
Sbjct: 778  FVASGEVKWMQRSGIVMSLPHGYDGQGPEHSSARIERYLQLSNEDPRVFPAKDKLARQHQ 837

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI   TTPAN FHVLRRQ+ R FRKPLI F SKSLLRHP+ARSSL E T  D  F+
Sbjct: 838  DCNMQIAYMTTPANLFHVLRRQMERQFRKPLIIFFSKSLLRHPLARSSLEEFTAEDAGFQ 897

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +T  + SPE+I R ILC+GQV+ AL + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 898  WIIPDPEHQTGAIKSPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQLNPFPWQQ 957

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 958  LKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTKYHDRKHVMYAGRSPSASV 1017

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE +LL  A 
Sbjct: 1018 ATGLKHVHSKEEKELLEMAF 1037



>gi|407919803|gb|EKG13026.1| Dehydrogenase E1 component [Macrophomina phaseolina MS6]
          Length = 1048

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/559 (63%), Positives = 436/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA NFVCQLAA++R TFKKDVVID+VCYRK GHNE DQP
Sbjct: 480  YCSDLAKAIDAPVFHVNGDDVEAFNFVCQLAADYRATFKKDVVIDMVCYRKQGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++IA+Q   L+KYV KLL++GTFTKEDI++HK WVW +LEE++ +SKDY PT
Sbjct: 540  FFTQPLMYKRIAQQKLALDKYVDKLLQEGTFTKEDIDEHKAWVWGMLEESFARSKDYQPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+WNGFKSPKELA E  P  PT    E+L+ V + I + P+GFNVH  L RIL+
Sbjct: 600  AKEWLTSAWNGFKSPKELATEVLPHLPTAVDSEILKQVADKIGNPPEGFNVHRNLKRILQ 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R+K ++EG+ ID  TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 660  NRSKTVSEGKNIDMATAEALAFGTLCLEGHHVRVSGQDVERGTFSQRHAVLHDQENEDTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLAKLSEDQGSFVISNSSLSEFGVLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P  +K+ RQHQ
Sbjct: 780  FIASGETKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSSDKLERQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T P+N FH+LRRQ++R FRKPLI F SKSLLRHPMARS++ E TGD+ F+ 
Sbjct: 840  DCNMQVAYLTKPSNMFHILRRQMNRQFRKPLILFFSKSLLRHPMARSNIEEFTGDSHFEW 899

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +PDP  E   +A  E+I R ILCSGQV+ AL+  RE++ + + AI+R+EQ+ PFP+  L
Sbjct: 900  LVPDPAHENGDIAPKEEIERVILCSGQVWAALVAHREEHGLKNTAITRIEQLHPFPWAQL 959

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ ++W QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 960  KDNLDSYPNAKNIVWCQEEPLNAGAWSFTQPRIETLLNETEHHNRRHVMYAGRNPSASVA 1019

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1020 TGLKAVHKKEEKDLLEMAF 1038



>gi|156054172|ref|XP_001593012.1| hypothetical protein SS1G_05934 [Sclerotinia sclerotiorum 1980]
 gi|154703714|gb|EDO03453.1| hypothetical protein SS1G_05934 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 1048

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/558 (61%), Positives = 433/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLAA+WR  F++DVVID+VCYRK+GHNE DQP
Sbjct: 481  YCTDIAKSIDAPVFHVNADDVEAVNYVCQLAADWRAEFQRDVVIDLVCYRKHGHNETDQP 540

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I K    ++ Y+ +LLKDG+FTK+DI++H+KWVW +LE+++ KSKDY PT
Sbjct: 541  SFTQPLMYKRIQKHKSQIDIYIDQLLKDGSFTKDDIDEHRKWVWGMLEDSFAKSKDYQPT 600

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG     L+H+ E I SYP+GFNVH  L RIL 
Sbjct: 601  SKEWTTSAWNGFKSPKELATEVLPHNPTGVPGHTLEHIAETIGSYPEGFNVHRNLKRILT 660

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EGQ IDW TAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 661  NRIKTVSEGQNIDWSTAEALAFGTLVGEGHHVRVSGQDVERGTFSQRHAVFHDQETEKTY 720

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 721  TPLQHISKDQGKFVISNSSLSEFGCLGFEYGYSLSSPDALVMWEAQFGDFANNAQCIIDQ 780

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 781  FVASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRVFPSPEKLDRQHQ 840

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 841  DCNMQIAYMTSPSNLFHILRRQMNRQFRKPLIIFFSKSLLRHPIARSSIDEFTGDSQFRW 900

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H +++  PE I R ILC+GQVY AL + R  N +   A +R+EQ+ PFP+  L 
Sbjct: 901  IIPDAEHGKSINEPENIERVILCTGQVYAALSKYRADNNIKDTAFTRIEQLNPFPWQQLK 960

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA+ ++W QEEPLN GAW++  PRI TL+N+++ H+ +    A R PSAS AT
Sbjct: 961  ENLDMYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTQYHDRKHVMYAGRDPSASVAT 1020

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE  LL  A 
Sbjct: 1021 GLKASHTKEEAKLLETAF 1038



>gi|443897124|dbj|GAC74466.1| 2-oxoglutarate dehydrogenase, E1 subunit [Pseudozyma antarctica T-34]
          Length = 1039

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/560 (63%), Positives = 427/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAV FV QLAA+WR TFKKDVVID+VCYR++GHNE DQP
Sbjct: 469  YPSDIAKSIDAPIFHVNGDDVEAVTFVSQLAADWRATFKKDVVIDLVCYRRHGHNETDQP 528

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY  IAKQ P L KY  +L+++G+FTK DIE+H+KWVW +LEE + KSK+Y P 
Sbjct: 529  SFTQPRMYAAIAKQDPTLTKYAARLVEEGSFTKSDIEEHQKWVWGMLEEAFDKSKNYRPE 588

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSS+W GF SPKEL E+      TG   E L+H+G+ +SSYP+ F VH  L RILK
Sbjct: 589  EREWLSSAWEGFPSPKELREQILDHKDTGVKEETLKHIGKTVSSYPEDFTVHRNLGRILK 648

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EG+ ID  T E LAFGSL LEG +VRLSGQDVERGTFSQRH+VLHDQ NE  Y
Sbjct: 649  TRLKTVDEGKNIDMSTGEALAFGSLALEGNYVRLSGQDVERGTFSQRHSVLHDQENEGTY 708

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQA F VCNSSLSEFG +GFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 709  TPLQHVGEGQAPFVVCNSSLSEFGCMGFELGFSLVSPQNLTIWEAQFGDFANNAQCIIDQ 768

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ +P PEK  RQHQ
Sbjct: 769  FIASGERKWLQRTGLVLNLPHGYDGQGPEHSSARIERFLQLCDDHPFRFPTPEKSNRQHQ 828

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPANYFHVLRRQ+HR+FRKPL+ F SKSLLRHP ARS+L +    T F+R
Sbjct: 829  DSNMAVVYCTTPANYFHVLRRQVHREFRKPLVNFFSKSLLRHPEARSNLEDFLPGTGFQR 888

Query: 421  FIPDPHP----ETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            FIP+PH     + L +P++I RHIL  GQ Y+ALL  R +N +  VAISR+EQ+ P  Y+
Sbjct: 889  FIPEPHANEGKDELVAPDQIKRHILTFGQTYFALLNHRRENNIKDVAISRIEQLSPLHYE 948

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q +DKYPNA+L++ QEEPLN GAW+YV PR+RT   H++ H+      A+R PS+S 
Sbjct: 949  AIVQALDKYPNADLVFCQEEPLNNGAWSYVQPRLRTACRHTQHHKNDIVILASRPPSSSV 1008

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+K  H  E    L  A 
Sbjct: 1009 ATGSKVAHKAEVEAYLRDAF 1028



>gi|449302313|gb|EMC98322.1| hypothetical protein BAUCODRAFT_32342 [Baudoinia compniacensis UAMH
            10762]
          Length = 1060

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/564 (62%), Positives = 438/564 (77%), Gaps = 9/564 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK V+APIFHVNGDDVEAVN+ CQLAA+WR  FKKDVVID+VCYR+ GHNE DQP
Sbjct: 486  YCSDIAKFVDAPIFHVNGDDVEAVNYACQLAADWRAEFKKDVVIDMVCYRRQGHNETDQP 545

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I +Q P+++KY ++LL + TFTKEDI++HKKWVW +LEE++ +SKDY PT
Sbjct: 546  SFTQPLMYKRINEQPPVIDKYTKQLLDNHTFTKEDIDEHKKWVWGMLEESFTRSKDYQPT 605

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+WNGFKSPKELA E  P  PT    E L+H+G+VI   P+GFNVH  L RIL 
Sbjct: 606  AKEWLTSAWNGFKSPKELATEVLPHLPTAVDAEQLKHIGKVIGEPPEGFNVHKNLKRILA 665

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  T E LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 666  NRTKTVEEGKNIDMSTGEALAFGTLCSEGHHVRVSGQDVERGTFSQRHAVLHDQESEATY 725

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q  F + NSSLSEFGTLGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 726  TPLKHVSKDQGSFVISNSSLSEFGTLGFEYGYSLSSPSALVIWEAQFGDFANNAQCIIDQ 785

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQLC++ P ++P PEK+ RQHQ
Sbjct: 786  FIASGEVKWLQRSGLVMNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPSPEKLDRQHQ 845

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI+N TTP+N FH+ RRQ++R FRKPLI+F SK+LLRHP+ARS++ E TG++ F+ 
Sbjct: 846  DCNMQIVNCTTPSNSFHIFRRQMNRQFRKPLISFFSKNLLRHPLARSNIDEFTGESHFQW 905

Query: 421  FIPDP-HPETLAS-------PEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICP 472
             IPDP H  +LA         E+I R ILC+GQV+ AL + R QN +   AI+R+EQ+ P
Sbjct: 906  IIPDPAHDGSLAGYDFRINPHEEIKRVILCTGQVFTALFKYRAQNNLKDAAITRIEQLHP 965

Query: 473  FPYDLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRL 531
            FP+  L +++D YPNAE +++ QEEPLN G W++  PRI TL+NH++ H  +    A R 
Sbjct: 966  FPWAQLQENLDSYPNAETIVYCQEEPLNAGGWSFAQPRIETLLNHTKHHHRKHVMYAGRG 1025

Query: 532  PSASPATGNKKQHIQEEHDLLSQA 555
            PSAS ATG K  H++EE +LL  A
Sbjct: 1026 PSASVATGLKSTHLKEEQELLDTA 1049



>gi|336468640|gb|EGO56803.1| 2-oxoglutarate dehydrogenase E1 component mitochondrial precursor
            [Neurospora tetrasperma FGSC 2508]
 gi|350289082|gb|EGZ70307.1| 2-oxoglutarate dehydrogenase E1 component mitochondrial precursor
            [Neurospora tetrasperma FGSC 2509]
          Length = 1043

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 437/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLA++WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 475  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++I++++P ++ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 535  AFTQPLMYKRISEKSPQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WN FKSPKELA E  P  PT      L+H+G VI S P+GF+ H  L RIL 
Sbjct: 595  SKEWTTSAWNNFKSPKELASEVLPHMPTAVDKPTLEHIGTVIGSTPEGFHAHRNLKRILT 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+GIDW TAE LAFG+L+ EG HVR++GQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 655  NRTKSVVEGKGIDWATAEALAFGTLVKEGHHVRITGQDVERGTFSQRHAVFHDQETEDTY 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PL  +   QA F + NSSLSE+G LGFEYGYSL +PN   +WE QFGDF N +Q IIDQ
Sbjct: 715  IPLQHISEDQAPFVISNSSLSEYGILGFEYGYSLQDPNGFNMWEAQFGDFANTAQVIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QRTGLV+ LPHGYDGQGPEHSS R+ERFL LC++ P +YP PEK+ RQHQ
Sbjct: 775  FLASGESKWMQRTGLVMSLPHGYDGQGPEHSSARMERFLSLCNEDPRIYPSPEKLERQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQ+ R FRKPL+ F SK+LLRHP+ARS + E T D  F+ 
Sbjct: 835  DCNMQIAYMTSPANLFHILRRQLKRQFRKPLVIFFSKALLRHPVARSDIEEFTDDAHFRW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +PD   +T  + +PE+I R ILC+GQVY ALL+ R+ NK+D+VA +R+EQ+ PFP++ L
Sbjct: 895  ILPDSAHQTGEIKAPEEIERVILCTGQVYAALLKHRQDNKIDNVAFTRIEQLHPFPWEQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++WAQEEPLN GAW+Y  PR+ TL+NH++ H+ +    A R PSAS A
Sbjct: 955  RENLDQYPNAKTIVWAQEEPLNAGAWSYTQPRLETLLNHTKHHDRKHVMYAGRAPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE +LL  A 
Sbjct: 1015 TGKKSSHLKEEKELLEMAF 1033



>gi|429849455|gb|ELA24845.1| alpha-ketoglutarate dehydrogenase complex subunit [Colletotrichum
            gloeosporioides Nara gc5]
          Length = 1042

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/559 (62%), Positives = 431/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV+ID+VCYRK+GHNE DQP
Sbjct: 474  YCTDIAKAIDAPVFHVNADDVEAVNFVCQIAADWRAEFQQDVIIDLVCYRKHGHNETDQP 533

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I      +  Y+ KLL+DG+FTKEDI++HK+WVW +LEE++ KSKDY PT
Sbjct: 534  SFTQPLMYKRIQDHDSQIGIYINKLLEDGSFTKEDIDEHKQWVWGMLEESFSKSKDYQPT 593

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T    + L+H+G VI S P GF  H  L RIL 
Sbjct: 594  SKEWTTSAWNGFKSPKELATEVLPHNETSVDGKTLEHIGTVIGSTPDGFQAHRNLKRILS 653

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EGQ ID PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 654  NRTKSVVEGQNIDMPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQATEDTH 713

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 714  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 773

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLVV LPHGYDGQGPEHSSGRLER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 774  FIASGEAKWMQRTGLVVSLPHGYDGQGPEHSSGRLERWLQLCNEDPRVFPSPEKLERQHQ 833

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI   T+P+N FHVLRRQ+HR FRKPLI F SK+LLRHP+ARS++ E TGD+ F+ 
Sbjct: 834  DCNIQIAYMTSPSNLFHVLRRQMHRQFRKPLIIFFSKALLRHPLARSNIEEFTGDSHFRW 893

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ET  + S E+I R ILCSGQV+  L + R  NK+D+VA +RLEQ+ PFP+  L
Sbjct: 894  IIPDPEHETGAIKSKEEIDRVILCSGQVWATLSKYRADNKIDNVAFTRLEQLNPFPWQQL 953

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++W QEEPLN GAW++  PR+ TL+N +E H+ +    A R PSAS A
Sbjct: 954  KENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRLETLLNQTEHHDRKHVMYAGRGPSASVA 1013

Query: 538  TGNKKQHIQEEHDLLSQAL 556
             GNK  H +EE + L  A 
Sbjct: 1014 AGNKGLHNKEEQEFLEMAF 1032



>gi|472241505|gb|EMR86223.1| putative oxoglutarate dehydrogenase protein [Botryotinia fuckeliana
            BcDW1]
          Length = 1048

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/558 (61%), Positives = 432/558 (77%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLAA+WR  F++DVVID+VCYRK+GHNE DQP
Sbjct: 481  YCTDIAKSIDAPVFHVNADDVEAVNYVCQLAADWRAEFQRDVVIDLVCYRKHGHNETDQP 540

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I K    ++ Y+ +LLKDG+FTKEDI++H+KWVW +LEE++ KSKDY PT
Sbjct: 541  SFTQPLMYKRIQKHKSQIDIYIDQLLKDGSFTKEDIDEHRKWVWGMLEESFAKSKDYQPT 600

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG     L+H+   I SYP+ FNVH  L RIL 
Sbjct: 601  SKEWTTSAWNGFKSPKELATEVLPHNPTGVPAHTLEHIATTIGSYPEDFNVHRNLKRILT 660

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K ++EGQ IDW TAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV HDQ NE  Y
Sbjct: 661  NRIKTVSEGQNIDWSTAEALAFGTLVGEGHHVRVSGQDVERGTFSQRHAVFHDQENEKTY 720

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF V NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 721  TPLQHISKDQGKFVVSNSSLSEFGCLGFEYGYSLSSPDALVMWEAQFGDFANNAQCIIDQ 780

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P PEK+ RQHQ
Sbjct: 781  FVASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPEKLERQHQ 840

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARS + E TGD+ F+ 
Sbjct: 841  DCNMQIAYMTSPSNLFHILRRQMNRQFRKPLIIFFSKSLLRHPIARSPIEEFTGDSQFRW 900

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H +++  PE+I R ILC+GQVY AL + R  N +   A +R+EQ+ PFP+  L 
Sbjct: 901  IIPDAEHGKSINEPEQIERVILCTGQVYAALSKYRADNNIKDTAFTRIEQLNPFPWQQLK 960

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA+ ++W QEEPLN GAW++  PRI TL+N+++ H+ +    A R PSAS AT
Sbjct: 961  ENLDMYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTQYHDRKHVMYAGRDPSASVAT 1020

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H +EE  LL  A 
Sbjct: 1021 GLKASHTKEEAKLLETAF 1038



>gi|310796732|gb|EFQ32193.1| oxoglutarate dehydrogenase [Glomerella graminicola M1.001]
          Length = 1043

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/559 (62%), Positives = 436/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV+ID+VCYRK+GHNE DQP
Sbjct: 475  YCTDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIIDLVCYRKHGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P +  YV KLL+DG+FTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 535  SFTQPLMYKRIQDHEPQISIYVNKLLEDGSFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P + T    + L H+GEVI S P+ F+VH  L RIL 
Sbjct: 595  SKEWTTSAWNGFKSPKELATEVLPHHETSVDRQTLNHLGEVIGSTPEDFHVHRNLKRILS 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 655  NRTKSVIEGKNIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTH 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 715  TPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLVV LPHGYDGQGPEHSSGRLER+LQL ++ P V+P PEK+ RQHQ
Sbjct: 775  FIASGEAKWMQRTGLVVSLPHGYDGQGPEHSSGRLERWLQLSNEDPRVFPSPEKLERQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  T+P+N FHVLRRQ+HR FRKPLI F SK+LLRHP+ARS++ E T D+ F+ 
Sbjct: 835  DCNMQVVYMTSPSNLFHVLRRQMHRQFRKPLIIFFSKALLRHPLARSNIEEFTDDSHFRW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ET  +   E+I R ILCSGQV+  L + R  NK+D+VA++RLEQ+ PFP+  L
Sbjct: 895  IIPDPEHETGAIKPKEEIDRVILCSGQVWATLSKYRADNKIDNVALTRLEQLNPFPWQQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++W QEEPLN GAW++  PR+ TL+N++E H+ +    A R PSAS A
Sbjct: 955  KENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRLETLLNNTEHHDRKHVMYAGRGPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
             GNK  H +EE + L  A 
Sbjct: 1015 AGNKGLHNKEEQEFLEMAF 1033



>gi|440638797|gb|ELR08716.1| oxoglutarate dehydrogenase, E1 component [Geomyces destructans
            20631-21]
          Length = 1050

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/558 (62%), Positives = 425/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVN+VCQLAA+WR  F+ DVVID+VCYRK+GHNE DQP
Sbjct: 483  YCTDIAKAIDAPVFHVNADDVEAVNYVCQLAADWRAEFRSDVVIDLVCYRKHGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I    P ++ YV +LLKDGTFTK+DI++HKKWVW +LEE++ KSKDY PT
Sbjct: 543  SFTQPLMYKRIQDHEPQIDIYVSQLLKDGTFTKDDIDEHKKWVWGMLEESFAKSKDYQPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PTG   E L+H+G  I + P  FNVH  L RIL 
Sbjct: 603  SKEWTTSAWNGFKSPKELATEVLPHPPTGVKKETLEHIGTTIGTAPDEFNVHRNLKRILA 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +NEGQ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ NE  +
Sbjct: 663  NRVKTVNEGQNIDWSTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQENEATF 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TPLQHVSKDQGKFVISNSSLSEFGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQL ++ P VYP PEK+ R HQ
Sbjct: 783  FIASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLSNEEPRVYPSPEKLDRLHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARSS+ E  GDT F+ 
Sbjct: 843  DCNMQIAYMTSPSNLFHILRRQMNRQFRKPLIIFFSKSLLRHPLARSSIDEFVGDTQFRP 902

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IP+  H      PE I R +LC+GQVY AL + R    +   AI+R+EQ+ PFP+  + 
Sbjct: 903  IIPETEHGGAAVDPEDIKRVVLCTGQVYAALHKHRLDKGITDTAITRIEQLNPFPWQQVK 962

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNAE ++W QEEPLN GAWT+  PRI T++N +E H  +    A R PSAS AT
Sbjct: 963  ENLDSYPNAETIVWCQEEPLNAGAWTFTQPRIETILNVTEHHNRKHVMYAGRNPSASVAT 1022

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  H++EE +LL  A 
Sbjct: 1023 GLKASHLKEESELLEMAF 1040



>gi|388855381|emb|CCF51045.1| probable KGD1-alpha-ketoglutarate dehydrogenase [Ustilago hordei]
          Length = 1041

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/560 (63%), Positives = 426/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAV FV QLAA+WR TFKKDVVID+VCYR++GHNE DQP
Sbjct: 471  YPSDIAKSIDAPIFHVNGDDVEAVTFVSQLAADWRATFKKDVVIDLVCYRRHGHNETDQP 530

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY  IAKQ P L KY  +L+++G+FTK DIE+H+KWVW++LEE + KSK Y P 
Sbjct: 531  SFTQPRMYAAIAKQDPTLTKYAARLVEEGSFTKSDIEEHQKWVWSMLEEAFDKSKSYKPE 590

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSS+W GF SPKEL E+      TG   E L+H+G+ +SSYP+ F VH  L RILK
Sbjct: 591  EREWLSSAWEGFPSPKELREQILDHKDTGVKEETLKHIGKTVSSYPQDFTVHRNLGRILK 650

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  T E LAFGSL LEG +VRLSGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 651  TRFKTVEEGKNIDMSTGEALAFGSLALEGNYVRLSGQDVERGTFSQRHAVLHDQENEGTY 710

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQA F VCNSSLSEFG +GFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 711  TPLQHVGEGQAPFVVCNSSLSEFGCMGFELGFSLVSPQNLTIWEAQFGDFANNAQCIIDQ 770

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ +P PEK  RQHQ
Sbjct: 771  FIASGERKWLQRTGLVLNLPHGYDGQGPEHSSARIERFLQLCDDHPFKFPTPEKSNRQHQ 830

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPANYFHVLRRQ+HRDFRKPL+ F SKSLLRHP ARS+L ++   T F+R
Sbjct: 831  DSNMAVVYCTTPANYFHVLRRQVHRDFRKPLVNFFSKSLLRHPEARSNLEDLLPGTGFQR 890

Query: 421  FIPDPHP----ETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            FIPDPH     + L   ++I RHIL  GQ Y+ LL+ R +N +  VAISR+EQ+ P  Y+
Sbjct: 891  FIPDPHATDGKDQLVPADQIKRHILTFGQTYFELLKHRRENNIKDVAISRIEQLSPLHYE 950

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q +DKYPNA+L++ QEEPLN GAW+Y+ PR+RT   H++ H+      A+R PS+S 
Sbjct: 951  AVVQALDKYPNADLVFCQEEPLNNGAWSYLQPRLRTACRHTQHHKNDIVILASRPPSSSV 1010

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+K  H  E    LS A 
Sbjct: 1011 ATGSKVAHKAEVEAYLSDAF 1030



>gi|388583356|gb|EIM23658.1| 2-oxoglutarate dehydrogenase complex E1 component mitochondrial
           precursor [Wallemia sebi CBS 633.66]
          Length = 963

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/552 (61%), Positives = 436/552 (78%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y +D+AK ++APIFHVN DD EAV F+CQLAA+WR  +KKDVVID+V YR++GHNE DQP
Sbjct: 406 YPTDIAKFIDAPIFHVNADDPEAVVFICQLAADWRAKWKKDVVIDLVGYRRHGHNETDQP 465

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQPRMYQ I K+  IL+ YV++L  +GTFTK+D ++HKKWVW +LE+++  S++Y P+
Sbjct: 466 SFTQPRMYQAIGKKQNILDLYVERLQNEGTFTKQDTDEHKKWVWQMLEKSFQNSREYKPS 525

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +EWLSSSW+GF +P EL++   P   TG   + L  + + + + P+GF +H  L R+LK
Sbjct: 526 PKEWLSSSWDGFPTPSELSQLVLPVNATGVREDKLVEIAKALGNVPEGFTIHRNLNRVLK 585

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + +G+GIDW TAE LA G+L +EG HVRLSGQDVERGTFSQRH+++HDQ     Y
Sbjct: 586 NREKMVQDGKGIDWSTAESLAMGALAMEGNHVRLSGQDVERGTFSQRHSIIHDQKTGEAY 645

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PLN L   QA  ++ NS+LSEFG LGFE GYSLV+P+SL +WE QFGDF NN+QC+IDQ
Sbjct: 646 MPLNHLGEKQAPVTIVNSTLSEFGVLGFELGYSLVSPDSLTIWEAQFGDFANNAQCMIDQ 705

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FI+SGE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDD+P V+P  E+  RQHQ
Sbjct: 706 FISSGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDNPLVFPSEEQQIRQHQ 765

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ++  TTPANYFHVLRRQ+HR FRKPLI F +KSLLRHPMARS L+E+ GDT+F+R
Sbjct: 766 DCNMQVVYPTTPANYFHVLRRQVHRGFRKPLILFFAKSLLRHPMARSDLSELIGDTSFQR 825

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           ++PDPHPE L +PE++ RHILCSGQVY+ L++ R++N +  V ISRLEQ+ PFPYD+L  
Sbjct: 826 YLPDPHPEHLVAPEQVRRHILCSGQVYHTLIKHRDENDIKDVVISRLEQLAPFPYDMLKP 885

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNA+L W QEEP N GAW+YV+ R+ TL++++E H+G+    A R PS+S ATG+
Sbjct: 886 HLDKYPNADLYWCQEEPANNGAWSYVSQRLITLVDNTECHKGKMPMYAGRPPSSSVATGS 945

Query: 541 KKQHIQEEHDLL 552
           K  H  E  + L
Sbjct: 946 KAAHKAEIENFL 957



>gi|399169329|emb|CCE29847.1| probable oxoglutarate dehydrogenase precursor [Claviceps purpurea
            20.1]
          Length = 1038

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 434/560 (77%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRKYGHNE DQP
Sbjct: 469  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKYGHNETDQP 528

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLL++GTFTKEDI++HK+WVW +LEE++ KSKDY PT
Sbjct: 529  SFTQPLMYKKIQQKEPQIDVYVNKLLEEGTFTKEDIDEHKQWVWGMLEESFDKSKDYTPT 588

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E    + TG     L HVGEVI   P+ F +H  L RIL 
Sbjct: 589  SKEWTTSAWNGFKSPKELATEVLSHHSTGVDKTTLDHVGEVIGGAPQDFQIHRNLKRILA 648

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV HDQ NE  +
Sbjct: 649  NRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQENEKTH 708

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 709  TPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLQSPNALVMWEAQFGDFANNAQCIIDQ 768

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P ++P  EK+ RQHQ
Sbjct: 769  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPTAEKLVRQHQ 828

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTTFK 419
            DCNMQI   TTPAN FHVLRRQ+HR FRKPLI F SKSLLRHP+ARS++ +  G D  F+
Sbjct: 829  DCNMQIAYMTTPANLFHVLRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEDFAGPDAGFQ 888

Query: 420  RFIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  +  T+ SPE+I R ILC+GQV+  L + R  NK+D+VA +R+EQ+ PFP+  
Sbjct: 889  WIIPDPEHQAGTIKSPEQIDRVILCTGQVWATLHKYRADNKIDNVAFTRIEQLNPFPWQQ 948

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++WAQEEPLN GAW++V PRI TL+N ++ H+ +    A R PSAS 
Sbjct: 949  LKENLDMYPNAKTIVWAQEEPLNAGAWSFVQPRIETLLNQTKHHDRKHVMYAGRNPSASV 1008

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H  EE DLL  A 
Sbjct: 1009 ATGLKHVHKTEEQDLLEMAF 1028



>gi|505757660|gb|EOR01781.1| hypothetical protein J056_004017 [Wallemia ichthyophaga EXF-994]
          Length = 1019

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/556 (60%), Positives = 438/556 (78%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y +DVAK ++APIFHVN DD EAV F+CQLAA+WR  +KKD+VID+VCYR++GHNE DQP
Sbjct: 462  YPTDVAKFIDAPIFHVNADDPEAVVFICQLAADWRAKWKKDIVIDLVCYRRHGHNETDQP 521

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQPRMYQ I+K+  IL+ YV  L  +GTFTK+D ++HKKWVW  LE+++  SK+Y P+
Sbjct: 522  AFTQPRMYQAISKKPNILDIYVDYLQNEGTFTKQDTDEHKKWVWQTLEKSFQNSKEYKPS 581

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             +EWLSSSW+GF +P EL++   P  PTG   + L  + + + + P+GF VH  L R+LK
Sbjct: 582  PKEWLSSSWDGFPTPSELSQLVLPVNPTGVREDKLVDIAKKLGNLPEGFTVHRNLSRVLK 641

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+GIDW TAE LA G+L  EG H+RLSGQDVERGTFSQRH+++HDQ     +
Sbjct: 642  NREKMVEEGKGIDWSTAETLAMGALATEGNHIRLSGQDVERGTFSQRHSIIHDQKTGEAF 701

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN L   QA  ++ NS+LSEFG LGFE GYSLV+P+SL +WE QFGDF NN+QC+IDQ
Sbjct: 702  MPLNHLGEKQAPVTIVNSTLSEFGVLGFELGYSLVSPDSLTIWEAQFGDFANNAQCMIDQ 761

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FI+SGE+KWLQRTGLV+ LPHGYDGQGPEHSSGR+ERFLQLCDD+P ++P  E+  RQHQ
Sbjct: 762  FISSGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDNPLIFPSEEQQIRQHQ 821

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ++  TTPANYFHVLRRQ+HR FRKPL+ F +KSLLRHPMARS L+E++GDT+F+R
Sbjct: 822  DCNMQVVYPTTPANYFHVLRRQVHRGFRKPLVLFFAKSLLRHPMARSDLSELSGDTSFQR 881

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++PDPHP+ L +PE++ RHILCSGQVY+ L++ R++  +  V ISRLEQ+ PFPYD++  
Sbjct: 882  YLPDPHPDHLVAPEQVRRHILCSGQVYHTLIKHRDEKGIKDVVISRLEQLSPFPYDMIKP 941

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            ++DKYPNA+L W QEEP+N GAW+YV+ R+ TL++++E H+G+    A R PS+S ATG+
Sbjct: 942  NLDKYPNADLYWCQEEPVNNGAWSYVSQRLITLVDNTEHHKGKVPLYAGRPPSSSVATGS 1001

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H  E  + L+ A 
Sbjct: 1002 KASHKSEIENFLNDAF 1017



>gi|164424833|ref|XP_963248.2| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Neurospora crassa OR74A]
 gi|157070681|gb|EAA34012.2| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Neurospora crassa OR74A]
          Length = 1043

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/559 (60%), Positives = 437/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLA++WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 475  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++I++++P ++ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 535  AFTQPLMYKRISEKSPQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WN FKSPKELA E  P  PT      L+H+G VI S P+GF+ H  L RIL 
Sbjct: 595  SKEWTTSAWNNFKSPKELASEVLPHMPTAVDKPTLEHIGTVIGSTPEGFHAHRNLKRILT 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+GIDW TAE LAFG+L+ EG HVR++GQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 655  NRTKSVVEGKGIDWATAEALAFGTLVKEGHHVRITGQDVERGTFSQRHAVFHDQETEDTY 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PL  +   QA F + NSSLSE+G LGFEYGYSL +PN   +WE QFGDF N +Q IIDQ
Sbjct: 715  IPLQHISEDQAPFVISNSSLSEYGILGFEYGYSLQDPNGFNMWEAQFGDFANTAQVIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QRTGLV+ LPHGYDGQGPEHSS R+ERFL LC++ P +YP PEK+ RQHQ
Sbjct: 775  FLASGESKWMQRTGLVMSLPHGYDGQGPEHSSARMERFLSLCNEDPRIYPSPEKLERQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQ+ R FRKPL+ F SK+LLRHP+ARS + E T D  F+ 
Sbjct: 835  DCNMQIAYMTSPANLFHILRRQLKRQFRKPLVIFFSKALLRHPVARSDIEEFTDDAHFRW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +PD   +T  + +PE+I R ILC+GQVY ALL+ R+ NK+D+VAI+R+EQ+ PFP++ L
Sbjct: 895  ILPDSAHQTGEIKAPEEIERVILCTGQVYAALLKHRQDNKIDNVAITRIEQLHPFPWEQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+Y NA+ ++WAQEEPLN GAW+Y  PR+ TL+NH++ H+ +    A R PSAS A
Sbjct: 955  RENLDQYTNAKTIVWAQEEPLNAGAWSYTQPRLETLLNHTKHHDRKHVMYAGRAPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE +L+  A 
Sbjct: 1015 TGKKSSHVKEEKELVDMAF 1033



>gi|16416078|emb|CAB91484.2| probable oxoglutarate dehydrogenase precursor [Neurospora crassa]
          Length = 1087

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/559 (60%), Positives = 437/559 (78%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLA++WR  FK+DV+ID+VCYRK+GHNE DQP
Sbjct: 519  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQP 578

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++I++++P ++ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 579  AFTQPLMYKRISEKSPQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 638

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WN FKSPKELA E  P  PT      L+H+G VI S P+GF+ H  L RIL 
Sbjct: 639  SKEWTTSAWNNFKSPKELASEVLPHMPTAVDKPTLEHIGTVIGSTPEGFHAHRNLKRILT 698

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+GIDW TAE LAFG+L+ EG HVR++GQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 699  NRTKSVVEGKGIDWATAEALAFGTLVKEGHHVRITGQDVERGTFSQRHAVFHDQETEDTY 758

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PL  +   QA F + NSSLSE+G LGFEYGYSL +PN   +WE QFGDF N +Q IIDQ
Sbjct: 759  IPLQHISEDQAPFVISNSSLSEYGILGFEYGYSLQDPNGFNMWEAQFGDFANTAQVIIDQ 818

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QRTGLV+ LPHGYDGQGPEHSS R+ERFL LC++ P +YP PEK+ RQHQ
Sbjct: 819  FLASGESKWMQRTGLVMSLPHGYDGQGPEHSSARMERFLSLCNEDPRIYPSPEKLERQHQ 878

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQ+ R FRKPL+ F SK+LLRHP+ARS + E T D  F+ 
Sbjct: 879  DCNMQIAYMTSPANLFHILRRQLKRQFRKPLVIFFSKALLRHPVARSDIEEFTDDAHFRW 938

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +PD   +T  + +PE+I R ILC+GQVY ALL+ R+ NK+D+VAI+R+EQ+ PFP++ L
Sbjct: 939  ILPDSAHQTGEIKAPEEIERVILCTGQVYAALLKHRQDNKIDNVAITRIEQLHPFPWEQL 998

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+Y NA+ ++WAQEEPLN GAW+Y  PR+ TL+NH++ H+ +    A R PSAS A
Sbjct: 999  RENLDQYTNAKTIVWAQEEPLNAGAWSYTQPRLETLLNHTKHHDRKHVMYAGRAPSASVA 1058

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE +L+  A 
Sbjct: 1059 TGKKSSHVKEEKELVDMAF 1077



>gi|302502401|ref|XP_003013191.1| hypothetical protein ARB_00375 [Arthroderma benhamiae CBS 112371]
 gi|302659068|ref|XP_003021229.1| hypothetical protein TRV_04661 [Trichophyton verrucosum HKI 0517]
 gi|291176754|gb|EFE32551.1| hypothetical protein ARB_00375 [Arthroderma benhamiae CBS 112371]
 gi|291185117|gb|EFE40611.1| hypothetical protein TRV_04661 [Trichophyton verrucosum HKI 0517]
          Length = 1050

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/558 (63%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 483  YCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV+KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 543  AFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYTPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  + S P+ F  H  L RIL 
Sbjct: 603  SREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRILA 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EGQ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 663  NREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +K+ RQHQ
Sbjct: 783  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADKIDRQHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 843  DCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 902

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PEKI R I+CSGQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 903  IIPDDQHGKQIDEPEKIERVIMCSGQVWAALTKHREANGIRNTAITRIEQMHPFPWQQLK 962

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 963  ENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVAT 1022

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL  A 
Sbjct: 1023 GLKSSHIKEEQDLLHDAF 1040



>gi|239608649|gb|EEQ85636.1| 2-oxoglutarate dehydrogenase E1 component [Ajellomyces dermatitidis
            ER-3]
 gi|327353787|gb|EGE82644.1| 2-oxoglutarate dehydrogenase E1 component [Ajellomyces dermatitidis
            ATCC 18188]
          Length = 1066

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/559 (61%), Positives = 434/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 498  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 557

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+QT  L+KYV KL+++ TF+KEDIE+HKKWVW +L +++ +SKDY P+
Sbjct: 558  SFTQPLMYKRIAEQTNQLDKYVDKLIREKTFSKEDIEEHKKWVWGMLNDSFDRSKDYQPS 617

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG   E L+ +GEV+ + P+ F VH  L RIL 
Sbjct: 618  SKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKKIGEVLGNIPENFTVHRNLKRILA 677

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I EG+ IDW TAE LAFGSL  EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 678  NRKKTIEEGENIDWSTAEALAFGSLCAEGHHVRVSGQDVERGTFSQRHAVLHDQENEATY 737

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 738  TALQHISPDQGKFVISNSSLSEFGVLGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 797

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P  +++ RQHQ
Sbjct: 798  FVASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPTGDRIDRQHQ 857

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L++ TGD+ F+ 
Sbjct: 858  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGDSHFQW 917

Query: 421  FIPDP--HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  H   + + + I R I+CSGQVY AL + R  + + + AI+R+EQ+ PFP+  L
Sbjct: 918  IIPDPEHHTGAVNNHKDIDRVIICSGQVYAALQKHRTAHGIKNTAITRIEQMHPFPWQQL 977

Query: 479  SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA +++W QEEPLN GAW+Y+ PRI TL+N +E H  R    A R PSAS A
Sbjct: 978  KENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETEHHNRRHVLYAGRHPSASVA 1037

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE +LL  A 
Sbjct: 1038 TGMKASHVKEEQELLQDAF 1056



>gi|261191769|ref|XP_002622292.1| 2-oxoglutarate dehydrogenase E1 component [Ajellomyces dermatitidis
            SLH14081]
 gi|239589608|gb|EEQ72251.1| 2-oxoglutarate dehydrogenase E1 component [Ajellomyces dermatitidis
            SLH14081]
          Length = 1066

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/559 (61%), Positives = 434/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 498  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 557

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+QT  L+KYV KL+++ TF+KEDIE+HKKWVW +L +++ +SKDY P+
Sbjct: 558  SFTQPLMYKRIAEQTNQLDKYVDKLIREKTFSKEDIEEHKKWVWGMLNDSFDRSKDYQPS 617

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG   E L+ +GEV+ + P+ F VH  L RIL 
Sbjct: 618  SKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKKIGEVLGNIPENFTVHRNLKRILA 677

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I EG+ IDW TAE LAFGSL  EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 678  NRKKTIEEGENIDWSTAEALAFGSLCAEGHHVRVSGQDVERGTFSQRHAVLHDQENEATY 737

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 738  TALQHISPDQGKFVISNSSLSEFGVLGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 797

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P  +++ RQHQ
Sbjct: 798  FVASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPTGDRIDRQHQ 857

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L++ TGD+ F+ 
Sbjct: 858  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGDSHFQW 917

Query: 421  FIPDP--HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  H   + + + I R I+CSGQVY AL + R  + + + AI+R+EQ+ PFP+  L
Sbjct: 918  IIPDPEHHTGAVNNHKDIDRVIICSGQVYAALQKHRTAHGIKNTAITRIEQMHPFPWQQL 977

Query: 479  SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA +++W QEEPLN GAW+Y+ PRI TL+N +E H  R    A R PSAS A
Sbjct: 978  KENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETEHHNRRHVLYAGRHPSASVA 1037

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE +LL  A 
Sbjct: 1038 TGMKASHVKEEQELLQDAF 1056



>gi|296808057|ref|XP_002844367.1| 2-oxoglutarate dehydrogenase E1 component [Arthroderma otae CBS
            113480]
 gi|238843850|gb|EEQ33512.1| 2-oxoglutarate dehydrogenase E1 component [Arthroderma otae CBS
            113480]
          Length = 1051

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/558 (62%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 484  YCSDIAKAIDAPVFHVNGDDVEALNYVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 543

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 544  AFTQPLMYKRIASQQSQIDKYVDKLLKEKTFTKEDIDEHKKWVWGMLNDSFDRSKDYTPT 603

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  + S P+ F  H  L RIL 
Sbjct: 604  SREWLTSAWNGFKTPKELATEVLAHPPTGVEAETLQMIGAKLGSVPENFTPHRNLKRILA 663

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+INEGQ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 664  NREKSINEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 723

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 724  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPHALVMWEAQFGDFANNAQCIIDQ 783

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +K+ RQHQ
Sbjct: 784  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPSADKIDRQHQ 843

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 844  DCNIQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 903

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PE I R I+CSGQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 904  IIPDDQHGKQINEPENIERVIMCSGQVWAALTKHREANGIKNTAITRIEQMHPFPWQQLK 963

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 964  ENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVMYAGRNPSASVAT 1023

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL  A 
Sbjct: 1024 GLKSSHIKEEQDLLHDAF 1041



>gi|326485345|gb|EGE09355.1| 2-oxoglutarate dehydrogenase E1 component [Trichophyton equinum CBS
            127.97]
          Length = 1050

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/558 (63%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 483  YCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV+KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 543  AFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYTPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  + S P+ F  H  L RIL 
Sbjct: 603  SREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRILA 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EGQ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 663  NREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +++ RQHQ
Sbjct: 783  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADRIDRQHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 843  DCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 902

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PEKI R I+CSGQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 903  IIPDDQHGKQIDEPEKIDRVIMCSGQVWAALTKHREANGIRNTAITRIEQMHPFPWQQLK 962

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 963  ENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVAT 1022

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL  A 
Sbjct: 1023 GLKSSHIKEEQDLLHDAF 1040



>gi|485921101|gb|EOD46907.1| putative alpha-ketoglutarate dehydrogenase complex subunit protein
            [Neofusicoccum parvum UCRNP2]
          Length = 1048

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/559 (62%), Positives = 432/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDD EA NFVCQLAA++R TFKKDVVID+VCYRK GHNE DQP
Sbjct: 480  YCSDIAKAIDAPVFHVNGDDAEAFNFVCQLAADYRATFKKDVVIDMVCYRKQGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++IA+Q P L+KYV KLL++GTFTKED+++HK WVW +LEE++ +SKDY PT
Sbjct: 540  FFTQPLMYKRIAEQKPALDKYVDKLLQEGTFTKEDVDEHKAWVWGMLEESFSRSKDYQPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+WNGFKSPKELA E  P  PT    E+L+ V E I   P+GF VH  L RIL+
Sbjct: 600  AKEWLTSAWNGFKSPKELATEVLPHLPTAVDAEVLKQVAEKIGGSPEGFTVHRNLKRILQ 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  TAE LAFG+L LEG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 660  NRTKTVTEGKNIDMATAEALAFGTLCLEGHHVRVSGQDVERGTFSQRHAVLHDQENEGTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLASLSQDQGSFVISNSSLSEFGVLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P P+K+ RQHQ
Sbjct: 780  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLERQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPL+ F SKSLLRHPMARS + E T D+ F+ 
Sbjct: 840  DCNMQIAYLTKPSNMFHILRRQMNRQFRKPLVLFFSKSLLRHPMARSDIDEFTDDSHFQW 899

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +PDP  ET  +A  ++I R ++C+GQV+ AL + R+++ + + AI+R+EQ+ PFP+  L
Sbjct: 900  LVPDPAHETNEIAPKDEIERVVICTGQVWGALWQYRQEHGLKNTAITRIEQLHPFPWAQL 959

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ ++W QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 960  RDNLDSYPNAKNIVWCQEEPLNAGAWSFTQPRIETLLNETEHHNRRHVMYAGRNPSASVA 1019

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1020 TGLKAVHKKEEKDLLEAAF 1038



>gi|225559813|gb|EEH08095.1| 2-oxoglutarate dehydrogenase [Ajellomyces capsulatus G186AR]
          Length = 1058

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 433/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 490  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+QT  L+KYV KL+ + TF+K DIE+HKKWVW +L +++ +SKDY P+
Sbjct: 550  SFTQPLMYKRIAEQTNQLDKYVDKLISEKTFSKADIEEHKKWVWGMLNDSFDRSKDYQPS 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG   E L+ +G+V+ S P+ F VH  L RIL 
Sbjct: 610  SKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKRIGDVLGSIPENFTVHRNLKRILA 669

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFGSL  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 670  NRKKTVEEGENIDWSTAEALAFGSLCAEGHHVRISGQDVERGTFSQRHAVLHDQENETTY 729

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 730  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 789

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P P+++ RQHQ
Sbjct: 790  FIASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPAPDRIDRQHQ 849

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L++ TGD+ F+ 
Sbjct: 850  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGDSHFQW 909

Query: 421  FIPDPH--PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP     +L + + I R ILCSGQVY AL + R  + +++ AI+R+EQ+ PFP+  L
Sbjct: 910  IIADPEHGSPSLNNHKDIERVILCSGQVYAALQKHRAAHGINNTAITRIEQMHPFPWQQL 969

Query: 479  SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA +++W QEEPLN GAW+Y+ PRI TL+N +  H  R    A R PSAS A
Sbjct: 970  KENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVA 1029

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE DLL  A 
Sbjct: 1030 TGLKASHVKEEQDLLQDAF 1048



>gi|326475719|gb|EGD99728.1| 2-oxoglutarate dehydrogenase E1 component [Trichophyton tonsurans CBS
            112818]
          Length = 1013

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/558 (63%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 446  YCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV+KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 506  AFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYTPT 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  + S P+ F  H  L RIL 
Sbjct: 566  SREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRILA 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EGQ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 626  NREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 686  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +++ RQHQ
Sbjct: 746  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADRIDRQHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 806  DCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 865

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PEKI R I+CSGQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 866  IIPDDQHGKQIDEPEKIDRVIMCSGQVWAALTKHREANGIRNTAITRIEQMHPFPWQQLK 925

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 926  ENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVAT 985

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL  A 
Sbjct: 986  GLKSSHIKEEQDLLHDAF 1003



>gi|71020737|ref|XP_760599.1| hypothetical protein UM04452.1 [Ustilago maydis 521]
 gi|46100487|gb|EAK85720.1| hypothetical protein UM04452.1 [Ustilago maydis 521]
          Length = 1221

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/560 (62%), Positives = 425/560 (75%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAV FV QLAA+WR TFKKDVVID+VCYR++GHNE DQP
Sbjct: 651  YPSDIAKSIDAPIFHVNGDDVEAVTFVSQLAADWRATFKKDVVIDLVCYRRHGHNETDQP 710

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY  IAKQ P L KY  +L+ +G+FTK DIE+H+KWVW +LEE + KSK+Y P 
Sbjct: 711  SFTQPRMYAAIAKQDPTLSKYAARLVDEGSFTKSDIEEHQKWVWGMLEEAFDKSKNYRPE 770

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSS+W GF SPK+LAE+      TG   + L+H+G+ +S+YP  F VH  L RILK
Sbjct: 771  EREWLSSAWEGFPSPKQLAEQILDHKDTGVKEQTLKHIGKTVSTYPDDFTVHRNLGRILK 830

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ ID  T E LAFGSL LEG +VRLSGQDVERGTFSQRH+VLHDQ NE  Y
Sbjct: 831  TRLKTVEEGKNIDMSTGEALAFGSLALEGNYVRLSGQDVERGTFSQRHSVLHDQENEGTY 890

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +  GQA F VCNSSLSEFG +GFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 891  TPLQHVGEGQAPFVVCNSSLSEFGCMGFELGFSLVSPQNLTIWEAQFGDFANNAQCIIDQ 950

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHP+ +P PEK  RQHQ
Sbjct: 951  FIASGERKWLQRTGLVLNLPHGYDGQGPEHSSARIERFLQLCDDHPFKFPTPEKSNRQHQ 1010

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPANYFHVLRRQ+HRDFRKPL+ F SKSLLRHP ARS+L +    T F+R
Sbjct: 1011 DSNMAVVYCTTPANYFHVLRRQVHRDFRKPLVNFFSKSLLRHPEARSNLQDFLPGTGFQR 1070

Query: 421  FIPDPHP----ETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            FIP+PH     + L +P++I RHIL  GQ Y+ LL+ R +N +  VAISR+EQ+ P  Y+
Sbjct: 1071 FIPEPHASEGKDELVAPDQIKRHILTFGQTYFELLKHRRENNIKDVAISRIEQLSPLHYE 1130

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q +DKYPNA+L++ QEEPLN GAW+Y+ PR+RT   H++ H+      A+R PS+S 
Sbjct: 1131 AVVQALDKYPNADLVFCQEEPLNNGAWSYLQPRLRTACRHTQHHKNDIVILASRPPSSSV 1190

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+K  H  E    L  A 
Sbjct: 1191 ATGSKVAHKAEVEAYLKDAF 1210



>gi|327295470|ref|XP_003232430.1| oxoglutarate dehydrogenase [Trichophyton rubrum CBS 118892]
 gi|326465602|gb|EGD91055.1| oxoglutarate dehydrogenase [Trichophyton rubrum CBS 118892]
          Length = 1050

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/558 (63%), Positives = 429/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 483  YCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 542

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV+KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 543  AFTQPLMYKRIASQQSQIDKYVEKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYTPT 602

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  + S P+ F  H  L RIL 
Sbjct: 603  SREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGSIPENFTPHRNLKRILA 662

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EG+ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 663  NREKSIKEGKNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 722

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 723  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 782

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +K+ RQHQ
Sbjct: 783  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPAADKIDRQHQ 842

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 843  DCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 902

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PEKI R I+CSGQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 903  IIPDDQHGKQIDEPEKIERVIMCSGQVWAALTKHRETNGIRNTAITRIEQMHPFPWQQLK 962

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            +++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 963  ENLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVAT 1022

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL  A 
Sbjct: 1023 GLKSSHIKEEQDLLHDAF 1040



>gi|325089830|gb|EGC43140.1| 2-oxoglutarate dehydrogenase [Ajellomyces capsulatus H88]
          Length = 1039

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 433/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 471  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 530

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+QT  L+KYV KL+ + TF+K DIE+HKKWVW +L +++ +SKDY P+
Sbjct: 531  SFTQPLMYKRIAEQTNQLDKYVDKLISEKTFSKADIEEHKKWVWGMLNDSFDRSKDYQPS 590

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG   E L+ +G+V+ S P+ F VH  L RIL 
Sbjct: 591  SKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKRIGDVLGSIPENFTVHRNLKRILA 650

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFGSL  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 651  NRKKTVEEGENIDWSTAEALAFGSLCAEGHHVRISGQDVERGTFSQRHAVLHDQENETTY 710

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 711  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 770

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P P+++ RQHQ
Sbjct: 771  FIASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPAPDRIDRQHQ 830

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L++ TGD+ F+ 
Sbjct: 831  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGDSHFQW 890

Query: 421  FIPDPH--PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP     +L + + I R ILCSGQVY AL + R  + +++ AI+R+EQ+ PFP+  L
Sbjct: 891  IIADPEHGSPSLNNHKDIERVILCSGQVYAALQKHRAAHGINNTAITRIEQMHPFPWQQL 950

Query: 479  SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA +++W QEEPLN GAW+Y+ PRI TL+N +  H  R    A R PSAS A
Sbjct: 951  KENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVA 1010

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE DLL  A 
Sbjct: 1011 TGLKASHVKEEQDLLQDAF 1029



>gi|380491979|emb|CCF34932.1| oxoglutarate dehydrogenase [Colletotrichum higginsianum]
          Length = 1043

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/559 (61%), Positives = 433/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV+ID+VCYRK+GHNE DQP
Sbjct: 475  YCTDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIIDLVCYRKHGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I      +  YV KLL+DG+FTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 535  SFTQPLMYKRIQDHESQISIYVNKLLEDGSFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P + T    + L H+GEVI S P+GF+ H  L RIL 
Sbjct: 595  SKEWTTSAWNGFKSPKELATEVLPHHETSVDLKTLNHLGEVIGSTPEGFHAHRNLKRILS 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 655  NRTKSVVEGKNIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTH 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 715  TPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLVV LPHGYDGQGPEHSSGRLER+LQL ++ P V+P P+K+ RQHQ
Sbjct: 775  FIASGEAKWMQRTGLVVSLPHGYDGQGPEHSSGRLERWLQLSNEDPRVFPSPDKLERQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T+P+N FHVLRRQ+HR FRKPLI F SK+LLRHP+ARS++ E + D+ F+ 
Sbjct: 835  DCNMQVAYMTSPSNLFHVLRRQMHRQFRKPLIIFFSKALLRHPLARSNIEEFSADSHFRW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ET  +   E+I R ILCSGQV+  L + R  NK+D+VA +RLEQ+ PFP+  L
Sbjct: 895  IIPDPEHETGAIKPKEEIDRVILCSGQVWATLSKYRADNKIDNVAFTRLEQLNPFPWQQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++W QEEPLN GAW++  PR+ TL+N++E H+ +    A R PSAS A
Sbjct: 955  KENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRLETLLNNTEHHDRKHVMYAGRGPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
             GNK  H +EE + L  A 
Sbjct: 1015 AGNKGLHNKEEQEFLEMAF 1033



>gi|315042810|ref|XP_003170781.1| 2-oxoglutarate dehydrogenase E1 component [Arthroderma gypseum CBS
            118893]
 gi|311344570|gb|EFR03773.1| 2-oxoglutarate dehydrogenase E1 component [Arthroderma gypseum CBS
            118893]
          Length = 1051

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/558 (62%), Positives = 427/558 (76%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N VCQLAA+WR  FK DVVIDIVCYRK GHNE DQP
Sbjct: 484  YCSDIAKAIDAPVFHVNGDDVEALNHVCQLAADWRAQFKSDVVIDIVCYRKQGHNETDQP 543

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA Q   ++KYV KLLK+ TFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 544  AFTQPLMYKRIASQQSQIDKYVDKLLKEKTFTKEDIDEHKKWVWGMLNDSFERSKDYTPT 603

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E     PTG   E LQ +G  +   P+ F  H  L RIL 
Sbjct: 604  SREWLTSAWNGFKTPKELATEVLGHPPTGVEAETLQMIGAKLGGIPENFTPHRNLKRILA 663

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EGQ IDW TAE LAFG+L  EG HVR+SGQDVERGTFSQRHAVLHDQ NE+ Y
Sbjct: 664  NREKSIKEGQNIDWSTAEALAFGTLCKEGHHVRVSGQDVERGTFSQRHAVLHDQENESTY 723

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q  F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 724  TALQHISPDQGSFVISNSSLSEYGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ 783

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P VYP  +K+ RQHQ
Sbjct: 784  FIASGESKWVQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVYPSADKIDRQHQ 843

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T+PAN FH+LRRQI+R FRKPLI F SKSLLRHP  RSS+ E TGD+ F+ 
Sbjct: 844  DCNMQIAYMTSPANLFHILRRQINRQFRKPLIIFFSKSLLRHPSCRSSIEEFTGDSHFRW 903

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             IPD  H + +  PEKI R I+C+GQV+ AL + RE N + + AI+R+EQ+ PFP+  L 
Sbjct: 904  IIPDDQHGKQIDEPEKIERVIMCTGQVWAALTKHRETNGIRNTAITRIEQMHPFPWQQLK 963

Query: 480  QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ++D YPNA ++++ QEEPLN G+W+Y+ PRI TL+N +  H  R    A R PSAS AT
Sbjct: 964  DNLDSYPNAKDIVFCQEEPLNAGSWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVAT 1023

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G K  HI+EE DLL+ A 
Sbjct: 1024 GLKSSHIKEEQDLLNDAF 1041



>gi|358387451|gb|EHK25046.1| hypothetical protein TRIVIDRAFT_84921 [Trichoderma virens Gv29-8]
          Length = 1035

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/563 (62%), Positives = 436/563 (77%), Gaps = 7/563 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 463  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 522

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLL++GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 523  SFTQPLMYKRIQEKVPQIDVYVNKLLQEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 582

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T      L H+GEVI S P+GF +H  L RIL 
Sbjct: 583  SKEWTTSAWNGFKSPKELATEILPHNDTSVDRNTLNHIGEVIGSAPEGFQIHRNLKRILT 642

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQ---VNE 237
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ     E
Sbjct: 643  NRTKSVIEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEETE 702

Query: 238  TQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCI 297
              Y PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCI
Sbjct: 703  ETYTPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCI 762

Query: 298  IDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR 357
            IDQFIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P V+P  +K+ R
Sbjct: 763  IDQFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSEDKIQR 822

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DT 416
            QHQDCNMQI   TTPAN FHVLRRQ+HR FRKPL+ F SKSLLRHP+ARS++ + TG + 
Sbjct: 823  QHQDCNMQIAYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEDFTGPNA 882

Query: 417  TFKRFIPDPHPE--TLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFP 474
             F+  IPDP  +  T+ +PE+I R ILC+GQV+ +L + R  NK+D+VA +R+EQ+ PFP
Sbjct: 883  GFQWIIPDPEHQTGTIKAPEEIDRVILCTGQVWASLHKYRADNKIDNVAFTRIEQLNPFP 942

Query: 475  YDLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPS 533
            +  L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PS
Sbjct: 943  WQQLKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQHHDRKHVMYAGRNPS 1002

Query: 534  ASPATGNKKQHIQEEHDLLSQAL 556
            AS ATG K  H +EE D L  A 
Sbjct: 1003 ASVATGLKNVHTKEEQDFLQMAF 1025



>gi|477536242|gb|ENH87715.1| 2-oxoglutarate dehydrogenase e1 component [Colletotrichum orbiculare
            MAFF 240422]
          Length = 1032

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/559 (61%), Positives = 431/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQ+AA+WR  F++DV+ID+VCYRK+GHNE DQP
Sbjct: 464  YCTDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIIDLVCYRKHGHNETDQP 523

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I      +  YV KLL+DG+FTKED+E+HK+WVW +LEE++ KSKDY PT
Sbjct: 524  SFTQPLMYKRIQSHESQISIYVNKLLEDGSFTKEDVEEHKQWVWGMLEESFSKSKDYQPT 583

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T    + LQH+GEVI S P+GF+ H  L RIL 
Sbjct: 584  SKEWTTSAWNGFKSPKELATEVLPHNDTSIDMKTLQHLGEVIGSTPEGFHAHRNLKRILS 643

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 644  NRTKSVVEGKNIDMPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTH 703

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 704  TPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQ 763

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLVV LPHGYDGQGPEHSS RLER+LQLC++ P V+P PEK+ RQHQ
Sbjct: 764  FIASGEAKWMQRTGLVVSLPHGYDGQGPEHSSARLERWLQLCNEDPRVFPSPEKLERQHQ 823

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI   T+PAN  HVLRRQ+HR FRKPLI F SK+LLRHP+ARS++ E +GD+ F+ 
Sbjct: 824  DCNIQIAYMTSPANLLHVLRRQMHRQFRKPLIIFFSKALLRHPLARSNIEEFSGDSHFRW 883

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             IPDP  ET  +   E+I R ILC+GQV+  L + R  NK+D+VA +R+EQ+ PFP+  L
Sbjct: 884  IIPDPEHETGAIKPKEEIDRVILCTGQVWATLSKYRADNKIDNVAFTRVEQLNPFPWQQL 943

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D+YPNA+ ++W QEEPLN GAW++  PR+ TL+N +E H+ +    A R PSAS A
Sbjct: 944  KENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRLETLLNQTEHHDHKHIMYAGRGPSASVA 1003

Query: 538  TGNKKQHIQEEHDLLSQAL 556
             GNK  H +EE + L  A 
Sbjct: 1004 AGNKGLHNKEEQEFLEMAF 1022



>gi|358397995|gb|EHK47353.1| hypothetical protein TRIATDRAFT_290783 [Trichoderma atroviride IMI
            206040]
          Length = 1013

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/563 (61%), Positives = 438/563 (77%), Gaps = 7/563 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID++CYRK+GHNE DQP
Sbjct: 441  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQP 500

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KLL++GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 501  SFTQPLMYKRIQEKVPQIDVYVNKLLQEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 560

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P   T      L H+G+VI S P+GF +H  L RIL 
Sbjct: 561  SKEWTTSAWNGFKSPKELATEILPHNDTSVDRATLNHIGQVIGSAPEGFQIHRNLKRILN 620

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQ---VNE 237
             R K + EG  ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ     E
Sbjct: 621  NRTKTVTEGTNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEETE 680

Query: 238  TQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCI 297
              Y PL  +   Q KF + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCI
Sbjct: 681  ETYTPLQHISKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCI 740

Query: 298  IDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR 357
            IDQFIASGE KW+QRTGL++ LPHGYDGQGPEHSSGRLER+LQLC++ P V+P  +K+ R
Sbjct: 741  IDQFIASGEVKWMQRTGLIMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSEDKLPR 800

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DT 416
            QHQDCNMQI+  TTPAN FHVLRRQ+HR FRKPLI F SKSLLRHP++RS++ + TG + 
Sbjct: 801  QHQDCNMQIVYMTTPANLFHVLRRQMHRQFRKPLIIFFSKSLLRHPLSRSNIEDFTGPNA 860

Query: 417  TFKRFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFP 474
             F+  IPDP  +T  + +PE+I R +LC+GQV+ +L + RE++K+D+VA++R+EQ+ PFP
Sbjct: 861  QFQWIIPDPEHQTGAIKAPEEIDRVVLCTGQVWASLHKYREEHKIDNVALTRIEQLNPFP 920

Query: 475  YDLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPS 533
            +  L +++D YPNA+ ++WAQEEPLN GAW++  PRI TL+N ++ H+ +    A R PS
Sbjct: 921  WQQLKENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPS 980

Query: 534  ASPATGNKKQHIQEEHDLLSQAL 556
            AS ATG K  H QEE + L  A 
Sbjct: 981  ASVATGLKNTHKQEEQEFLEMAF 1003



>gi|255947496|ref|XP_002564515.1| Pc22g04770 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591532|emb|CAP97765.1| Pc22g04770 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1060

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/561 (62%), Positives = 430/561 (76%), Gaps = 5/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DD EAVN+VCQ+AA+WR  FK+DVVID+VCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDAEAVNYVCQVAADWRAEFKRDVVIDMVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKAQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLGDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS--YPKGFNVHSGLVRI 178
             +EWL+S+WN FKSPKELA E  P  PT    + LQH+ + IS    P+GF +H  L RI
Sbjct: 610  GKEWLTSAWNNFKSPKELANEVLPHLPTAVPAKSLQHIADKISGTGVPEGFELHRNLKRI 669

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
            L  R KA++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ  E 
Sbjct: 670  LAGRKKAVDEGKNIDWATAEALAFGSLVDEGYHVRVSGQDVERGTFSQRHAVLHDQQTER 729

Query: 239  QYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             Y PL  +R  Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCII
Sbjct: 730  TYTPLKHVRDNQGSFVISNSSLSEFGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCII 789

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQ 358
            DQFIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P  YP  +K+ RQ
Sbjct: 790  DQFIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRSYPEADKLDRQ 849

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG-DTT 417
            HQDCNMQI   TTPAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS + E+T  D+ 
Sbjct: 850  HQDCNMQIACMTTPANLFHILRRQIHRQFRKPLVLFFSKSLLRHPLARSDIEELTAEDSH 909

Query: 418  FKRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            F+  IPD  H   + +P+ I R ILCSGQVY AL + RE N + + AI+R+EQ+ PFP+ 
Sbjct: 910  FQWIIPDQGHGTAIEAPKDIERVILCSGQVYAALTKHREANGIRNTAITRIEQLHPFPWA 969

Query: 477  LLSQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSAS 535
             L +++D YPNA +++W QEEPLN GAW+Y  PRI +L+N +E H  R    A R  SAS
Sbjct: 970  QLKENLDSYPNAKDIVWCQEEPLNAGAWSYAQPRIESLLNATEHHNRRHVLYAGRAGSAS 1029

Query: 536  PATGNKKQHIQEEHDLLSQAL 556
             ATG K  H++EE D L +A 
Sbjct: 1030 VATGLKAVHLKEEQDFLEEAF 1050



>gi|328863203|gb|EGG12303.1| hypothetical protein MELLADRAFT_115101 [Melampsora larici-populina
            98AG31]
          Length = 1033

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/561 (63%), Positives = 431/561 (76%), Gaps = 5/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDD EAV FVCQLAA+WR TFKKDVV+DIVCYR++GHNE DQP
Sbjct: 469  YPSDIAKSIDAPIFHVNGDDAEAVTFVCQLAADWRATFKKDVVVDIVCYRRHGHNETDQP 528

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ IA Q   L+ Y + L+K+G+FT+++IEKHK+WVW ++E+ Y  SKDY PT
Sbjct: 529  SFTQPKMYQAIANQPSTLKIYSENLVKEGSFTEQEIEKHKEWVWGMMEKAYQGSKDYTPT 588

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS-YPKGFNVHSGLVRIL 179
            SREWLSSSW+GF SPKEL E    A PTG S E L  +GE IS  +P  F VH  L RIL
Sbjct: 589  SREWLSSSWDGFPSPKELKENILEARPTGVSTERLLKIGEKISGGWPSKFEVHKNLSRIL 648

Query: 180  KARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQ 239
            K R K I+EG+ IDW TAE LAFGSLL+EG HVR+SGQDVERGTFSQRHAVLHDQ     
Sbjct: 649  KNRGKTISEGKEIDWSTAEALAFGSLLMEGNHVRVSGQDVERGTFSQRHAVLHDQQTNET 708

Query: 240  YVPLNDL-RPGQAK---FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQ 295
            Y+PL++L + G+ +   F++CNSSLSEFG LGFE GYSLV+P+ L +WE QFGDF NN+Q
Sbjct: 709  YIPLSNLEQDGENQVGPFTICNSSLSEFGALGFELGYSLVDPHLLTIWEAQFGDFANNAQ 768

Query: 296  CIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKM 355
            CIIDQFI SGE+KW QRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHPY  P PEK 
Sbjct: 769  CIIDQFICSGERKWFQRTGLVMSLPHGYDGQGPEHSSARIERFLQLCDDHPYKVPTPEKS 828

Query: 356  ARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGD 415
             R HQDCNMQ++  TTP+NYFHVLRRQIHRDFRKPLI F SK+LLRHPMA+S+L EM   
Sbjct: 829  QRAHQDCNMQLVYCTTPSNYFHVLRRQIHRDFRKPLIVFFSKALLRHPMAKSNLNEMEIG 888

Query: 416  TTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
            T F+ F+ +   + +   + I RHI CSGQVYY L++ RE+ K++++AISR+EQ+ P PY
Sbjct: 889  TFFQPFLLEEGYDGMVEKDLIKRHIFCSGQVYYTLVQEREKRKINNIAISRIEQLSPVPY 948

Query: 476  DLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSAS 535
              +      +PNAE+++ QEEP+NGGA++Y+APR+ T M  +E H G+    A R P AS
Sbjct: 949  TEILNSFSTFPNAEIMYCQEEPINGGAFSYLAPRLETAMEQTETHRGQKVLYAGRPPYAS 1008

Query: 536  PATGNKKQHIQEEHDLLSQAL 556
             ATG+KK H  E +  L QAL
Sbjct: 1009 VATGSKKIHQHEINQFLDQAL 1029



>gi|425768887|gb|EKV07398.1| Alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Penicillium digitatum PHI26]
          Length = 1059

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/560 (62%), Positives = 431/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVID+VCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDMVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKTQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLGDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVI--SSYPKGFNVHSGLVRI 178
             +EWL+S+WN FKSPKELA E  P  PT    + LQH+ + I  +  P+GF +H  L RI
Sbjct: 610  GKEWLTSAWNNFKSPKELATEVLPHLPTAVPAKSLQHIADKIAGTGVPEGFELHRNLKRI 669

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
            L  R K ++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ  E 
Sbjct: 670  LSGRKKTVDEGKNIDWATAEALAFGSLVDEGYHVRVSGQDVERGTFSQRHAVLHDQQTER 729

Query: 239  QYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             Y PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCII
Sbjct: 730  TYTPLKHISDKQGSFVISNSSLSEFGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCII 789

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQ 358
            DQFIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQ
Sbjct: 790  DQFIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSADKLDRQ 849

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTF 418
            HQDCNMQI   TTPAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS +  + G++ F
Sbjct: 850  HQDCNMQIACMTTPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDIEALNGESHF 909

Query: 419  KRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
            +  IPD  H   + +PE+I R ILCSGQVY AL++ RE N + + AI+R+EQ+ PFP+  
Sbjct: 910  QWIIPDEGHGTAINAPEEIERVILCSGQVYAALIKHREANGIRNTAITRVEQLHPFPWAQ 969

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++W QEEPLN GAW+Y  PRI +L+N +E H  R    A R  SAS 
Sbjct: 970  LKENLDSYPNAKNIVWCQEEPLNAGAWSYAQPRIESLLNATEHHHRRHVLYAGRPGSASV 1029

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H++EE DLL  A 
Sbjct: 1030 ATGLKAVHLKEEQDLLEDAF 1049



>gi|425776391|gb|EKV14610.1| Alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
            [Penicillium digitatum Pd1]
          Length = 1059

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/560 (62%), Positives = 431/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVN+VCQ+AA+WR  FK+DVVID+VCYRK GHNE DQP
Sbjct: 490  YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDMVCYRKQGHNETDQP 549

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+Q   L+KYV+KL+ +GTFTKEDI++HKKWVW +L +++ +SKDY PT
Sbjct: 550  SFTQPLMYKRIAEQKTQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLGDSFDRSKDYQPT 609

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVI--SSYPKGFNVHSGLVRI 178
             +EWL+S+WN FKSPKELA E  P  PT    + LQH+ + I  +  P+GF +H  L RI
Sbjct: 610  GKEWLTSAWNNFKSPKELATEVLPHLPTAVPAKSLQHIADKIAGTGVPEGFELHRNLKRI 669

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
            L  R K ++EG+ IDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAVLHDQ  E 
Sbjct: 670  LSGRKKTVDEGKNIDWATAEALAFGSLVDEGYHVRVSGQDVERGTFSQRHAVLHDQQTER 729

Query: 239  QYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             Y PL  +   Q  F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCII
Sbjct: 730  TYTPLKHISDKQGSFVISNSSLSEFGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCII 789

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQ 358
            DQFIASGE KWLQR+GLVV LPHGYDGQGPEHSSGR+ER+LQLC++ P V+P  +K+ RQ
Sbjct: 790  DQFIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSADKLDRQ 849

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTF 418
            HQDCNMQI   TTPAN FH+LRRQIHR FRKPL+ F SKSLLRHP+ARS +  + G++ F
Sbjct: 850  HQDCNMQIACMTTPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDIEALNGESHF 909

Query: 419  KRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
            +  IPD  H   + +PE+I R ILCSGQVY AL++ RE N + + AI+R+EQ+ PFP+  
Sbjct: 910  QWIIPDEGHGTAINAPEEIERVILCSGQVYAALIKHREANGIRNTAITRVEQLHPFPWAQ 969

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D YPNA+ ++W QEEPLN GAW+Y  PRI +L+N +E H  R    A R  SAS 
Sbjct: 970  LKENLDSYPNAKNIVWCQEEPLNAGAWSYAQPRIESLLNATEHHHRRHVLYAGRPGSASV 1029

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H++EE DLL  A 
Sbjct: 1030 ATGLKAVHLKEEQDLLEDAF 1049



>gi|475664584|gb|EMT62378.1| 2-oxoglutarate dehydrogenase, mitochondrial [Fusarium oxysporum f.
            sp. cubense race 4]
 gi|477522089|gb|ENH74171.1| 2-oxoglutarate dehydrogenase, mitochondrial [Fusarium oxysporum f.
            sp. cubense race 1]
          Length = 1051

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/560 (61%), Positives = 436/560 (77%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+ CYRKYGHNE DQP
Sbjct: 482  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KL+++G+F+K D+++HK+WVW +LEE++ KSKDY PT
Sbjct: 542  SFTQPLMYKRITEKEPQIDIYVNKLIEEGSFSKADVDEHKQWVWGMLEESFTKSKDYTPT 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E      T      L+H+G VI S P+GF+VH  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEVLATNETSVKSTTLEHIGTVIGSTPEGFHVHRNLKRILA 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 662  NRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTY 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQHLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  EK+ RQHQ
Sbjct: 782  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRDFPTGEKLVRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTT-FK 419
            DCNMQI   T+PAN FH+LRRQ+HR +RKPL+ F SKSLLRHP+ARS++ E TG+   F+
Sbjct: 842  DCNMQIAYMTSPANLFHILRRQMHRQYRKPLVIFFSKSLLRHPLARSNIEEFTGENAGFQ 901

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  ET  + +PE+I R ILCSGQV+ AL + R +N +D+VAI+R+EQ+ PFP+  
Sbjct: 902  WIIPDPEHETGAIKAPEEIERVILCSGQVWAALHKHRSENNLDNVAITRIEQLNPFPWQQ 961

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D+YPNA+ ++W QEEPLN GAW++  PRI TL+N++E H  +    A R PSAS 
Sbjct: 962  LKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSASV 1021

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K+ H++EE +LL  A 
Sbjct: 1022 ATGLKQVHMKEERELLEMAF 1041



>gi|396492716|ref|XP_003843865.1| similar to 2-oxoglutarate dehydrogenase E1 component [Leptosphaeria
            maculans JN3]
 gi|312220445|emb|CBY00386.1| similar to 2-oxoglutarate dehydrogenase E1 component [Leptosphaeria
            maculans JN3]
          Length = 1045

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/559 (62%), Positives = 428/559 (76%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+NFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 477  YCSDIAKAIDAPVFHVNGDDVEALNFVCQLAADFRAQFKKDVVIDMVCYRKQGHNETDQP 536

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++IA+Q   L+ Y QKLL++ TFTKEDI++HK WVW +L+E++++SKDY PT
Sbjct: 537  FFTQPLMYKKIAQQPQTLDIYTQKLLEEKTFTKEDIDEHKAWVWGMLDESFNRSKDYTPT 596

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+WNGFKSPKELA E  P  PT      L+H+ E I S P+GFNVH  L RIL 
Sbjct: 597  AKEWLTSAWNGFKSPKELATEVLPHLPTAIEESQLKHIAEKIGSAPEGFNVHKNLKRILA 656

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EGQ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 657  GRTKTVVEGQNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQENEQTY 716

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 717  TPLQNLTEDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 776

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQL ++ P ++P  +K+ RQHQ
Sbjct: 777  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSARMERYLQLVNEDPRIFPSADKLDRQHQ 836

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+QI   T P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARS+L E TGD+ F+ 
Sbjct: 837  DCNIQIAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSNLEEFTGDSHFQW 896

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   +  + S E I R ILC+GQVY AL++ RE   +  VAI+RLEQ+ PFP+  L
Sbjct: 897  IIEDPAHASGEIESHEGINRVILCTGQVYAALVKEREARGLKDVAITRLEQLNPFPWQQL 956

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA+ +IW QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 957  KENLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNETEYHNRRHVMFAGRNPSASVA 1016

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H +EE DLL  A 
Sbjct: 1017 TGLKNSHKKEEKDLLEMAF 1035



>gi|482815122|gb|EOA91797.1| hypothetical protein SETTUDRAFT_40748 [Setosphaeria turcica Et28A]
          Length = 1043

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 425/559 (76%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVN DDVEAVNFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 475  YCSDIAKAIDAPVFHVNSDDVEAVNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++I++Q P L+ Y +KLL++ TFTKEDI++HK WVW +L+E++ +SKDYVP 
Sbjct: 535  FFTQPLMYKKISQQPPTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFSRSKDYVPN 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E  P  PT    + L+H+ +VI   P+ FNVH  L RIL 
Sbjct: 595  SREWLTSAWNGFKTPKELATEVLPHLPTAIEEDQLKHIAKVIGEAPEDFNVHKNLKRILA 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +GQ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 655  GRTKTVMDGQNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTY 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 715  TPLQNLSQDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGRLER+LQLC++ P ++P PEK+ RQHQ
Sbjct: 775  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRIFPSPEKLERQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 835  DCNMQIAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSSIDEFTGDSHFQW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   +  + S E I R I+C+GQVY AL++ RE      VAI+R+EQ+ PFP+  L
Sbjct: 895  IIEDPAHASGEIESHEGINRVIICTGQVYAALVKEREARGERDVAITRIEQLNPFPWQQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ +IW QEEPLN GAW++  PRI TL+N ++ H  R    A R PSAS A
Sbjct: 955  KNNLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNETQHHNRRHVMYAGRNPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL  A 
Sbjct: 1015 TGLKTSHKNEEKALLDMAF 1033



>gi|164661599|ref|XP_001731922.1| hypothetical protein MGL_1190 [Malassezia globosa CBS 7966]
 gi|159105823|gb|EDP44708.1| hypothetical protein MGL_1190 [Malassezia globosa CBS 7966]
          Length = 1023

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/551 (62%), Positives = 431/551 (78%), Gaps = 4/551 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAVNFVCQLA EWR  FKKDVVID+VCYR++GHNE+DQP
Sbjct: 451  YPSDIAKAIDAPIFHVNGDDVEAVNFVCQLAVEWRHQFKKDVVIDLVCYRRHGHNEIDQP 510

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQPRMY+ I++Q P L++Y+ +L+++G+  K+++E H +W+W +L E + KSK +VP 
Sbjct: 511  AFTQPRMYKAISQQKPTLQQYIDRLVEEGSLGKKEVEGHLQWIWEMLTEAFEKSKSFVPE 570

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS+W GF SP E+ E+      TG   + L+++GEV +SYP+GF VH  L RILK
Sbjct: 571  ERQWLSSAWEGFPSPTEMQEKILEQRETGVDIDRLKYIGEVSASYPEGFTVHRNLARILK 630

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA++EG+GID  TAEG+AFGSL +E   VR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 631  TRQKAVDEGEGIDMSTAEGMAFGSLAMEKNLVRVSGQDVERGTFSQRHAVLHDQESERTY 690

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA F +CNSSLSE+G LGFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 691  TPLAHLSDDQAPFIICNSSLSEYGALGFELGFSLVDPRNLTIWEAQFGDFANNAQCIIDQ 750

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDDHPY +P  E++ARQHQ
Sbjct: 751  FIASGERKWLQRTGLVMNLPHGYDGQGPEHSSARMERFLQLCDDHPYHFPSKEQLARQHQ 810

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPAN FHVLRRQ+HRDFRKPLI   SKSLLRHP ARSSL+EM   T F+R
Sbjct: 811  DANMAVVYCTTPANLFHVLRRQVHRDFRKPLINLFSKSLLRHPEARSSLSEMGPGTYFQR 870

Query: 421  FIPDPH----PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
            ++P+PH     + L  PE+ITRHIL  GQ YYALL  R +N ++ VAISR+EQ+ P  Y+
Sbjct: 871  YLPEPHETEGKDALVPPEQITRHILTVGQAYYALLNYRRENNINDVAISRIEQVSPLDYE 930

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             L   IDKYPNA+L++AQEEPLN GAW+Y+ PR+RT+ + S+ H+ +    ++R PS+S 
Sbjct: 931  ALLSSIDKYPNADLMFAQEEPLNNGAWSYLEPRLRTICSKSQHHQNKEFLVSSRPPSSSV 990

Query: 537  ATGNKKQHIQE 547
            ATG+K  HI E
Sbjct: 991  ATGHKAAHIAE 1001



>gi|452001107|gb|EMD93567.1| hypothetical protein COCHEDRAFT_1171454 [Bipolaris maydis C5]
 gi|477589909|gb|ENI06984.1| hypothetical protein COCC4DRAFT_164481 [Bipolaris maydis ATCC 48331]
          Length = 1044

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 425/559 (76%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVNFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 476  YCSDIAKAIDAPVFHVNGDDVEAVNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQP 535

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++I++Q   L+ Y +KLL++ TFTKEDI++HK WVW +L+E++++SKDYVP 
Sbjct: 536  FFTQPLMYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFNRSKDYVPN 595

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E  P  PT      L+H+ +VI   P+ FNVH  L RIL 
Sbjct: 596  SREWLTSAWNGFKTPKELATEVLPHLPTAIEESQLKHIAKVIGEAPEDFNVHKNLKRILA 655

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +GQ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 656  GRTKTVMDGQNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTY 715

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 716  TPLQNLSQDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 775

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P PEK+ RQHQ
Sbjct: 776  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPRIFPSPEKLDRQHQ 835

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPL+ F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 836  DCNMQIAYTTKPSNLFHLLRRQMNRQFRKPLVLFFSKSLLRHPIARSSIDEFTGDSHFQW 895

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   +  + S E I R ILC+GQVY AL++ RE      VAI+R+EQ+ PFP+  L
Sbjct: 896  IIEDPAHASGEIESHEGINRVILCTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQL 955

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ +IW QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 956  KDNLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNQTEHHNRRHVMYAGRNPSASVA 1015

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL  A 
Sbjct: 1016 TGLKVSHKNEEKALLDMAF 1034



>gi|189190882|ref|XP_001931780.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973386|gb|EDU40885.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 1043

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/559 (61%), Positives = 425/559 (76%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+NFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 475  YCSDIAKAIDAPVFHVNGDDVEALNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++I++Q   L+ Y +KLL++ TFTKEDI++HK WVW +L+E++ +SKDYVP 
Sbjct: 535  FFTQPLMYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFSRSKDYVPN 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFKSPKELA E  P  PT      L+H+ E I S P+ FNVH  L RIL 
Sbjct: 595  SKEWLTSAWNGFKSPKELATEVLPHLPTAIEESQLKHIAEKIGSAPEDFNVHKNLKRILA 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +G+ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 655  GRTKTVMDGKNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTY 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL DL P QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 715  TPLQDLSPDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P P+K+ RQHQ
Sbjct: 775  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLDRQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPL+ F SKSLLRHP+ARS++ E TGD+ F+ 
Sbjct: 835  DCNMQIAYTTKPSNLFHLLRRQMNRQFRKPLVLFFSKSLLRHPIARSNIEEFTGDSHFQW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   T  + S E I R I+C+GQVY AL++ RE      VAI+R+EQ+ PFP+  L
Sbjct: 895  IIEDPAHATGEIESHEGINRVIICTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ +IW QEEPLN GAW++  PRI TL+N ++ H  R    A R PSAS A
Sbjct: 955  KDNLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNETQHHNRRHVMYAGRNPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL  A 
Sbjct: 1015 TGLKVSHKNEEKALLEMAF 1033



>gi|388579271|gb|EIM19597.1| 2-oxoglutarate dehydrogenase, E1 component [Wallemia sebi CBS
           633.66]
          Length = 1006

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/556 (62%), Positives = 427/556 (76%), Gaps = 1/556 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y +D+AK ++APIFH NGD+ EAV FV QLAA++R  FKKDVVI++VCYRK+GHNE DQP
Sbjct: 439 YPTDIAKSIDAPIFHCNGDNAEAVTFVFQLAADFRAKFKKDVVINLVCYRKHGHNESDQP 498

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY+ IAKQ   L KYV++L ++  FT+  +E+H+K VW+ LE  +  + +Y P 
Sbjct: 499 SFTQPIMYEAIAKQPTALAKYVKQLQQEEAFTETQMEEHRKAVWSKLESAFKNAPNYKPH 558

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            REWLSSSW GF SP +LA    P   TG   E L+++G+VIS++P GF  H  L RI+ 
Sbjct: 559 GREWLSSSWEGFPSPDDLAARVLPTATTGVKQETLENIGKVISTFPDGFTPHKNLARIIG 618

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K + EG+GIDW TAE LAFGSL LE  HVRLSGQDVERGTFSQRHA+L DQ NE+ Y
Sbjct: 619 NRGKMVMEGKGIDWSTAEALAFGSLALEKIHVRLSGQDVERGTFSQRHAILVDQQNESLY 678

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PLN L   QA   VCNSSLSEFGTLG+E GYSLV+P++L LWE QFGDF NN+QCIIDQ
Sbjct: 679 MPLNHLGSRQAGVVVCNSSLSEFGTLGYELGYSLVSPDNLTLWEAQFGDFANNAQCIIDQ 738

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIASGE+KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQL DD+P+  P  E+MARQHQ
Sbjct: 739 FIASGERKWLQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLADDNPFSVPTEEEMARQHQ 798

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCN+Q++  TTPANYFHVLRRQ+HRDFRKPLI F SK+LLRHPMARS+L EMTG+T F+R
Sbjct: 799 DCNIQVVYPTTPANYFHVLRRQVHRDFRKPLILFFSKALLRHPMARSTLEEMTGETQFER 858

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
           +IP+ + E +  PEK+ +HILCSGQVY+ L + RE+ +   VAISRLEQI PFPYDL+  
Sbjct: 859 YIPE-NSEKMVEPEKVRKHILCSGQVYHTLYKEREERQAYDVAISRLEQISPFPYDLIQS 917

Query: 481 HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
           H+DKYPNAE+ W QEEPLN GAW+YV+ R+ TL+  ++ H  R  +   R PS+S ATG+
Sbjct: 918 HLDKYPNAEITWCQEEPLNNGAWSYVSQRLLTLVKQTKHHSERWPQYVGRDPSSSVATGS 977

Query: 541 KKQHIQEEHDLLSQAL 556
           K  H  E   +L  A 
Sbjct: 978 KAVHTTEIKKILDAAF 993



>gi|342876357|gb|EGU77980.1| hypothetical protein FOXB_11498 [Fusarium oxysporum Fo5176]
          Length = 1057

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/566 (60%), Positives = 436/566 (77%), Gaps = 10/566 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+ CYRKYGHNE DQP
Sbjct: 482  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I ++ P ++ YV KL+++G+F+K D+++HK+WVW +LEE++ KSKDY PT
Sbjct: 542  SFTQPLMYKRITEKEPQIDIYVNKLIEEGSFSKADVDEHKQWVWGMLEESFTKSKDYTPT 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E      T      L+H+G VI S P+GF+VH  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEVLATNETSVKSTTLEHIGTVIGSTPEGFHVHRNLKRILA 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 662  NRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTY 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQHLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  EK+ RQHQ
Sbjct: 782  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRDFPTGEKLVRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRK------PLIAFTSKSLLRHPMARSSLAEMTG 414
            DCNMQI   T+PAN FH+LRRQ+HR +RK       L+ F SKSLLRHP+ARS++ E TG
Sbjct: 842  DCNMQIAYMTSPANLFHILRRQMHRQYRKRANLSAALVIFFSKSLLRHPLARSNIEEFTG 901

Query: 415  DTT-FKRFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQIC 471
            +   F+  IPDP  ET  + +PE+I R ILCSGQV+ AL + R +NK+D+VAI+R+EQ+ 
Sbjct: 902  ENAGFQWIIPDPEHETGAIKAPEEIERVILCSGQVWAALHKHRSENKLDNVAITRIEQLN 961

Query: 472  PFPYDLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATR 530
            PFP+  L +++D+YPNA+ ++W QEEPLN GAW++  PRI TL+N++E H  +    A R
Sbjct: 962  PFPWQQLKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGR 1021

Query: 531  LPSASPATGNKKQHIQEEHDLLSQAL 556
             PSAS ATG K+ H++EE +LL  A 
Sbjct: 1022 NPSASVATGLKQVHMKEERELLEMAF 1047



>gi|330915031|ref|XP_003296878.1| hypothetical protein PTT_07092 [Pyrenophora teres f. teres 0-1]
 gi|311330771|gb|EFQ95025.1| hypothetical protein PTT_07092 [Pyrenophora teres f. teres 0-1]
          Length = 1043

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/559 (61%), Positives = 424/559 (75%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+NFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 475  YCSDIAKAIDAPVFHVNGDDVEALNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQP 534

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++I++Q   L+ Y +KLL++ TFTKEDI++HK WVW +L+E++ +SKDYVP 
Sbjct: 535  FFTQPLMYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFSRSKDYVPN 594

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFKSPKELA E  P  PT      L+H+ E I + P+ FNVH  L RIL 
Sbjct: 595  SKEWLTSAWNGFKSPKELATEVLPHLPTAIEESQLKHIAEKIGNAPEDFNVHKNLKRILA 654

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +G+ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 655  GRTKTVMDGKNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTY 714

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL DL   QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 715  TPLQDLSKDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 774

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P P+K+ RQHQ
Sbjct: 775  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLDRQHQ 834

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARS++ E TGD+ F+ 
Sbjct: 835  DCNMQIAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSNIEEFTGDSHFQW 894

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   T  + S E I R I+C+GQVY AL++ RE      VAI+R+EQ+ PFP+  L
Sbjct: 895  IIEDPAHATGEIESHEGINRVIICTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQL 954

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ +IW QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 955  KDNLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNETEHHNRRHVMYAGRNPSASVA 1014

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL  A 
Sbjct: 1015 TGLKVSHKNEEKALLEMAF 1033



>gi|451854945|gb|EMD68237.1| hypothetical protein COCSADRAFT_178113 [Bipolaris sorokiniana ND90Pr]
          Length = 1044

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 424/559 (75%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEAVNFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 476  YCSDIAKAIDAPVFHVNGDDVEAVNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQP 535

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++I++Q   L+ Y +KLL++ TFTKEDI++HK WVW +L+E++++SKDYV  
Sbjct: 536  FFTQPLMYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFNRSKDYVSN 595

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGFK+PKELA E  P  PT      L+H+ +VI   P+ FNVH  L RIL 
Sbjct: 596  SREWLTSAWNGFKTPKELATEVLPHLPTAIEEPQLKHIAKVIGEAPEDFNVHKNLKRILA 655

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +GQ ID  TAE LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ  E  Y
Sbjct: 656  GRTKTVMDGQNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTY 715

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   QA F++ NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 716  TPLQNLSQDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQ 775

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P PEK+ RQHQ
Sbjct: 776  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPRIFPSPEKLDRQHQ 835

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   T P+N FH+LRRQ++R FRKPLI F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 836  DCNMQIAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSSIDEFTGDSHFQW 895

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP   +  + S E I R ILC+GQVY AL++ RE      VAI+R+EQ+ PFP+  L
Sbjct: 896  IIEDPAHASGEIESHEGINRVILCTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQL 955

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D YPNA+ +IW QEEPLN GAW++  PRI TL+N +E H  R    A R PSAS A
Sbjct: 956  KDNLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNQTEHHNRRHVMYAGRNPSASVA 1015

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL  A 
Sbjct: 1016 TGLKVSHKNEEKALLDMAF 1034



>gi|302901631|ref|XP_003048478.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729411|gb|EEU42765.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 1049

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/560 (61%), Positives = 429/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+ CYRK+GHNE DQP
Sbjct: 480  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKHGHNETDQP 539

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I  + P ++ YV KL+++G+FTKEDI++HK+WVW +LEE++ KSKDY PT
Sbjct: 540  SFTQPLMYKRITGKEPQIDIYVDKLIEEGSFTKEDIDEHKQWVWGMLEESFTKSKDYTPT 599

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E      T    + L+H+GE I S P+GF VH  L RIL 
Sbjct: 600  SKEWTTSAWNGFKSPKELATEVLATNETAVKPQTLEHIGEAIGSVPEGFQVHRNLKRILT 659

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID  TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 660  NRTKSVVEGKNIDMSTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTY 719

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 720  TPLQHLSKDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQ 779

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  EK+ RQHQ
Sbjct: 780  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQHQ 839

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTT-FK 419
            DCNMQI   T+PAN FH+LRRQ+HR +RKPL+ F SKSLLRHP+ARS++ E TG+   F+
Sbjct: 840  DCNMQIAYMTSPANLFHILRRQMHRQYRKPLVIFFSKSLLRHPLARSNIEEFTGENAGFQ 899

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  ET  L   E+I R ILCSGQV+ AL + R +N +D+VA +R+EQ+ PFP+  
Sbjct: 900  WIIPDPEHETGVLKPREEIDRVILCSGQVWAALHKYRSENNIDNVAFTRIEQLNPFPWQQ 959

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D+YPNA+ ++WAQEEPLN GAW++  PRI TL+N++E H  +    A R PSAS 
Sbjct: 960  LKENLDQYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNNTEHHNRKHVMYAGRNPSASV 1019

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE + L  A 
Sbjct: 1020 ATGLKSVHNKEEQEFLKMAF 1039



>gi|494832942|gb|EON69053.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Coniosporium apollinis CBS 100218]
          Length = 1057

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/561 (61%), Positives = 431/561 (76%), Gaps = 5/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA NFVCQLAA++R  FKKDVVID+VCYRK GHNE DQP
Sbjct: 487  YCSDIAKAIDAPVFHVNGDDVEAFNFVCQLAADYRAEFKKDVVIDMVCYRKQGHNETDQP 546

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY++IAKQ P L+ Y+ KLL++ TFTKEDIE+HK+WVW +LEE++ +SKDY PT
Sbjct: 547  FFTQPLMYKRIAKQRPALDTYIDKLLEEHTFTKEDIEEHKQWVWGMLEESFARSKDYQPT 606

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            ++EWL+S+WNGFKSPKELA E  P  PT    + L+ +    ++ P+GF+VH  L RIL 
Sbjct: 607  AKEWLTSAWNGFKSPKELATEVLPHLPTAVERDQLEFIAHKTANAPEGFHVHRNLKRILA 666

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + +G+GID  TAE L FG+L +EG HVR+SGQDVERGTFSQRHAVLHDQ NE  +
Sbjct: 667  GREKTVTDGKGIDMATAEALGFGTLCMEGHHVRVSGQDVERGTFSQRHAVLHDQENEETF 726

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PLN+L   QA F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF N +Q IIDQ
Sbjct: 727  TPLNNLSKDQASFVISNSSLSEYGVLGFEYGYSLSSPNALVIWEAQFGDFANTAQVIIDQ 786

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P ++P P+K+ RQHQ
Sbjct: 787  FIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLERQHQ 846

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   T P+N FH+LRRQ++R FRKPLI F SK+LLRHP+ARS++ E TGD+ F+ 
Sbjct: 847  DCNMQVAYLTKPSNMFHILRRQMNRQFRKPLILFFSKNLLRHPLARSNIEEFTGDSHFQW 906

Query: 421  FIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMD--HVAISRLEQICPFPYD 476
             I DP  E+  +A PE+I R ILC+GQVY AL   RE    +   +AI+R+EQ+ PFP+ 
Sbjct: 907  LIRDPAHESGAIAPPEEIDRVILCTGQVYTALHSHRESKGEEGKKIAITRIEQLHPFPWQ 966

Query: 477  LLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSAS 535
             L  ++D YPNA+ ++W QEEPLN GAW++  PRI TL+NH++ H  R    A R PSAS
Sbjct: 967  QLQDNLDSYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNHTKHHNRRHVMYAGRNPSAS 1026

Query: 536  PATGNKKQHIQEEHDLLSQAL 556
             ATG K  H +EE +LL  A 
Sbjct: 1027 VATGLKAVHKREEKELLDIAF 1047



>gi|505755135|gb|EOQ99366.1| hypothetical protein J056_001922 [Wallemia ichthyophaga EXF-994]
          Length = 1290

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/556 (61%), Positives = 425/556 (76%), Gaps = 1/556 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y +D+AK ++APIFH NGD+ EA+ FV QLAA++R  FKKDVVI+ VCYRK+GHNE DQP
Sbjct: 723  YPTDIAKSIDAPIFHCNGDNAEAITFVFQLAADFRAKFKKDVVINQVCYRKHGHNESDQP 782

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+ IAKQ   L KYV++L ++  FT+  +E+H+K VW+ LE  ++ + +Y P 
Sbjct: 783  SFTQPVMYEAIAKQPTALSKYVKQLQQEEAFTETQMEEHRKAVWSKLEGAFNNATNYKPH 842

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLSSSW GF SP +LA    P   TG   E L+++G+VIS++P GF  H  L RI+ 
Sbjct: 843  GREWLSSSWEGFPSPDDLAARVLPTAATGVKQETLENIGKVISTFPDGFTPHKNLARIIN 902

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+GIDW TAE LA GSL LE  HVRLSGQDVERGTFSQRHA+L DQ NE+ Y
Sbjct: 903  NRGKMVMEGKGIDWSTAESLALGSLALEKIHVRLSGQDVERGTFSQRHAILVDQENESLY 962

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN L   QA   VCNSSLSEFG LG+E GYSLV+P++L +WE QFGDF NN+QCIIDQ
Sbjct: 963  MPLNHLGSRQAGVVVCNSSLSEFGALGYELGYSLVSPDNLTIWEAQFGDFANNAQCIIDQ 1022

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE+KWLQR+GLV+ LPHGYDGQGPEHSSGR+ERFLQL DD P+  P  E+MARQHQ
Sbjct: 1023 FIASGERKWLQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLADDSPFKVPTEEEMARQHQ 1082

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+Q++  TTPANYFHVLRRQ+HRDFRKPLI F SKSLLRHPMARS L+EMTG T F+R
Sbjct: 1083 DCNIQVVYPTTPANYFHVLRRQVHRDFRKPLILFFSKSLLRHPMARSELSEMTGQTQFER 1142

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            ++P+ H E +  PEK+ +HILCSGQVY+ L + RE+ +   VAISR+EQI PFPYDL+ +
Sbjct: 1143 YLPENH-EKMVEPEKVRKHILCSGQVYHTLYKEREERQAYDVAISRVEQISPFPYDLIGE 1201

Query: 481  HIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATGN 540
            H+DKYPNAE+ W QEEPLN GAW+YV+ R+ TL+  ++ H  R  +   R PS+S ATG+
Sbjct: 1202 HLDKYPNAEITWCQEEPLNNGAWSYVSQRLLTLVKQTKHHSERWPQYVGRDPSSSVATGS 1261

Query: 541  KKQHIQEEHDLLSQAL 556
            K  H+ E   +L  A 
Sbjct: 1262 KAVHLAEIQKILDGAF 1277



>gi|408395837|gb|EKJ75010.1| hypothetical protein FPSE_04830 [Fusarium pseudograminearum CS3096]
          Length = 1051

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/560 (60%), Positives = 426/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+ CYRKYGHNE DQP
Sbjct: 482  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I  + P ++ YV KL+++G+F+K D+E+HK+WVW +LEE++ KSKDY PT
Sbjct: 542  SFTQPLMYKRINAKEPQIDIYVNKLIEEGSFSKADVEEHKQWVWGMLEESFTKSKDYTPT 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E      T      L+H+G  I S P+GF VH  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEVLATNETNVKSTTLEHIGNAIGSVPEGFQVHRNLKRILS 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 662  NRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTH 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQNLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  EK+ RQHQ
Sbjct: 782  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTT-FK 419
            DCNMQI   T+PAN FH LRRQ+HR +RKPLI F SKSLLRHP+ARS +   TG+   F+
Sbjct: 842  DCNMQIAYFTSPANLFHALRRQMHRQYRKPLIIFFSKSLLRHPLARSDIEAFTGENAGFQ 901

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  ET  + SP++I R +LC+GQV+ AL + R  N +D+VA +R+EQ+ PFP+  
Sbjct: 902  WIIPDPEHETGAIKSPDQIERVVLCTGQVWAALHKYRADNNIDNVAFTRIEQLNPFPWQQ 961

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D+YPNA+ ++W QEEPLN GAW++  PRI TL+N++E H  +    A R PSAS 
Sbjct: 962  LKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSASV 1021

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE D L  A 
Sbjct: 1022 ATGLKNVHTKEEKDFLEMAF 1041



>gi|46116934|ref|XP_384485.1| hypothetical protein FG04309.1 [Fusarium graminearum PH-1]
          Length = 1051

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/560 (60%), Positives = 426/560 (76%), Gaps = 4/560 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  F+ DVVID+ CYRKYGHNE DQP
Sbjct: 482  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQP 541

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I  + P ++ YV KL+++G+F+K D+E+HK+WVW +LEE++ KSKDY PT
Sbjct: 542  SFTQPLMYKRINAKEPQIDIYVNKLIEEGSFSKADVEEHKQWVWGMLEESFTKSKDYTPT 601

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E      T      L+H+G  I S P+GF VH  L RIL 
Sbjct: 602  SKEWTTSAWNGFKSPKELATEVLATNETNVKSTTLEHIGNAIGSVPEGFQVHRNLKRILS 661

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+ ID+PTAE LAFG+L+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  +
Sbjct: 662  NRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTH 721

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   Q KF + NSSLSEFG LGFEYGYSL +P++L++WE QFGDF NN+QCIIDQ
Sbjct: 722  TPLQNLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQ 781

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KW+QRTGLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  EK+ RQHQ
Sbjct: 782  FIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQHQ 841

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTT-FK 419
            DCNMQI   T+PAN FH LRRQ+HR +RKPLI F SKSLLRHP+ARS +   TG+   F+
Sbjct: 842  DCNMQIAYFTSPANLFHALRRQMHRQYRKPLIIFFSKSLLRHPLARSDIEAFTGENAGFQ 901

Query: 420  RFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDL 477
              IPDP  ET  + SP++I R +LC+GQV+ AL + R  N +D+VA +R+EQ+ PFP+  
Sbjct: 902  WIIPDPEHETGAIKSPDQIERVVLCTGQVWAALHKYRADNNIDNVAFTRIEQLNPFPWQQ 961

Query: 478  LSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
            L +++D+YPNA+ ++W QEEPLN GAW++  PRI TL+N++E H  +    A R PSAS 
Sbjct: 962  LKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSASV 1021

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG K  H +EE D L  A 
Sbjct: 1022 ATGLKNVHTKEEKDFLEMAF 1041



>gi|465792746|emb|CCU97988.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 1021

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/551 (61%), Positives = 419/551 (76%), Gaps = 4/551 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVNGDDVEAVN+VC LA +WR  FKKDVVID+VCYR++GHNE+DQP
Sbjct: 452  YPSDIAKGIDAPIFHVNGDDVEAVNYVCGLAVDWRTKFKKDVVIDLVCYRRHGHNEIDQP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ I KQ P L++Y+ +L+++GTFT++ +  H +WVW +L+E + KSK Y P 
Sbjct: 512  SFTQPRMYEAIGKQLPTLKQYINRLVEEGTFTEKQLNDHCEWVWGMLQEAFEKSKTYEPE 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS+W GF SP+EL E       TG   E L+++G+  +S+P+ F VH  LVRIL+
Sbjct: 572  ERQWLSSAWEGFPSPRELKEHILEQRETGVDVERLRYIGKASASFPEDFTVHRNLVRILR 631

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +  G+GID  TAE LAFGSL++E   VR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 632  NREKTLETGEGIDMSTAEALAFGSLVMENNMVRVSGQDVERGTFSQRHAVLHDQKSENTY 691

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPL  L   QA F++CNSSLSEFG LGFE G+SLV+P +L +WE QFGDF NN+QCIIDQ
Sbjct: 692  VPLQHLSDDQAPFTICNSSLSEFGALGFELGFSLVDPKNLTIWEAQFGDFANNAQCIIDQ 751

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQRTGLVV LPHGYDGQGPEHSS R ERFL L DDHPY +P  E++ARQHQ
Sbjct: 752  FIASGEHKWLQRTGLVVNLPHGYDGQGPEHSSARPERFLLLMDDHPYRFPNSEQVARQHQ 811

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NM ++  TTPAN FHVLRRQ+HRDFRKPLI   SKSLLRHP ARS L EM   T+F+R
Sbjct: 812  DANMAVVYCTTPANLFHVLRRQVHRDFRKPLINLFSKSLLRHPEARSKLEEMGPGTSFQR 871

Query: 421  FIPDPH----PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
             IP+PH     + L SPE+I RHIL  GQ YYALL  R +N++  VAI+R+EQI P  Y+
Sbjct: 872  VIPEPHETEGKDALVSPEQIKRHILTVGQSYYALLNHRRENEIKDVAITRIEQIAPLDYE 931

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             +   +DKYPNA+L++AQEEP+N GAW Y+ PR+RTL   ++ H+GR    + R PS+S 
Sbjct: 932  TIVAALDKYPNADLMFAQEEPVNNGAWLYLEPRLRTLCTKTQHHKGREFMVSARPPSSSV 991

Query: 537  ATGNKKQHIQE 547
            ATGNK  H+ E
Sbjct: 992  ATGNKGAHLAE 1002



>gi|154287386|ref|XP_001544488.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Ajellomyces capsulatus NAm1]
 gi|150408129|gb|EDN03670.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Ajellomyces capsulatus NAm1]
          Length = 1054

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 423/559 (75%), Gaps = 15/559 (2%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++AP+FHVNGDDVEA+N+VCQ+AA+WR TFK+DVVIDIVCYRK GHNE DQP
Sbjct: 498  YCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRKQGHNETDQP 557

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA+QT  L+             K DIE+HKKWVW +L +++ +SKDY P+
Sbjct: 558  SFTQPLMYKRIAEQTNQLD------------NKADIEEHKKWVWGMLNDSFDRSKDYQPS 605

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EWL+S+WNGFK+PKELA E  P  PTG   E L+ +G+V+ S P+ F VH  L RIL 
Sbjct: 606  SKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKRIGDVLGSIPENFTVHRNLKRILA 665

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K + EG+ IDW TAE LAFGSL  EG HVR+SGQDVERGTFSQRHAVLHDQ NET Y
Sbjct: 666  NRKKTVEEGENIDWSTAEALAFGSLCAEGHHVRISGQDVERGTFSQRHAVLHDQENETTY 725

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  + P Q KF + NSSLSEFG LGFEYGYSL +P++ ++WE QFGDF NN+QCIIDQ
Sbjct: 726  TSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQCIIDQ 785

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIASGE KWLQR+GLV+ LPHGYDGQGPEHSS R+ER+LQLC++ P V+P P+++ RQHQ
Sbjct: 786  FIASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPAPDRIDRQHQ 845

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FHV+RRQ++R FRKPLI F SKSLLRHP+ RS L++ TGD+ F+ 
Sbjct: 846  DCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGDSHFQW 905

Query: 421  FIPDPH--PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP     +L + E I R ILCSGQVY AL + R  + +++ AI+R+EQ+ PFP+  L
Sbjct: 906  IIADPEHGSSSLNNHEDIERVILCSGQVYAALQKHRAAHGINNTAITRIEQMHPFPWQQL 965

Query: 479  SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             +++D YPNA +++W QEEPLN GAW+Y+ PRI TL+N +  H  R    A R PSAS A
Sbjct: 966  KENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETVHHNRRHVLYAGRNPSASVA 1025

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H++EE DLL  A 
Sbjct: 1026 TGLKASHVKEEQDLLQDAF 1044



>gi|470316446|gb|EMR08200.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Pneumocystis murina B123]
          Length = 1025

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/559 (59%), Positives = 433/559 (77%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSD+AK ++APIFHVNGDDVEA+ F+C++A+EWR TFKKDVVIDIVCYR++GHNE DQP
Sbjct: 464  YCSDIAKSIDAPIFHVNGDDVEALVFICKIASEWRATFKKDVVIDIVCYRRHGHNETDQP 523

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++I +QT  LEKY ++L+K+G+F+++DI +HKK VW+ILE ++ K+K+Y PT
Sbjct: 524  SFTQPLMYRKIIEQTSTLEKYAKQLIKEGSFSEKDINEHKKCVWDILESSFKKAKNYKPT 583

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+S+WNGF SP++L  ++ P  PT    E L+++G  I  YPK FN+H  L RI++
Sbjct: 584  SREWLTSAWNGFASPRDLTVKNFPHLPTSVDKETLKNLGRKIFLYPKDFNIHPNLKRIIR 643

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA +I E + IDW T E LAF +LL+EG HVRLSGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 644  NRALSIEEEKNIDWATGEALAFATLLMEGCHVRLSGQDVERGTFSQRHAVLHDQENEDTY 703

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN + P QAKF + NSSLSEFG LGFEYGYSL++PNSL++WE QFGDF NN+QCIIDQ
Sbjct: 704  IPLNFIDPKQAKFVISNSSLSEFGVLGFEYGYSLISPNSLVVWEAQFGDFANNAQCIIDQ 763

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIAS E KW QR+G+++ LPHGYDGQGPEHSSGR+ER+LQL +D   V+P  E++ RQHQ
Sbjct: 764  FIASAEVKWRQRSGIILSLPHGYDGQGPEHSSGRIERYLQLVNDDYRVFPSKERLQRQHQ 823

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            +CN+QI   TTPAN FH+LRRQIHR+FRKPLI F SKSLLRHP+A S+L+E + ++ F+R
Sbjct: 824  ECNIQIAYPTTPANLFHLLRRQIHREFRKPLIMFFSKSLLRHPLACSNLSEFSQNSHFQR 883

Query: 421  FIPDP-HPETLASPEKI-TRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             + DP H      P ++  + ILC+GQ+Y +L + R++ K++  AI R EQI PF +  L
Sbjct: 884  ILDDPGHENGFLKPRELCNKLILCTGQIYVSLYKERQERKINDTAIVRCEQIHPFHFQGL 943

Query: 479  SQHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             + +D YPN  ELIW QEEPLN GAW Y+ PR++T++  ++ H+ +  K   RLPSAS A
Sbjct: 944  KECLDSYPNLKELIWCQEEPLNAGAWQYIQPRLKTVLRETQVHKNKKIKYVGRLPSASVA 1003

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TGNK QH QE  +L+  A 
Sbjct: 1004 TGNKIQHKQEHEELIRNAF 1022



>gi|430811116|emb|CCJ31407.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 939

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/559 (59%), Positives = 429/559 (76%), Gaps = 3/559 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YCSD+AK ++APIFH+NGDDVEA+ F+C++A+EWR TFKKDVVIDIVCYRK+GHNE DQP
Sbjct: 376 YCSDIAKSIDAPIFHINGDDVEALVFICKIASEWRATFKKDVVIDIVCYRKHGHNETDQP 435

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++I +QTP LEKY +KL+ +G+F+++DI++HKK VW+ LE ++ K+KDY PT
Sbjct: 436 SFTQPLMYRKIMEQTPTLEKYTRKLISEGSFSEKDIQEHKKCVWDTLESSFKKAKDYKPT 495

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            REWL+S+WNGF SP++L  +    +PT  + E L+ +G  I SYPK F++H  L RI+K
Sbjct: 496 PREWLTSAWNGFASPRDLIIKDFNHFPTSVNKEALKGIGRKIFSYPKDFHIHPNLKRIMK 555

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R  +I + + IDW T E LAF +LL EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 556 NRLTSIEDEKNIDWATGEALAFATLLTEGCHVRVSGQDVERGTFSQRHAVLHDQENENTY 615

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           + LN + P QAKF + NSSLSE+G LGFEYGYSL++PNSL++WE QFGDF NN+QCIIDQ
Sbjct: 616 ISLNYIDPNQAKFVISNSSLSEYGVLGFEYGYSLISPNSLVVWEAQFGDFANNAQCIIDQ 675

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIAS E KW QR+G+V+ LPHGYDGQGPEHSSGR+ERFLQL +D   V+P  EK  RQ+Q
Sbjct: 676 FIASAEVKWHQRSGIVLSLPHGYDGQGPEHSSGRIERFLQLANDDYRVFPSKEKFQRQYQ 735

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           +CN+QI   TTPAN FH+LRRQI R+FRKPLI F SK+LLRHP+ARS+L+E +GD+ F+ 
Sbjct: 736 ECNIQIAYPTTPANLFHILRRQIRREFRKPLILFFSKALLRHPLARSNLSEFSGDSHFQS 795

Query: 421 FIPD-PHPETLASPEKI-TRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
            + D  H   +  P ++  + ILC+GQ+Y +L + RE+ K+D  AI R EQI PF +  L
Sbjct: 796 ILSDHDHKNGILKPHELCNKLILCTGQIYVSLYKEREERKIDDTAILRCEQIHPFDFQGL 855

Query: 479 SQHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
            + +D YPN  E++W QEEPLN GAW YV PR+ T++N ++ H+ +  + A R PSAS A
Sbjct: 856 KECLDSYPNLKEIVWCQEEPLNAGAWQYVQPRLETVLNKTQAHKDKKVRYAGRPPSASVA 915

Query: 538 TGNKKQHIQEEHDLLSQAL 556
           TGNK QH QE  DL+ +A 
Sbjct: 916 TGNKTQHKQEHDDLIREAF 934



>gi|19112564|ref|NP_595772.1| alpha-ketoglutarate dehydrogenase [Schizosaccharomyces pombe 972h-]
 gi|74626854|sp|O74378.1|ODO1_SCHPO RecName: Full=2-oxoglutarate dehydrogenase, mitochondrial; AltName:
            Full=2-oxoglutarate dehydrogenase complex component E1;
            Short=OGDC-E1; AltName: Full=Alpha-ketoglutarate
            dehydrogenase; Flags: Precursor
 gi|3417411|emb|CAA20299.1| 2-oxoglutarate dehydrogenase (lipoamide) (e1 component of
            oxoglutarate dehydrogenase complex) (predicted)
            [Schizosaccharomyces pombe]
          Length = 1009

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/559 (58%), Positives = 424/559 (75%), Gaps = 4/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK + APIFHVNGDDVEAV F+CQLAA+WR+ FK DVV+DIVCYR++GHNE DQP
Sbjct: 453  YCTDIAKSMEAPIFHVNGDDVEAVTFICQLAADWRKAFKTDVVVDIVCYRRHGHNETDQP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQPRMY+ IAK  P  + Y Q+LL++ T +K +++  +K VW+ILE ++  SK+Y   
Sbjct: 513  SFTQPRMYKAIAKHPPTFKIYTQQLLQEKTVSKAEVDAQEKRVWDILESSFESSKNYKSD 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWLS+ W GF SPK+L  +  P+YPTG + + L+ +G+ + + P+GF+ H  L RIL 
Sbjct: 573  HREWLSNPWVGFASPKDLMTKILPSYPTGVNIDTLKQIGKALYTLPEGFDAHRNLKRILN 632

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I+ G+GID PTAE LAFG+LL EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 633  NRNKSISSGEGIDMPTAEALAFGTLLEEGHHVRVSGQDVERGTFSQRHAVLHDQSSENVY 692

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN L P QA F + NSSLSE+G LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 693  IPLNHLSPNQASFVIRNSSLSEYGVLGFEYGYSLSSPNALVVWEAQFGDFANNAQCIIDQ 752

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE KWLQRTG+V+ LPHGYDGQGPEHSS R+ER+LQLC++ P  +P  EK+ RQHQ
Sbjct: 753  FIAAGETKWLQRTGIVLSLPHGYDGQGPEHSSARMERYLQLCNEDPREFPSEEKLQRQHQ 812

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+Q I  T P+ YFH LRR IHR FRKPL+ F SKSLLRHP ARS++ E      FK 
Sbjct: 813  DCNIQAIYVTKPSQYFHALRRNIHRQFRKPLVIFFSKSLLRHPAARSTIDEFDEKHGFKL 872

Query: 421  FI-PDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             +  + H +++  PEKI + I+CSGQV+ AL +ARE+NK+D++AI+R+EQ+ PF +  ++
Sbjct: 873  ILEEEEHGKSILPPEKIEKLIICSGQVWVALSKAREENKIDNIAITRVEQLHPFGWKQMA 932

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             +I +YPN  E+IW QEEPLN GAWTY+ PRI T++ H  R      + A R PSAS A 
Sbjct: 933  ANISQYPNLKEIIWCQEEPLNAGAWTYMEPRIYTILKHLGR--DLPVRYAGRPPSASVAA 990

Query: 539  GNKKQHIQEEHDLLSQALI 557
            GNK+QH+ E+   L+ AL+
Sbjct: 991  GNKQQHLAEQEQFLNDALL 1009



>gi|448085949|ref|XP_004195984.1| Piso0_005419 [Millerozyma farinosa CBS 7064]
 gi|359377406|emb|CCE85789.1| Piso0_005419 [Millerozyma farinosa CBS 7064]
          Length = 998

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/558 (58%), Positives = 415/558 (74%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVE+  F+C LAAEWR TF  DV+ID+VCYRKYGHNE DQP
Sbjct: 438 YPSDIAKSINAPIFHVNADDVESCIFMCNLAAEWRATFHTDVIIDLVCYRKYGHNETDQP 497

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA++  +++ Y ++L+++GTFT EDI++HKKWVWNILEE++ KSK+Y PT
Sbjct: 498 SFTQPLMYKKIAEKKSVIDYYTKQLIEEGTFTAEDIDEHKKWVWNILEESFSKSKEYEPT 557

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT    E L+ +G+ +S  PKGF++H  L RIL 
Sbjct: 558 SREWLTTPWEDFKSPKELATEVLPHLPTTVEEETLKKIGKAVSEVPKGFDLHRNLKRILN 617

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K +  G+GIDW T E LAFGSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  +
Sbjct: 618 NRKKTVETGEGIDWATGEALAFGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQSSEQTH 677

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN L   QA F + NSSLSEFG +GFEYGYSL +P++ ++WE QFGDF NN+Q +IDQ
Sbjct: 678 TPLNHLSDSQAPFVITNSSLSEFGVMGFEYGYSLFSPDAFVMWEAQFGDFANNAQVMIDQ 737

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIAS E KW QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++    +P PEK+ RQHQ
Sbjct: 738 FIASAESKWKQRSGVVLSLPHGYDGQGPEHSSGRIERYLQLCNEDQRYFPAPEKLERQHQ 797

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           D NMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+A+S+++E TGD+ F+ 
Sbjct: 798 DANMQVAYPTTPANLFHLLRRQMHRQFRKPLILFFSKSLLRHPLAKSNMSEFTGDSHFQW 857

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I DP   ++++S E I R +LCSGQV+ AL + R   +    A  R+EQ+ PFP+  L 
Sbjct: 858 IIEDPELDKSISSKEGIKRVVLCSGQVFTALHKKRAAIEDKTTAFIRIEQLHPFPFAQLR 917

Query: 480 QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             +D YPN E L+W QEEPLN G+++Y APRI T++  +  H+G   + A R PSAS A 
Sbjct: 918 DTLDTYPNLEDLVWVQEEPLNFGSYSYSAPRIATILEQTNNHKGLTLRYAGRDPSASIAA 977

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G K  H  EE   L +A 
Sbjct: 978 GTKSMHTAEEEAFLKEAF 995



>gi|448081469|ref|XP_004194897.1| Piso0_005419 [Millerozyma farinosa CBS 7064]
 gi|359376319|emb|CCE86901.1| Piso0_005419 [Millerozyma farinosa CBS 7064]
          Length = 998

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/558 (59%), Positives = 414/558 (74%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVE+  FV  LAAEWR TF  DV+ID+VCYRK+GHNE DQP
Sbjct: 438 YPSDIAKSINAPIFHVNADDVESSIFVFNLAAEWRATFHTDVIIDVVCYRKHGHNETDQP 497

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA++  +++ Y ++L+++GTFT EDI++HKKWVWNILEE++ KSK+Y PT
Sbjct: 498 SFTQPLMYKKIAEKKSVIDYYTKQLIEEGTFTAEDIDEHKKWVWNILEESFSKSKEYEPT 557

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT    E L+ +G+ +S  PKGF++H  L RIL 
Sbjct: 558 SREWLTTPWEDFKSPKELATEVLPHLPTAVDEETLKKIGKTVSEVPKGFDLHRNLKRILN 617

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K +  G+GIDW T E LAFGSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 618 NRKKTVETGEGIDWATGEALAFGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQSSEQTY 677

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN L   QA F + NSSLSEFG +GFEYGYSL +P++ + WE QFGDF NN+Q +IDQ
Sbjct: 678 TPLNHLSDSQAPFVISNSSLSEFGVMGFEYGYSLFSPDAFVQWEAQFGDFANNAQVMIDQ 737

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIAS E KW QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++    +P PEK+ RQHQ
Sbjct: 738 FIASAESKWKQRSGVVLSLPHGYDGQGPEHSSGRIERYLQLCNEDQRYFPAPEKLERQHQ 797

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           D NMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+A+S+++E TGD+ F+ 
Sbjct: 798 DANMQVAYPTTPANLFHLLRRQMHRQFRKPLILFFSKSLLRHPLAKSNMSEFTGDSHFQW 857

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I DP   ++++S E I R +LCSGQV+ AL + R   +    A  R+EQ+ PFP+  L 
Sbjct: 858 IIEDPELGKSISSKEGIKRVVLCSGQVFTALHKKRAAIEDKTTAFIRIEQLHPFPFAQLR 917

Query: 480 QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             +D YPN E L+W QEEPLN G+++Y APRI T++  +  H+G   + A R PSAS A 
Sbjct: 918 DALDTYPNLEDLVWVQEEPLNFGSYSYSAPRIATILEQTNNHKGLTLRYAGRDPSASIAA 977

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G K  HI EE   L +A 
Sbjct: 978 GTKSMHIAEEEAFLREAF 995



>gi|354543523|emb|CCE40242.1| hypothetical protein CPAR2_102800 [Candida parapsilosis]
          Length = 1001

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/557 (57%), Positives = 419/557 (75%), Gaps = 5/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVEA  FV  LAAEWR T+  D +ID+V YRK+GHNE DQP
Sbjct: 447 YPSDIAKSINAPIFHVNADDVEACTFVFNLAAEWRATYHTDCIIDLVGYRKHGHNETDQP 506

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IAK+  +++ Y ++L+K+GTFT+EDI++HKKWVWN+LEE++ K+KDY PT
Sbjct: 507 SFTQPLMYQEIAKKKSVIDIYTEQLVKEGTFTREDIDEHKKWVWNLLEESFSKAKDYQPT 566

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P +PTG   ++L+ +G+ IS  P+GF +H  L RIL 
Sbjct: 567 SREWLTTPWEDFKSPKELATEVLPHFPTGVDADILKKIGDAISEAPEGFEIHRNLKRILN 626

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA+  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  +
Sbjct: 627 QRKKAVETGEGIDYSTGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQKSEKTW 686

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL +L   Q  FS+ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q IIDQ
Sbjct: 687 TPLANLSEDQGVFSISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVIIDQ 746

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F++  E KW+QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 747 FVSGAESKWMQRSGVVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRYFPSPEKLERQHQ 806

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+ARS+L++ TGD+ F+ 
Sbjct: 807 DCNMQVAYPTTPANVFHLLRRQMHRQFRKPLILFFSKSLLRHPLARSNLSDFTGDSQFQW 866

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     +    ++ R +LC+GQ++ A+ + REQ      A  ++EQ+ PFP+  L  
Sbjct: 867 IIED----VVGDKSEVKRLVLCTGQIHAAMHKRREQTNDKSTAFIKIEQLNPFPFAQLRD 922

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            ++ YPN E L+WAQEEPLN GAW+++ PR+  +++ +++H G   + A R PSAS A G
Sbjct: 923 ALNTYPNIEDLVWAQEEPLNMGAWSFIEPRVNVVLDKTDKHGGLNIRYAGRDPSASIAAG 982

Query: 540 NKKQHIQEEHDLLSQAL 556
            K +H+ EE ++L++  
Sbjct: 983 TKAKHLAEEEEVLNEVF 999



>gi|344232738|gb|EGV64611.1| 2-oxoglutarate dehydrogenase, E1 component [Candida tenuis ATCC
            10573]
          Length = 1009

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 411/558 (73%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK +NAPIFHVN DDVE++ FV  LAAEWR TF  DV+ID+V YRKYGHNE DQP
Sbjct: 450  YPSDIAKSINAPIFHVNSDDVESLVFVFNLAAEWRSTFHSDVIIDVVGYRKYGHNETDQP 509

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA++  +LE+Y  +LL + TFT+EDI++HKKWVWN+LEE++ KSK+Y PT
Sbjct: 510  AFTQPLMYKKIAEKKSVLEEYTAQLLAEKTFTQEDIDEHKKWVWNLLEESFAKSKEYKPT 569

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL++ W  FKSPKELA E  P  PT     +L+ +G  IS  PKGF +H  L RIL 
Sbjct: 570  SREWLTTPWEDFKSPKELATEVLPHLPTAVDEAILKDIGTKISEAPKGFEIHRNLKRILN 629

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+++ G+GIDW T E LAFGSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  +
Sbjct: 630  TRKKSVDTGEGIDWATGEALAFGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQTSEQTH 689

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PLN+L   Q  F++ NSSLSE+G +GFEYGYSL +P++L++WEGQFGDF N +Q IIDQ
Sbjct: 690  TPLNNLSEDQGAFAISNSSLSEYGVMGFEYGYSLTSPDALVVWEGQFGDFANTAQVIIDQ 749

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+ E KW QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 750  FIAAAESKWKQRSGIVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRYFPSPEKLERQHQ 809

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQI   TTP+N FH+LRRQ+HR FRKPLI F SKSLLRHP+ARS L E T D+ F+ 
Sbjct: 810  DCNMQIAYPTTPSNIFHLLRRQMHRQFRKPLILFFSKSLLRHPLARSELKEFTDDSHFQW 869

Query: 421  FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D    +++ + E I R +LC+GQVY AL + R   +    A  ++EQ+ PFP+  L 
Sbjct: 870  IIEDVELGKSIGNKEDIKRIVLCTGQVYTALHKKRIALEDTTTAFIKVEQLHPFPFQQLR 929

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              +D YPN E L+W QEEPLN G + YV PR+ T +  +E H+    + A R PSAS A 
Sbjct: 930  DALDSYPNVEDLVWCQEEPLNMGPFAYVQPRLLTTLAETENHKSLTLRYAGRDPSASVAA 989

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H QEE   L++  
Sbjct: 990  GSKAMHTQEEEAFLNETF 1007



>gi|448516366|ref|XP_003867551.1| Kgd1 2-oxoglutarate dehydrogenase [Candida orthopsilosis Co 90-125]
 gi|380351890|emb|CCG22114.1| Kgd1 2-oxoglutarate dehydrogenase [Candida orthopsilosis]
          Length = 1001

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/557 (57%), Positives = 417/557 (74%), Gaps = 5/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVEA  FV  LAAEWR  +  D +ID+V YRK+GHNE DQP
Sbjct: 447 YPSDIAKSINAPIFHVNADDVEACTFVFNLAAEWRAKYHTDCIIDLVGYRKHGHNETDQP 506

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IAK+  +++ Y  +L+++GTFT+EDI++HKKWVWN+LEE++ K+KDY PT
Sbjct: 507 SFTQPLMYQEIAKKKSVIDIYTNQLVEEGTFTREDIDEHKKWVWNLLEESFSKAKDYQPT 566

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P +PTG   + L+ +G  IS  P+GF +H  L RIL 
Sbjct: 567 SREWLTTPWEDFKSPKELATEVLPHFPTGVDEDTLKKIGVAISEAPEGFEIHRNLKRILN 626

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA+  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  +
Sbjct: 627 QRKKAVETGEGIDYSTGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQKSEKTW 686

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL +L   Q  FS+ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q IIDQ
Sbjct: 687 TPLANLSEDQGVFSISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVIIDQ 746

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F++  E KW+QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 747 FVSGAESKWMQRSGVVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRYFPSPEKLERQHQ 806

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 807 DCNMQVAYPTTPANIFHLLRRQMHRQFRKPLILFFSKSLLRHPLARSNLSEFTGDSQFQW 866

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L    ++ R +LC+GQ++ A+ + REQ K +  A  ++EQ+ PFP+  L  
Sbjct: 867 IIED----VLGDKSEVKRLVLCTGQIHSAMHKRREQTKDNSTAFIKIEQLNPFPFAQLRD 922

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            +++YPN E L+WAQEEPLN GAW++V PR+  +++ ++++     + A R PSAS A G
Sbjct: 923 ALNEYPNIEDLVWAQEEPLNMGAWSFVEPRVHVVLDKTDKYADLKMRYAGRDPSASIAAG 982

Query: 540 NKKQHIQEEHDLLSQAL 556
            K +H+ EE ++L++  
Sbjct: 983 TKAKHLAEEEEILNEVF 999



>gi|190347141|gb|EDK39362.2| hypothetical protein PGUG_03460 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 997

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 410/558 (73%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVEA+ FV  LAAEWR TF  DV+ID+V YRKYGHNE DQP
Sbjct: 437 YPSDIAKAINAPIFHVNADDVEAMVFVFNLAAEWRATFHSDVLIDVVGYRKYGHNETDQP 496

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA++  +L+ Y ++L+K+ TFTKEDI++HKKW W +LEE++ KSKDY PT
Sbjct: 497 SFTQPLMYRKIAEKKSVLDYYTEQLIKEKTFTKEDIDEHKKWCWGMLEESFKKSKDYQPT 556

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT    + L+ +G+VIS  PKGF +H  L RIL 
Sbjct: 557 SREWLTTPWEDFKSPKELATEVLPHLPTAVEEDTLKKIGDVISDAPKGFEIHRNLKRILN 616

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA+  G+GIDW T E LAFGSL+LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 617 TRKKAVETGEGIDWSTGEALAFGSLVLEGYHVRVSGQDVERGTFSQRHAVLHDQSSEQTY 676

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN L   QA F + NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q +IDQ
Sbjct: 677 TPLNHLSEDQAAFVISNSSLSEYGVMGFEYGYSLTSPDALVMWEAQFGDFANTAQVVIDQ 736

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+ E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 737 FIAAAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRYFPAPEKLERQHQ 796

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           D NMQ+   TTPAN FH+LRRQ+HR FRKPL  F SKSLLRHP+ARS L++ TGD+ F+ 
Sbjct: 797 DANMQVAYPTTPANLFHLLRRQMHRQFRKPLALFFSKSLLRHPLARSQLSDFTGDSHFQW 856

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D    +++++ E I R I+C+GQVY AL + R   +    AI ++EQ+ PFP+  L 
Sbjct: 857 IIDDVELGKSISAKEDIKRLIICTGQVYTALHKKRASLEDKSTAIVKVEQLHPFPFAQLR 916

Query: 480 QHIDKYPNAELI-WAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ++ YP  E I W QEEPLN G+W+YVAPR  T +  +++++    +   R PSAS A 
Sbjct: 917 DTLNSYPGLEDIAWCQEEPLNMGSWSYVAPRFATTLKETDKYKDLTLRYCGRDPSASVAA 976

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G+K  H  EE   L  A 
Sbjct: 977 GSKGMHTGEEEKFLEAAF 994



>gi|210076290|ref|XP_504734.2| YALI0E33517p [Yarrowia lipolytica]
 gi|199426995|emb|CAG80338.2| YALI0E33517p [Yarrowia lipolytica CLIB122]
          Length = 1004

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/558 (59%), Positives = 415/558 (74%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN DD+EAV+F+  LAA+WR TFK DV+ID+VCYRK+GHNE DQP
Sbjct: 441 YPSDLAKSIDAPIFHVNADDMEAVDFIFNLAADWRATFKSDVIIDLVCYRKFGHNETDQP 500

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA +   L+ YV KLLK+ TFTKEDIE+HK+WVW +LEE++ KSKDYVP 
Sbjct: 501 SFTQPLMYKKIADKPNPLDIYVDKLLKEKTFTKEDIEEHKQWVWGMLEESFKKSKDYVPH 560

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +EWL+S W+ FK+PKELA E  P  PT    + L+ +G+VISS P+GF +H  L RIL 
Sbjct: 561 QKEWLASPWDDFKTPKELATEILPHLPTSVEEKKLKEIGKVISSVPEGFTLHRNLKRILS 620

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K++ EG GIDW T E LAFG+LL EG HVRLSGQDVERGTFSQRHAV+HDQVNET Y
Sbjct: 621 NRGKSVEEGHGIDWSTGEALAFGTLLEEGHHVRLSGQDVERGTFSQRHAVVHDQVNETTY 680

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           VPLN L   QA F+V NS LSE+G +GFEYGYSL +P +L++WE QFGDF N +Q IIDQ
Sbjct: 681 VPLNHLTKDQADFTVSNSHLSEYGVMGFEYGYSLASPEALVIWEAQFGDFANTAQVIIDQ 740

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIAS E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+L L ++ P  +P P+K+ RQHQ
Sbjct: 741 FIASAETKWSQRSGLVLSLPHGYDGQGPEHSSGRIERYLLLGNEDPLHFPSPDKLERQHQ 800

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCN+QI   TTPAN FH+ RRQ+HR FRKPL  F SK+LLR+PMA+S L+E  G++ F+ 
Sbjct: 801 DCNIQIAYPTTPANIFHLYRRQMHRAFRKPLACFFSKNLLRNPMAKSDLSEFVGESHFQW 860

Query: 421 FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D  H +T+ + E I R + CSGQV+ AL + RE       AI R+EQ+ PFP++ + 
Sbjct: 861 VIEDDQHGKTINNKEGIERVLFCSGQVWTALFKRREDLADKKTAIIRIEQLHPFPWEQVR 920

Query: 480 QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
           + +D YPN  ++ WAQEEPLN GAW ++ PR+ T    ++ H+    + A R PSAS A 
Sbjct: 921 ELLDSYPNLKDICWAQEEPLNAGAWVHIQPRMYTTFQATKNHKHAHIRYAGRKPSASVAA 980

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G KK H+ EE  LL QA 
Sbjct: 981 GTKKLHLAEEEALLKQAF 998



>gi|146416219|ref|XP_001484079.1| hypothetical protein PGUG_03460 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 997

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 410/558 (73%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVEA+ FV  LAAEWR TF  DV+ID+V YRKYGHNE DQP
Sbjct: 437 YPSDIAKAINAPIFHVNADDVEAMVFVFNLAAEWRATFHSDVLIDVVGYRKYGHNETDQP 496

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA++  +L+ Y ++L+K+ TFTKEDI++HKKW W +LEE++ KSKDY PT
Sbjct: 497 SFTQPLMYRKIAEKKSVLDYYTEQLIKEKTFTKEDIDEHKKWCWGMLEESFKKSKDYQPT 556

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT    + L+ +G+VIS  PKGF +H  L RIL 
Sbjct: 557 SREWLTTPWEDFKSPKELATEVLPHLPTAVEEDTLKKIGDVISDAPKGFEIHRNLKRILN 616

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA+  G+GIDW T E LAFGSL+LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 617 TRKKAVETGEGIDWSTGEALAFGSLVLEGYHVRVSGQDVERGTFSQRHAVLHDQSSEQTY 676

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN L   QA F + NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q +IDQ
Sbjct: 677 TPLNHLSEDQAAFVISNSSLSEYGVMGFEYGYSLTSPDALVMWEAQFGDFANTAQVVIDQ 736

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+ E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 737 FIAAAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRYFPAPEKLERQHQ 796

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           D NMQ+   TTPAN FH+LRRQ+HR FRKPL  F SKSLLRHP+ARS L++ TGD+ F+ 
Sbjct: 797 DANMQVAYPTTPANLFHLLRRQMHRQFRKPLALFFSKSLLRHPLARSQLSDFTGDSHFQW 856

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D    +++++ E I R I+C+GQVY AL + R   +    AI ++EQ+ PFP+  L 
Sbjct: 857 IIDDVELGKSISAKEDIKRLIICTGQVYTALHKKRASLEDKSTAIVKVEQLHPFPFAQLR 916

Query: 480 QHIDKYPNAELI-WAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ++ YP  E I W QEEPLN G+W+YVAPR  T +  +++++    +   R PSAS A 
Sbjct: 917 DTLNSYPGLEDIAWCQEEPLNMGSWSYVAPRFATTLKETDKYKDLTLRYCGRDPSASVAA 976

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G+K  H  EE   L  A 
Sbjct: 977 GSKGMHTGEEEKFLEAAF 994



>gi|240276310|gb|EER39822.1| 2-oxoglutarate dehydrogenase E1 component [Ajellomyces capsulatus
            H143]
          Length = 1011

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/530 (61%), Positives = 405/530 (76%), Gaps = 3/530 (0%)

Query: 30   LAAEWRQTFKKDVVIDIVCYRKYGHNEVDQPSFTQPRMYQQIAKQTPILEKYVQKLLKDG 89
            +AA+WR TFK+DVVIDIVCYRK GHNE DQPSFTQP MY++IA+QT  L+KYV KL+ + 
Sbjct: 472  MAADWRATFKRDVVIDIVCYRKQGHNETDQPSFTQPLMYKRIAEQTNQLDKYVDKLISEK 531

Query: 90   TFTKEDIEKHKKWVWNILEENYHKSKDYVPTSREWLSSSWNGFKSPKELAEESTPAYPTG 149
            TF+K DIE+HKKWVW +L +++ +SKDY P+S+EWL+S+WNGFK+PKELA E  P  PTG
Sbjct: 532  TFSKADIEEHKKWVWGMLNDSFDRSKDYQPSSKEWLTSAWNGFKTPKELATEVLPHPPTG 591

Query: 150  SSYELLQHVGEVISSYPKGFNVHSGLVRILKARAKAINEGQGIDWPTAEGLAFGSLLLEG 209
               E L+ +G+V+ S P+ F VH  L RIL  R K + EG+ IDW TAE LAFGSL  EG
Sbjct: 592  VPTETLKRIGDVLGSIPENFTVHRNLKRILANRKKTVEEGENIDWSTAEALAFGSLCAEG 651

Query: 210  KHVRLSGQDVERGTFSQRHAVLHDQVNETQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFE 269
             HVR+SGQDVERGTFSQRHAVLHDQ NET Y  L  + P Q KF + NSSLSEFG LGFE
Sbjct: 652  HHVRISGQDVERGTFSQRHAVLHDQENETTYTSLQHISPDQGKFVISNSSLSEFGALGFE 711

Query: 270  YGYSLVNPNSLILWEGQFGDFGNNSQCIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPE 329
            YGYSL +P++ ++WE QFGDF NN+QCIIDQFIASGE KWLQR+GLV+ LPHGYDGQGPE
Sbjct: 712  YGYSLTSPDAFVMWEAQFGDFANNAQCIIDQFIASGESKWLQRSGLVMSLPHGYDGQGPE 771

Query: 330  HSSGRLERFLQLCDDHPYVYPPPEKMARQHQDCNMQIINATTPANYFHVLRRQIHRDFRK 389
            HSS R+ER+LQLC++ P V+P P+++ RQHQDCNMQI   TTP+N FHV+RRQ++R FRK
Sbjct: 772  HSSARIERYLQLCNEDPRVFPAPDRIDRQHQDCNMQIAYMTTPSNLFHVMRRQMNRQFRK 831

Query: 390  PLIAFTSKSLLRHPMARSSLAEMTGDTTFKRFIPDPH--PETLASPEKITRHILCSGQVY 447
            PLI F SKSLLRHP+ RS L++ TGD+ F+  I DP     +L + + I R ILCSGQVY
Sbjct: 832  PLIIFFSKSLLRHPLCRSPLSDFTGDSHFQWIIADPEHGSPSLNNHKDIERVILCSGQVY 891

Query: 448  YALLRAREQNKMDHVAISRLEQICPFPYDLLSQHIDKYPNA-ELIWAQEEPLNGGAWTYV 506
             AL + R  + +++ AI+R+EQ+ PFP+  L +++D YPNA +++W QEEPLN GAW+Y+
Sbjct: 892  AALQKHRAAHGINNTAITRIEQMHPFPWQQLKENLDSYPNAKDIVWCQEEPLNAGAWSYM 951

Query: 507  APRIRTLMNHSERHEGRAAKPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             PRI TL+N +  H  R    A R PSAS ATG K  H++EE DLL  A 
Sbjct: 952  QPRIETLLNETVHHNRRHVLYAGRNPSASVATGLKASHVKEEQDLLQDAF 1001



>gi|213405791|ref|XP_002173667.1| 2-oxoglutarate dehydrogenase E1 [Schizosaccharomyces japonicus
            yFS275]
 gi|212001714|gb|EEB07374.1| 2-oxoglutarate dehydrogenase E1 [Schizosaccharomyces japonicus
            yFS275]
          Length = 1016

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/560 (57%), Positives = 418/560 (74%), Gaps = 8/560 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK + APIFHVNGDD EAV FVCQLAA+WR+TFK D +IDI+CYR++GHNE DQP
Sbjct: 460  YCTDIAKTIGAPIFHVNGDDTEAVTFVCQLAADWRKTFKSDCIIDIICYRRHGHNETDQP 519

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQPRMY+ IAK     + Y ++L+++ T +K+DIE H+K VW+IL++++  SKDY   
Sbjct: 520  LFTQPRMYKTIAKHPSTYKIYSEQLVEEKTLSKQDIEAHQKKVWDILQQSFESSKDYKVD 579

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
              EWLS+ W GF SPK+L  +  P+YPTG S + L+ VG  + + P+GF+VH  L RIL 
Sbjct: 580  HTEWLSNPWFGFASPKDLMTKILPSYPTGVSVDTLKRVGRSLYTLPEGFDVHRNLRRILN 639

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++  G+ ID PTAE LAF +LL EG HVR+SGQDVERGTFSQRH VLHDQ NE+ Y
Sbjct: 640  NRLKSVENGKEIDMPTAEALAFATLLEEGHHVRVSGQDVERGTFSQRHDVLHDQTNESIY 699

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PLN + P QA F + NSSLSEFG LGFEYGYSL +PN+L++WE QFGDF NN+QCIIDQ
Sbjct: 700  IPLNYISPRQASFVIRNSSLSEFGVLGFEYGYSLSSPNALVVWEAQFGDFANNAQCIIDQ 759

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE KWLQR+G+V+ LPHGYDGQGPEHSS R+ER+LQLC++ P  +P  EK+ RQHQ
Sbjct: 760  FIAAGETKWLQRSGIVLSLPHGYDGQGPEHSSARIERYLQLCNEDPREFPSEEKLQRQHQ 819

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN+Q I  T P  YFH LRR IHR FRKPLI F SK+LLRHP+ARS+L +   +  F  
Sbjct: 820  DCNLQAIYVTKPHQYFHALRRNIHRQFRKPLIVFFSKALLRHPLARSTLEDFDENRAFSL 879

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             + +  H +++ +PE+I R ++CSGQV+ +LL+ARE  K+D +A +R+EQ+ PF +   +
Sbjct: 880  ILEETEHGKSIKAPEEIKRLVVCSGQVWVSLLKAREDAKIDDIAFTRIEQLHPFGWKQFA 939

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGR--AAKPATRLPSASP 536
            +++ KYPN  E++W QEEPLN GAW+++ PRI T +    RH GR    + A R PSAS 
Sbjct: 940  ENLQKYPNLQEIVWCQEEPLNAGAWSFMEPRILTTL----RHLGRDIPLRYAGRPPSASV 995

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATGNK+QH+ E    L+ AL
Sbjct: 996  ATGNKQQHLAELEQFLNAAL 1015



>gi|260940997|ref|XP_002615338.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238850628|gb|EEQ40092.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 999

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/558 (58%), Positives = 405/558 (72%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DD+EAV FV  LAAEWR TF  DV+ID+V YRK+GHNE DQP
Sbjct: 440 YPSDIAKAINAPIFHVNADDIEAVTFVFNLAAEWRATFHSDVIIDVVGYRKHGHNETDQP 499

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP MYQ+IA++  +L+ Y  KL+++ TFTKEDIE+HKKWVWNILEE++ KSK+Y PT
Sbjct: 500 AFTQPVMYQKIAEKKSVLQYYADKLVQEETFTKEDIEEHKKWVWNILEESFAKSKEYQPT 559

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT    ++L+ +G  IS  PKGF VH  L RIL 
Sbjct: 560 SREWLTTPWEDFKSPKELATEVLPHLPTAVDADILKKIGAEISEAPKGFEVHRNLKRILN 619

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           +R K +  G+GIDW T E LAFGSL+LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 620 SRKKTVESGEGIDWATGEALAFGSLVLEGYHVRVSGQDVERGTFSQRHAVLHDQKSEKVY 679

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL  L   Q  F++ NSSLSE+G +GFEYGYSL +P++L+ WE QFGDF N +Q IIDQ
Sbjct: 680 TPLQHLSEDQGAFTISNSSLSEYGVMGFEYGYSLFSPDALVQWEAQFGDFANTAQVIIDQ 739

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA  E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQ+C++    +P PEK+ RQHQ
Sbjct: 740 FIAGAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQMCNEDQRYFPSPEKLERQHQ 799

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPL+ F SKSLLRHP+ARS L+E TGD+ F+ 
Sbjct: 800 DCNMQVAYPTTPANLFHLLRRQMHRQFRKPLVLFFSKSLLRHPLARSDLSEFTGDSHFEW 859

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D    +T+     I R +LCSGQVY AL + R   +    A  ++EQ+ PFP+  L 
Sbjct: 860 IIDDKELGKTINEKAGIKRVVLCSGQVYTALHKKRAAIEDKETAFIKIEQMHPFPFAQLR 919

Query: 480 QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ++ YP  E L+W QEEPLN G++ YV+PRI T +  ++ ++    + A R PSAS A 
Sbjct: 920 DALNSYPAIEDLVWCQEEPLNMGSFAYVSPRIGTTLAETDNYKDLTLRYAGRDPSASVAA 979

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G+K  H  EE   L +  
Sbjct: 980 GSKAMHTAEEEAFLKEVF 997



>gi|50425085|ref|XP_461134.1| DEHA2F17798p [Debaryomyces hansenii CBS767]
 gi|49656803|emb|CAG89517.1| DEHA2F17798p [Debaryomyces hansenii CBS767]
          Length = 997

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/558 (57%), Positives = 413/558 (74%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVEA  F+  LAAEWR TF  DV+ID+V YRK+GHNE DQP
Sbjct: 438 YPSDIAKSINAPIFHVNADDVEANIFIFNLAAEWRATFHTDVIIDLVGYRKHGHNETDQP 497

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP MYQ+IA++ P+++ Y ++L+++GTFTKEDI++HKKWVWNIL+E++ KSK+Y  T
Sbjct: 498 AFTQPLMYQKIAEKKPVIDYYTKQLIEEGTFTKEDIDEHKKWVWNILDESFSKSKEYQST 557

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL+++W  FKSPKELA E  P  PT    + L+ +G  IS  P+GF VH  L RIL 
Sbjct: 558 SREWLTTAWEDFKSPKELATEVLPHLPTAVEEDTLKKIGTAISEAPEGFEVHRNLKRILN 617

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++  G+GIDW T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 618 ARKKSVETGEGIDWSTGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQSSEQTY 677

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN+L   Q  F +CNSSLSE+G + FEYGYSL +P++L+ WE QFGDF N +Q I+DQ
Sbjct: 678 TPLNNLSEDQGAFVICNSSLSEYGVMSFEYGYSLTSPDALVQWEAQFGDFANTAQVIVDQ 737

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FI++ E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQLC++    +P PE + RQHQ
Sbjct: 738 FISAAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQLCNEDQRYFPSPELLERQHQ 797

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           D NMQ+   TTPAN FH+LRRQ+HR FRKPL+ F SK LLRHP+A+S L+E TG++ F+ 
Sbjct: 798 DANMQVAYPTTPANIFHLLRRQMHRQFRKPLVLFFSKQLLRHPLAKSELSEFTGESHFQW 857

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I DP   +++ + E I R ILCSGQV+ AL + R   +    A  ++EQ+ PFP+  L 
Sbjct: 858 IIEDPELGKSINAKEDIKRVILCSGQVFTALHKKRADIEDKSTAFIKIEQLHPFPFAQLR 917

Query: 480 QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             +D YP  E L+W QEEPLN G+++Y APRI T++ ++E+H+ ++ + A R PSAS A 
Sbjct: 918 DALDSYPALEDLVWCQEEPLNMGSYSYSAPRIATVLENTEKHKDKSLRYAGRDPSASVAA 977

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G K  H  EE + L +  
Sbjct: 978 GTKAMHNSEEEEFLKEVF 995



>gi|149245522|ref|XP_001527238.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449632|gb|EDK43888.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
            [Lodderomyces elongisporus NRRL YB-4239]
          Length = 1014

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/557 (57%), Positives = 409/557 (73%), Gaps = 5/557 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK +NAPIFHVN DDVEA  FV  LAAEWR T+  DV+ID+V YRK+GHNE DQP
Sbjct: 461  YPSDIAKSINAPIFHVNADDVEACTFVFNLAAEWRATYHTDVIIDVVGYRKHGHNETDQP 520

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MYQ+I+K+  +++ Y ++L+ +GTFT EDIE+HKKWVWNILEE++ K+KDY PT
Sbjct: 521  AFTQPLMYQEISKKKSVIDIYAKQLIDEGTFTAEDIEEHKKWVWNILEESFSKAKDYEPT 580

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL++ W  FKSPKELA E  P +PT      L+ +G+ IS  P+GF VH  L RIL 
Sbjct: 581  SREWLTTPWEDFKSPKELATEVLPHFPTAVDEATLKKIGDAISEVPEGFEVHRNLKRILN 640

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E+ +
Sbjct: 641  QRKKTVESGEGIDYATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQKSESTW 700

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL++L   Q  FS+ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q IIDQ
Sbjct: 701  TPLSNLSDDQGVFSISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVIIDQ 760

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA  E KW QR+G+V+ LPHGYDGQGPEHSSGR+ER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 761  FIAGAESKWKQRSGIVLSLPHGYDGQGPEHSSGRIERYLQLCNEDPRHFPTPEKLERQHQ 820

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            D NMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+ARS L + TGD+ F+ 
Sbjct: 821  DSNMQVAYPTTPANVFHLLRRQMHRQFRKPLILFFSKSLLRHPLARSELKDFTGDSGFQW 880

Query: 421  FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
             I D     L    ++ R +L +GQVY  L + R+Q +    A  ++EQ+ PFP+  L  
Sbjct: 881  IIED----VLGDKSEVKRVVLMTGQVYTLLHKKRQQLEDKTTAFIKIEQLNPFPFAQLRD 936

Query: 481  HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
             +++YPN E L+W QEEPLN GAW++V PR+ + +N +++++    + A R PSAS A G
Sbjct: 937  ALNEYPNIEDLVWCQEEPLNMGAWSFVVPRVESTLNETDKYKDLKLRYAGRDPSASVAAG 996

Query: 540  NKKQHIQEEHDLLSQAL 556
            +K  H+ EE  +L +  
Sbjct: 997  SKAMHLAEEEQVLEEVF 1013



>gi|320581271|gb|EFW95492.1| Component of the mitochondrial alpha-ketoglutarate dehydrogenase
           complex [Ogataea parapolymorpha DL-1]
          Length = 995

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/558 (58%), Positives = 408/558 (73%), Gaps = 3/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVE+V ++  LAAEWR  F  DV++D+V YRK+GHNE DQP
Sbjct: 437 YPSDIAKSINAPIFHVNADDVESVVYMFNLAAEWRAAFNSDVILDVVGYRKHGHNETDQP 496

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA +  +L+ Y+ KLLK+GTFT+EDI +HK+WVWN LEE++ KSKDY P 
Sbjct: 497 SFTQPLMYERIAHKKQVLDMYIDKLLKEGTFTEEDINEHKQWVWNTLEESFGKSKDYKPD 556

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W GFKSPKELA E  P  PT  S E ++H+G+V+S+ P+ FN+H  L RIL 
Sbjct: 557 SREWLTTPWEGFKSPKELATEVLPHLPTAISEEKVKHIGKVVSTVPEKFNLHRNLKRILG 616

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K+I  GQGIDW T E LAFGSL +EG HVR+SGQDVERGTFSQRHAVLHDQ NE  Y
Sbjct: 617 NRLKSIESGQGIDWSTGEALAFGSLAMEGYHVRVSGQDVERGTFSQRHAVLHDQKNEETY 676

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PL  L   Q  F + NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q IIDQ
Sbjct: 677 IPLKHLDENQGDFVISNSSLSEYGVMGFEYGYSLTSPDALVVWEAQFGDFANTAQVIIDQ 736

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE KW QR+G+V+ LPHGYDGQGPEHSSGRLER+LQLC++ P  +P PEK+ RQHQ
Sbjct: 737 FIAAGESKWKQRSGVVLSLPHGYDGQGPEHSSGRLERYLQLCNEDPRYFPTPEKLERQHQ 796

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   +TPA+ FH+LRRQ+HR FRKPLI F SKSLLRHP+ARSS+ E TGD+ F+ 
Sbjct: 797 DCNMQVAYPSTPASLFHILRRQMHRQFRKPLILFFSKSLLRHPLARSSIEEFTGDSHFQW 856

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D    +++     I R +LCSGQVY AL + R+       A  ++EQ+ PFP+  L 
Sbjct: 857 LIEDVELGKSINDKAGIKRVVLCSGQVYTALHKRRQNLGDKETAFIKVEQLHPFPFAQLR 916

Query: 480 QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             +  YP  E L+W QEEP N GA++YV PRI T++  +   E    + A R PSAS A 
Sbjct: 917 DALLSYPALEDLVWCQEEPFNMGAYSYVTPRIETVLREAGL-EKLGLRYAGRDPSASVAA 975

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G+K  H  EE  LL Q  
Sbjct: 976 GSKAMHTAEEEALLDQVF 993



>gi|255729610|ref|XP_002549730.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
           [Candida tropicalis MYA-3404]
 gi|240132799|gb|EER32356.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
           [Candida tropicalis MYA-3404]
          Length = 995

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/557 (56%), Positives = 410/557 (73%), Gaps = 5/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN DDVEA  FV  LAAEWR TF  D +ID+V YRKYGHNE DQP
Sbjct: 442 YPSDIAKSIDAPIFHVNADDVEACTFVFNLAAEWRATFHTDCIIDVVGYRKYGHNETDQP 501

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IAK+  +++ Y ++L+ +GTFT EDI++HKKWVW++LE+N+ K+KDY PT
Sbjct: 502 SFTQPLMYQEIAKKKSVIDIYEKQLINEGTFTAEDIQEHKKWVWDVLEDNFKKAKDYKPT 561

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSP+ELA E  P  PT     +L+ +G+ IS  P+GF VH  L RIL 
Sbjct: 562 SREWLTTPWEDFKSPRELATEVLPHLPTAVDEGILKKIGKAISETPEGFEVHRNLKRILN 621

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E+ +
Sbjct: 622 ARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESTW 681

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL++L   Q  F++ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q +IDQ
Sbjct: 682 TPLSNLAEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQ 741

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F+A  E KW QR+G+V+ LPHGYDGQGPEHSS R+ER+LQLC++    +P PEK+ RQHQ
Sbjct: 742 FVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSARIERYLQLCNEDQRYFPSPEKLERQHQ 801

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR+FRKPLI   SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 802 DCNMQVAYPTTPANIFHLLRRQMHREFRKPLIVIFSKSLLRHPLARSNLSEFTGDSHFQW 861

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L    ++ R +L SGQVY AL + R   +    A  ++EQ+ PFPY  L  
Sbjct: 862 IIED----VLGEKSEVKRVVLLSGQVYAALHKKRAALEDKTTAFIKVEQLHPFPYAQLRD 917

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            +++YPN E L+W QEEPLN GA+ YVAPRI  ++  +E ++    + A R PSAS A G
Sbjct: 918 ALNEYPNIEDLVWTQEEPLNMGAYNYVAPRIEAVLQETENYKDLKLRYAGRDPSASVAAG 977

Query: 540 NKKQHIQEEHDLLSQAL 556
           +K  H+ EE ++++Q  
Sbjct: 978 SKSMHVAEEEEIIAQTF 994



>gi|50288623|ref|XP_446741.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526049|emb|CAG59668.1| unnamed protein product [Candida glabrata]
          Length = 1011

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/558 (56%), Positives = 413/558 (74%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV ++  LAAEWRQTF  D +ID+V +RK+GHNE DQP
Sbjct: 452  YPSDLAKAIDAPIFHVNANDVEAVTYIFGLAAEWRQTFHTDAIIDVVGWRKHGHNETDQP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+QIAK   +++ Y  KLLK+G+F+K DIE+HKKWVW + EE + K+KDYVPT
Sbjct: 512  SFTQPLMYKQIAKTPSVIDVYTDKLLKEGSFSKSDIEEHKKWVWGMFEEAFEKAKDYVPT 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W  FKSPKELA E  P  PT  S ++L+++G+ ISS+P+ F VH  L RIL 
Sbjct: 572  PREWLTAAWEDFKSPKELATEILPHEPTKVSEDILKNIGKTISSWPENFEVHRNLKRILN 631

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++  G+GIDW T E LA+GSL+LEG +VR+SG+DVERGTFSQRH+VLHDQ +E  Y
Sbjct: 632  QRGKSVETGEGIDWATGEALAYGSLVLEGHNVRVSGEDVERGTFSQRHSVLHDQASEATY 691

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   QA F++ NSSLSE+G +GFEYGYSL +P +LI+WE QFGDF N +Q IIDQ
Sbjct: 692  TPLKNLSDKQADFTIANSSLSEYGVMGFEYGYSLTSPENLIVWEAQFGDFANTAQVIIDQ 751

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQ+ ++ P  +P PEK+ RQHQ
Sbjct: 752  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANEDPRYFPSPEKLQRQHQ 811

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL+ F SK LLRHP+ARS+L+E T + +F+ 
Sbjct: 812  DCNYQVVYPTTPANLFHILRRQQHRQFRKPLVLFFSKQLLRHPLARSNLSEFT-EGSFQW 870

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H + + + E+  + +L SGQVY AL + REQ      A  ++E++ PFP+  L 
Sbjct: 871  IIEDVEHGKAIGTKEETKKLVLMSGQVYTALHKKREQLGDKTTAFLKIEELHPFPFAQLR 930

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W YVAPR++T++  +E+++    +   R PS + A 
Sbjct: 931  DTLNSYPNLEEIVWCQEEPLNMGSWNYVAPRLQTVLKETEQYKDNVVRYCGRSPSGAVAA 990

Query: 539  GNKKQHIQEEHDLLSQAL 556
            GNKK H+ EE   L    
Sbjct: 991  GNKKLHLAEEEAFLKDVF 1008



>gi|150866747|ref|XP_001386444.2| alpha-ketoglutarate dehydrogenase [Scheffersomyces stipitis CBS 6054]
 gi|149388003|gb|ABN68415.2| alpha-ketoglutarate dehydrogenase [Scheffersomyces stipitis CBS 6054]
          Length = 1015

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/558 (57%), Positives = 404/558 (72%), Gaps = 2/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  N+PIFHVN DDVEA  FV  LAAEWR TF  DV+ID+V YRK+GHNE DQP
Sbjct: 456  YPSDIAKASNSPIFHVNADDVEACIFVFNLAAEWRATFHSDVIIDVVGYRKHGHNETDQP 515

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA++  +LE Y  +L+++GTFT EDI +HKKWVWN+LE+ + KSK+YVPT
Sbjct: 516  AFTQPLMYKKIAEKKSVLEYYTNQLIQEGTFTTEDISEHKKWVWNLLEDYFAKSKEYVPT 575

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL++ W  FKSPKELA E  P  PT    E L+ +G+ IS  P+GF +H  L RIL 
Sbjct: 576  SREWLTTPWEDFKSPKELATEVLPHLPTAVDEETLKKIGKAISEAPEGFEIHRNLKRILN 635

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +  G+GIDW T E LAFG+L LEG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 636  TRNKTVETGEGIDWATGEALAFGTLALEGYHVRVSGQDVERGTFSQRHAVLHDQQSEKTY 695

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PLN L   Q  F + NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N  Q I+DQ
Sbjct: 696  TPLNHLSEEQGAFVISNSSLSEYGVLGFEYGYSLTSPDALVQWEAQFGDFANTGQVIMDQ 755

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIAS E KW QR+GLV+ LPHGYDGQGPEHSSGR+ER+LQ+C++    +P P K+ RQHQ
Sbjct: 756  FIASAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQMCNEDQRYFPSPSKLERQHQ 815

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q+   TTPAN FH+LRRQ+HR FRKPL  F SKSLLRHP+ARS L+E T D+ F+ 
Sbjct: 816  DCNFQVAYPTTPANLFHLLRRQMHRQFRKPLALFFSKSLLRHPLARSDLSEFTNDSHFQW 875

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  + +T+A  E+I R +LCSGQV+ AL + R   +    A  ++EQ+ PFP+  L 
Sbjct: 876  IIEDAEYGKTIAPKEEIKRVVLCSGQVFTALHKKRAAIEDKTTAFIKIEQVHPFPFAQLR 935

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              +D +PN E L+W QEEPLN G++++V+PRI T +  +E H+G   + A R PSAS A 
Sbjct: 936  DALDSHPNLEDLVWCQEEPLNMGSYSFVSPRITTTLAETENHKGLTLRYAGRDPSASVAA 995

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  +E   L++  
Sbjct: 996  GSKAMHTAQEEAFLNETF 1013



>gi|254567720|ref|XP_002490970.1| Component of the mitochondrial alpha-ketoglutarate dehydrogenase
           complex, which catalyzes a key step [Komagataella
           pastoris GS115]
 gi|238030767|emb|CAY68690.1| Component of the mitochondrial alpha-ketoglutarate dehydrogenase
           complex, which catalyzes a key step [Komagataella
           pastoris GS115]
 gi|328352497|emb|CCA38896.1| 2-oxoglutarate dehydrogenase E1 component [Komagataella pastoris
           CBS 7435]
          Length = 1001

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/558 (56%), Positives = 411/558 (73%), Gaps = 2/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPI HVN DDVE+V F  QLAAEWRQTF  DV++D+V YRKYGHNE DQP
Sbjct: 440 YPSDIAKSINAPILHVNADDVESVIFNFQLAAEWRQTFHSDVILDVVGYRKYGHNETDQP 499

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IA++  +L+ YV KL+K+G+FT +DI +HK+WVWN LEE + KS +Y PT
Sbjct: 500 SFTQPLMYQKIAEKKQVLDIYVDKLIKEGSFTLDDINEHKQWVWNTLEEAFTKSVEYKPT 559

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W GFKSPKELA E  P  PT     +++ +G+ ISS+P+GF VH  L RILK
Sbjct: 560 SREWLTTPWEGFKSPKELASEVLPHLPTSVERGVVERIGDTISSWPEGFEVHRNLKRILK 619

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R  +I +G+GIDW T E LAFGSL++EG HVR+SGQDVERGTFSQRHAVLHDQ +E  Y
Sbjct: 620 NRKDSIQKGEGIDWSTGEALAFGSLVIEGYHVRISGQDVERGTFSQRHAVLHDQNSEKVY 679

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
           +PL  L   Q+ F + NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q IIDQ
Sbjct: 680 IPLKHLSKVQSDFGISNSSLSEYGCMGFEYGYSLTSPDALVMWEAQFGDFANTAQVIIDQ 739

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F+A+GE KW QR+G+V+ LPHGYDGQG EHSS RLER+LQLC++ P VYP PEK+ RQHQ
Sbjct: 740 FLAAGESKWKQRSGVVLSLPHGYDGQGSEHSSARLERYLQLCNEDPRVYPSPEKLERQHQ 799

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI   SK LLRHP+ARS++ +  G+++F+ 
Sbjct: 800 DCNMQVAYPTTPANLFHLLRRQMHRQFRKPLILLFSKKLLRHPLARSNIEDFIGESSFQW 859

Query: 421 FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D    +T+   E I R +LCSGQV+ +L + R        A+ ++EQ+ PFP++ L 
Sbjct: 860 IIEDSELGKTINDKEGIKRLVLCSGQVHSSLHKKRADIGDKETAVLKIEQLHPFPFEQLK 919

Query: 480 QHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             ID YP+  E++W QEEPLN G++ + APRI T++  +E+++    + A R P+A+ A 
Sbjct: 920 NAIDSYPSLDEIVWCQEEPLNMGSYAFSAPRIVTVLEQTEKYKDYNLRYAGRNPAAAVAV 979

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G K  H+ +E   L    
Sbjct: 980 GTKSMHVAQEEAFLDDVF 997



>gi|430811677|emb|CCJ30874.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 939

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 408/541 (75%), Gaps = 18/541 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YCSD+AK ++APIFH+NGDDVEA+ F+C++A+EWR TFKKDVVIDIVCYRK+GHNE DQP
Sbjct: 398 YCSDIAKSIDAPIFHINGDDVEALVFICKIASEWRATFKKDVVIDIVCYRKHGHNETDQP 457

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++I +QTP LEKY +KL+ +G+F+++DI++HKK VW+ LE ++ K+KDY PT
Sbjct: 458 SFTQPLMYRKIMEQTPTLEKYTRKLISEGSFSEKDIQEHKKCVWDTLESSFKKAKDYKPT 517

Query: 121 SREWLSSSWNG---------------FKSPKELAEESTPAYPTGSSYELLQHVGEVISSY 165
            REWL+S+WNG               F SP++L  +    +PT  + E L+ +G  I SY
Sbjct: 518 PREWLTSAWNGILLDFLKIHSKLKIGFASPRDLIIKDFNHFPTSVNKEALKGIGRKIFSY 577

Query: 166 PKGFNVHSGLVRILKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFS 225
           PK F++H  L RI+K R  +I + + IDW T E LAF +LL EG HVR+SGQDVERGTFS
Sbjct: 578 PKDFHIHPNLKRIMKNRLTSIEDEKNIDWATGEALAFATLLTEGCHVRVSGQDVERGTFS 637

Query: 226 QRHAVLHDQVNETQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEG 285
           QRHAVLHDQ NE  Y+ LN + P QAKF + NSSLSE+G LGFEYGYSL++PNSL++WE 
Sbjct: 638 QRHAVLHDQENENTYISLNYIDPNQAKFVISNSSLSEYGVLGFEYGYSLISPNSLVVWEA 697

Query: 286 QFGDFGNNSQCIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDH 345
           QFGDF NN+QCIIDQFIAS E KW QR+G+V+ LPHGYDGQGPEHSSGR+ERFLQL +D 
Sbjct: 698 QFGDFANNAQCIIDQFIASAEVKWHQRSGIVLSLPHGYDGQGPEHSSGRIERFLQLANDD 757

Query: 346 PYVYPPPEKMARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMA 405
             V+P  EK  RQ+Q+CN+QI   TTPAN FH+LRRQI R+FRKPLI F SK+LLRHP+A
Sbjct: 758 YRVFPSKEKFQRQYQECNIQIAYPTTPANLFHILRRQIRREFRKPLILFFSKALLRHPLA 817

Query: 406 RSSLAEMTGDTTFKRFIPD-PHPETLASPEKI-TRHILCSGQVYYALLRAREQNKMDHVA 463
           RS+L+E +GD+ F+  + D  H   +  P ++  + ILC+GQ+Y +L + RE+ K+D  A
Sbjct: 818 RSNLSEFSGDSHFQSILSDHDHKNGILKPHELCNKLILCTGQIYVSLYKEREERKIDDTA 877

Query: 464 ISRLEQICPFPYDLLSQHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEG 522
           I R EQI PF +  L + +D YPN  E++W QEEPLN GAW YV PR+ T++N ++ H+ 
Sbjct: 878 ILRCEQIHPFDFQGLKECLDSYPNLKEIVWCQEEPLNAGAWQYVQPRLETVLNKTQAHKD 937

Query: 523 R 523
           +
Sbjct: 938 K 938



>gi|459367061|gb|EMG46177.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial [Candida
           maltosa Xu316]
          Length = 997

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/557 (56%), Positives = 407/557 (73%), Gaps = 5/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN DDVEA  FV  LAAEWR TF  DV+ID+V YRKYGHNE DQP
Sbjct: 444 YPSDIAKGIDAPIFHVNADDVEACTFVFNLAAEWRATFHTDVIIDVVGYRKYGHNETDQP 503

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP MYQ+I K+  +++ Y Q+L+K+GTF+ EDI++HKKWVW+ILE+N+ KSK+Y PT
Sbjct: 504 AFTQPVMYQEIGKKKSVIDIYEQQLVKEGTFSAEDIQEHKKWVWDILEDNFKKSKEYKPT 563

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT      L+ +G  IS  P+GF VH  L RIL 
Sbjct: 564 SREWLTTPWEDFKSPKELATEVLPHLPTAVDEATLKKIGVAISETPEGFEVHRNLKRILN 623

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E+ +
Sbjct: 624 ARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESTW 683

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL++L   Q  F++ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q +IDQ
Sbjct: 684 TPLSNLEEKQGAFNISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQ 743

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA  E KW QR+G+V+ LPHGYDGQGPEHSS R+ER+LQLC++    +P PEK+ RQHQ
Sbjct: 744 FIAGAESKWKQRSGVVLSLPHGYDGQGPEHSSARIERYLQLCNEDQRFFPSPEKLERQHQ 803

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI   SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 804 DCNMQVAYPTTPANVFHLLRRQMHRQFRKPLILIFSKSLLRHPLARSNLSEFTGDSHFQW 863

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L    ++ R +L +GQ+Y AL + R        A  ++EQ+ PFPY  L  
Sbjct: 864 IIED----VLGEKSEVKRVVLLTGQLYAALHKKRASLDDKSTAFIKIEQLHPFPYAQLRD 919

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            +++YPN E L+WAQEEPLN GA+ + APRI  ++  +E+++    + A R PSAS A G
Sbjct: 920 ALNEYPNIEDLVWAQEEPLNMGAYNFAAPRIEAVLQETEKYKDLKLRYAGRDPSASVAAG 979

Query: 540 NKKQHIQEEHDLLSQAL 556
           +K  H+ EE  +L++  
Sbjct: 980 SKAMHVVEEEQILTETF 996



>gi|328774065|gb|EGF84102.1| hypothetical protein BATDEDRAFT_34093 [Batrachochytrium dendrobatidis
            JAM81]
          Length = 1230

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/591 (55%), Positives = 412/591 (69%), Gaps = 69/591 (11%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YCSDVAK VNAPI HVNGDDVEAV F CQLA+EWR  FKKDVV+DIVCYR+YGHNE+DQP
Sbjct: 485  YCSDVAKTVNAPIIHVNGDDVEAVVFACQLASEWRAEFKKDVVLDIVCYRRYGHNEIDQP 544

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MYQ+I + TP+LEKY+Q+LL +G+ T+E+++  KK VW ILEE+Y  SKDY  +
Sbjct: 545  GFTQPLMYQKINQMTPVLEKYIQQLLGEGSVTQEEVDAMKKRVWGILEEHYILSKDYKAS 604

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW+SS+W+GF+SP  LA+E+    PTG S +LL+H+G   ++YP  F VH  L RILK
Sbjct: 605  SKEWVSSTWSGFRSPSVLAKEAVSPRPTGVSLDLLKHIGTAGATYPADFKVHPNLARILK 664

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EGQ IDW TAE +AFG+LL EG HVRLSGQDVERGTFS RHA+LHDQ +E Q+
Sbjct: 665  TRIKSVTEGQDIDWATAESMAFGTLLCEGNHVRLSGQDVERGTFSHRHALLHDQKSEKQF 724

Query: 241  VPLNDL-----RPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQ 295
            VPLN+L        Q+ F+VCNSSLSEFGTLGFE G+SLVNP+ L++WE QFGDF NN+Q
Sbjct: 725  VPLNNLVSEGIVSSQSPFTVCNSSLSEFGTLGFELGFSLVNPDQLVMWEAQFGDFANNAQ 784

Query: 296  CIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPP---P 352
            CIIDQFIASGE+KWLQRTGL +LLPHGYDGQGPEHSS RLERFL LCD+ PY  P     
Sbjct: 785  CIIDQFIASGEQKWLQRTGLTMLLPHGYDGQGPEHSSARLERFLMLCDEDPYCMPELNGT 844

Query: 353  EK--MARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLA 410
            EK   +RQHQDCNMQ++  T P+NY+H LRRQ+HR+FRKPLI FTSK++LRHP+A+S + 
Sbjct: 845  EKGSRSRQHQDCNMQVVYTTVPSNYYHALRRQVHREFRKPLIVFTSKAVLRHPLAKSCIE 904

Query: 411  EMTGDTTFKRFIPD---PHPETLASP---------------------------------- 433
            EM G+T F+R IP+   P+P T+ SP                                  
Sbjct: 905  EMVGNTRFQRLIPEVLHPNPLTILSPNGASEPNADGSLSSGNSFDPRIPYALVTDPAYPP 964

Query: 434  ---EKITRHILCSG-----------------QVYYALLRAREQNKMDHVAISRLEQICPF 473
               +  T+ +  SG                 QVYY+L R R  N + HVAI R+EQ+ PF
Sbjct: 965  ALQDGTTKAVTPSGFTLLPPNEIKTLIFCSGQVYYSLYRTRALNNLRHVAIVRIEQLNPF 1024

Query: 474  PYDLLSQHIDKYPNA--ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEG 522
            P+  +   +D Y     E+++ QEE  N GAW +V PR+ T + +S+  +G
Sbjct: 1025 PFWEVKTIVDFYKEGLEEIVYCQEESFNSGAWLFVDPRLETAVKNSDWFKG 1075



>gi|403215943|emb|CCK70441.1| hypothetical protein KNAG_0E01790 [Kazachstania naganishii CBS 8797]
          Length = 1017

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/558 (56%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFH N +D+EAV F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 456  YPSDLAKAIDAPIFHCNANDIEAVTFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 515

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MYQ+IAKQ  ++++Y +KL  + TFTK+DIE+HKKWVWN+ EE + K+KDY P+
Sbjct: 516  AFTQPLMYQKIAKQKSVIDEYSEKLEAENTFTKQDIEEHKKWVWNLFEEAFEKAKDYKPS 575

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT    E+LQ +G+ ISS+P+GF VH  L RIL 
Sbjct: 576  QREWLTAAWEGFKSPKELATEILPHEPTNVPAEVLQDIGKAISSWPEGFEVHKNLKRILT 635

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I EG+GIDW T E LAFG+L LEG +VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 636  QRGKSIKEGEGIDWSTGEALAFGTLSLEGHNVRVSGEDVERGTFSQRHAVLHDQKSEATY 695

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA FS+CNSSLSE+G +GFEYGYSL +P  L++WE QFGDF N +Q IIDQ
Sbjct: 696  TPLQHLSEKQADFSICNSSLSEYGVMGFEYGYSLTSPEYLVIWEAQFGDFANTAQVIIDQ 755

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQ+ ++ P  +P   K+ RQHQ
Sbjct: 756  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANEDPRYFPSELKLQRQHQ 815

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 816  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 874

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++A  E+  R +L SGQVY AL R R Q +  + A  ++EQ+ PFPY  L 
Sbjct: 875  IIEDIEHGKSIAPKEETKRLVLLSGQVYTALHRKRGQLQDKNTAFLKIEQLHPFPYAQLR 934

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEPLN G+W Y +PR++T +  +E+++    +   R PS + A 
Sbjct: 935  DTLNSYPNLEDIVWCQEEPLNMGSWAYASPRLQTTLKETEKYKDHEIRYCGRNPSGAVAA 994

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L++  
Sbjct: 995  GSKALHTVEEEQFLAEVF 1012



>gi|444320587|ref|XP_004180950.1| hypothetical protein TBLA_0E03770 [Tetrapisispora blattae CBS 6284]
 gi|387513993|emb|CCH61431.1| hypothetical protein TBLA_0E03770 [Tetrapisispora blattae CBS 6284]
          Length = 1018

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/559 (55%), Positives = 408/559 (72%), Gaps = 3/559 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV FV  LAAEWR TF  D +IDIV +RK+GHNE DQP
Sbjct: 459  YPSDLAKAIDAPIFHVNANDVEAVTFVFNLAAEWRNTFHSDAIIDIVGWRKHGHNETDQP 518

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MYQ+I+KQ  + + Y +KL+ +G+FT+  IE+H+KWVW + E+++ K+K+Y PT
Sbjct: 519  AFTQPLMYQRISKQKNVFDVYKEKLIAEGSFTESAIEEHRKWVWGLFEDSFEKAKEYTPT 578

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W GFKSPKELA E  P YPT    ++L  +   ISS+P+ F VH  L RIL 
Sbjct: 579  SREWLTAAWEGFKSPKELATEILPQYPTNVDKDILDKIAGKISSWPENFEVHKNLKRILT 638

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K +  G+GIDW T E LAFGSLLLEG +VR+SG+DVERGTFSQRHAVLHDQ++E  Y
Sbjct: 639  TRGKTVATGEGIDWSTGEALAFGSLLLEGYNVRVSGEDVERGTFSQRHAVLHDQISERTY 698

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L  GQA F++ NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q I DQ
Sbjct: 699  TPLKHLSNGQANFTISNSSLSEYGVMGFEYGYSLTSPDNLVMWEAQFGDFANTAQVITDQ 758

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P PEK+ RQHQ
Sbjct: 759  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSPEKLQRQHQ 818

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARS L+E T D  F+ 
Sbjct: 819  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSKLSEFT-DGGFQW 877

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + R++ K    A  ++E++ PFP+  L 
Sbjct: 878  IIEDAEHGKSIGTKEETKRLVLMSGQVYTALHKRRQELKDTATAFLKIEELHPFPFAQLR 937

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
            + +D YPN  E++W QEEPLN G W+Y +PR++T++N + +++    +   R PS + A 
Sbjct: 938  ESLDSYPNLEEIVWCQEEPLNMGGWSYASPRLQTVLNETAKYKDAKIRYCGRNPSGAVAA 997

Query: 539  GNKKQHIQEEHDLLSQALI 557
            GNK  H+ EE   L    +
Sbjct: 998  GNKPLHLAEEDAFLRDVFL 1016



>gi|403160615|ref|XP_003321098.2| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|375170322|gb|EFP76679.2| oxoglutarate dehydrogenase (succinyl-transferring), E1 component
            [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 1133

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/561 (57%), Positives = 404/561 (72%), Gaps = 13/561 (2%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++APIFHVNGDD EAV FVCQLAA+WR  FKKDVV+DIVCYR++GHNE DQP
Sbjct: 579  YCTDIAKSIDAPIFHVNGDDAEAVTFVCQLAADWRAAFKKDVVVDIVCYRRHGHNETDQP 638

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I +Q P L+ Y   L+K+G+FT+++ ++ ++       E   +       
Sbjct: 639  SFTQPKMYQAIGQQPPTLKIYTDHLIKEGSFTEQENQQSQRMGVEYDGEGLRR------- 691

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS-YPKGFNVHSGLVRIL 179
             +  L  ++       EL E    A PTG    ++  +G+ IS  +P+ F VH  L RIL
Sbjct: 692  -KSGLQPNFARVAVELELKENILEARPTGVERSVMNKIGDTISGGWPENFEVHKNLGRIL 750

Query: 180  KARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQ 239
            K R K I EG  IDW TAE LAFGSLLLEG HVR+SGQDVERGTFSQRHAVLHDQ     
Sbjct: 751  KNRGKTIAEGDQIDWSTAEALAFGSLLLEGNHVRVSGQDVERGTFSQRHAVLHDQKTNDN 810

Query: 240  YVPLNDLRPGQAK----FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQ 295
            Y+PL++L+P  +     F++CNSSLSEFG LGFE GYSLV+P+ L +WE QFGDF NN+Q
Sbjct: 811  YIPLSNLKPEGSDPVGPFTICNSSLSEFGALGFELGYSLVDPHLLTMWEAQFGDFANNAQ 870

Query: 296  CIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKM 355
            CIIDQFI SGE+KWLQRTGLV+ LPHGYDGQGPEHSS R+ERFLQLCDD P+ +P PEK 
Sbjct: 871  CIIDQFICSGERKWLQRTGLVMSLPHGYDGQGPEHSSARIERFLQLCDDDPFKFPTPEKA 930

Query: 356  ARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGD 415
             R HQDCNMQ++  TTP+NYFHVLRRQIHRDFRKPLI F SKSLLRHP+A+SS+ EM   
Sbjct: 931  QRIHQDCNMQLVYCTTPSNYFHVLRRQIHRDFRKPLIVFFSKSLLRHPLAKSSVTEMEPG 990

Query: 416  TTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPY 475
            T F   IP+P    +    +I RHI CSGQVYY LL+ RE+  ++ +AI+R+EQ+ P PY
Sbjct: 991  TFFIPLIPEPGFSGMVENHQIKRHIFCSGQVYYTLLQEREKRNINDIAITRIEQLSPVPY 1050

Query: 476  DLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSAS 535
              + + ++ YPN+++++ QEEP+NGGA+TY+APR+   MN +E H G+    A R P AS
Sbjct: 1051 YEIVKALETYPNSDVMYCQEEPVNGGAYTYLAPRLENAMNQTENHAGKKVLYAGRPPYAS 1110

Query: 536  PATGNKKQHIQEEHDLLSQAL 556
             ATG+KK H QE    L QAL
Sbjct: 1111 VATGSKKIHKQEVQQFLDQAL 1131



>gi|366990679|ref|XP_003675107.1| hypothetical protein NCAS_0B06520 [Naumovozyma castellii CBS 4309]
 gi|342300971|emb|CCC68736.1| hypothetical protein NCAS_0B06520 [Naumovozyma castellii CBS 4309]
          Length = 1008

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/561 (56%), Positives = 405/561 (72%), Gaps = 4/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFH N +D+EAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 450  YPSDIAKAIDAPIFHCNANDIEAVTFIFNLAAEWRNEFHTDAIIDVVGWRKHGHNETDQP 509

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ+IAKQ  ++++Y  KL+K+G+FTK DI++HKKWVW + E+ + KSKDYVPT
Sbjct: 510  SFTQPLMYQKIAKQKSVIDEYTDKLIKEGSFTKSDIDEHKKWVWGLFEKAFEKSKDYVPT 569

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W  FKSPKELA E  P  PT  S +++Q +G+ +SS+P+ F VH  L RIL 
Sbjct: 570  QREWLTAAWEDFKSPKELATEILPHNPTNVSVDIIQDIGKALSSWPENFEVHKNLKRILT 629

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I+ G+GIDW T E LAFG+L+LEG +VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 630  NRGKSISTGEGIDWSTGEALAFGTLVLEGYNVRVSGEDVERGTFSQRHAVLHDQKSEDTY 689

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPL  L   QA FS+CNSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q I DQ
Sbjct: 690  VPLKHLSAKQADFSICNSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVITDQ 749

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQ+ ++ P  +P  EK+ RQHQ
Sbjct: 750  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANEDPRYFPSEEKLQRQHQ 809

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH++RRQ HR FRKPLI F SK LLRHP+ARS L E T +  F+ 
Sbjct: 810  DCNYQVVYPTTPANLFHIIRRQQHRQFRKPLILFFSKQLLRHPLARSQLEEFT-EGGFQW 868

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H   + + E+  R +L SGQVY AL + RE       A+ ++E++ PFP+  L 
Sbjct: 869  IIEDVEHGRAIGTKEETKRLVLLSGQVYTALHKKRETIGDKSTALMKIEELHPFPFAQLR 928

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ID YPN  E +W QEEPLN G W Y APR++T +  ++ ++    +   R PS + A 
Sbjct: 929  DAIDSYPNLEEFVWCQEEPLNMGGWAYAAPRLQTTLQETQNYKNHTVRYCGRNPSGAVAA 988

Query: 539  GNKKQHIQEEHDLLSQALIGQ 559
            G+K  HI EE   L + + GQ
Sbjct: 989  GSKSLHIAEEEAFL-KDVFGQ 1008



>gi|241952613|ref|XP_002419028.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor,
           putative; alpha-ketoglutarate dehydrogenase, putative
           [Candida dubliniensis CD36]
 gi|223642368|emb|CAX42610.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor,
           putative [Candida dubliniensis CD36]
          Length = 996

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/557 (56%), Positives = 404/557 (72%), Gaps = 5/557 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK + APIFHVN DDVEA  FV  LAAEWR T+  D +ID+V YRK+GHNE DQP
Sbjct: 442 YPSDIAKAIEAPIFHVNADDVEACTFVFNLAAEWRATYHTDCIIDVVGYRKHGHNETDQP 501

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IAK+  +++ Y ++L+++GTFT EDI +HK+WVWNILE+N+ K+KDY PT
Sbjct: 502 SFTQPLMYQEIAKKKSVIDIYEKQLIEEGTFTAEDINEHKQWVWNILEDNFKKAKDYKPT 561

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT      L+ +G  IS  P+GF VH  L RIL 
Sbjct: 562 SREWLTTPWEDFKSPKELATEVLPHLPTAVDEATLKKIGNAISETPEGFEVHRNLKRILN 621

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E+ +
Sbjct: 622 ARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESVW 681

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL++L   Q  F++ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q +IDQ
Sbjct: 682 TPLSNLSEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQ 741

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F+A  E KW QR+G+V+ LPHGYDGQGPEHSS RLER+LQLC++    +P PEK+ RQHQ
Sbjct: 742 FVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSSRLERYLQLCNEDQRFFPSPEKLERQHQ 801

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI   SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 802 DCNMQVAYPTTPANVFHLLRRQMHRQFRKPLILVFSKSLLRHPLARSNLSEFTGDSHFQW 861

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L    ++ R +L +GQVY A  + R        A  ++EQ+ PFPY  L  
Sbjct: 862 IIED----VLGDKSEVKRVVLLTGQVYAAFHKKRASLDDKSTAFIKIEQLHPFPYAQLRD 917

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            +++YPN E L+W QEEPLN GA+ +VAPR+  ++  +++++    + A R PSAS A G
Sbjct: 918 ALNEYPNLEDLVWTQEEPLNMGAYNFVAPRVEAVLGETQKYKDLKLRYAGRDPSASVAAG 977

Query: 540 NKKQHIQEEHDLLSQAL 556
           +K  H+ EE + L++  
Sbjct: 978 SKAMHVAEEEEFLAETF 994



>gi|367012107|ref|XP_003680554.1| hypothetical protein TDEL_0C04540 [Torulaspora delbrueckii]
 gi|359748213|emb|CCE91343.1| hypothetical protein TDEL_0C04540 [Torulaspora delbrueckii]
          Length = 1021

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/558 (56%), Positives = 403/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWRQTF  D +ID+V +RK+GHNE DQP
Sbjct: 462  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAIIDVVGWRKHGHNETDQP 521

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ+IAKQ  +++ Y +KL+ +G+FTK DIE+HKKWVWN+ EE + K+KDY PT
Sbjct: 522  SFTQPLMYQKIAKQKSVIDVYTEKLVVEGSFTKADIEEHKKWVWNLFEEAFEKAKDYKPT 581

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W  FKSPKELA E  P  PT    + L+ VG+ ISS+P  F VH  L RIL 
Sbjct: 582  SREWLTAAWENFKSPKELATEILPHEPTNVQADTLKEVGKAISSWPADFEVHRNLKRILN 641

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++  G GIDW T E LAFG+L LEG +VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 642  NRGKSVESGNGIDWSTGEALAFGTLALEGYNVRVSGEDVERGTFSQRHAVLHDQSSEKIY 701

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL +L   Q  F++ NSSLSE+G +GFEYGYSL +P++ ++WE QFGDF N +Q IIDQ
Sbjct: 702  TPLKNLSEKQGDFTIANSSLSEYGVMGFEYGYSLTDPDNFVMWEAQFGDFANTAQVIIDQ 761

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++    +P  EK+ RQHQ
Sbjct: 762  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDQRFFPSEEKLQRQHQ 821

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPLI F SK LLRHP+ARS L+E + + +FK 
Sbjct: 822  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLILFFSKQLLRHPLARSELSEFS-EGSFKW 880

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H  ++ + E+  R +L +GQVY AL + R   +    A  ++EQ  PFP+  L 
Sbjct: 881  IIEDGEHGNSIGTKEETKRLVLMTGQVYTALHKRRADLEDKTTAFLKIEQPHPFPFAQLR 940

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              I+ YPN E ++W QEEPLN G+W+Y APR+ T++  ++ ++G A +   R PS + A 
Sbjct: 941  DAINSYPNLEDIVWCQEEPLNMGSWSYAAPRLATVLKETDNYKGHAVRYCGRNPSGAVAA 1000

Query: 539  GNKKQHIQEEHDLLSQAL 556
            GNK  H+ EE   L +  
Sbjct: 1001 GNKALHLAEEDAFLKEVF 1018



>gi|406606545|emb|CCH42044.1| 2-oxoglutarate dehydrogenase E1 component [Wickerhamomyces
           ciferrii]
          Length = 998

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/557 (56%), Positives = 400/557 (71%), Gaps = 6/557 (1%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK +NAPIFHVN DDVE + F+  LAAEWR TF  DV+ID+V YRKYGHNE DQP
Sbjct: 445 YPSDIAKAINAPIFHVNADDVEGITFIFTLAAEWRATFHTDVIIDVVGYRKYGHNETDQP 504

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+I+++  +++ Y +KL+ +G+FTK+DI +HK+WVWNILEE++ KSK+Y PT
Sbjct: 505 SFTQPLMYQKISEKKSVIDLYTKKLIDEGSFTKDDIAEHKQWVWNILEESFTKSKEYKPT 564

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W GFKSPKELA E  P  PT    E L+H+G+ ISS+P+ F VH  L RIL 
Sbjct: 565 SREWLTTPWEGFKSPKELANEILPHLPTAVKEETLKHIGKTISSWPEAFEVHRNLKRILG 624

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA++ G+GIDW T E LA+GSL+ EG HVR+SGQDVERGTFSQRH+VLHDQ +E  Y
Sbjct: 625 QRQKAVDSGEGIDWATGEALAYGSLVDEGYHVRVSGQDVERGTFSQRHSVLHDQKSEQTY 684

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL  +   QA F + NSSLSE+G +GFEYGYSL +P++ + WE QFGDF N +Q IIDQ
Sbjct: 685 TPLKHISENQADFIISNSSLSEYGVMGFEYGYSLTSPDAFVQWEAQFGDFANTAQVIIDQ 744

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA+GE KW QR+GLV+ LPHGYDGQGPEHSSGRLER+LQL ++ P  +P  +K+ RQHQ
Sbjct: 745 FIAAGESKWKQRSGLVLTLPHGYDGQGPEHSSGRLERYLQLTNEDPRFFPSEDKLQRQHQ 804

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCN Q+   TTPAN FH+ RRQ+HR FRKPL+   SK LLRHP+ARS L++ TG++ F+ 
Sbjct: 805 DCNFQVAYPTTPANLFHLYRRQMHRQFRKPLVLLVSKQLLRHPLARSPLSDFTGESHFQW 864

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I     E   + + I R ++ SGQV+ AL + RE    +  A  R+EQ+ PFP+  L  
Sbjct: 865 II----EENNINKDDIKRVVVLSGQVFTALTKKRETLGDNTTAFIRVEQLHPFPFAQLRD 920

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            ++ Y N E L+W QEEPLN G W+Y  PR+ T++  +E H  +  + A R PSAS A G
Sbjct: 921 ALNSYKNVEDLVWCQEEPLNMGGWSYAQPRLETVLQETE-HSDKKFRYAGRDPSASVAAG 979

Query: 540 NKKQHIQEEHDLLSQAL 556
            K  H+ EE   L    
Sbjct: 980 TKSMHLAEEAAFLEDVF 996



>gi|50310525|ref|XP_455282.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644418|emb|CAG97990.1| KLLA0F04477p [Kluyveromyces lactis]
          Length = 1017

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/558 (56%), Positives = 403/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+ K ++APIFHVN +DVEA+ F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 459  YPSDLGKTIDAPIFHVNANDVEALTFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 518

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ+I+KQ  +++ Y +KL+ +G+FTK+DI++HKKWVW + EE Y K+KDY PT
Sbjct: 519  SFTQPLMYQKISKQKSVIDVYTEKLVSEGSFTKQDIDEHKKWVWGLFEEAYEKAKDYKPT 578

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W GFKSPK LA E     PT    + L+++G+ ISS+P+ F VH  L RIL 
Sbjct: 579  SREWLTAAWEGFKSPKALATEILSHEPTVVDADTLKNIGKTISSWPENFEVHKNLKRILT 638

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA+  G+GIDW T E LAFGSL+LEG HVR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 639  NRGKAVESGEGIDWSTGEALAFGSLVLEGNHVRVSGEDVERGTFSQRHAVLHDQKSENTY 698

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA F++CNSSLSE+G +GFEYGYSL NP+  ++WE QFGDF N +Q IIDQ
Sbjct: 699  TPLKHLSEKQANFTICNSSLSEYGCMGFEYGYSLTNPDYFVVWEAQFGDFANTAQVIIDQ 758

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 759  FIAAGEVKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLGNEDPRYFPSEEKLQRQHQ 818

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN QI+  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARS+L E T +  F+ 
Sbjct: 819  DCNFQIVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSNLNEFT-EGGFQW 877

Query: 421  FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D    +++A  E+I R +L SGQVY AL + RE  +  + A  ++EQ+ PFPY  L 
Sbjct: 878  IIEDVELGKSIAPKEEIKRVVLLSGQVYTALHKKRETIQDKNTAFIKIEQLHPFPYAQLR 937

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEPLN G W Y  PR++T +  +++++    + A R PS S A 
Sbjct: 938  DALNTYPNLEDIVWCQEEPLNMGGWAYAQPRLQTTLKETDKYKDAIIRYAGRNPSGSVAA 997

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L +  
Sbjct: 998  GSKALHNAEEEAFLKEVF 1015



>gi|401841723|gb|EJT44068.1| KGD1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 1014

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/558 (55%), Positives = 408/558 (73%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR TF  D +IDIV +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHTFHTDAIIDIVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +G+F+ +DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLINEGSFSNKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT  S + L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNISEKTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFGSL+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGSLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAVY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E + D  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFS-DGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFPY  L 
Sbjct: 874  IIEDVEHGKSIGTKEETKRVVLLSGQVYTALHKRRETLGDRTTAFLKIEELHPFPYAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  ++ ++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYAEPRLHTTLKETDNYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|401625342|gb|EJS43355.1| kgd1p [Saccharomyces arboricola H-6]
          Length = 1014

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/558 (55%), Positives = 408/558 (73%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +IDIV +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDIVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+QIAKQ  +++ Y +KL+ +GTF+ +DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKQIAKQKSVIDVYTEKLINEGTFSNKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT    + L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNIPEKTLKDLGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFGSL+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGSLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAVY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GL++ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLILSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E + +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHMLRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFS-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A+ ++E++ PFPY  L 
Sbjct: 874  IIEDVEHGKSIGTKEETKRLVLLSGQVYTALHKRRENLGDKTTALLKIEELHPFPYAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+RT +  ++ ++    +   R PS + A 
Sbjct: 934  DTLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLRTTLKETDNYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKALHMTEEDAFLKDVF 1011



>gi|513034202|gb|AGO14168.1| AaceriAER374Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 1004

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/561 (55%), Positives = 401/561 (71%), Gaps = 4/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+ K ++APIFHVN +D+EAVNF+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 446  YPSDIGKTIDAPIFHVNANDIEAVNFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+QIAKQ  +++ Y +KLL +G+ TK+ I+ HKKWVW + EE + K+K+Y PT
Sbjct: 506  SFTQPLMYKQIAKQPSVIDVYTKKLLDEGSMTKDQIDTHKKWVWGLFEEAFSKAKEYKPT 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W  FKSPKELA E  P  PT      L+ +G ++SS+P  F VH  L RIL 
Sbjct: 566  SREWLTAAWENFKSPKELATEILPHNPTNVDAPTLKQIGSILSSWPSDFEVHRNLKRILT 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG++L+EG H+R+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 626  NRGKSIESGEGIDWSTGEALAFGTMLMEGTHIRVSGEDVERGTFSQRHAVLHDQNSENTY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA F++CNSSLSE+G +GFEYGYSL +P+  ++WE QFGDF N +Q IIDQ
Sbjct: 686  TPLKHLSKDQADFTICNSSLSEYGCMGFEYGYSLTSPDYFVMWEAQFGDFANTAQVIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA  E KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ R+HQ
Sbjct: 746  FIAGAETKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLTNEDPRYFPSEEKIQREHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q+   TTPAN FH+LRRQ HR FRKPL+ F SK LLRHP+ARS+L+E T D  F+ 
Sbjct: 806  DCNFQVAYPTTPANLFHILRRQQHRQFRKPLVIFFSKQLLRHPLARSNLSEFT-DGGFQW 864

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H + +AS E+  R ++ +GQVY AL + RE       A  R+EQ+ PFPY  L 
Sbjct: 865  IIEDSEHGKAIASKEETKRLVILTGQVYTALHKKREALGDKSTAFLRIEQLHPFPYAQLR 924

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEP N G+W YV PRI+T +  ++++ G A + A R PS + A 
Sbjct: 925  DTLNSYPNLEDIVWCQEEPFNMGSWAYVQPRIQTTLKETDKYNGFAFRYAGRNPSGAVAA 984

Query: 539  GNKKQHIQEEHDLLSQALIGQ 559
            G+K  H  EE   L + + GQ
Sbjct: 985  GSKALHTAEEEAFL-KDVFGQ 1004



>gi|6322066|ref|NP_012141.1| alpha-ketoglutarate dehydrogenase KGD1 [Saccharomyces cerevisiae
            S288c]
 gi|730221|sp|P20967.2|ODO1_YEAST RecName: Full=2-oxoglutarate dehydrogenase, mitochondrial; AltName:
            Full=2-oxoglutarate dehydrogenase complex component E1;
            Short=OGDC-E1; AltName: Full=Alpha-ketoglutarate
            dehydrogenase; Flags: Precursor
 gi|599992|emb|CAA86867.1| 2-oxoglutarate dehydrogenase E1 component [Saccharomyces cerevisiae]
 gi|285812529|tpg|DAA08428.1| TPA: alpha-ketoglutarate dehydrogenase KGD1 [Saccharomyces cerevisiae
            S288c]
          Length = 1014

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++EQ+ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEQLHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|171785|gb|AAA34721.1| alpha-ketoglutarate dehydrogenase [Saccharomyces cerevisiae]
          Length = 1014

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE D+P
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDRP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKTKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++EQ+ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEQLHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|151943041|gb|EDN61376.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190406336|gb|EDV09603.1| alpha-ketoglutarate dehydrogenase [Saccharomyces cerevisiae RM11-1a]
 gi|256269546|gb|EEU04830.1| Kgd1p [Saccharomyces cerevisiae JAY291]
 gi|259147129|emb|CAY80382.1| Kgd1p [Saccharomyces cerevisiae EC1118]
 gi|323354550|gb|EGA86386.1| Kgd1p [Saccharomyces cerevisiae VL3]
          Length = 1014

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEELHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|392298792|gb|EIW09888.1| Kgd1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 1014

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEELHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|71064093|gb|AAZ22502.1| Kgd1p [Saccharomyces cerevisiae]
          Length = 1014

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEELHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|349578831|dbj|GAA23995.1| K7_Kgd1p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 1014

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEELHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 994  GSKSLHLAEEDAFLKDVF 1011



>gi|68491108|ref|XP_710646.1| hypothetical protein CaO19.6165 [Candida albicans SC5314]
 gi|46431876|gb|EAK91398.1| hypothetical protein CaO19.6165 [Candida albicans SC5314]
 gi|238880525|gb|EEQ44163.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
           [Candida albicans WO-1]
          Length = 996

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/546 (56%), Positives = 399/546 (73%), Gaps = 5/546 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFHVN DDVEA  FV  LAAEWR T+  D +ID+V YRK+GHNE DQP
Sbjct: 442 YPSDIAKAIDAPIFHVNADDVEACTFVFNLAAEWRATYHTDCIIDVVGYRKHGHNETDQP 501

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ+IAK+  +++ Y ++L+ +GTFT EDI++HK+WVWNILE+N+ K+K+Y PT
Sbjct: 502 SFTQPLMYQEIAKKNSVIDIYEKQLIDEGTFTAEDIKEHKQWVWNILEDNFKKAKEYKPT 561

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSPKELA E  P  PT      L+ +G  IS  P+GF VH  L RIL 
Sbjct: 562 SREWLTTPWEDFKSPKELATEVLPHLPTAVDEATLKKIGNAISETPEGFEVHRNLKRILN 621

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
           AR K++  G+GID+ T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ +E+ +
Sbjct: 622 ARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESVW 681

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL++L   Q  F++ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q +IDQ
Sbjct: 682 TPLSNLSEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQ 741

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           F+A  E KW QR+G+V+ LPHGYDGQGPEHSS RLER+LQLC++    +P PEK+ RQHQ
Sbjct: 742 FVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSSRLERYLQLCNEDQRFFPSPEKLERQHQ 801

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI   SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 802 DCNMQVAYPTTPANVFHLLRRQMHRQFRKPLILVFSKSLLRHPLARSNLSEFTGDSHFQW 861

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L    ++ R +L +GQVY AL + R        A  ++EQ+ PFPY  L  
Sbjct: 862 IIED----VLGDKSEVKRVVLLTGQVYAALHKKRASLDDKSTAFIKIEQLHPFPYAQLRD 917

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            +++YPN E L+W QEEPLN GA+ + APR+  ++  +++++    + A R PSAS A G
Sbjct: 918 ALNEYPNLEDLVWTQEEPLNMGAYNFAAPRVEAVLGETQKYKDLKLRYAGRDPSASVAAG 977

Query: 540 NKKQHI 545
           +K  H+
Sbjct: 978 SKAMHV 983



>gi|365765073|gb|EHN06587.1| Kgd1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 1014

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/558 (55%), Positives = 407/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEAV F+  LAAEWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y +KL+ +GTF+K+DI++HKKWVWN+ E+ + K+KDYVP+
Sbjct: 515  SFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPS 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W GFKSPKELA E  P  PT      L+ +G+V+SS+P+GF VH  L RILK
Sbjct: 575  QREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILK 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG+L+L+G++VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL+ L   +A F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 695  TPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 755  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARSSL+E T +  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++ + E+  R +L SGQVY AL + RE       A  ++E++ PFP+  L 
Sbjct: 874  IIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEELHPFPFAQLR 933

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W Y  PR+ T +  +++++    +   R PS + A 
Sbjct: 934  DSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G++  H+ EE   L    
Sbjct: 994  GSRSLHLAEEDAFLKDVF 1011



>gi|336263898|ref|XP_003346728.1| hypothetical protein SMAC_04160 [Sordaria macrospora k-hell]
 gi|380091435|emb|CCC10931.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 1019

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/567 (55%), Positives = 403/567 (71%), Gaps = 36/567 (6%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+D+AK ++AP+FHVN DDVEAVNFVCQLAA+WR  FK+DV+ID+              
Sbjct: 468  YCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFKQDVIIDL-------------- 513

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
                P MY++I  + P ++ YV +LLK+GTFTKEDIE+HK+WVW +LEE++ KSKDY PT
Sbjct: 514  ----PLMYKRINAKNPQIDTYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPT 569

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            S+EW +S+WNGFKSPKELA E  P  PT  + + L+H+G VI S P+GF  H  L RIL 
Sbjct: 570  SKEWTTSAWNGFKSPKELATEVLPHNPTAVNKQTLEHIGTVIGSTPEGFQPHRNLKRILT 629

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++ EG+GIDW TAE LAFGSL+ EG HVR+SGQDVERGTFSQRHAV HDQ  E  Y
Sbjct: 630  NRTKSVVEGKGIDWATAEALAFGSLVNEGHHVRISGQDVERGTFSQRHAVFHDQETEDTY 689

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   Q KF + NSSLSE+G LGFEYGYSL +PN   +WE QFGDF N +Q IIDQ
Sbjct: 690  TPLQHISKDQGKFVISNSSLSEYGILGFEYGYSLQDPNGFNMWEAQFGDFANTAQVIIDQ 749

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+ASGE KW+QRTGLV+ LPHGYDGQGPEHSS R+ERFLQLC++ P +YP PEK+ RQHQ
Sbjct: 750  FLASGESKWMQRTGLVMSLPHGYDGQGPEHSSARIERFLQLCNEDPRIYPSPEKLERQHQ 809

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRK--------PLIAFTSKSLLRHPMARSSLAEM 412
            DCNMQ+   T+PAN FH+LRRQ+ R FRK         +     +   RH        E 
Sbjct: 810  DCNMQVAYMTSPANLFHILRRQMKRQFRKRNPRHLLLQVPPPPPRRSFRH-------REF 862

Query: 413  TGDTTFKRFIPDPHPET--LASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQI 470
            T D  F+  + D   +T  + +PE+I R ILC+GQVY ALL+ R+ NK+D+VA +R+EQ+
Sbjct: 863  TDDAHFRWILEDSAHKTGEIKAPEEIERVILCTGQVYAALLKHRQDNKIDNVAFTRIEQL 922

Query: 471  CPFPYDLLSQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPAT 529
             PFP++ L +++D+YPNA+ ++WAQEEPLN G W+Y  PR+ TL+NH++ H+ +    A 
Sbjct: 923  HPFPWEQLRENLDQYPNAKTIVWAQEEPLNAGPWSYTQPRLETLLNHTKNHDRKHVMYAG 982

Query: 530  RLPSASPATGNKKQHIQEEHDLLSQAL 556
            R PSAS ATG K  H++EE  L+  A 
Sbjct: 983  RAPSASVATGKKSSHLKEEKALVEMAF 1009



>gi|365983650|ref|XP_003668658.1| hypothetical protein NDAI_0B03810 [Naumovozyma dairenensis CBS 421]
 gi|343767425|emb|CCD23415.1| hypothetical protein NDAI_0B03810 [Naumovozyma dairenensis CBS 421]
          Length = 1014

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/558 (55%), Positives = 405/558 (72%), Gaps = 4/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFH N +D+EAV F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 457  YPSDLAKAIDAPIFHCNANDIEAVTFIFNLAAEWRNTFHTDAIIDVVGWRKHGHNETDQP 516

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y  KLL +G+FT++DI++HKKWVW++ EE + KSKDYVP+
Sbjct: 517  SFTQPLMYKRIAKQKSVIDVYTAKLLNEGSFTQKDIDEHKKWVWSLFEEAFEKSKDYVPS 576

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL+++W  FKSPKELA E  P  PT    E LQ++G+VIS++P+ F VH  L RIL 
Sbjct: 577  QREWLTAAWEDFKSPKELATEILPHNPTKVPAETLQNIGKVISTWPEKFEVHKNLKRILT 636

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I+EG+GIDW T E LAF +L LEG +VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 637  NRGKSISEGEGIDWSTGEALAFATLTLEGHNVRVSGEDVERGTFSQRHAVLHDQNSEDTY 696

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            +PL  L   QA FS+CNSSLSE+G +GFEYGYSL +P  L++WE QFGDF N +Q IIDQ
Sbjct: 697  IPLKHLSEKQADFSICNSSLSEYGVMGFEYGYSLTSPEYLVMWEAQFGDFANTAQVIIDQ 756

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GL++ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ RQHQ
Sbjct: 757  FIAGGEQKWKQRSGLILSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQ 816

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH++RRQ HR FRKPL  F SK LLRHP+ARS+L E T +  F+ 
Sbjct: 817  DCNFQVVYPTTPANLFHIIRRQQHRQFRKPLALFFSKQLLRHPLARSNLEEFT-EGGFQW 875

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H + + + E+  R +L SGQVY AL + RE       A+ ++E++ PFP+  L 
Sbjct: 876  IIEDVEHGKAIGTKEETKRLVLLSGQVYTALHKKRETLGDKTTALMKIEELHPFPFAQLR 935

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              I+ YPN  E++W QEEPLN G+W++V+PR++T +N +  ++    +   R PS + A 
Sbjct: 936  DAINSYPNLEEIVWCQEEPLNMGSWSFVSPRLKTTLNET-TYKDFTVRYCGRNPSGAVAA 994

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L    
Sbjct: 995  GSKALHAAEEEAFLKDVF 1012



>gi|302308342|ref|NP_985230.2| AER374Cp [Ashbya gossypii ATCC 10895]
 gi|299789409|gb|AAS53054.2| AER374Cp [Ashbya gossypii ATCC 10895]
 gi|374108455|gb|AEY97362.1| FAER374Cp [Ashbya gossypii FDAG1]
          Length = 1004

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/561 (55%), Positives = 399/561 (71%), Gaps = 4/561 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+ K ++APIFHVN +D+EAVNF+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 446  YPSDIGKTIDAPIFHVNANDIEAVNFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 505

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+QIAKQ  +++ Y +KLL +G+ T E I+ HKKWVW + EE + K+K+Y P+
Sbjct: 506  SFTQPLMYKQIAKQPSVIDVYTKKLLDEGSMTNEQIDTHKKWVWGLFEEAFSKAKEYKPS 565

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W  FKSPKELA E  P  PT      L+ +G V+SS+P  F VH  L RIL 
Sbjct: 566  SREWLTAAWENFKSPKELATEILPHNPTNVDASTLKQIGSVLSSWPTDFEVHRNLKRILL 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I  G+GIDW T E LAFG++L+EG H+R+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 626  NRGKSIESGEGIDWSTGEALAFGTMLMEGTHIRVSGEDVERGTFSQRHAVLHDQNSENTY 685

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   QA F++CNSSLSE+G +GF+YGYSL +P+  ++WE QFGDF N +Q IIDQ
Sbjct: 686  TPLKHVSKDQADFTICNSSLSEYGCIGFDYGYSLTSPDYFVMWEAQFGDFANTAQVIIDQ 745

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA  E KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK+ R+HQ
Sbjct: 746  FIAGAETKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLTNEDPRYFPSEEKIQREHQ 805

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q+   TTPAN FH+LRRQ HR FRKPL+ F SK LLRHP+ARSSL+E T D  F+ 
Sbjct: 806  DCNFQVAYPTTPANLFHILRRQQHRQFRKPLVLFFSKQLLRHPLARSSLSEFT-DGGFQW 864

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H + + S E+  R ++ +GQVY AL + RE       A  R+EQ+ PFPY  L 
Sbjct: 865  IIEDIEHGKAIVSKEETKRLVILTGQVYTALHKKREALGDRTTAFLRIEQLHPFPYAQLR 924

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEP N G+W YV PRI+T +  ++++ G A + A R PS + A 
Sbjct: 925  DALNSYPNLEDIVWCQEEPFNMGSWAYVQPRIQTTLKETDKYSGFAFRYAGRNPSGAVAA 984

Query: 539  GNKKQHIQEEHDLLSQALIGQ 559
            G+K  H  EE   L + + GQ
Sbjct: 985  GSKALHTTEEEAFL-KDVFGQ 1004



>gi|255718309|ref|XP_002555435.1| KLTH0G09262p [Lachancea thermotolerans]
 gi|238936819|emb|CAR24998.1| KLTH0G09262p [Lachancea thermotolerans CBS 6340]
          Length = 1013

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/558 (55%), Positives = 404/558 (72%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +DVEA+ F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 455  YPSDIAKAIDAPIFHVNANDVEALTFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 514

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ+I+KQ  +++ Y +KL+ +G+FTK+DI++HK+WVW + E+ + K+KDY PT
Sbjct: 515  SFTQPLMYQKISKQKSVIDVYTEKLISEGSFTKKDIDEHKQWVWGLFEKAFEKAKDYEPT 574

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL++ W  FKSPKELA E  P  PT    E L+ +G++ISS+P+ F VH  L RIL 
Sbjct: 575  SREWLTADWANFKSPKELATEILPHEPTVVQQEKLKEIGKIISSWPEDFEVHRNLKRILT 634

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+I +G+GIDW T E LA GSL  EG H+R+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 635  NRGKSIEKGEGIDWSTGEALALGSLATEGYHIRVSGEDVERGTFSQRHAVLHDQKSERTY 694

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   QA F++CNSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N  Q IIDQ
Sbjct: 695  TPLQHLSDKQANFTICNSSLSEYGCMGFEYGYSLTSPDFLVMWEAQFGDFANTGQVIIDQ 754

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            F+A GE KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQ+ ++ P  +P  EK+ RQHQ
Sbjct: 755  FLAGGEAKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANEDPRYFPSEEKLQRQHQ 814

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPLI F SK LLRHP+ARS L++ + D  F+ 
Sbjct: 815  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLILFFSKQLLRHPLARSKLSDFS-DNGFQW 873

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +++AS E+  R ++ SGQVY AL + RE     + A  ++EQ+ PFP+  L 
Sbjct: 874  IIEDVEHGKSIASKEETKRLVIMSGQVYTALHKKRESLGDKNTAFLKVEQLHPFPFAQLR 933

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E +++ QEEPLN G+W Y APR+ T++  +++++    + A R PS + A 
Sbjct: 934  DSLNSYPNLEDIVFCQEEPLNMGSWAYAAPRLGTVLKETDKYKDFEVRFAGRNPSGAVAA 993

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L +  
Sbjct: 994  GSKALHAAEEEAFLKEVF 1011



>gi|344301023|gb|EGW31335.1| hypothetical protein SPAPADRAFT_67403 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 996

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/545 (57%), Positives = 395/545 (72%), Gaps = 6/545 (1%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK VNAPIFHVN DDVEA  FV  LAAEWR TF  DV+ID+V YRK+GHNE DQP
Sbjct: 444 YPSDIAKSVNAPIFHVNADDVEACTFVFNLAAEWRATFHSDVIIDVVGYRKHGHNETDQP 503

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP MY++IA++  +++ Y  KL+++GTFT EDI++HKKWVW  LEE + K+KDY PT
Sbjct: 504 AFTQPLMYEKIAEKKSVIDYYTTKLIEEGTFTVEDIDEHKKWVWQTLEEQFGKAKDYQPT 563

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SREWL++ W  FKSP +LA E  P  PT      L+ +G+ IS  P+GF VH  L RIL 
Sbjct: 564 SREWLTTPWEDFKSPTQLATEILPHLPTAVEENTLKKIGDAISQAPEGFEVHRNLKRILG 623

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K ++ G+GIDW T E LA+GSL LEG HVR+SGQDVERGTFSQRHAVLHDQ ++  +
Sbjct: 624 TRKKTVDSGEGIDWATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQKSDRTW 683

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL +L   Q  F++ NSSLSE+G LGFEYGYSL +P++L+ WE QFGDF N +Q IIDQ
Sbjct: 684 TPLANLSEDQGAFTIANSSLSEYGCLGFEYGYSLTSPDALVQWEAQFGDFANTAQVIIDQ 743

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA  E KW QR+G+V+ LPHGYDGQGPEHSSGRLER+LQLC++ P  +P   K+ RQHQ
Sbjct: 744 FIAGAESKWKQRSGVVLSLPHGYDGQGPEHSSGRLERYLQLCNEDPRYFPSETKLERQHQ 803

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCNMQ+   TTPAN FH+LRRQ+HR FRKPLI F SKSLLRHP+ARS+L+E TGD+ F+ 
Sbjct: 804 DCNMQVAYPTTPANLFHLLRRQMHRQFRKPLILFVSKSLLRHPLARSNLSEFTGDSHFQW 863

Query: 421 FIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLSQ 480
            I D     L     I + +LCSGQV+ AL + R     + +A  ++EQ+ PFP+  L  
Sbjct: 864 IIED----YLGEKSDIKKVVLCSGQVFAALHKKRAGLNDNSIAFIKVEQLHPFPFAQLRD 919

Query: 481 HIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPATG 539
            ++ YPN E L+W QEEPLN G+W +V+PR+  ++  +  H+    + A R PSAS A G
Sbjct: 920 ALNSYPNVEDLVWCQEEPLNMGSWAHVSPRMDVVVQET-IHKDLKVRYAGRNPSASVAAG 978

Query: 540 NKKQH 544
           +K +H
Sbjct: 979 SKAKH 983



>gi|410083577|ref|XP_003959366.1| hypothetical protein KAFR_0J01660 [Kazachstania africana CBS 2517]
 gi|372465957|emb|CCF60231.1| hypothetical protein KAFR_0J01660 [Kazachstania africana CBS 2517]
          Length = 958

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 400/558 (71%), Gaps = 3/558 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AK ++APIFH N +DVEAV F+  LA EWR  F  D +ID+V +RK+GHNE DQP
Sbjct: 400 YSSDLAKAIDAPIFHCNANDVEAVTFIFNLATEWRNEFHTDAIIDVVGWRKHGHNETDQP 459

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA+Q  +++ Y +KL+++GTF+K+DI++HKKWVW++ E  + K+KDYVP 
Sbjct: 460 SFTQPLMYKKIAEQQSVIDAYTEKLIEEGTFSKKDIDEHKKWVWDLFESAFAKAKDYVPN 519

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            REWL+++W  FKSP  LA E  P  PT    E LQ++G+ ISS+PKGF VH  L RIL 
Sbjct: 520 DREWLTAAWENFKSPLALATEVLPHEPTNVPAETLQNIGDTISSWPKGFEVHKNLKRILT 579

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R K +  G+ IDW T E LAFGSL+LEG +VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 580 NRGKTVTNGEEIDWSTGEALAFGSLVLEGHNVRVSGEDVERGTFSQRHAVLHDQNSEATY 639

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PL  L   QA FS+CNSSLSE+G +GFEYGYSL +P  L++WE QFGDF N  Q +IDQ
Sbjct: 640 TPLQHLSDKQADFSICNSSLSEYGVMGFEYGYSLTSPEYLVIWEAQFGDFANTGQVMIDQ 699

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
           FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++    +P  EK+ARQHQ
Sbjct: 700 FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDERYFPSEEKLARQHQ 759

Query: 361 DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
           DCN+Q++  TTPAN FH+LRRQ HR FRKPLI F SK LLRHP+ARS+L+E T D  FK 
Sbjct: 760 DCNVQVVYPTTPANLFHILRRQQHRQFRKPLILFFSKQLLRHPLARSNLSEFT-DGGFKW 818

Query: 421 FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
            I D  H +++ + ++  + ++ +GQVY AL + R +      A  ++E++ PFP+  L 
Sbjct: 819 IIEDTEHGKSIGTKDETKKLVIMTGQVYTALHKKRAKLGDTSTAFLKIEELHPFPFAQLR 878

Query: 480 QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
             I+ YPN  E+IW QEEPLN GAW++V+PR+ T +  ++++     +   R PSA+ A 
Sbjct: 879 DTINSYPNLEEIIWCQEEPLNMGAWSFVSPRLITTLKETDKYSDYIVRYCGRNPSAAVAA 938

Query: 539 GNKKQHIQEEHDLLSQAL 556
           G+K  H  EE   L    
Sbjct: 939 GSKALHNAEEAAFLKDVF 956



>gi|167538236|ref|XP_001750783.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163770700|gb|EDQ84382.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1294

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/562 (56%), Positives = 402/562 (71%), Gaps = 13/562 (2%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y +D+AK+V APIFHVNGDD EAV  VCQ+A EWRQ F  DVV+DIVCYR++GHNE DQP
Sbjct: 739  YSTDLAKMVGAPIFHVNGDDPEAVARVCQVAMEWRQEFGNDVVVDIVCYRRFGHNEADQP 798

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MY++IA+Q P+ + Y +K+  +GT   +  E  +K      EEN + + D  PT
Sbjct: 799  AFTQPLMYERIAEQKPVDQIYEEKVAAEGTIDGQWFESARK----TYEENLNAAWDRAPT 854

Query: 121  SR----EWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLV 176
             +    E+L S W+  KS +    +    Y TG    LL+ VG + S YP  FN+H  L 
Sbjct: 855  FKNTRPEYLGSWWSSLKSQQV---DVAQIYDTGVDEALLKEVGTIFSQYPDDFNIHRSLK 911

Query: 177  RILKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQ-V 235
            +IL++R  +I E  G+DW TAEGLAFG+LL+EGK VRLSGQDVERGTFSQRH VLHDQ V
Sbjct: 912  KILQSRLDSIVEDTGMDWATAEGLAFGTLLMEGKAVRLSGQDVERGTFSQRHHVLHDQKV 971

Query: 236  NETQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQ 295
            +   YV L +L P Q  +SV NS LSE+G LGFE GYS+VNP+SLI WE QFGDF N +Q
Sbjct: 972  DGKTYVSLQELAPAQTNYSVSNSHLSEYGVLGFELGYSMVNPHSLICWEAQFGDFANTAQ 1031

Query: 296  CIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPP-PEK 354
            CIIDQFIA+GE KW + TGL +LLPHGY+G GPEHSSGR+ERFLQLC+D+  VYP   + 
Sbjct: 1032 CIIDQFIAAGEHKWRRMTGLTMLLPHGYEGMGPEHSSGRIERFLQLCNDNESVYPEMRDG 1091

Query: 355  MARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG 414
              RQ QDCN+Q++NATTPANYFHVLRRQ+HRDFRKPL+ FT KSLLRHPM +S+LA++  
Sbjct: 1092 QRRQIQDCNIQVVNATTPANYFHVLRRQVHRDFRKPLVVFTPKSLLRHPMCKSTLADIGA 1151

Query: 415  DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFP 474
             T F RF  +      ++P+ + R +LCSG+VYY LL+ R+ N +  VAI R+EQI PFP
Sbjct: 1152 GTRFTRFYSETDESISSNPDGVKRVVLCSGKVYYDLLKHRQDNNITDVAIGRVEQISPFP 1211

Query: 475  YDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSA 534
            +DL+   +D+YPNAE++W QEEP N GAW+YV  RI T ++ SE H+G  A+   R  SA
Sbjct: 1212 FDLVHNMMDQYPNAEVVWCQEEPRNMGAWSYVDSRIETALSKSEHHQGARARYVGRNASA 1271

Query: 535  SPATGNKKQHIQEEHDLLSQAL 556
            S A G+KKQH  E+  L+ QAL
Sbjct: 1272 SVAAGDKKQHNAEQQSLIEQAL 1293



>gi|254576895|ref|XP_002494434.1| ZYRO0A01386p [Zygosaccharomyces rouxii]
 gi|238937323|emb|CAR25501.1| ZYRO0A01386p [Zygosaccharomyces rouxii]
          Length = 1021

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 399/558 (71%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  +APIFHVN +DVEAV F+  LAAEWRQTF  D VIDIV +RK+GHNE DQP
Sbjct: 461  YPSDLAKAFDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAVIDIVGWRKHGHNETDQP 520

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ+IAKQ  + + Y +KL+ +G+FTK DIEKH++WVW++ EE++ K+K YVP 
Sbjct: 521  SFTQPMMYQKIAKQKSVFDVYAEKLMVEGSFTKADIEKHRQWVWSLFEESFEKAKGYVPN 580

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL++ W   KSPKE+A E  P  PT    + L+ VG  +SS+P+GF VH  L RIL 
Sbjct: 581  PREWLTAPWENLKSPKEMATEILPHEPTKVDLDTLKKVGLAVSSWPEGFEVHRNLRRILT 640

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RAK+I  G+GIDW TAE +AFG+L LEG +VR+SG+DVERGTFSQRH+VLHDQ +E  +
Sbjct: 641  NRAKSIESGEGIDWSTAEAMAFGTLALEGYNVRVSGEDVERGTFSQRHSVLHDQKSERVF 700

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPL +L   Q  F++ NSSLSE+G +GFEYGYSL +P++L++WE QFGDF N +Q IIDQ
Sbjct: 701  VPLKNLSEKQGDFTISNSSLSEYGVMGFEYGYSLTDPDNLVMWEAQFGDFANTAQVIIDQ 760

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+G+V+ LPHGYDGQGPEHSSGRLER+LQL ++    +P  E + RQHQ
Sbjct: 761  FIAGGEQKWKQRSGIVLSLPHGYDGQGPEHSSGRLERYLQLANEDSRFFPSEEGLQRQHQ 820

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARS + E + D  F+ 
Sbjct: 821  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSRMEEFS-DGEFQW 879

Query: 421  FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D    +++A  E+I R +L +GQVY AL + RE     + A  ++EQ  PFP+  L 
Sbjct: 880  IIEDVELGKSIAPKEEIKRIVLLTGQVYTALFKKRESLGDKNTAFIKIEQPHPFPFAQLR 939

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ID YPN E ++W QEEPLN G+W+YV+ R  T++  ++ ++    +   R PS + A 
Sbjct: 940  DAIDSYPNLEDIVWCQEEPLNMGSWSYVSQRFPTVLKETQNYKNSQVRYCGRDPSGTVAA 999

Query: 539  GNKKQHIQEEHDLLSQAL 556
            GNK  H  EE D L+   
Sbjct: 1000 GNKPAHTAEEEDFLNDVF 1017



>gi|385305753|gb|EIF49704.1| 2-oxoglutarate dehydrogenase e1 mitochondrial precursor [Dekkera
            bruxellensis AWRI1499]
          Length = 1013

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/556 (56%), Positives = 394/556 (70%), Gaps = 4/556 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  +AP+FHVN DDVEAV F+  LAAEWR+TF  DV +DIV YRK+GHNE DQP
Sbjct: 456  YPSDIAKAFDAPVFHVNADDVEAVVFMFNLAAEWRETFHSDVFLDIVGYRKHGHNETDQP 515

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA++  +LE Y ++L  +G FT  DI++HK+WVW  L+ ++ K+++Y P 
Sbjct: 516  SFTQPLMYKRIAQKKQVLEXYEKQLRDEGFFTDADIDEHKQWVWKKLQASFDKAREYTPE 575

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL++ W GFKSP+ELA E  P  PT      L+ +G VIS+ P GF +H  L R+LK
Sbjct: 576  SREWLTAPWEGFKSPRELAREILPHLPTAVDEATLKSIGRVISTPPDGFKIHRNLKRVLK 635

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            +R K+I+ G+GIDW T E LA GSL LEG HVR++G+DVERGTFSQRHAVLHDQ +   Y
Sbjct: 636  SRLKSIDAGKGIDWSTGEALALGSLALEGYHVRVTGEDVERGTFSQRHAVLHDQDSGATY 695

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            VPL  +   Q  F + NS LSE+G LG+EYGYSL +P++ + WE QFGDF NN+QCIIDQ
Sbjct: 696  VPLKHIGASQGDFVISNSPLSEYGALGYEYGYSLASPDAFVEWEAQFGDFANNAQCIIDQ 755

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA+GE KW QR+GLV+ LPHGYDGQGPEHSS R+ER+L+LC++ P V+P PEK+ RQHQ
Sbjct: 756  FIAAGESKWKQRSGLVMSLPHGYDGQGPEHSSARIERYLELCNEEPRVFPSPEKLDRQHQ 815

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCNMQ+   TTPA+ FH++RRQ+HR FRKPLI F SKSLLRHP+ARS L+E TGD+ F  
Sbjct: 816  DCNMQVAYPTTPASLFHLMRRQMHRQFRKPLIIFFSKSLLRHPLARSDLSEFTGDSHFPW 875

Query: 421  FIPDPH-PETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D     ++     I R +LCSGQVY  L + RE       A  ++EQ  PFPY LL 
Sbjct: 876  IIEDKELGXSINDKPGIKRLVLCSGQVYATLFKKREDLGDRETAFLKVEQFHPFPYALLR 935

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
                 YP  E L+W QEEPLN GA+ Y+ PR+   +   E       + A R PSAS AT
Sbjct: 936  DAFKTYPALEDLVWCQEEPLNMGAYWYMKPRLNXTLK--EAGVDLPLRYAGRDPSASIAT 993

Query: 539  GNKKQHIQEEHDLLSQ 554
            GNKK+H  EE   L+Q
Sbjct: 994  GNKKRHHAEEEAFLAQ 1009



>gi|482548272|gb|EOA12466.1| hypothetical protein CARUB_v10025801mg [Capsella rubella]
          Length = 1025

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/569 (55%), Positives = 406/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVN DD+EAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 452  YCTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  T+EDI+K +K V +IL E +  SKDY+P 
Sbjct: 512  SFTQPKMYKVIRSHPSSLQIYQEKLLESGQVTQEDIDKIQKKVSSILNEEFGASKDYIPQ 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WL+S W GFKSP++++        TG   E+L++VG+ IS++P+ F  H G+ R+ +
Sbjct: 572  KRDWLASHWTGFKSPEQISRVRN----TGVKPEILKNVGKAISTFPENFKPHRGVKRVYE 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    QY
Sbjct: 628  QRAQMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEQY 687

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q + 
Sbjct: 688  CPLDHLTMNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVMF 747

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+PYV P  +  + +
Sbjct: 748  DQFISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPTLRK 807

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH    S+L+E      
Sbjct: 808  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFDDVKG 867

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D    +    E I R +LCSG+VYY L   R+++    VAI R+
Sbjct: 868  HPGFDKQGTRFKRLIKDQSDHSDLE-EGIRRLVLCSGKVYYELDEERKKSATKDVAICRV 926

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G + Y+APR+ T M   ER +    K 
Sbjct: 927  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGGYQYIAPRLCTAMKALERGKFNDIKY 986

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              RLPSA+ ATG  + H++E+ DL+ +AL
Sbjct: 987  VGRLPSAATATGFYQLHVKEQTDLVKKAL 1015



>gi|367002636|ref|XP_003686052.1| hypothetical protein TPHA_0F01330 [Tetrapisispora phaffii CBS 4417]
 gi|357524352|emb|CCE63618.1| hypothetical protein TPHA_0F01330 [Tetrapisispora phaffii CBS 4417]
          Length = 1025

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/558 (54%), Positives = 398/558 (71%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  +APIFHVN +DVEAV F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 466  YPSDLAKAFDAPIFHVNANDVEAVTFIFNLAAEWRNTFHSDAIIDVVGWRKHGHNETDQP 525

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IA Q  +++ Y ++L+K+G+F+++DI++ ++ +W   E  + K+KDY PT
Sbjct: 526  SFTQPLMYKKIANQKSVIDVYTEQLVKEGSFSQKDIDECRENIWQSFERAFEKAKDYTPT 585

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL++SW  FKSPKELA E  P  PT    E L+ +G+ ISS+P+ F VH  L RIL 
Sbjct: 586  QREWLTASWENFKSPKELATEILPHNPTNVPAETLKKIGKCISSWPEDFEVHRNLKRILN 645

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K++  G GIDW T E LAFGSLLLEG  VR+SG+DVERGTFSQRH+VLHDQ ++  Y
Sbjct: 646  NRGKSLETGTGIDWSTGEALAFGSLLLEGYQVRVSGEDVERGTFSQRHSVLHDQKSDATY 705

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
              L  L P Q KF+V NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q I+DQ
Sbjct: 706  TYLKHLDPNQGKFTVSNSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIVDQ 765

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FI+SGE+KW QR+GL++ LPHGYDGQGPEHSSGRLERFLQ+ ++ P  +P PEK+ RQHQ
Sbjct: 766  FISSGEQKWKQRSGLILSLPHGYDGQGPEHSSGRLERFLQMANEDPRYFPSPEKLQRQHQ 825

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARS L+E T +  F+ 
Sbjct: 826  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSELSEFT-EGGFQW 884

Query: 421  FIPD-PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +T+ + E   R +L +GQVY AL + RE+      A  ++E++ PFPY  L 
Sbjct: 885  LIEDVEHGKTIGTKEDTKRLVLLTGQVYTALHKKREELGDKTTAFLKIEELHPFPYAALR 944

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEPLN GAW YV+PR++T M  ++ ++    + A R PS + A 
Sbjct: 945  DTLNSYPNLEDIVWCQEEPLNMGAWNYVSPRLQTTMKETDNYKDVTVRYAGRNPSGAVAA 1004

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L  A 
Sbjct: 1005 GSKILHTAEEKAFLRDAF 1022



>gi|156846476|ref|XP_001646125.1| hypothetical protein Kpol_1039p16 [Vanderwaltozyma polyspora DSM
            70294]
 gi|156116798|gb|EDO18267.1| hypothetical protein Kpol_1039p16 [Vanderwaltozyma polyspora DSM
            70294]
          Length = 1020

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/558 (54%), Positives = 398/558 (71%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK  +APIFHVN +DVEAV ++  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 461  YPSDIAKTFDAPIFHVNANDVEAVTYIFNLAAEWRNTFHSDAIIDVVGWRKHGHNETDQP 520

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY++IAKQ  +++ Y ++L+K+G+F++ +I   K  VW   EE ++K+KDYVP+
Sbjct: 521  SFTQPLMYKEIAKQKSVIDVYSEQLIKEGSFSEANINDLKTEVWEKFEEAFNKAKDYVPS 580

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             REWL++SW  FKSPKELA E  P  PT    E L  +G  ISS+PKGF VH  L RIL 
Sbjct: 581  QREWLTASWENFKSPKELATEILPHNPTNVDLETLNGIGSAISSWPKGFEVHKNLKRILT 640

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K+++ G+GIDW T E LA+GSL+LEG  VR+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 641  NRGKSVDTGKGIDWSTGEALAYGSLVLEGYQVRVSGEDVERGTFSQRHAVLHDQKSEAVY 700

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  L   Q +F++ NSSLSE+G +GFEYGYSL +P+ L++WE QFGDF N +Q IIDQ
Sbjct: 701  TPLKHLSKDQGEFTISNSSLSEYGVMGFEYGYSLTSPDYLVVWEAQFGDFANTAQVIIDQ 760

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA GE+KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P   K+ RQHQ
Sbjct: 761  FIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFPSELKLQRQHQ 820

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q++  TTPAN FH+LRRQ HR FRKPLI F SK LLRHP+ARS++ E T +  F+ 
Sbjct: 821  DCNFQVVYPTTPANLFHILRRQQHRQFRKPLILFFSKQLLRHPLARSNIEEFT-EGGFEW 879

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +T+A+ E+  R +L +GQVY AL + RE+      A  R+E++ PFP+  L 
Sbjct: 880  IIEDSEHGKTIATKEETKRLVLMTGQVYTALHKRREELGDKSTAFLRIEELHPFPFAQLR 939

Query: 480  QHIDKYPN-AELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN  E++W QEEPLN G+W YV+PR++T +  +  ++  A +   R PS + A 
Sbjct: 940  DTLNSYPNLEEIVWCQEEPLNMGSWGYVSPRLQTTLKETNNYKNHAVRYCGRNPSGAVAA 999

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H+ EE   L    
Sbjct: 1000 GSKSLHLAEEESFLKDVF 1017



>gi|363753514|ref|XP_003646973.1| hypothetical protein Ecym_5401 [Eremothecium cymbalariae DBVPG#7215]
 gi|356890609|gb|AET40156.1| hypothetical protein Ecym_5401 [Eremothecium cymbalariae DBVPG#7215]
          Length = 1016

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/558 (54%), Positives = 398/558 (71%), Gaps = 3/558 (0%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AK ++APIFHVN +D+EAV F+  LAAEWR TF  D +ID+V +RK+GHNE DQP
Sbjct: 458  YPSDIAKAIDAPIFHVNANDIEAVIFIFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQP 517

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+++AKQ  +++ Y ++LL +G+ TK++I+ HKKWVW + EE + K+KDY PT
Sbjct: 518  SFTQPLMYKRVAKQQSVMDTYSERLLSEGSMTKKEIDDHKKWVWGLFEEAFEKAKDYKPT 577

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SREWL+++W  FKSPKELA E  P  PT    ++L+ +G+VISS+PK F VH  L RIL 
Sbjct: 578  SREWLTAAWEDFKSPKELATEILPHNPTNVDGKILKKIGKVISSWPKDFEVHKNLKRILT 637

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            +R KAI+  +GIDW T E LAFG++LL+G  +R+SG+DVERGTFSQRHAVLHDQ +E  Y
Sbjct: 638  SRGKAIDGEKGIDWSTGEALAFGTMLLDGYDIRVSGEDVERGTFSQRHAVLHDQNSENTY 697

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PL  +   QA F++CNSSLSE+G +GFEYGYSL +P+  ++WE QFGDF N +Q IIDQ
Sbjct: 698  TPLQHISKDQADFTICNSSLSEYGCMGFEYGYSLTSPDYFVMWEAQFGDFANTAQVIIDQ 757

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQHQ 360
            FIA  E KW QR+GLV+ LPHGYDGQGPEHSSGRLERFLQL ++ P  +P  EK  R+HQ
Sbjct: 758  FIAGAETKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLTNEDPRYFPTEEKSQREHQ 817

Query: 361  DCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFKR 420
            DCN Q+   TTPAN FH+LRRQ HR FRKPL  F SK LLRHP+ARS L+E T D  F+ 
Sbjct: 818  DCNFQVAYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSDLSEFT-DGGFQW 876

Query: 421  FIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLLS 479
             I D  H +T+ + E+  R +L +GQV+ AL + RE       A  ++EQ+ PFP+  L 
Sbjct: 877  IIEDAEHGKTIGTKEETKRLVLLTGQVFTALHKKRETIGDRTTAFLKIEQLHPFPFYQLR 936

Query: 480  QHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPAT 538
              ++ YPN E ++W QEEP N G+W +V+PRI+T +  ++++     + A R P+ + A 
Sbjct: 937  DILNSYPNLEDIVWCQEEPFNMGSWAFVSPRIQTTLKETDKYSNFEVRYAGRNPNGAVAA 996

Query: 539  GNKKQHIQEEHDLLSQAL 556
            G+K  H  EE   L    
Sbjct: 997  GSKALHNAEEQAFLKDVF 1014



>gi|297794187|ref|XP_002864978.1| E1 subunit of 2-oxoglutarate dehydrogenase [Arabidopsis lyrata subsp.
            lyrata]
 gi|297310813|gb|EFH41237.1| E1 subunit of 2-oxoglutarate dehydrogenase [Arabidopsis lyrata subsp.
            lyrata]
          Length = 1025

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/569 (55%), Positives = 408/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVN DD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 452  YCTDVAKALSAPIFHVNADDIEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  T+EDI+K +K V +IL E +  SKDY+P 
Sbjct: 512  SFTQPKMYKVIRNHPSSLQIYQEKLLQSGQVTEEDIDKIQKKVSSILNEEFRASKDYIPQ 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WL+S W GFKSP++++        TG   E+L++VG+ IS++P+ F  H G+ R+ +
Sbjct: 572  KRDWLASHWTGFKSPEQISRIRN----TGVKPEILKNVGKAISTFPENFKPHRGVKRVYE 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 628  QRAQMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 687

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 688  CPLDHLTMNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFANGAQVMF 747

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+PYV P  +  + +
Sbjct: 748  DQFISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPTLRK 807

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH    S+L+E      
Sbjct: 808  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKQCVSNLSEFDDVKG 867

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D    +    E I R +LCSG+VYY L   R++++ + VAI R+
Sbjct: 868  HPGFDKQGTRFKRLIKDQSGHSDLE-EGIRRLVLCSGKVYYELDEERKKSETNDVAICRV 926

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G + Y+A R+ T M   +R      K 
Sbjct: 927  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGGYQYIALRLCTAMKALQRGNFNDIKY 986

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              RLPSA+ ATG  + H++E+ DL+ +AL
Sbjct: 987  VGRLPSAATATGFYQLHVKEQTDLVKKAL 1015



>gi|15239128|ref|NP_201376.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 gi|10177333|dbj|BAB10682.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 gi|18389254|gb|AAL67070.1| putative 2-oxoglutarate dehydrogenase E1 component [Arabidopsis
            thaliana]
 gi|20465597|gb|AAM20281.1| putative 2-oxoglutarate dehydrogenase E1 component [Arabidopsis
            thaliana]
 gi|332010718|gb|AED98101.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
          Length = 1025

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/569 (55%), Positives = 405/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVN DD+EAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 452  YCTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  T+EDI+K +K V +IL E Y  SKDY+P 
Sbjct: 512  SFTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQKKVSSILNEEYEASKDYIPQ 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WL+S W GFKSP++++        TG   E+L++VG+ IS++P+ F  H G+ R+ +
Sbjct: 572  KRDWLASHWTGFKSPEQISRIRN----TGVKPEILKNVGKAISTFPENFKPHRGVKRVYE 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 628  QRAQMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 687

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q + 
Sbjct: 688  CPLDHLIKNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVMF 747

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+PYV P  +  + +
Sbjct: 748  DQFISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPTLRK 807

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH    S+L+E      
Sbjct: 808  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFDDVKG 867

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D    +    E I R +LCSG+VYY L   R++++   VAI R+
Sbjct: 868  HPGFDKQGTRFKRLIKDQSGHSDLE-EGIRRLVLCSGKVYYELDEERKKSETKDVAICRV 926

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G + Y+A R+ T M   +R      K 
Sbjct: 927  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGGYQYIALRLCTAMKALQRGNFNDIKY 986

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              RLPSA+ ATG  + H++E+ DL+ +AL
Sbjct: 987  VGRLPSAATATGFYQLHVKEQTDLVKKAL 1015



>gi|110740037|dbj|BAF01922.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
          Length = 673

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/569 (55%), Positives = 405/569 (71%), Gaps = 18/569 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK ++APIFHVN DD+EAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 100 YCTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 159

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      L+ Y +KLL+ G  T+EDI+K +K V +IL E Y  SKDY+P 
Sbjct: 160 SFTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQKKVSSILNEEYEASKDYIPQ 219

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WL+S W GFKSP++++        TG   E+L++VG+ IS++P+ F  H G+ R+ +
Sbjct: 220 KRDWLASHWTGFKSPEQISRIRN----TGVKPEILKNVGKAISTFPENFKPHRGVKRVYE 275

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 276 QRAQMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 335

Query: 241 VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ L   Q    F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q + 
Sbjct: 336 CPLDHLIKNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVMF 395

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQFI+SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+PYV P  +  + +
Sbjct: 396 DQFISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPTLRK 455

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH    S+L+E      
Sbjct: 456 QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFDDVKG 515

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D    +    E I R +LCSG+VYY L   R++++   VAI R+
Sbjct: 516 HPGFDKQGTRFKRLIKDQSGHSDLE-EGIRRLVLCSGKVYYELDEERKKSETKDVAICRV 574

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G + Y+A R+ T M   +R      K 
Sbjct: 575 EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGGYQYIALRLCTAMKALQRGNFNDIKY 634

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             RLPSA+ ATG  + H++E+ DL+ +AL
Sbjct: 635 VGRLPSAATATGFYQLHVKEQTDLVKKAL 663



>gi|460382059|ref|XP_004236757.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Solanum
            lycopersicum]
          Length = 1020

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/569 (55%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVE V + C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 448  YCTDVAKALSAPIFHVNGDDVEGVVYACELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      LE Y  KLL+ G  TK+D+EK    +  IL E +  SKDYVP 
Sbjct: 508  SFTQPKMYQVIRNHPSSLEIYQNKLLQHGQVTKDDVEKIHNKINTILNEEFVASKDYVPQ 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W+GFKSP +L+        TG   E+L+ VG+ I+S P  F  H  + RI  
Sbjct: 568  KRDWLSAFWSGFKSPAQLSRVRN----TGVKPEILKDVGKAITSLPDDFKPHRAVKRIFD 623

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R K I  G+G+DW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 624  DRKKMIETGEGVDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVVHDQETGAKY 683

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 684  CPLDHVMMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFANGAQVIF 743

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL+++GLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  E  + +
Sbjct: 744  DQFLSSGEAKWLRQSGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPDMEPTLRK 803

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN+Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 804  QIQECNLQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQG 863

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++ +   VAI R+
Sbjct: 864  HPGFDKQGTRFKRLIKDQNDHSDLE-EDIRRLVLCSGKVYYELDEERKKVEGKDVAICRV 922

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+ Y+APR+ T M    R      K 
Sbjct: 923  EQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYHYIAPRLSTAMKALNRGNVDDIKY 982

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +L+ +AL
Sbjct: 983  VGRAPSAATATGFYQVHVKEQTELVQKAL 1011



>gi|4210330|emb|CAA11552.1| 2-oxoglutarate dehydrogenase, E1 subunit [Arabidopsis thaliana]
          Length = 1027

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/571 (54%), Positives = 406/571 (71%), Gaps = 20/571 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVN DD+EAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 452  YCTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  T+EDI+K +K V +IL E Y  SKDY+P 
Sbjct: 512  SFTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQKKVSSILNEEYEASKDYIPQ 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGL--VRI 178
             R+WL+S W GFKSP++++        TG   E+L++VG+ IS++P+ F  H G+  VR+
Sbjct: 572  KRDWLASHWTGFKSPEQISRIRN----TGVKPEILKNVGKAISTFPENFKPHRGVKRVRV 627

Query: 179  LKARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNET 238
             + RA+ I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    
Sbjct: 628  YEQRAQMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGE 687

Query: 239  QYVPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQC 296
            +Y PL+ L   Q    F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q 
Sbjct: 688  EYCPLDHLIKNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQV 747

Query: 297  IIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KM 355
            + DQFI+SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+PYV P  +  +
Sbjct: 748  MFDQFISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPTL 807

Query: 356  ARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG- 414
             +Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH    S+L+E    
Sbjct: 808  RKQIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFDDV 867

Query: 415  ---------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                      T FKR I D    +    E I R +LCSG+VYY L   R++++   VAI 
Sbjct: 868  KGHPGFDKQGTRFKRLIKDQSGHSDLE-EGIRRLVLCSGKVYYELDEERKKSETKDVAIC 926

Query: 466  RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
            R+EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G + Y+A R+ T M   +R      
Sbjct: 927  RVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGGYQYIALRLCTAMKALQRGNFNDI 986

Query: 526  KPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
            K   RLPSA+ ATG  + H++E+ DL+ +AL
Sbjct: 987  KYVGRLPSAATATGFYQLHVKEQTDLVKKAL 1017



>gi|224100929|ref|XP_002312072.1| predicted protein [Populus trichocarpa]
 gi|222851892|gb|EEE89439.1| predicted protein [Populus trichocarpa]
          Length = 1021

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/569 (54%), Positives = 404/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDMEAVVRVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      LE Y +KLL+ G  T+EDI + ++ V +IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYQVIRNHPSALEIYKKKLLESGQVTEEDISRIQEKVLSILNEEFLASKDYVPK 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS W GFKSP++L+        TG   E+L++VG+ I++ P  F  H  + ++  
Sbjct: 569  RRDWLSSHWTGFKSPEQLSRVRN----TGVKPEILKNVGKAITTLPDNFKPHRAVKKVYD 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 625  QRAQMIETGEGIDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVIHDQETGEKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ +PNSL++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVTINQNEEMFTVSNSSLSEFGVLGFELGYSMESPNSLVIWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR- 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DD+P+V P  E   R 
Sbjct: 745  DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPFVIPEMEPTFRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPL+    K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNLLRHKECKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R + +   +AI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDEERRKVEAKDIAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YP+AE++W QEEP+N GA++Y+APR+ T M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPSAEVVWCQEEPMNMGAYSYIAPRLSTAMKALGRGTMDDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
            A R PSA+ ATG  + H++E+ +LL +A+
Sbjct: 984  AGRGPSAATATGFYQMHVKEQAELLQKAM 1012



>gi|326494940|dbj|BAJ85565.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 1016

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV + C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALDAPIFHVNGDDLEAVVYTCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K  K V  IL E + KSKD +P 
Sbjct: 504  SFTQPKMYKVIRNHPSALEMYQNQLLESGKISKEDIDKIHKKVSTILNEEFKKSKDDIPN 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 564  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPETFKPHRAVKKIFD 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 620  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 680  CPLDNLVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVV LPHGYDGQGPEHSS R+ERFLQ+ DD+PYV P  +  M +
Sbjct: 740  DQFISSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARMERFLQMSDDNPYVIPEMDPTMRK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +SSL+E      
Sbjct: 800  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSSLSEFDDLAG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R+++  + VAI R+
Sbjct: 860  HPGFDKQGTRFKRLIKDRNDHKDLE-EGIRRLVLCSGKVYYELDEERKKSDCNDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      K 
Sbjct: 919  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLLTAMRALGRGSIDDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 979  VGRAPSAATATGFYTVHVQEQTELVKKAL 1007



>gi|293331403|ref|NP_001169536.1| uncharacterized protein LOC100383412 [Zea mays]
 gi|224029953|gb|ACN34052.1| unknown [Zea mays]
          Length = 814

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/575 (54%), Positives = 402/575 (69%), Gaps = 18/575 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D++CYR++GHNE+D+P
Sbjct: 243 YCTDVAKALNAPIFHVNGDDLEAVVCVCELAAEWRQTFHSDVVVDLICYRRFGHNEIDEP 302

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MYQ I      L+ Y QKLL  G   KED+++    V  IL E + KSKDYVP 
Sbjct: 303 SFTQPKMYQVIKNHPSSLKLYEQKLLGTGEVMKEDVQRIHDKVNRILNEEFAKSKDYVPN 362

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L+ VG+ I++ P+ F  H  + +I +
Sbjct: 363 KRDWLSAYWTGFKSPEQISR----VRNTGVKPEILKRVGQAITTLPENFKPHRAVKKIFE 418

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA  I  GQGIDW  AE LAF +L++EG HVRLSGQDVERGTFS RHAVLHDQ    +Y
Sbjct: 419 LRAAMIESGQGIDWAVAEALAFATLIVEGNHVRLSGQDVERGTFSHRHAVLHDQETGAKY 478

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 479 CPLDHVAMDQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFANGAQVMF 538

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  E  + +
Sbjct: 539 DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEPTLRK 598

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFH+LRRQIHR+FRKPLI    K+LLRH   +S+L+E      
Sbjct: 599 QIQECNWQVVNVTTPANYFHLLRRQIHREFRKPLIVTAPKNLLRHKDCKSNLSEFDDVEG 658

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +       E + R ILCSG+VYY L   R++++   VAI R+
Sbjct: 659 HLGFDKQGTRFKRLIKDRNDHKQVE-EGVNRLILCSGKVYYELDEERKKSERGDVAICRV 717

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y++PR+ T M    R      K 
Sbjct: 718 EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLFTAMKALGRGSFEDIKY 777

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVK 562
             R PSA+ ATG    H QE+ +L+ +AL  + +K
Sbjct: 778 VGRAPSAATATGFLSVHAQEQSELVKKALQAEPIK 812



>gi|413943020|gb|AFW75669.1| hypothetical protein ZEAMMB73_452342 [Zea mays]
          Length = 1016

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/575 (54%), Positives = 402/575 (69%), Gaps = 18/575 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D++CYR++GHNE+D+P
Sbjct: 445  YCTDVAKALNAPIFHVNGDDLEAVVCVCELAAEWRQTFHSDVVVDLICYRRFGHNEIDEP 504

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      L+ Y QKLL  G   KED+++    V  IL E + KSKDYVP 
Sbjct: 505  SFTQPKMYQVIKNHPSSLKLYEQKLLGTGEVMKEDVQRIHDKVNRILNEEFAKSKDYVPN 564

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VG+ I++ P+ F  H  + +I +
Sbjct: 565  KRDWLSAYWTGFKSPEQISRVRN----TGVKPEILKRVGQAITTLPENFKPHRAVKKIFE 620

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA  I  GQGIDW  AE LAF +L++EG HVRLSGQDVERGTFS RHAVLHDQ    +Y
Sbjct: 621  LRAAMIESGQGIDWAVAEALAFATLIVEGNHVRLSGQDVERGTFSHRHAVLHDQETGAKY 680

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 681  CPLDHVAMDQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFANGAQVMF 740

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  E  + +
Sbjct: 741  DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEPTLRK 800

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFH+LRRQIHR+FRKPLI    K+LLRH   +S+L+E      
Sbjct: 801  QIQECNWQVVNVTTPANYFHLLRRQIHREFRKPLIVTAPKNLLRHKDCKSNLSEFDDVEG 860

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E + R ILCSG+VYY L   R++++   VAI R+
Sbjct: 861  HLGFDKQGTRFKRLIKDRNDHKQVE-EGVNRLILCSGKVYYELDEERKKSERGDVAICRV 919

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y++PR+ T M    R      K 
Sbjct: 920  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLFTAMKALGRGSFEDIKY 979

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVK 562
              R PSA+ ATG    H QE+ +L+ +AL  + +K
Sbjct: 980  VGRAPSAATATGFLSVHAQEQSELVKKALQAEPIK 1014



>gi|293335820|ref|NP_001169698.1| hypothetical protein [Zea mays]
 gi|224031001|gb|ACN34576.1| unknown [Zea mays]
 gi|414587574|tpg|DAA38145.1| TPA: hypothetical protein ZEAMMB73_516904 [Zea mays]
 gi|414587575|tpg|DAA38146.1| TPA: hypothetical protein ZEAMMB73_516904 [Zea mays]
          Length = 1025

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/569 (55%), Positives = 397/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 453  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  +KEDI+K  K V  IL E +  SKDYVP 
Sbjct: 513  SFTQPKMYKVIRNHPSALEIYQRKLLESGKISKEDIDKLNKKVSTILNEEFQNSKDYVPN 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ FN H  + +I  
Sbjct: 573  KRDWLSAYWTGFKSPEQISRIQN----TGVKPEILKRVGEAMTTLPENFNPHRAVKKIFY 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    QY
Sbjct: 629  QRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVLHDQETGEQY 688

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 689  CPLDHLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVIWEAQFGDFSNGAQVIF 748

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 749  DQFLSSGESKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 808

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 809  QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 868

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R + +   VAI R+
Sbjct: 869  HPGFDKQGTRFKRLIKDQNNHKDLE-EGINRLVLCSGKVYYELDEERRKTERTDVAICRV 927

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 928  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMKALGRGGIEDIKY 987

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 988  VGRAPSAATATGFYSVHVQEQTELVQKAL 1016



>gi|297602611|ref|NP_001052638.2| Os04g0390000 [Oryza sativa Japonica Group]
 gi|255675403|dbj|BAF14552.2| Os04g0390000, partial [Oryza sativa Japonica Group]
          Length = 1001

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 429 YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 488

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K +K V  IL + +  SK+Y+P 
Sbjct: 489 SFTQPKMYKIIRNHQSALEIYQNRLLESGKISKEDIDKMQKKVSTILNDEFQNSKEYIPN 548

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I +
Sbjct: 549 KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFE 604

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ    QY
Sbjct: 605 LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHAVIHDQETGEQY 664

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 665 CPLDNLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 724

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 725 DQFLSSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 784

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 785 QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 844

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +       E I R +LCSG+VYY L   R + + D VAI R+
Sbjct: 845 HPGFDKQGTRFKRLIKDQNNHKDLE-EGIKRLVLCSGKVYYELDEERRKKERDDVAICRV 903

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 904 EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMRALGRGTIDDIKY 963

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 964 VGRAPSAATATGFYSVHVQEQTELVQKAL 992



>gi|222628767|gb|EEE60899.1| hypothetical protein OsJ_14584 [Oryza sativa Japonica Group]
          Length = 999

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 427 YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 486

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K +K V  IL + +  SK+Y+P 
Sbjct: 487 SFTQPKMYKIIRNHQSALEIYQNRLLESGKISKEDIDKMQKKVSTILNDEFQNSKEYIPN 546

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I +
Sbjct: 547 KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFE 602

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ    QY
Sbjct: 603 LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHAVIHDQETGEQY 662

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 663 CPLDNLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 722

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 723 DQFLSSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 782

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 783 QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 842

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +       E I R +LCSG+VYY L   R + + D VAI R+
Sbjct: 843 HPGFDKQGTRFKRLIKDQNNHKDLE-EGIKRLVLCSGKVYYELDEERRKKERDDVAICRV 901

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 902 EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMRALGRGTIDDIKY 961

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 962 VGRAPSAATATGFYSVHVQEQTELVQKAL 990



>gi|224109580|ref|XP_002315242.1| predicted protein [Populus trichocarpa]
 gi|222864282|gb|EEF01413.1| predicted protein [Populus trichocarpa]
          Length = 1021

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 404/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDMEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      LE Y +KLL+ G  T+EDI + ++ V +IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYQVIRNHPSALEIYKKKLLESGQVTEEDISRIQEKVLSILNEEFLASKDYVPK 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS W GFKSP++L+        TG   E+L++VG+ I+++P+ F  H  + ++ +
Sbjct: 569  RRDWLSSHWTGFKSPEQLSRVRN----TGVKPEILKNVGKAITTFPENFKPHRAVKKVYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 625  QRLQMIETGEGIDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVVHDQETGEKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ +PNSL++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVVMNQDEEMFTVSNSSLSEFGVLGFELGYSMESPNSLVIWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLV+LLPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  E  + +
Sbjct: 745  DQFLSSGESKWLRQTGLVLLLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMEPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPL+    K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLVVIAPKNLLRHKECKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG++YY L   R + +   +AI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDRNDHSDLE-EGIRRLVLCSGKIYYELDEVRGKVEAKDIAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+ Y+APR+ T M   ER      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYNYIAPRLSTAMKALERGTVDDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +L+  A+
Sbjct: 984  VGRGPSAASATGFYQVHVKEQTELVQMAM 1012



>gi|218194753|gb|EEC77180.1| hypothetical protein OsI_15669 [Oryza sativa Indica Group]
          Length = 1016

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K +K V  IL + +  SK+Y+P 
Sbjct: 504  SFTQPKMYKIIRNHQSALEIYQNRLLESGKISKEDIDKMQKKVSTILNDEFQNSKEYIPN 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I +
Sbjct: 564  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFE 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ    QY
Sbjct: 620  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHAVIHDQETGEQY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 680  CPLDNLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 740  DQFLSSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 800  QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R + + D VAI R+
Sbjct: 860  HPGFDKQGTRFKRLIKDQNNHKDLE-EGIKRLVLCSGKVYYELDEERRKKERDDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 919  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMRALGRGTIDDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 979  VGRAPSAATATGFYSVHVQEQTELVQKAL 1007



>gi|475607556|gb|EMT26751.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial [Aegilops
            tauschii]
          Length = 1154

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 398/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV   C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 582  YCTDVAKALDAPIFHVNGDDLEAVVHTCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 641

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K  K V  IL E + KSKD +P 
Sbjct: 642  SFTQPKMYKVIRNHPSALEIYQNQLLESGKISKEDIDKIHKKVSTILNEEFKKSKDDIPN 701

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 702  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPETFKPHRAVKKIFD 757

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 758  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 817

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 818  CPLDNLVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 877

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVV LPHGYDGQGPEHSS R+ERFLQ+ DD+PYV P  +  + +
Sbjct: 878  DQFISSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARMERFLQMSDDNPYVIPEMDPTLRK 937

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +SSL+E      
Sbjct: 938  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSSLSEFDDLAG 997

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R+++  + VAI R+
Sbjct: 998  HPGFDKQGTRFKRLIKDRNDHK-DLEEGIRRLVLCSGKVYYELDEERKKSDSNDVAICRV 1056

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      K 
Sbjct: 1057 EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLLTAMRALGRGSIDDIKY 1116

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 1117 VGRAPSAATATGFYTVHVQEQTELVKKAL 1145



>gi|359486641|ref|XP_002279332.2| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Vitis
           vinifera]
          Length = 959

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 403/569 (70%), Gaps = 18/569 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 387 YCTDVAKALNAPIFHVNGDDMEAVVHVCELAAEWRQTFHSDVVVDVVCYRRFGHNEIDEP 446

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      LE Y +KLL+ G  T+EDI++ +  V  IL E +  SKDYVP 
Sbjct: 447 SFTQPKMYKVIRNHPSALEIYQKKLLELGQATQEDIDRVQNKVNTILNEEFLASKDYVPN 506

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L++VG+ I++ P+ F  H  + +I  
Sbjct: 507 RRDWLSAYWAGFKSPEQISRVRN----TGVRPEILKNVGKAITTLPENFKAHRAVKKIFD 562

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 563 LRAQMIETGEGIDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVIHDQETGERY 622

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L++WE QFGDF N +Q I 
Sbjct: 623 CPLDHVIMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNALVMWEAQFGDFANGAQVIF 682

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 683 DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 742

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN QI+N TTPANYFHVLRRQIHR+FRKPLI  + K+LLRH   +S+L+E      
Sbjct: 743 QIQECNWQIVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQG 802

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +  + +  E I R ILCSG+VYY L   R++ K + VAI R+
Sbjct: 803 HPGFDKQGTRFKRLIKDQNDHS-SLEEGIRRLILCSGKVYYELDEQRKKVKANDVAICRV 861

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL  + + +YPNAE++W QEEP+N GA+ Y+ PR+ T M   +R      K 
Sbjct: 862 EQLCPFPYDLAQRELKRYPNAEIVWCQEEPMNMGAYNYILPRLCTAMKEVDRGTVEDVKY 921

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             R PSA+ ATG    H +E+ +L+ +AL
Sbjct: 922 VGRAPSAATATGFSSLHTKEQTELVQKAL 950



>gi|116309350|emb|CAH66433.1| OSIGBa0096P03.7 [Oryza sativa Indica Group]
          Length = 1016

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K +K V  IL + +  SK+Y+P 
Sbjct: 504  SFTQPKMYKIIRNHQSALEIYQNRLLESGKISKEDIDKMQKKVSTILNDEFQNSKEYIPN 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I +
Sbjct: 564  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFE 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ    QY
Sbjct: 620  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHAVIHDQETGEQY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 680  CPLDNLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 740  DQFLSSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 800  QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R + + D VAI R+
Sbjct: 860  HPGFDKQGTRFKRLIKDQNNHKDLE-EGIKRLVLCSGKVYYELDEERRKKERDDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 919  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMRALGRGTIDDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 979  VGRAPSAATATGFYSVHVQEQTELVQKAL 1007



>gi|242072740|ref|XP_002446306.1| hypothetical protein SORBIDRAFT_06g013930 [Sorghum bicolor]
 gi|241937489|gb|EES10634.1| hypothetical protein SORBIDRAFT_06g013930 [Sorghum bicolor]
          Length = 1025

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 397/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 453  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  +KEDI+K  K V  IL E +  SKDYVP 
Sbjct: 513  SFTQPKMYKVIRNHPSALEIYQRKLLESGKISKEDIDKLNKKVSTILNEEFQNSKDYVPN 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 573  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFD 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 629  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 688

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 689  YPLDHLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVIWEAQFGDFANGAQVIF 748

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 749  DQFLSSGESKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 808

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 809  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 868

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R + +   VAI R+
Sbjct: 869  HPGFDKQGTRFKRLIKDQNNHKDLE-EGINRLVLCSGKVYYELDEERRKAERTDVAICRV 927

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 928  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMKALGRGGIEDIKY 987

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 988  VGRAPSAATATGFYSVHVQEQTELVKKAL 1016



>gi|242072742|ref|XP_002446307.1| hypothetical protein SORBIDRAFT_06g013940 [Sorghum bicolor]
 gi|241937490|gb|EES10635.1| hypothetical protein SORBIDRAFT_06g013940 [Sorghum bicolor]
          Length = 1025

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 397/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 453  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  +KEDI+K  K V  IL E +  SKDYVP 
Sbjct: 513  SFTQPKMYKVIRNHPSALEIYQRKLLESGKISKEDIDKLNKKVSTILNEEFQNSKDYVPN 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 573  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFD 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 629  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 688

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 689  CPLDHLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNSLVIWEAQFGDFANGAQVIF 748

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 749  DQFLSSGESKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 808

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 809  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 868

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R + +   VAI R+
Sbjct: 869  HPGFDKQGTRFKRLIKDQNNHKDLE-EGINRLVLCSGKVYYELDEERRKAERTDVAICRV 927

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 928  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMKALGRGGIEDIKY 987

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 988  VGRAPSAATATGFYSVHVQEQTELVQKAL 1016



>gi|357163093|ref|XP_003579623.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like
            [Brachypodium distachyon]
          Length = 1016

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 397/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV   C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALDAPIFHVNGDDLEAVVHTCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y ++LL+ G  +KEDI+K  K V  IL E + KSKD +P 
Sbjct: 504  SFTQPKMYKIIRNHPSALEIYQKQLLESGKLSKEDIDKLHKKVSTILNEEFQKSKDDIPN 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 564  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPETFKPHRAVKKIFD 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 620  LRRQMIETGEGIDWAVGEALAFATLIVEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 680  CPLDNLVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLVV LPHGYDGQGPEHSS R+ERFLQ+ DD+PYV P  +  + +
Sbjct: 740  DQFISSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARMERFLQMSDDNPYVIPEMDPTLRK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +SSL+E      
Sbjct: 800  QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKECKSSLSEFDDLAG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R++   + VAI R+
Sbjct: 860  HPGFDKQGTRFKRLIKDRNDHKDLE-EGINRLVLCSGKVYYELDEERKKLDRNDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      K 
Sbjct: 919  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLLTAMKALSRGSIEDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 979  VGRAPSAATATGFYSVHVQEQTELVQKAL 1007



>gi|413918140|gb|AFW58072.1| hypothetical protein ZEAMMB73_255234 [Zea mays]
 gi|413918141|gb|AFW58073.1| hypothetical protein ZEAMMB73_255234 [Zea mays]
          Length = 1025

 Score =  639 bits (1647), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 396/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 453  YCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  +KEDI++  K V  IL E +  SKDYVP 
Sbjct: 513  SFTQPKMYKVIRNHPSALEIYQRKLLESGKISKEDIDRLNKKVSTILNEEFQNSKDYVPN 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 573  KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFD 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 629  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 688

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 689  CPLDHLVMNQDAELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 748

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVV LPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 749  DQFLSSGESKWLRQTGLVVCLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 808

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +S+L+E      
Sbjct: 809  QIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSNLSEFDDLAG 868

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R +++   VAI R+
Sbjct: 869  HPGFDKQGTRFKRLIKDQNNHKDLE-EGINRLVLCSGKVYYELDEERRKSERTDVAICRV 927

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+ PR+ T M    R      K 
Sbjct: 928  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPRLLTAMKVLGRGGIEDIKY 987

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 988  VGRAPSAATATGFYSVHVQEQTELVQKAL 1016



>gi|302793194|ref|XP_002978362.1| hypothetical protein SELMODRAFT_152569 [Selaginella moellendorffii]
 gi|300153711|gb|EFJ20348.1| hypothetical protein SELMODRAFT_152569 [Selaginella moellendorffii]
          Length = 969

 Score =  638 bits (1646), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/572 (54%), Positives = 398/572 (69%), Gaps = 18/572 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDDVEAV   C+LAAEWR  FK DVV+DIVCYR++GHNE+D+P
Sbjct: 401 YCTDVAKALNAPIFHVNGDDVEAVVHACELAAEWRCQFKADVVVDIVCYRRFGHNEIDEP 460

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MYQ I      LE Y +KL++ G  ++E ++K    V+ IL E +  SKDYVP 
Sbjct: 461 SFTQPKMYQVIKNHPTSLELYEKKLIESGQISEETVKKIHDKVYGILSEEFESSKDYVPK 520

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           +++WL++ W+GFKSP++L+        TG   E+L++VG+ I++ P  F  H  + R+ +
Sbjct: 521 TQDWLAAYWSGFKSPEQLSRLRN----TGVKPEVLKNVGKKITTLPPSFTAHRAIKRVYE 576

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G G+DW TAE LAF +LL EG HVRLSGQDVERGTFS RHAV+HDQ    +Y
Sbjct: 577 QRAQMIETGDGVDWATAEALAFATLLAEGNHVRLSGQDVERGTFSHRHAVVHDQETGERY 636

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL+ WE QFGDF N +Q I 
Sbjct: 637 CPLDHVVTNQKEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVCWEAQFGDFSNGAQVIF 696

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLV +LPHGYDGQGPEHSS RLERFLQ+ DDHP+V P  E  + +
Sbjct: 697 DQFLSSGEAKWLRQTGLVCMLPHGYDGQGPEHSSARLERFLQMSDDHPFVIPEMEVSLRK 756

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFHVLRRQ+HRDFRKPLI  + K+LLRH   RS+L+E      
Sbjct: 757 QIQECNWQVVNVTTPANYFHVLRRQLHRDFRKPLIIMSPKNLLRHSSCRSNLSEFDDVQG 816

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +      PE I R +LCSG+VYY L   RE+     VAI R+
Sbjct: 817 HPGFDKQGTRFKRLIKDKNDHGTVEPE-IRRLVLCSGKVYYELDEERERVGAKDVAICRV 875

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CP PYDLL + + +YPNA+++W QEEP+N GA++Y+APR+ T M    R      K 
Sbjct: 876 EQLCPVPYDLLQRELKRYPNADVVWCQEEPMNMGAFSYIAPRLGTAMLSVNRGSFGDIKY 935

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQALIGQ 559
             R PSA+ ATG    H  E+ +L+ +AL  Q
Sbjct: 936 VGRPPSAATATGFAAVHKMEQTELVQKALQAQ 967



>gi|115474297|ref|NP_001060747.1| Os07g0695800 [Oryza sativa Japonica Group]
 gi|34394039|dbj|BAC84070.1| putative 2-oxoglutarate dehydrogenase, E1 subunit [Oryza sativa
            Japonica Group]
 gi|113612283|dbj|BAF22661.1| Os07g0695800 [Oryza sativa Japonica Group]
 gi|215713493|dbj|BAG94630.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 1008

 Score =  638 bits (1645), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/575 (54%), Positives = 403/575 (70%), Gaps = 18/575 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D++CYR++GHNE+D+P
Sbjct: 437  YCTDVAKALNAPIFHVNGDDLEAVVRVCELAAEWRQTFHSDVVVDLICYRRFGHNEIDEP 496

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      L+ Y QKLL  G  +KED++K  + V  IL E + KSKDYVP 
Sbjct: 497  SFTQPKMYQVIKNHPSSLKLYEQKLLGTGEVSKEDVQKIHEKVNRILNEEFAKSKDYVPN 556

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG +  +L+ VG+ I++ P+ F  H  + +I +
Sbjct: 557  KRDWLSAYWTGFKSPEQISRVRN----TGVNPGVLKRVGQAITTLPEDFKPHRAVKKIFE 612

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA  I  G+GIDW  AE LAF +L++EG HVRLSGQDVERGTFS RHAVLHDQ N  ++
Sbjct: 613  QRAAMIESGEGIDWAVAEALAFATLIVEGNHVRLSGQDVERGTFSHRHAVLHDQENGRKH 672

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 673  CPLDHVVMNQNEELFTVSNSSLSEFAVLGFEMGYSMENPNSLVLWEAQFGDFSNGAQVMF 732

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  E  + +
Sbjct: 733  DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEPTLRK 792

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHR+FRKPLI    K+LLRH   +S+L+E      
Sbjct: 793  QIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNLLRHKDCKSNLSEFDDVEG 852

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R++ +   VAI R+
Sbjct: 853  HPGFDKQGTRFKRLIKDRNDHKQVE-EGIKRLVLCSGKVYYELDEERKKTERSDVAICRV 911

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y++PR+   M    R      K 
Sbjct: 912  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLYASMKTLGRGSFDDIKY 971

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVK 562
              R PSA+ ATG    H QE+ +L+ +AL  + +K
Sbjct: 972  VGRAPSAATATGFLSVHAQEQTELVKKALQAEPIK 1006



>gi|356575371|ref|XP_003555815.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Glycine
            max]
          Length = 1021

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 312/569 (54%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV  VC+LAAEWRQTF  DVV+D VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDVEAVVHVCELAAEWRQTFHSDVVVDFVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  T+EDI+K  K V +IL + +  SKDYVP 
Sbjct: 509  SFTQPKMYKVIRNHPSALEIYQKKLLESGELTQEDIDKIHKKVTSILNDEFLASKDYVPK 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W+GFKSP++++        TG   E+L+ VG+ I+  PK F+ H  + RI +
Sbjct: 569  RRDWLSAYWSGFKSPEQISRIRN----TGVKPEILKSVGKAITILPKFFSPHKAVKRIYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ +  G+ IDW  AE LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ     Y
Sbjct: 625  QRAQMVETGEDIDWGFAEALAFATLIVEGNHVRLSGQDVERGTFSHRHAVVHDQTTGEIY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            D F++SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ DDHPYV P  +  + +
Sbjct: 745  DNFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMADDHPYVIPEMDPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+N TTPAN+FHVLRRQIHR+FRKPLI  + K+LLR    RS+L+E      
Sbjct: 805  QIQECNWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNLLRSKACRSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R +     VAI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNNHSDVE-EGIRRLVLCSGKVYYELDEQRTKEDAKDVAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G +TY+ PR+ + M    R      K 
Sbjct: 924  EQLCPFPYDLVQRELKRYPNAEVVWCQEEPMNMGGYTYILPRLISSMKAVGRGGYEDVKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  K H+ E+ +L+ +A+
Sbjct: 984  VGRAPSAATATGFLKVHLNEQAELVQKAI 1012



>gi|255575120|ref|XP_002528465.1| 2-oxoglutarate dehydrogenase, putative [Ricinus communis]
 gi|223532141|gb|EEF33948.1| 2-oxoglutarate dehydrogenase, putative [Ricinus communis]
          Length = 1021

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 310/569 (54%), Positives = 400/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      L+ Y  KLL+ G   +EDI + ++ V  IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYQVIRNHPSSLQIYKNKLLESGQVGEEDISRIQEKVITILNEEFLASKDYVPK 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS W GFKSP++L+        TG   E+L++VG+ I++ P  F  H  + ++ +
Sbjct: 569  RRDWLSSHWAGFKSPEQLSRIRN----TGVQPEILKNVGKAITTIPDNFKPHRAVKKVYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW  AE LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 625  QRAQMIETGEGIDWAVAEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVIHDQETGEKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ +PNSL++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIMNQNEEMFTVSNSSLSEFGVLGFELGYSMESPNSLVIWEAQFGDFSNGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P V P  E  + +
Sbjct: 745  DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPCVIPEMEPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQ+HRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQLHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDEERKKIGAKDVAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+ Y+APR+ T M   ER      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYNYIAPRLCTAMKALERGSVEDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +L+ +A+
Sbjct: 984  VGRAPSAATATGFYQVHVKEQSELVQKAM 1012



>gi|449483889|ref|XP_004156723.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis
            sativus]
          Length = 1021

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/569 (54%), Positives = 402/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDVEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+    ++EDI+K +  V +IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYKVIRNHPSSLEIYRKKLLELEQVSQEDIQKMQSKVNSILNEEFVASKDYVPR 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++L+        TG   E+L++VG+ I+S P  F  H  + ++ +
Sbjct: 569  KRDWLSAYWAGFKSPEQLSRIQN----TGVKPEILKNVGKTITSLPDHFKPHRAVKKVYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 625  QRAQMIEIGDGIDWALGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIINQNEEMFTVSNSSLSEFGVLGFELGYSMENPNALVMWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 745  DQFVSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   RS+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCRSNLSEFDDVKG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R ILCSG++YY L   R++     +AI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNMHS-DREEGIRRLILCSGKIYYELDEERKKTNGKDIAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ + M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLGSAMKSLSRGTIEDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +++ +AL
Sbjct: 984  VGRAPSAATATGFYQVHVKEQTEIIGKAL 1012



>gi|449459928|ref|XP_004147698.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis
            sativus]
 gi|449518101|ref|XP_004166082.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis
            sativus]
          Length = 1022

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 401/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 450  YCTDVAKALDAPIFHVNGDDMEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 509

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      LE Y +KLL+ G  ++EDI K +  V  IL E +  SKDYVP 
Sbjct: 510  SFTQPKMYQVIRNHPSSLEIYQKKLLESGQVSQEDINKIRDKVNKILNEEFLASKDYVPK 569

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W+GFKSP++++        TG   E+L++VG+ I+ +P+ F  H  + ++ +
Sbjct: 570  RRDWLSAYWSGFKSPEQISRVRN----TGVKPEILKNVGKAITVFPENFKPHRAVKKVYE 625

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ     Y
Sbjct: 626  QRAQMIETGEGIDWALGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVVHDQETGAIY 685

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 686  CPLDHVIMNQNEELFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFSNGAQVIF 745

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR- 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +   R 
Sbjct: 746  DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDSTLRK 805

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHR+FRKPL+    K+LLRH   +S+L+E      
Sbjct: 806  QIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLVVMAPKNLLRHKDCKSNLSEFDDVQG 865

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG++YY L   R ++    VAI R+
Sbjct: 866  HPGFDKQGTRFKRLIKDQNNHS-DHEEGIRRLVLCSGKIYYELDDERTKSDGKDVAICRV 924

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY++PR+ T M    R      K 
Sbjct: 925  EQLCPFPYDLIQRELKRYPNAEVVWCQEEPMNMGAFTYISPRLATAMRALGRGTFEDIKY 984

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSAS ATG    H++E+ +L+ +AL
Sbjct: 985  VGRAPSASTATGFYTVHVKEQTELVKKAL 1013



>gi|357163090|ref|XP_003579622.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like
            [Brachypodium distachyon]
          Length = 1016

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/569 (54%), Positives = 396/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDD+EAV   C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALDAPIFHVNGDDLEAVVHTCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +++L+ G  +KEDI+K    V  IL E + KSKD +P 
Sbjct: 504  SFTQPKMYKVIRNHPSALEIYQKQMLESGKLSKEDIDKLHTKVNTILNEEFKKSKDDIPN 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 564  KRDWLSAYWTGFKSPEQISRVRN----TGVKPEILKRVGEAMTTLPENFKPHRAVKKIFD 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ     Y
Sbjct: 620  LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVVHDQETGQHY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL++L   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 680  CPLDNLVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR- 357
            DQFI+SGE KWL+++GLVV LPHGYDGQGPEHSS R+ERFLQ+ DD+PYV P  +   R 
Sbjct: 740  DQFISSGEAKWLRQSGLVVCLPHGYDGQGPEHSSARMERFLQMSDDNPYVIPEMDSTTRK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN+Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +SSL+E      
Sbjct: 800  QIQQCNLQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKECKSSLSEFDDVAG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R+++  + VAI R+
Sbjct: 860  HPGFDKQGTRFKRLIKDRNDHKDLE-EGINRLVLCSGKVYYELDEERKKSDRNDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      K 
Sbjct: 919  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLLTAMRALGRGTIEDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
            A R PSA+ ATG    H QE+ +L+ +AL
Sbjct: 979  AGRAPSAATATGFYSVHGQEQTELVQKAL 1007



>gi|470325460|ref|XP_004364462.1| 2-oxoglutarate dehydrogenase [Capsaspora owczarzaki ATCC 30864]
 gi|320166651|gb|EFW43550.1| 2-oxoglutarate dehydrogenase [Capsaspora owczarzaki ATCC 30864]
          Length = 1052

 Score =  635 bits (1637), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 305/560 (54%), Positives = 393/560 (70%), Gaps = 8/560 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAKVV APIFHVN DDVEAV +VCQLAAEWRQ F KDVVID+V YR++GHNEVDQP
Sbjct: 495  YCTDVAKVVQAPIFHVNADDVEAVVYVCQLAAEWRQQFGKDVVIDLVGYRRHGHNEVDQP 554

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            +FTQP MYQ+I     +   Y ++L+ +G  ++E +++         E  + +SKD+   
Sbjct: 555  NFTQPLMYQRIDAHPRVFSLYAKQLISEGVVSQEFVDQAVGKYMEEAEAAFDRSKDFKMD 614

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             ++WL S W GFKS ++LA+       TG     LQHVG V +SYP  F  H  L +IL 
Sbjct: 615  KKDWLESYWKGFKSSEQLAKIQN----TGVDVAALQHVGRVSASYPSDFTPHPQLAKILA 670

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQ-VNETQ 239
             R + I +G+ IDW T E LAFG+LL +  HVRLSGQDVERGTFSQRH VLHDQ V+   
Sbjct: 671  TRIETIEKGKDIDWATGEALAFGTLLADKFHVRLSGQDVERGTFSQRHHVLHDQRVDGRT 730

Query: 240  YVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIID 299
            + PL  L   QA ++V NS LSE+G +GFE GYS+ NPNSL+LWE QFGDF N +Q IID
Sbjct: 731  HTPLMHLSADQAPYTVTNSHLSEYGVMGFELGYSMANPNSLVLWEAQFGDFANTAQVIID 790

Query: 300  QFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR-Q 358
            QFI++GE KWL+++GLV+LLPHGY+G G EHSS RLERFLQ+ DD   V+P      R Q
Sbjct: 791  QFISAGESKWLRQSGLVLLLPHGYEGNGAEHSSARLERFLQMVDDDADVFPNMRHEERNQ 850

Query: 359  HQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTF 418
             Q  NMQ++N +TPANY+HVLRRQ++R+FRKPL+  T K LLRHP+ARS+LA+M  DT F
Sbjct: 851  IQRTNMQVVNCSTPANYYHVLRRQVYREFRKPLVVVTPKYLLRHPLARSTLADMAKDTRF 910

Query: 419  KRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
            +R IP+  P   + P+ + R I CSG+VYY +   RE+  + +VA+ R+EQI PFP+DL+
Sbjct: 911  RRVIPEETPAITSQPQDVKRLIFCSGKVYYDIFEGREKAGLKNVALCRVEQIAPFPFDLV 970

Query: 479  SQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPA--TRLPSASP 536
             +  + +PNAE++WAQEEP N GAW+YV PRI T +  S+ H G  A+P    R PSA+ 
Sbjct: 971  QRQAECFPNAEIVWAQEEPKNMGAWSYVQPRIETALKQSKTHPGDRARPKFIGRRPSAAT 1030

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG KK H+ EE +L+  AL
Sbjct: 1031 ATGKKKTHLAEEAELVKSAL 1050



>gi|168001944|ref|XP_001753674.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695081|gb|EDQ81426.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 1041

 Score =  635 bits (1637), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 305/571 (53%), Positives = 402/571 (70%), Gaps = 22/571 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV   C+LAAEWR  FK DVV+DIVCYR++GHNE+D+P
Sbjct: 470  YCTDVAKALNAPIFHVNGDDVEAVVHACELAAEWRHKFKADVVVDIVCYRRFGHNEIDEP 529

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MY+ I    P L+ Y+++L+ +   ++E++   +  V+ IL E + KSK+YVP+
Sbjct: 530  SFTQPTMYKVIRNHPPALDSYMKRLIDEKHLSQEEVSDLQNNVFRILNEEFDKSKEYVPS 589

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            +R+WL++ W GFK P++L+        TG   E+L++VG+ I++ P+GF  H G+ R+  
Sbjct: 590  TRDWLAAYWQGFKGPEQLSRIRN----TGVKPEILKNVGQAITTLPEGFTAHKGIQRVYD 645

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            AR K I  G+G+DW TAE LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 646  ARKKMIETGEGVDWATAEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVVHDQKTGEKY 705

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL+LWE QFGDF N +Q I 
Sbjct: 706  CPLDHVVMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFANGAQVIF 765

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLV  LPHGYDGQGPEHSS RLER+LQ+ DD+P+  P  +  + R
Sbjct: 766  DQFVSSGESKWLRQTGLVCTLPHGYDGQGPEHSSARLERYLQMSDDYPFAVPEMDPSLRR 825

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+ N Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH    S+L+E      
Sbjct: 826  QIQEVNWQVVNVTTPANYFHVLRRQIHRDFRKPLIIMSPKNLLRHKSCVSNLSEFDDVQG 885

Query: 415  -------DTTFKRFIPDP--HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                    T FKR I D   H E     E I R +LCSG+VYY L   R +   + VAI 
Sbjct: 886  HPGFDKQGTRFKRLIKDKNDHGEV---EESIRRLVLCSGKVYYELDEERNRVGANDVAIC 942

Query: 466  RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
            RLEQ+CP PYDL+ + + +YPNAE++W+QEEP+N GA+TY+APRI T++    R +    
Sbjct: 943  RLEQLCPVPYDLVMRELKRYPNAEVVWSQEEPMNMGAFTYIAPRIATVLRELSRGKFEDI 1002

Query: 526  KPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
            K   R P+A+ ATG    H QE+ +L+ +++
Sbjct: 1003 KYVGRPPAAATATGFGSVHAQEQIELVQKSM 1033



>gi|449449970|ref|XP_004142737.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis
            sativus]
          Length = 1021

 Score =  634 bits (1636), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/569 (54%), Positives = 402/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDVEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+    ++EDI+K +  V +IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYKVIRNHPSSLEIYRKKLLELEQVSQEDIQKMQSKVNSILNEEFVASKDYVPR 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++L+        TG   E+L++VG+ I+S P  F  H  + ++ +
Sbjct: 569  KRDWLSAYWAGFKSPEQLSRIQN----TGVKPEILKNVGKTITSLPDHFKPHRAVKKVYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 625  QRAQMIEIGDGIDWALGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIINQNEEMFTVSNSSLSEFGVLGFELGYSMENPNALVMWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 745  DQFVSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   RS+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCRSNLSEFDDVKG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R ILCSG++YY L   R++     +AI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNMHS-DREEGIRRLILCSGKIYYELDEERKKTNGKDIAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ + M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAFTYINPRLGSAMKSLSRGTIEDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +++ +AL
Sbjct: 984  VGRAPSAATATGFYQVHVKEQTEIIGKAL 1012



>gi|475675094|gb|EMT72174.1| 2-oxoglutarate dehydrogenase, mitochondrial [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 960

 Score =  632 bits (1630), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 311/559 (55%), Positives = 393/559 (70%), Gaps = 8/559 (1%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           Y SD+AKVV+APIFHVN DDVE+V F+C+LAA+WR TF  D V+DI+CYRK+GHNE DQP
Sbjct: 403 YASDIAKVVDAPIFHVNADDVESVVFLCKLAADWRATFHSDCVVDIICYRKFGHNEFDQP 462

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MYQ++A QTP LEKYVQKL+ +G+FT E+I   ++ VWN L E Y  S+D+V +
Sbjct: 463 SFTQPLMYQKVAAQTPSLEKYVQKLVSEGSFTMEEINSRRESVWNRLNEMYDSSRDFV-S 521

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           SRE  ++ W   +SP+ L     P   T      ++ V     S P GF +HS L RIL 
Sbjct: 522 SREAFTAPWQSLESPESLKNNVIPPATTAIDQATVEQVATKALSVPSGFQLHSNLERILA 581

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R KA+++G+ +DW TAE LAFG+L LE   VRL+GQDV+RGTFSQRHAVLHDQ     +
Sbjct: 582 GRKKALHDGK-VDWSTAEALAFGTLCLENHPVRLTGQDVQRGTFSQRHAVLHDQETGESW 640

Query: 241 VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
            PLN+L P QA F V NS LSEFG LGFEYG +L +P+SL++WE QFGDF NN+Q IID 
Sbjct: 641 TPLNNLSPEQAPFEVENSPLSEFGALGFEYGVTLADPHSLVMWEAQFGDFANNTQVIIDN 700

Query: 301 FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPP-PEKMARQH 359
           FIASGE KWL R+GLV+ LPHGYDGQG EHSS R+ERFL LC +   VYP  PE   R H
Sbjct: 701 FIASGETKWLDRSGLVLSLPHGYDGQGAEHSSARIERFLMLCSEEGRVYPSEPE---RAH 757

Query: 360 QDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFK 419
           QD NM ++  TTPANYFHVLRRQ+ R++RKPL+ F SKSLLRHP+ RS +A+ TG +TF+
Sbjct: 758 QDANMGLVYMTTPANYFHVLRRQMRREYRKPLVIFFSKSLLRHPLTRSDIADFTGSSTFQ 817

Query: 420 RFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             I DP H  ++  PE I R ILCSGQVY A+ + RE   +  VAI+R+E++ PFP+  +
Sbjct: 818 PVITDPEHGHSIEDPESIQRVILCSGQVYAAIQKHREAAGIKDVAITRIEELHPFPWAEV 877

Query: 479 SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
             ++D+Y NA+ ++WAQEE  NGGAW Y+  R+  +++ ++   GR    A R  SASPA
Sbjct: 878 KSNLDQYKNAKTIVWAQEEHYNGGAWHYIRDRLDAVLDKTDHLAGRRVLFAGRGTSASPA 937

Query: 538 TGNKKQHIQEEHDLLSQAL 556
           TG K  H  EE  LL    
Sbjct: 938 TGLKHLHYAEEKALLDDVF 956



>gi|297816834|ref|XP_002876300.1| hypothetical protein ARALYDRAFT_485968 [Arabidopsis lyrata subsp.
            lyrata]
 gi|297322138|gb|EFH52559.1| hypothetical protein ARALYDRAFT_485968 [Arabidopsis lyrata subsp.
            lyrata]
          Length = 1017

 Score =  632 bits (1630), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 404/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 448  YCTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  +++DI++ ++ V  IL E +  SKDY+P 
Sbjct: 508  SFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVSSKDYLPK 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS++W GFKSP++++        TG   E+L+ VG+ ISS P+ F  H  + ++ +
Sbjct: 568  KRDWLSTNWAGFKSPEQISR----VRNTGVKPEILKSVGKAISSLPENFKPHRAVKKVYE 623

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW  AE LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 624  QRAQMIESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 683

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ +PNSL+LWE QFGDF N +Q I 
Sbjct: 684  CPLDHLIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIF 743

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLV+LLPHGYDGQGPEHSS RLER+LQ+ DD+PYV P  E  M +
Sbjct: 744  DQFISSGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPTMRK 803

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+NATTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 804  QIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 863

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 864  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDDERKKVGATDVAICRV 922

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEE +N GA++Y++PR+ T M    R +    K 
Sbjct: 923  EQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGAFSYISPRLWTAMRSLNRGDMEDIKY 982

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H++E+ +L+ +A+
Sbjct: 983  VGRGPSAATATGFYTFHVKEQAELVQKAI 1011



>gi|482559249|gb|EOA23440.1| hypothetical protein CARUB_v10016624mg [Capsella rubella]
          Length = 1017

 Score =  632 bits (1629), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 404/569 (71%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 448  YCTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  +++DI++ ++ V  IL E +  SKDY+P 
Sbjct: 508  SFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPK 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS++W GFKSP++++        TG   E+L+ VG+ ISS P+ F  H  + ++ +
Sbjct: 568  KRDWLSTNWAGFKSPEQISR----VRNTGVKPEILKTVGKAISSLPENFKPHRAVKKVYE 623

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW  AE LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 624  QRAQMIESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 683

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ +PNSL+LWE QFGDF N +Q I 
Sbjct: 684  CPLDHLIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIF 743

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLV+LLPHGYDGQGPEHSS RLER+LQ+ DD+PYV P  E  M +
Sbjct: 744  DQFISSGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPTMRK 803

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+NATTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 804  QIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 863

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 864  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDDERKKVGATDVAICRV 922

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEE +N GA++Y++PR+ T M    R +    K 
Sbjct: 923  EQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGAFSYISPRLWTAMRSLNRGDMEDIKY 982

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H++E+ +L+ +A+
Sbjct: 983  VGRGPSAATATGFYTFHVKEQAELVQKAI 1011



>gi|474193779|gb|EMS58258.1| 2-oxoglutarate dehydrogenase, mitochondrial [Triticum urartu]
          Length = 985

 Score =  632 bits (1629), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/571 (53%), Positives = 394/571 (69%), Gaps = 20/571 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK ++APIFHVNGDD+EAV   C+LAAEWRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 411 YCTDVAKALDAPIFHVNGDDLEAVVHTCELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEP 470

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      LE Y  +LL+ G  +KEDI+K  K V  IL E + KSKD +P 
Sbjct: 471 SFTQPKMYKVIRNHPSALEIYQNQLLESGKISKEDIDKIHKKVSTILNEEFKKSKDDIPN 530

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L+ VGE +++ P+ F  H  + +I  
Sbjct: 531 KRDWLSAYWTGFKSPEQISRIRN----TGVKPEILKRVGEAMTTLPETFKPHRAVKKIFD 586

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            R + I  G+GIDW   E LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    QY
Sbjct: 587 LRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVERGTFSHRHSVIHDQETGEQY 646

Query: 241 VPLNDLRPGQAK----FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQC 296
            PL++L   Q +         SSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q 
Sbjct: 647 CPLDNLVMNQNEELFTLRYATSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQV 706

Query: 297 IIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KM 355
           I DQFI+SGE KWL++TGLVV LPHGYDGQGPEHSS R+ERFLQ+ DD+PYV P  +  +
Sbjct: 707 IFDQFISSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARMERFLQMSDDNPYVIPEMDPTL 766

Query: 356 ARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG- 414
            +Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI  + K+LLRH   +SSL+E    
Sbjct: 767 RKQIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNLLRHKDCKSSLSEFDDL 826

Query: 415 ---------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                     T FKR I D +       E I R +LCSG+VYY L   R+++  + VAI 
Sbjct: 827 AGHPGFDKQGTRFKRLIKDRNDHKDLE-EGIRRLVLCSGKVYYELDEERKKSDSNDVAIC 885

Query: 466 RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
           R+EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      
Sbjct: 886 RVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYINPRLLTAMRALGRGSIDDI 945

Query: 526 KPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
           K   R PSA+ ATG    H+QE+ +L+ +AL
Sbjct: 946 KYVGRAPSAATATGFYTVHVQEQTELVKKAL 976



>gi|502121391|ref|XP_004497299.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cicer
            arietinum]
          Length = 1024

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 313/569 (55%), Positives = 398/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y +DVAK +NAPIFHVNGDDVEAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 452  YSTDVAKAINAPIFHVNGDDVEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  TK D++K  + + +IL E +  SKDYVP 
Sbjct: 512  SFTQPKMYKVIRNHPSALEIYQKKLLELGELTKGDVDKIHQKITSILNEEFLASKDYVPK 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W+GFKSP++++        TG   E+L++VG+ I+  P     H  + RI +
Sbjct: 572  RRDWLSAYWSGFKSPEQISRIRN----TGVKPEILKNVGKAITVLPGNLTPHKAVKRIYE 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+ IDW  AE LAF +L++EG HVRLSGQDVERGTFS RHAV+HDQ N  +Y
Sbjct: 628  QRAQMIETGEDIDWGFAEALAFATLVVEGNHVRLSGQDVERGTFSHRHAVVHDQTNGEKY 687

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q K  F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 688  CPLDHVIINQNKELFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVIF 747

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            D F++SGE KWL++TGLVVLLPHGYDGQGPEHSSGRLERFLQ+ D HPY+ P  +  + +
Sbjct: 748  DNFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMADGHPYIIPEMDPTLGK 807

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+N TTPAN+FHVLRRQIHR+FRKPLI  + K+LLR  + RS+L+E      
Sbjct: 808  QIQECNWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNLLRSKVCRSNLSEFDDVQG 867

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R ILCSG+VYY L   R +     VAI R+
Sbjct: 868  HPGFDKQGTRFKRLIKDRNDHSNVE-EGIRRLILCSGKVYYELDDQRSKVDAKDVAICRV 926

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + +++YPNAE++W QEEP+N G +TYV PR+ T M    R      K 
Sbjct: 927  EQLCPFPYDLVQRELNRYPNAEVVWCQEEPMNMGGYTYVLPRLITSMKSIGRGGYEDVKY 986

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  K H +E  +LL +AL
Sbjct: 987  VGRAPSAATATGFLKVHQKEHVELLGKAL 1015



>gi|28416717|gb|AAO42889.1| At3g55410 [Arabidopsis thaliana]
 gi|110743207|dbj|BAE99494.1| 2-oxoglutarate dehydrogenase, E1 subunit - like protein [Arabidopsis
            thaliana]
          Length = 1017

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 403/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 448  YCTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  +++DI++ ++ V  IL E +  SKDY+P 
Sbjct: 508  SFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPK 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS++W GFKSP++++        TG   E+L+ VG+ ISS P+ F  H  + ++ +
Sbjct: 568  KRDWLSTNWAGFKSPEQISR----VRNTGVKPEILKTVGKAISSLPENFKPHRAVKKVYE 623

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW  AE LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 624  QRAQMIESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 683

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ +PNSL+LWE QFGDF N +Q I 
Sbjct: 684  CPLDHLIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIF 743

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLV+LLPHGYDGQGPEHSS RLER+LQ+ DD+PYV P  E  M +
Sbjct: 744  DQFISSGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPTMRK 803

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+NATTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 804  QIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 863

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 864  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDDERKKVGATDVAICRV 922

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEE +N GA++Y++PR+ T M    R +    K 
Sbjct: 923  EQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGAFSYISPRLWTAMRSVNRGDMEDIKY 982

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H++E+  L+ +A+
Sbjct: 983  VGRGPSAATATGFYTFHVKEQAGLVQKAI 1011



>gi|30694242|ref|NP_191101.2| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 gi|332645860|gb|AEE79381.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
          Length = 1017

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 403/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 448  YCTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 507

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y +KLL+ G  +++DI++ ++ V  IL E +  SKDY+P 
Sbjct: 508  SFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPK 567

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS++W GFKSP++++        TG   E+L+ VG+ ISS P+ F  H  + ++ +
Sbjct: 568  KRDWLSTNWAGFKSPEQISR----VRNTGVKPEILKTVGKAISSLPENFKPHRAVKKVYE 623

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW  AE LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 624  QRAQMIESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 683

Query: 241  VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ L   Q    F+V NSSLSEFG LGFE GYS+ +PNSL+LWE QFGDF N +Q I 
Sbjct: 684  CPLDHLIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIF 743

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQFI+SGE KWL++TGLV+LLPHGYDGQGPEHSS RLER+LQ+ DD+PYV P  E  M +
Sbjct: 744  DQFISSGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPTMRK 803

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN QI+NATTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 804  QIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 863

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 864  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDDERKKVGATDVAICRV 922

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEE +N GA++Y++PR+ T M    R +    K 
Sbjct: 923  EQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGAFSYISPRLWTAMRSVNRGDMEDIKY 982

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG    H++E+  L+ +A+
Sbjct: 983  VGRGPSAATATGFYTFHVKEQAGLVQKAI 1011



>gi|110739609|dbj|BAF01713.1| 2-oxoglutarate dehydrogenase, E1 subunit - like protein
           [Arabidopsis thaliana]
          Length = 611

 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/569 (54%), Positives = 403/569 (70%), Gaps = 18/569 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 42  YCTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 101

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      L+ Y +KLL+ G  +++DI++ ++ V  IL E +  SKDY+P 
Sbjct: 102 SFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPK 161

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS++W GFKSP++++        TG   E+L+ VG+ ISS P+ F  H  + ++ +
Sbjct: 162 KRDWLSTNWAGFKSPEQISRVRN----TGVKPEILKTVGKAISSLPENFKPHRAVKKVYE 217

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+G+DW  AE LAF +L++EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 218 QRAQMIESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEY 277

Query: 241 VPLNDLRPGQ--AKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ L   Q    F+V NSSLSEFG LGFE GYS+ +PNSL+LWE QFGDF N +Q I 
Sbjct: 278 CPLDHLIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIF 337

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQFI+SGE KWL++TGLV+LLPHGYDGQGPEHSS RLER+LQ+ DD+PYV P  E  M +
Sbjct: 338 DQFISSGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPTMRK 397

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN QI+NATTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 398 QIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDVQG 457

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +  +    E I R +LCSG+VYY L   R++     VAI R+
Sbjct: 458 HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKVYYELDDERKKVGATDVAICRV 516

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
           EQ+CPFPYDL+ + + +YPNAE++W QEE +N GA++Y++PR+ T M    R +    K 
Sbjct: 517 EQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGAFSYISPRLWTAMRSVNRGDMEDIKY 576

Query: 528 ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
             R PSA+ ATG    H++E+  L+ +A+
Sbjct: 577 VGRGPSAATATGFYTFHVKEQAGLVQKAI 605



>gi|508726332|gb|EOY18229.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma
            cacao]
 gi|508726333|gb|EOY18230.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma
            cacao]
          Length = 1023

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 313/585 (53%), Positives = 402/585 (68%), Gaps = 23/585 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L+ Y  KLL+ G   KEDI    + V  IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYKIIRNHPSALQIYQNKLLESGQVMKEDIGWISEKVSKILNEEFLASKDYVPK 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++L+        TG   E+L++VG+ I++ P  F  H  + ++  
Sbjct: 569  RRDWLSAYWTGFKSPEQLSRVRN----TGVKPEILKNVGKAITTLPDNFKPHRAVKKVYD 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW   E LAF +LL+EG HVRLSGQDVERGTFS RH+VLHDQ    QY
Sbjct: 625  QRAQMIETGEGLDWAIGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEQY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIINQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVMWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR- 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLER+L +  D+P+V P  +   R 
Sbjct: 745  DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERYLLMSGDNPFVIPEMDPTLRT 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHR+FRKPLI  + K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG+VYY L   R++NK   VAI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNMHSDLE-EGIRRLVLCSGKVYYELDDERKKNKATDVAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+APR+ T M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAFSYIAPRLATSMQALGRGTFEDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVKPKEIVSGVPV 572
              R PSAS ATG    H++E+ +L+ +A     ++P+ I    PV
Sbjct: 984  VGRAPSASTATGFYVVHVKEQTELVQKA-----IQPEPIKFHAPV 1023



>gi|477522236|gb|ENH74305.1| 2-oxoglutarate dehydrogenase, mitochondrial [Fusarium oxysporum f.
            sp. cubense race 1]
          Length = 1045

 Score =  629 bits (1622), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/559 (55%), Positives = 391/559 (69%), Gaps = 8/559 (1%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            Y SD+AKVV+APIFHVN DDVE+V F+C+LAA+WR TF  D V+DI+CYRK+GHNE DQP
Sbjct: 488  YASDIAKVVDAPIFHVNADDVESVVFLCKLAADWRATFHSDCVVDIICYRKFGHNEFDQP 547

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP MYQ++A QTP LEKYVQKL+ +G+FT E+++  ++ VWN L E Y  S+++V +
Sbjct: 548  SFTQPLMYQKVAAQTPSLEKYVQKLVSEGSFTMEEVDSRRESVWNRLNEIYDSSREFV-S 606

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            SRE  ++ W   KSP+ L  +  P   T S    ++ V     S P GF +H  L RIL 
Sbjct: 607  SREAFTAPWQSLKSPESLKNDVLPPATTASDQATVEQVATKALSVPSGFQLHGNLERILA 666

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             R KA+  G  +DW TAE LAFG+L LE   VRL+GQDV+RGTFSQRHAVLHDQ     +
Sbjct: 667  GRKKALENGT-VDWSTAEALAFGTLCLENHPVRLTGQDVQRGTFSQRHAVLHDQETGESW 725

Query: 241  VPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIIDQ 300
             PLN+L P QA F V NS LSEFG LGFEYG +L +P+SL++WE QFGDF NN+Q IID 
Sbjct: 726  TPLNNLSPEQAPFEVENSPLSEFGALGFEYGVTLADPHSLVMWEAQFGDFANNTQVIIDN 785

Query: 301  FIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPP-PEKMARQH 359
            FIASGE KWL ++GLV+ LPHGYDGQG EHSS R+ERFL LC +   VYP  PE   R H
Sbjct: 786  FIASGETKWLDQSGLVLSLPHGYDGQGAEHSSARIERFLMLCSEEGRVYPSEPE---RAH 842

Query: 360  QDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFK 419
            QD NM ++  TTPANYFHVLRRQ+ R++RKPL+ F SKSLLRHP+ RS +A+ TG +TF+
Sbjct: 843  QDANMGLVYMTTPANYFHVLRRQMRREYRKPLVIFFSKSLLRHPLTRSDIADFTGSSTFQ 902

Query: 420  RFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
              I DP H  ++  PE I R +LCSGQVY A+ + RE   +  VAI+R+E++ PFP+  +
Sbjct: 903  PVITDPEHGHSIEDPESIQRVVLCSGQVYAAIQKHREAAGIKDVAITRIEELHPFPWAEV 962

Query: 479  SQHIDKYPNAE-LIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
              ++D+Y NA+ ++WAQEE  NGGAW Y+  R+  ++  ++   GR    A R  SASPA
Sbjct: 963  KSNLDQYKNAKTIVWAQEEHYNGGAWHYIRDRLDAVLAKTDHLAGRRVLFAGRGTSASPA 1022

Query: 538  TGNKKQHIQEEHDLLSQAL 556
            TG K  H  EE  LL    
Sbjct: 1023 TGLKHLHYAEEKALLDDVF 1041



>gi|302773560|ref|XP_002970197.1| hypothetical protein SELMODRAFT_93779 [Selaginella moellendorffii]
 gi|300161713|gb|EFJ28327.1| hypothetical protein SELMODRAFT_93779 [Selaginella moellendorffii]
          Length = 972

 Score =  629 bits (1621), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/572 (53%), Positives = 396/572 (69%), Gaps = 21/572 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDDVEAV   C+LAAEWR  FK DVV+DIVCYR++GHNE+D+P
Sbjct: 401 YCTDVAKALNAPIFHVNGDDVEAVVHACELAAEWRCQFKADVVVDIVCYRRFGHNEIDEP 460

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MYQ I      LE Y +KL++ G  ++E ++K    V+ IL E +  SKDYVP 
Sbjct: 461 SFTQPKMYQVIKNHPTSLELYEKKLIESGQISEETVKKIHDKVYGILSEEFENSKDYVPK 520

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           +++WL++ W+GFKSP++L+        TG   E+L++VG+ I++ P  F  H  + R+ +
Sbjct: 521 TQDWLAAYWSGFKSPEQLSRLRN----TGVKPEVLKNVGKKITTLPPSFTPHRAIKRVYE 576

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G G+DW TAE LAF +LL EG HVRLSGQDVERGTFS RHAV+HDQ    +Y
Sbjct: 577 QRAQMIETGDGVDWATAEALAFATLLAEGNHVRLSGQDVERGTFSHRHAVVHDQETGERY 636

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSL+ WE QFGDF N +Q I 
Sbjct: 637 CPLDHVVTNQKEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVCWEAQFGDFANGAQVIF 696

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPE---HSSGRLERFLQLCDDHPYVYPPPE-K 354
           DQF++SGE KWL++TGLV +LPHGYDGQGPE   HSS RL RFLQ+ DDHP+V P  E  
Sbjct: 697 DQFLSSGEAKWLRQTGLVCMLPHGYDGQGPEHSKHSSARLARFLQMSDDHPFVIPEMEVS 756

Query: 355 MARQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG 414
           + +Q Q+CN Q++N TTPANYFHVLRRQ+HRDFRKPLI  + K+LLRH   RS+L+E   
Sbjct: 757 LRKQIQECNCQVVNVTTPANYFHVLRRQLHRDFRKPLIIMSPKNLLRHSSCRSNLSEFDD 816

Query: 415 ----------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAI 464
                      T FKR + D +      PE I R +LCSG+VYY L   RE+     VAI
Sbjct: 817 VQGHPGFDKQGTRFKRLVKDKNDHGTVEPE-IRRLVLCSGKVYYELDEERERVGAKDVAI 875

Query: 465 SRLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRA 524
            R+EQ+CP PYDLL + + +YPNA+++W QEEP+N GA++Y+APR+ T M    R     
Sbjct: 876 CRVEQLCPVPYDLLQRELKRYPNADVVWCQEEPMNMGAFSYIAPRLGTAMLSVNRGSFGD 935

Query: 525 AKPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
            K   R PSA+ ATG    H  E+ +L+ +AL
Sbjct: 936 IKYVGRPPSAATATGFAAVHKMEQTELVQKAL 967



>gi|470143788|ref|XP_004307550.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Fragaria
            vesca subsp. vesca]
          Length = 1018

 Score =  629 bits (1621), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 304/569 (53%), Positives = 398/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPI HVN DD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPILHVNADDMEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L  Y  KLL+ G  T+EDIE+ +  V  IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYKVIRNHPNPLTIYKNKLLESGQVTQEDIERIQSKVTTILNEEFLASKDYVPQ 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS W+GFKSP++L+        TG   E+L++VG+ I++ P+ F  H  + ++  
Sbjct: 569  RRDWLSSHWSGFKSPEQLSRIRN----TGVKPEILKNVGKAITALPENFKPHRAVKKVYG 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+VLHDQ    +Y
Sbjct: 625  ERAQMIETGEGIDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVLHDQETGERY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L++WE QFGDF N +Q I 
Sbjct: 685  CPLDHVIANQDEEMFTVSNSSLSEFGVLGFELGYSMENPNALVIWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLV+LLPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 745  DQFLSSGESKWLRQTGLVLLLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQI+RDFRKPL+    K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQINRDFRKPLVVMAPKNLLRHKDCKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG++YY +   R +     VAI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNDHSDLE-EGIRRLVLCSGKIYYEIDEERRKASAKDVAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+ Y+APR+ T M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYNYIAPRLCTAMKSLSRGTIDDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ D++ +A+
Sbjct: 984  IGRAPSAATATGFYQVHLKEQADIVHKAV 1012



>gi|462417372|gb|EMJ22109.1| hypothetical protein PRUPE_ppa000728mg [Prunus persica]
          Length = 1021

 Score =  628 bits (1620), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 303/569 (53%), Positives = 403/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVN DD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNADDMEAVVHVCELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      L  Y  KLL+ G  TKEDIE+ +  V +IL E +  SKDYVP 
Sbjct: 509  SFTQPKMYKVIRNHPSALTIYQNKLLESGQVTKEDIERIQNKVNSILNEEFLASKDYVPQ 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLSS W+GFKSP++++        TG   E+L+ VG+ ++S P+ F  H  + +  +
Sbjct: 569  RRDWLSSHWSGFKSPEQISRIRN----TGVKPEILKSVGKAVTSLPETFKPHRAVKKNYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW  AE LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 625  QRAQMIETGEGIDWAVAEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVVHDQETGERY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ +PN+L++WE QFGDF N +Q I 
Sbjct: 685  CPLDHIMANQDEEMFTVSNSSLSEFGVLGFELGYSMESPNALVIWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 745  DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLRK 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQ+HR+FRKPLI    K+LLRH   +S+L+E      
Sbjct: 805  QIQECNWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNLLRHKECKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG++YY L   R + +   VAI R+
Sbjct: 865  HPGFDKQGTRFKRLIKDQNDHSNLE-EGIRRLVLCSGKLYYELDEERRKVEAKDVAICRV 923

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y+APR+ + M    R      K 
Sbjct: 924  EQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYIAPRLCSAMKSLGRGTIEDIKY 983

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+++++ +A+
Sbjct: 984  VGRAPSAATATGFYQVHVKEQNEIVHKAV 1012



>gi|326531426|dbj|BAJ94174.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 1018

 Score =  625 bits (1612), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 312/577 (54%), Positives = 404/577 (70%), Gaps = 22/577 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK VN PIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D++CYR++GHNE+D+P
Sbjct: 447  YCTDVAKAVNVPIFHVNGDDLEAVVRVCELAAEWRQTFHSDVVVDLICYRRFGHNEIDEP 506

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      L+ Y QKLL+ G   KED+++    V  IL E + KSKDYVP 
Sbjct: 507  SFTQPKMYQVIKNHPSSLKLYEQKLLETGEVAKEDVDRIHDKVNRILNEEFAKSKDYVPN 566

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++++        TG   E+L+ VG+ I+S P+ F  H  + +I +
Sbjct: 567  KRDWLSAYWTGFKSPEQISRVRN----TGVKPEVLKRVGQAITSLPESFKPHRAVKKIFE 622

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA  I  G+GIDW  AE LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 623  QRAAMIESGEGIDWAVAEALAFAALIVEGNHVRLSGQDVERGTFSHRHSVVHDQETGAKY 682

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 683  CPLDHVVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVMF 742

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 743  DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSSRLERFLQMSDDNPFVIPEMDPTLRK 802

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 803  QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVTAPKNLLRHKECKSNLSEFDDVEG 862

Query: 415  -------DTTFKRFIPD--PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                    T FKR I D   H E     E I R +LCSG+VYY L   R++++   VAI 
Sbjct: 863  HPGFDKQGTRFKRLIKDRNDHKEV---EEGINRLVLCSGKVYYELDDERKKSERSDVAIC 919

Query: 466  RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
            R+EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA++Y++PR+ + M    R      
Sbjct: 920  RVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLYSAMKTLGRGTFEDI 979

Query: 526  KPATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVK 562
            K   R PSA+ ATG    H+QE+ +L+ +AL  + +K
Sbjct: 980  KYVGRAPSAATATGFLTVHVQEQSELVKKALQPEPIK 1016



>gi|470143790|ref|XP_004307551.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Fragaria
            vesca subsp. vesca]
          Length = 1013

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 304/569 (53%), Positives = 393/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVN DD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 444  YCTDVAKALNAPIFHVNADDMEAVVSVCELAAEWRQTFHSDVVVDLVCYRRFGHNELDEP 503

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MYQ I      L  Y  KLL+ G   +EDIE+ +  V  IL E +  SKDYVP 
Sbjct: 504  SFTQPKMYQVIRNHPNPLTIYTNKLLESGQVNQEDIERIQNKVNTILNEEFLASKDYVPK 563

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WL+S W+GFKSP++L+        TG   E+L+ VG+ I+S P+ F  H  + ++  
Sbjct: 564  RRDWLASHWSGFKSPEQLSRIRN----TGVKPEILKDVGKAITSLPENFKPHRAVKKVYA 619

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+GIDW  AE LAF +LL+EG HVRLSGQDVERGTFS RHAVLHDQ    +Y
Sbjct: 620  ERAEMIESGEGIDWAVAEALAFATLLVEGNHVRLSGQDVERGTFSHRHAVLHDQETGEKY 679

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L+LWE QFGDF N +Q I 
Sbjct: 680  CPLDHVLANQNEELFTVSNSSLSEFGVLGFELGYSMENPNALVLWEAQFGDFANGAQVIF 739

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKM-AR 357
            DQF++SGE KWL+++GLVVLLPH Y GQGPEHSS RLERFLQ+ DD+P   P  +    +
Sbjct: 740  DQFLSSGEAKWLRQSGLVVLLPHSYAGQGPEHSSARLERFLQMSDDNPNFIPEIDDTHGK 799

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN Q++N TTPANYFHVLRRQIHR+FRKPL+    K+LLRH   +S+L+E      
Sbjct: 800  QIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLVVMAPKNLLRHKDCKSNLSEFDDVEG 859

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +  +    E I R +LCSG++YY L   R Q     VAI R+
Sbjct: 860  HPGFDKQGTKFKRLIKDQNDHSDLE-EGIRRLVLCSGKIYYELDEERRQTNAKDVAICRV 918

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CP PY+L+ + + +YPNAE++W QEEP+N GA++Y+APR+ + M    R      K 
Sbjct: 919  EQLCPLPYNLIQRELKRYPNAEIVWCQEEPMNMGAYSYIAPRLCSTMKSVSRGTADDIKY 978

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  + H++E+ +L+ +AL
Sbjct: 979  VGRPPSAATATGFYEVHLKEQAELVQKAL 1007



>gi|356568971|ref|XP_003552681.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Glycine
            max]
          Length = 1025

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 306/569 (53%), Positives = 399/569 (70%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 453  YCTDVAKALDAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 512

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y +KLL+ G  T+E+I++  K V +IL E +  SK+Y+P 
Sbjct: 513  SFTQPKMYKVIRSHPSTLEIYEKKLLESGELTQEEIDRIHKKVTSILNEEFLASKEYIPK 572

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++L+        TG   E+L++VG+ I++ P+ F  H  + RI +
Sbjct: 573  RRDWLSAYWLGFKSPEQLSRIRN----TGVKPEILKNVGKAITTIPENFTPHRAVKRIYE 628

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+ IDW  AE LA+ +LL+EG HVRLSGQDVERGTFS RHAV+HDQ    +Y
Sbjct: 629  QRAQMIETGEDIDWGFAEALAYATLLIEGNHVRLSGQDVERGTFSHRHAVVHDQTTGEKY 688

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+++   Q +  F+V NSSLSEFG LGFE GYS+ NPNSLI+WE QFGDF N +  I 
Sbjct: 689  CPLDNVIMNQDEEMFTVSNSSLSEFGVLGFELGYSMENPNSLIIWEAQFGDFANGAHVIF 748

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            D F+ASGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 749  DNFLASGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMADDNPHVIPEMDPTLRK 808

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN+QI+N TTPAN+FHVLRRQ+HR+FRKPLI  + K+LLR    RS+L+E      
Sbjct: 809  QIQECNLQIVNVTTPANFFHVLRRQVHREFRKPLIVMSPKNLLRSKACRSNLSEFDDVQG 868

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D + E     E I R +LCSG+VYY L   R +     VAI R+
Sbjct: 869  HPGFDKQGTRFKRLIKDQN-EHKDVEEGIRRLVLCSGKVYYELDEHRTKVDAKDVAICRV 927

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G +TY+ PR+ + M    R      K 
Sbjct: 928  EQLCPFPYDLVQRELKRYPNAEVVWCQEEPMNMGGYTYILPRLISSMKAVNRGGYDDVKY 987

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  K H +E+ ++  +AL
Sbjct: 988  VGRAPSAATATGFLKVHQKEQTEIAEKAL 1016



>gi|428172820|gb|EKX41726.1| hypothetical protein GUITHDRAFT_141727 [Guillardia theta CCMP2712]
          Length = 1024

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 306/560 (54%), Positives = 391/560 (69%), Gaps = 12/560 (2%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK V APIFHVNGDD EAV +V  LAAE+RQTF+KDVV+DIV YR++GHNE+D+P
Sbjct: 451  YCTDVAKSVGAPIFHVNGDDPEAVCWVMSLAAEFRQTFRKDVVVDIVGYRRHGHNEIDEP 510

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKD--YV 118
             FTQP MY+ I K   +L+ Y  KL+ +G  T+E +E+ K     +  E + K+KD  Y 
Sbjct: 511  MFTQPLMYKIIKKHPDVLKIYSDKLVAEGRVTREKVEEMKAAANTVFNEAFEKAKDPNYR 570

Query: 119  PTSREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRI 178
            P    W  + W G+K+  +L +    A P     + LQ +GE IS+ P+GFN+H  L ++
Sbjct: 571  PPPSAWFGTQWKGYKTKFQLGKNDETAVPK----DTLQSIGEKISAVPQGFNIHRKLEKM 626

Query: 179  LKARAKAI-NEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNE 237
            ++ + KA+ ++ +GIDW TAE LAFGSLLLEG HVRLSGQDVERGTFS RHAVLHDQ NE
Sbjct: 627  MRDKRKAVCDQEKGIDWGTAEALAFGSLLLEGTHVRLSGQDVERGTFSHRHAVLHDQKNE 686

Query: 238  TQYVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCI 297
            T+Y+PLN+L P QA F+V NS+LSE+  LGFE GY++ NPNSL+ WE QFGDF N +Q I
Sbjct: 687  TKYIPLNNLSPNQAMFAVFNSNLSEYAVLGFELGYAMENPNSLVCWEAQFGDFANTAQVI 746

Query: 298  IDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMA- 356
            IDQFI+SGE+KWL+ +GLV+LLPHG++GQGPEHSS RLER+LQ+CDD P   P  E    
Sbjct: 747  IDQFISSGEQKWLKGSGLVMLLPHGFEGQGPEHSSARLERYLQMCDDDPDYIPEMEDTGV 806

Query: 357  RQHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDT 416
            RQ QD NMQ++N +TPANYFH+LRRQI RDFRKPLI  + KSLLRHP  +S L +   + 
Sbjct: 807  RQIQDVNMQVVNPSTPANYFHLLRRQIRRDFRKPLICISPKSLLRHPQCQSDLLDFYDNK 866

Query: 417  TFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYD 476
             F+R +PD   E +   +++ R ILCSG+VYY L   R++  +  VAI R+EQICPFPYD
Sbjct: 867  GFQRVLPDSL-EDIVPDKEVQRLILCSGRVYYDLAAERDKRNVKDVAIVRIEQICPFPYD 925

Query: 477  LLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASP 536
             + Q   +YPNAE+ W QEEP N GAW YV PRI T +       G+ A    R  +ASP
Sbjct: 926  RVGQMSIRYPNAEIFWVQEEPFNQGAWGYVQPRIATALRDL---NGKEAFYVGRNAAASP 982

Query: 537  ATGNKKQHIQEEHDLLSQAL 556
            ATG+   H  E   +L  A 
Sbjct: 983  ATGSPAIHQAELDRILEDAF 1002



>gi|475536576|gb|EMT08930.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial [Aegilops
           tauschii]
          Length = 847

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 310/577 (53%), Positives = 404/577 (70%), Gaps = 22/577 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK VN PIFHVNGDD+EAV  VC+LAAEWRQ F  DVV+D++CYR++GHNE+D+P
Sbjct: 276 YCTDVAKAVNVPIFHVNGDDLEAVVRVCELAAEWRQNFHSDVVVDLICYRRFGHNEIDEP 335

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MYQ I      L+ Y QKLL+ G  TKED+++    V  IL E + KSKDYVP 
Sbjct: 336 SFTQPKMYQVIKNHPSSLKLYEQKLLETGEVTKEDVQRIHDKVNRILNEEFAKSKDYVPN 395

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L+ VG+ I++ P+ F  H  + +I +
Sbjct: 396 KRDWLSAYWTGFKSPEQISRVRN----TGVKPEVLKRVGQAITTLPESFKPHRAVKKIFE 451

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA  I  G+GIDW  AE LAF +L++EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 452 QRAAMIESGEGIDWAVAEALAFAALIVEGNHVRLSGQDVERGTFSHRHSVVHDQETGAKY 511

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEF  LGFE GYS+ NPNSL+LWE QFGDF N +Q + 
Sbjct: 512 CPLDHVVMNQNEELFTVSNSSLSEFAVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVMF 571

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 572 DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSSRLERFLQMSDDNPFVIPEMDPTLRK 631

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPLI    K+LLRH   +S+L+E      
Sbjct: 632 QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVTAPKNLLRHKECKSNLSEFDDVEG 691

Query: 415 -------DTTFKRFIPD--PHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                   T FKR I D   H E     E I R +LCSG+VYY L   R++++   VAI 
Sbjct: 692 HPGFDKQGTRFKRLIKDRNDHKEV---EEGINRLVLCSGKVYYELDDERKKSERSDVAIC 748

Query: 466 RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
           R+EQ+ PFPYDL+ + + +YPNAE++W QEEP+N GA++Y++PR+ + M    R      
Sbjct: 749 RVEQLSPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLYSAMKTLGRGTFEDI 808

Query: 526 KPATRLPSASPATGNKKQHIQEEHDLLSQALIGQIVK 562
           K   R PSA+ ATG    H+QE+ +L+ +AL  +++K
Sbjct: 809 KYVGRAPSAATATGFLTVHVQEQSELVKKALQPELIK 845



>gi|356499661|ref|XP_003518655.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Glycine
            max]
          Length = 1029

 Score =  622 bits (1604), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 305/569 (53%), Positives = 396/569 (69%), Gaps = 18/569 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++APIFHVNGDDVEAV   C+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 457  YCTDVAKALDAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEP 516

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
            SFTQP+MY+ I      LE Y + LL+ G  T+E+I++  K V +IL E +  SK+Y+P 
Sbjct: 517  SFTQPKMYKVIRSHPSTLEIYEKNLLESGELTQEEIDRIHKKVTSILNEEFLASKEYIPK 576

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS+ W GFKSP++L+        TG   E+L+ VG+ I++ P+ F  H  + RI +
Sbjct: 577  RRDWLSAYWLGFKSPEQLSRIRN----TGVKPEILKTVGKAITTIPENFTPHRAVKRIYE 632

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+ IDW  AE LA+ +LL+EG HVRLSGQDVERGTFS RHAV+HDQ    +Y
Sbjct: 633  QRAQMIETGEDIDWGFAEALAYATLLIEGNHVRLSGQDVERGTFSHRHAVVHDQTTGEKY 692

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPNSLI+WE QFGDF N +  I 
Sbjct: 693  CPLDHVIMNQDEEMFTVSNSSLSEFGVLGFELGYSMENPNSLIIWEAQFGDFANGAHVIF 752

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
            D F+ASGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  +  + +
Sbjct: 753  DNFLASGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMADDNPHVIPEMDPTLRK 812

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q+CN+QI+N TTPAN+FHVLRRQ+HRDFRKPLI  + K+LLR    RS+L+E      
Sbjct: 813  QIQECNLQIVNVTTPANFFHVLRRQVHRDFRKPLIVMSPKNLLRSKACRSNLSEFDDVQG 872

Query: 415  -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                    T FKR I D +       E I R +LCSG+VYY L   R +   + VAI R+
Sbjct: 873  HPGFDKQGTRFKRLIKDQNAHKDVE-EGIRRLVLCSGKVYYELDEQRTKVDANDVAICRV 931

Query: 468  EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKP 527
            EQ+CPFPYDL+ + + +YPNAE++W QEEP+N G +TYV PR+ + M    R      K 
Sbjct: 932  EQLCPFPYDLVQRELKRYPNAEVVWCQEEPMNMGGYTYVLPRLISSMKAVNRGGYDDVKY 991

Query: 528  ATRLPSASPATGNKKQHIQEEHDLLSQAL 556
              R PSA+ ATG  K H +E+ ++  +A+
Sbjct: 992  IGRAPSAATATGFLKVHQKEQTEIAEKAV 1020



>gi|66806367|ref|XP_636906.1| 2-oxoglutarate dehydrogenase, E1 subunit [Dictyostelium discoideum
            AX4]
 gi|74852748|sp|Q54JE4.1|ODO1_DICDI RecName: Full=2-oxoglutarate dehydrogenase, mitochondrial; AltName:
            Full=2-oxoglutarate dehydrogenase complex component E1;
            Short=OGDC-E1; AltName: Full=Alpha-ketoglutarate
            dehydrogenase; Flags: Precursor
 gi|60465316|gb|EAL63408.1| 2-oxoglutarate dehydrogenase, E1 subunit [Dictyostelium discoideum
            AX4]
          Length = 1013

 Score =  622 bits (1603), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/571 (52%), Positives = 383/571 (67%), Gaps = 23/571 (4%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK ++ P+FHVNGD+VEAV  VC++AAEWRQ FK+DV +DIVCYRK+GHNE DQP
Sbjct: 452  YCTDVAKTIDIPVFHVNGDNVEAVVKVCKIAAEWRQKFKRDVFVDIVCYRKHGHNETDQP 511

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP MY +I KQ PI+EKY  KL+ +   T+E   + K  +    E+ Y     +VP 
Sbjct: 512  KFTQPIMYDKIGKQQPIIEKYSNKLIAEKVITQEQYLQMKNIIHESYEKGYQDGMKHVPN 571

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            + +WL S W GFKSP EL         TG   +LLQ +G+V+ + P GF VHS + R+LK
Sbjct: 572  AEDWLESRWEGFKSPIELGNPGR----TGIDQDLLQKIGKVLYTEPSGFEVHSTIKRLLK 627

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             +    ++G G DW TAE LAFGSLLL+G HVRLSGQDVERGTFS RHAV HDQ  +  Y
Sbjct: 628  EKKDMFDKGTGFDWATAEALAFGSLLLDGNHVRLSGQDVERGTFSHRHAVWHDQKTDQTY 687

Query: 241  VPLNDL-----RPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQ 295
             PL  L     +   A+F   NSSLSEF  LGFE GYSL NP++LILWE QFGDF N +Q
Sbjct: 688  APLTKLATALGKKDAAEFVASNSSLSEFAVLGFELGYSLENPDALILWEAQFGDFSNGAQ 747

Query: 296  CIIDQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKM 355
             IIDQFI+SGE+KW++++GL +LLPHGYDG GPEHSS R+ER+LQLCD  P   PP E+ 
Sbjct: 748  VIIDQFISSGEQKWMRQSGLTMLLPHGYDGAGPEHSSCRIERYLQLCDSDPNKIPPKEEA 807

Query: 356  AR-QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG 414
             R Q Q CNMQ++N +TP NYFH LRRQ+HRDFRKPL+  T K LLR+  + S+  E + 
Sbjct: 808  ERKQSQHCNMQVLNCSTPVNYFHALRRQVHRDFRKPLVIATPKYLLRYEKSFSTAKEFSN 867

Query: 415  DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFP 474
            D +F R  P+  P+ +  PEKI R + C+GQVYY L+ +RE N +  VAI R+EQ+ PFP
Sbjct: 868  D-SFTRLYPEAFPDQINKPEKINRIVFCTGQVYYNLIASRESNNIKDVAIIRVEQLHPFP 926

Query: 475  YDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSER-----HEGRAAKPAT 529
            +DL+++ +  YPNA+ IW QEEP+N G W Y+ P   +   H  R     + GR +    
Sbjct: 927  FDLVAEQLQHYPNAKAIWCQEEPMNMGYWNYIYPYFISTFKHINRPADITYTGRPS---- 982

Query: 530  RLPSASPATGNKKQHIQEEHDLLSQALIGQI 560
               SASPA  +   H  +  + LS AL GQ+
Sbjct: 983  ---SASPAVASHTLHKLQLENFLSNALTGQV 1010



>gi|358371467|dbj|GAA88075.1| alpha-ketoglutarate dehydrogenase complex subunit Kgd1 [Aspergillus
           kawachii IFO 4308]
          Length = 978

 Score =  621 bits (1602), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 292/559 (52%), Positives = 386/559 (69%), Gaps = 3/559 (0%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK+++AP+ HVNGDDVEAV F   LAA++R TFKKD ++DIVCYR+ GHNE+DQ 
Sbjct: 414 YCTDVAKILDAPVIHVNGDDVEAVAFAGILAADFRATFKKDCLVDIVCYRRNGHNEMDQA 473

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP MY++IA++  IL++Y   ++  G   KE+++  K   W  L E + + KD  P 
Sbjct: 474 SFTQPTMYERIAEKKNILDEYEASIISKGVVMKEEVQMMKDKAWAELTECFDRRKDQKPD 533

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISS-YPKGFNVHSGLVRIL 179
            +EWL  +W G K+P E   E+ P   T  +YE ++ V +   +  P+GF +H  L RIL
Sbjct: 534 PKEWLIDAWKGMKTPTESNTETLPPKVTAVNYEFIEAVSKNFGAEVPQGFELHKNLERIL 593

Query: 180 KARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQ 239
             R + +  G+ IDW TAE LAFG+LL EG  VR++GQDVERGTFSQRHAVLHDQ     
Sbjct: 594 SRRQQTLTTGKDIDWATAEALAFGTLLREGTGVRVAGQDVERGTFSQRHAVLHDQRTNKT 653

Query: 240 YVPLNDLRPGQAKFSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCIID 299
           Y PL+ + PGQ  F++ NSSLSE   +GFE GYSL +PN+L++WE QFGDF NN+Q IID
Sbjct: 654 YTPLSTISPGQGLFTITNSSLSETAAMGFEVGYSLADPNALVMWEAQFGDFANNAQVIID 713

Query: 300 QFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMARQH 359
            +IAS EKKWLQR+G+V+ LPHGYDGQGPEH+S RLERFLQL D+    +P PE++ RQH
Sbjct: 714 NYIASSEKKWLQRSGVVLSLPHGYDGQGPEHTSARLERFLQLGDEDSRHFPTPEQLQRQH 773

Query: 360 QDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTGDTTFK 419
           QD N+QI+  T+PANYFHVLRRQIHRDFRKPLI   SK+LLRHP+ARS +AE      F+
Sbjct: 774 QDANIQIVCMTSPANYFHVLRRQIHRDFRKPLIILFSKTLLRHPLARSDIAEFIETPYFQ 833

Query: 420 RFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRLEQICPFPYDLL 478
             +P+  H  T+   E + R I CSGQVY AL + RE + +   AI+R+E++ PFP++ +
Sbjct: 834 PLLPETRHGITINEAEDVKRVIFCSGQVYAALYKYRETHNLKDTAITRIEELHPFPWEKV 893

Query: 479 SQHIDKYPNA-ELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAKPATRLPSASPA 537
            Q++D YPNA +++W QEE LNGGAW YV PR   ++  +  H  +  + A R P +S A
Sbjct: 894 RQNLDNYPNATDVVWCQEETLNGGAWGYVMPRFEAILAKTANHTDKKVRYAGRDPMSSVA 953

Query: 538 TGNKKQHIQEEHDLLSQAL 556
            G K  H  EE  ++  A 
Sbjct: 954 VGYKVLHSTEEEKVMGDAF 972



>gi|302776648|ref|XP_002971476.1| hypothetical protein SELMODRAFT_95372 [Selaginella moellendorffii]
 gi|300160608|gb|EFJ27225.1| hypothetical protein SELMODRAFT_95372 [Selaginella moellendorffii]
          Length = 971

 Score =  621 bits (1602), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 307/571 (53%), Positives = 391/571 (68%), Gaps = 22/571 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDDVEAV   C +AAEWR  FK DVV+DIVCYR++GHNE+D+P
Sbjct: 403 YCTDVAKALNAPIFHVNGDDVEAVVHACAMAAEWRCHFKADVVVDIVCYRRFGHNEIDEP 462

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP+MYQ I      L+ Y +KL + G   KEDI +    V  IL E +  SKDY+P 
Sbjct: 463 NFTQPKMYQVIKGHPTSLDIYEKKLAQVGQLKKEDIARVHDKVMAILNEEFQSSKDYIPK 522

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           +++WL++ W GFKSP++L+        TG   E+L++ G+ I++ P  F  H  + ++ +
Sbjct: 523 TQDWLAAYWTGFKSPEQLSRLRN----TGVKPEILKNFGKAITTLPPTFTPHRAIKKVYE 578

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+G+DW TAE LAF +LL EG HVRLSGQDVERGTFS RHAV+HDQ +  +Y
Sbjct: 579 QRAQMIETGEGVDWATAEALAFATLLAEGNHVRLSGQDVERGTFSHRHAVIHDQKSGEKY 638

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PLN +   Q    F+V NSSLSEFG LGFE GYS+ NPNSL+ WE QFGDF N  Q I 
Sbjct: 639 CPLNHVVKNQKDEMFTVSNSSLSEFGVLGFELGYSMENPNSLVCWEAQFGDFSNGCQVIF 698

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  E  + +
Sbjct: 699 DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEVSLRK 758

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPL+    K+LLRH   RSSL+E      
Sbjct: 759 QIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNLLRHQACRSSLSEFNDVEG 818

Query: 415 -------DTTFKRFIPDP--HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                   T FKR I D   H E  +    + R +LCSG+VYY L   R++     VAI 
Sbjct: 819 HPGFDKQGTRFKRLIKDQNNHAEVESG---VRRLVLCSGKVYYELDEERQRVGAKDVAIC 875

Query: 466 RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
           R+EQ+CP PYDLL + + +YPNA+++W QEEP+N GA+ Y+APR+ T M   E       
Sbjct: 876 RVEQLCPVPYDLLQRELRRYPNADVVWCQEEPMNMGAFPYMAPRLATAMVSVEHGSFEDL 935

Query: 526 KPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
           K   R PSA+ ATG    H +E+ +L+ +AL
Sbjct: 936 KYVGRPPSAATATGFGSVHSREQKELVQKAL 966



>gi|296086274|emb|CBI31715.3| unnamed protein product [Vitis vinifera]
          Length = 899

 Score =  619 bits (1597), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 297/527 (56%), Positives = 382/527 (72%), Gaps = 18/527 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDD+EAV  VC+LAAEWRQTF  DVV+D+VCYR++GHNE+D+P
Sbjct: 364 YCTDVAKALNAPIFHVNGDDMEAVVHVCELAAEWRQTFHSDVVVDVVCYRRFGHNEIDEP 423

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           SFTQP+MY+ I      LE Y +KLL+ G  T+EDI++ +  V  IL E +  SKDYVP 
Sbjct: 424 SFTQPKMYKVIRNHPSALEIYQKKLLELGQATQEDIDRVQNKVNTILNEEFLASKDYVPN 483

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
            R+WLS+ W GFKSP++++        TG   E+L++VG+ I++ P+ F  H  + +I  
Sbjct: 484 RRDWLSAYWAGFKSPEQISRVRN----TGVRPEILKNVGKAITTLPENFKAHRAVKKIFD 539

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+GIDW   E LAF +LL+EG HVRLSGQDVERGTFS RH+V+HDQ    +Y
Sbjct: 540 LRAQMIETGEGIDWAVGEALAFATLLVEGNHVRLSGQDVERGTFSHRHSVIHDQETGERY 599

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NPN+L++WE QFGDF N +Q I 
Sbjct: 600 CPLDHVIMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNALVMWEAQFGDFANGAQVIF 659

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+PYV P  +  + +
Sbjct: 660 DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPYVIPEMDPTLRK 719

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN QI+N TTPANYFHVLRRQIHR+FRKPLI  + K+LLRH   +S+L+E      
Sbjct: 720 QIQECNWQIVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQG 779

Query: 415 -------DTTFKRFIPDPHPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISRL 467
                   T FKR I D +  + +  E I R ILCSG+VYY L   R++ K + VAI R+
Sbjct: 780 HPGFDKQGTRFKRLIKDQNDHS-SLEEGIRRLILCSGKVYYELDEQRKKVKANDVAICRV 838

Query: 468 EQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLM 514
           EQ+CPFPYDL  + + +YPNAE++W QEEP+N GA+ Y+ PR+ T M
Sbjct: 839 EQLCPFPYDLAQRELKRYPNAEIVWCQEEPMNMGAYNYILPRLCTAM 885



>gi|508726340|gb|EOY18237.1| 2-oxoglutarate dehydrogenase, E1 component [Theobroma cacao]
          Length = 1026

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 304/570 (53%), Positives = 398/570 (69%), Gaps = 20/570 (3%)

Query: 1    YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
            YC+DVAK +NAPIFHVNGD++EAV  VC+LAA+WRQTF  DVV+DIVCYR++GHNE+D+P
Sbjct: 449  YCTDVAKALNAPIFHVNGDNIEAVVHVCELAAQWRQTFHSDVVVDIVCYRRFGHNEIDEP 508

Query: 61   SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
             FTQP+MY+ I K    LE Y  KLL+ G  T+EDI++  K V +IL E +  SKDYV  
Sbjct: 509  FFTQPKMYKVIQKHPSALEIYKNKLLESGEVTQEDIDRIHKKVESILSEEFLNSKDYVQQ 568

Query: 121  SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
             R+WLS++W GFKSP++L+        TG + ++L+ VG  I+  P+ F  H  + ++ +
Sbjct: 569  RRDWLSTNWEGFKSPEQLSRIRN----TGVNPDILKKVGRAITVLPEDFKPHRAVRKVYE 624

Query: 181  ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
             RA+ I  G+G+DW   E LAF +LL+EG HVRLSGQDVERGTFS RHA++H Q    +Y
Sbjct: 625  DRARMIETGEGLDWAMGEALAFATLLVEGNHVRLSGQDVERGTFSHRHAMVHHQETGDKY 684

Query: 241  VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
             PL+ +   Q +  F+V NSSLSEFG LGFE GYS+ NP++L+LWE QFGDF N +Q I 
Sbjct: 685  CPLDHVMENQNEEMFTVSNSSLSEFGVLGFELGYSMENPDALVLWEAQFGDFANGAQVIF 744

Query: 299  DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPEKMAR- 357
            DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+  ++PY  P  +   R 
Sbjct: 745  DQFLSSGESKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSGENPYEIPQMDPTHRN 804

Query: 358  QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
            Q Q CN Q++NATTPANYFHVLRRQIHR+FRKPLI  + K+LLR+   +S+L+E      
Sbjct: 805  QIQKCNWQVVNATTPANYFHVLRRQIHREFRKPLIVMSPKNLLRYKFCKSNLSEFDDVQG 864

Query: 415  -------DTTFKRFIPDP-HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAISR 466
                    T FKR I D  H   L   + I R +LCSG+VYY L   R++  ++ +AI R
Sbjct: 865  HEGFDKQGTRFKRLIKDQNHHSDLE--KGIRRLVLCSGKVYYELDEERQRLNVNDIAICR 922

Query: 467  LEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAAK 526
            +EQ+CPFPYDL+ + + +YPNAE++W QEEP+N GA+TY+ PR+ T M    R      K
Sbjct: 923  VEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYTYIVPRLYTAMIGIGRGSVEDIK 982

Query: 527  PATRLPSASPATGNKKQHIQEEHDLLSQAL 556
               R PSA+ ATG  K+H  E+ D+L  A+
Sbjct: 983  YVGRAPSAATATGFLKKHQNEQADILRLAM 1012



>gi|302765184|ref|XP_002966013.1| hypothetical protein SELMODRAFT_83943 [Selaginella moellendorffii]
 gi|300166827|gb|EFJ33433.1| hypothetical protein SELMODRAFT_83943 [Selaginella moellendorffii]
          Length = 971

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 305/571 (53%), Positives = 391/571 (68%), Gaps = 22/571 (3%)

Query: 1   YCSDVAKVVNAPIFHVNGDDVEAVNFVCQLAAEWRQTFKKDVVIDIVCYRKYGHNEVDQP 60
           YC+DVAK +NAPIFHVNGDDVEAV   C +AAEWR  FK DVV+DIVCYR++GHNE+D+P
Sbjct: 403 YCTDVAKALNAPIFHVNGDDVEAVVHACAMAAEWRCHFKADVVVDIVCYRRFGHNEIDEP 462

Query: 61  SFTQPRMYQQIAKQTPILEKYVQKLLKDGTFTKEDIEKHKKWVWNILEENYHKSKDYVPT 120
           +FTQP+MYQ I      L+ Y +KL + G   KEDI +    V  IL E +  SKDY+P 
Sbjct: 463 NFTQPKMYQVIKGHPTSLDIYEKKLAQVGQLKKEDIARVHDKVMAILNEEFQSSKDYIPK 522

Query: 121 SREWLSSSWNGFKSPKELAEESTPAYPTGSSYELLQHVGEVISSYPKGFNVHSGLVRILK 180
           +++WL++ W GFK P++L+        TG   E+L+++G+ I++ P  F  H  + ++ +
Sbjct: 523 TQDWLAAYWTGFKGPEQLSRLRN----TGVKPEILKNLGKAITTLPPTFTAHRAIKKVYE 578

Query: 181 ARAKAINEGQGIDWPTAEGLAFGSLLLEGKHVRLSGQDVERGTFSQRHAVLHDQVNETQY 240
            RA+ I  G+G+DW TAE LAF +LL EG HVRLSGQDVERGTFS RHAV+HDQ +  +Y
Sbjct: 579 QRAQMIETGEGVDWATAEALAFATLLAEGNHVRLSGQDVERGTFSHRHAVVHDQKSGEKY 638

Query: 241 VPLNDLRPGQAK--FSVCNSSLSEFGTLGFEYGYSLVNPNSLILWEGQFGDFGNNSQCII 298
            PLN +   Q    F+V NSSLSEFG LGFE GYS+ NPNSL+ WE QFGDF N  Q I 
Sbjct: 639 CPLNHVVKNQEDEMFTVSNSSLSEFGVLGFELGYSMENPNSLVCWEAQFGDFSNGCQVIF 698

Query: 299 DQFIASGEKKWLQRTGLVVLLPHGYDGQGPEHSSGRLERFLQLCDDHPYVYPPPE-KMAR 357
           DQF++SGE KWL++TGLVVLLPHGYDGQGPEHSS RLERFLQ+ DD+P+V P  E  + +
Sbjct: 699 DQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEVSLRK 758

Query: 358 QHQDCNMQIINATTPANYFHVLRRQIHRDFRKPLIAFTSKSLLRHPMARSSLAEMTG--- 414
           Q Q+CN Q++N TTPANYFHVLRRQIHRDFRKPL+    K+LLRH   RSSL+E      
Sbjct: 759 QIQECNWQVMNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNLLRHQACRSSLSEFNDVEG 818

Query: 415 -------DTTFKRFIPDP--HPETLASPEKITRHILCSGQVYYALLRAREQNKMDHVAIS 465
                   T FKR I D   H E  +    + R +LCSG+VYY L   +++     VAI 
Sbjct: 819 HPGFDKQGTRFKRLIKDQNNHAEVESG---VRRLVLCSGKVYYELDEEKQRVGAKDVAIC 875

Query: 466 RLEQICPFPYDLLSQHIDKYPNAELIWAQEEPLNGGAWTYVAPRIRTLMNHSERHEGRAA 525
           R+EQ+CP PYDLL + + +YPNA+++W QEEP+N GA+ Y+APR+ T M   E       
Sbjct: 876 RVEQLCPVPYDLLQRELRRYPNADVVWCQEEPMNMGAFPYMAPRLATAMVSVEHGSFEDL 935

Query: 526 KPATRLPSASPATGNKKQHIQEEHDLLSQAL 556
           K   R PSA+ ATG    H +E+ +L+ +AL
Sbjct: 936 KYVGRPPSAATATGFGSVHSREQKELVQKAL 966