BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10103_c0_seq1-m.36 5prime_partial 2-967(+) 322 (+)
         (321 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384496179|gb|EIE86670.1| glycyl-tRNA synthetase [Rhizopus del...   400   e-109   Rhizopus delemar RA 99-880
gi|328773234|gb|EGF83271.1| hypothetical protein BATDEDRAFT_1842...   397   e-108   Batrachochytrium dendrobatidis JAM81
gi|511009370|gb|EPB90614.1| glycyl-tRNA synthetase [Mucor circin...   388   e-105   Mucor circinelloides f. circinelloides 1006PhL
gi|259482954|tpe|CBF77921.1| TPA: glycyl-tRNA synthetase (AFU_or...   381   e-103   Aspergillus nidulans FGSC A4
gi|67903696|ref|XP_682104.1| hypothetical protein AN8835.2 [Aspe...   380   e-103   Aspergillus nidulans FGSC A4
gi|213403660|ref|XP_002172602.1| glycyl-tRNA synthetase [Schizos...   379   e-103   Schizosaccharomyces japonicus yFS275
gi|350634078|gb|EHA22442.1| hypothetical protein ASPNIDRAFT_5729...   379   e-103   Aspergillus niger ATCC 1015
gi|470316809|gb|EMR08547.1| glycyl-tRNA synthetase [Pneumocystis...   379   e-103   Pneumocystis murina B123
gi|317036964|ref|XP_001398427.2| glycyl-tRNA synthetase 1 [Asper...   377   e-102   Aspergillus niger CBS 513.88
gi|238503462|ref|XP_002382964.1| glycyl-tRNA synthetase [Aspergi...   377   e-102   Aspergillus flavus NRRL3357
gi|83764945|dbj|BAE55089.1| unnamed protein product [Aspergillus...   377   e-102   Aspergillus oryzae RIB40
gi|402216494|gb|EJT96581.1| glycyl-tRNA synthetase [Dacryopinax ...   376   e-102   Dacryopinax primogenitus
gi|115438430|ref|XP_001218064.1| glycyl-tRNA synthetase 1 [Asper...   374   e-101   Aspergillus terreus NIH2624
gi|70998636|ref|XP_754040.1| glycyl-tRNA synthetase [Aspergillus...   374   e-101   Aspergillus fumigatus Af293
gi|345565896|gb|EGX48844.1| hypothetical protein AOL_s00079g483 ...   373   e-101   Arthrobotrys oligospora ATCC 24927
gi|358373298|dbj|GAA89897.1| glycyl-tRNA synthetase [Aspergillus...   373   e-101   Aspergillus kawachii IFO 4308
gi|378730454|gb|EHY56913.1| glycyl-tRNA synthetase [Exophiala de...   372   e-101   Exophiala dermatitidis NIH/UT8656
gi|448519232|ref|XP_003868040.1| Grs1 tRNA-Gly synthetase [Candi...   371   e-100   Candida orthopsilosis Co 90-125
gi|119498573|ref|XP_001266044.1| glycyl-tRNA synthetase [Neosart...   371   e-100   Aspergillus fischeri NRRL 181
gi|403214084|emb|CCK68585.1| hypothetical protein KNAG_0B01380 [...   370   e-100   Kazachstania naganishii CBS 8797
gi|403165407|ref|XP_003325424.2| glycyl-tRNA synthetase [Puccini...   368   1e-99   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|121712626|ref|XP_001273924.1| glycyl-tRNA synthetase [Aspergi...   367   2e-99   Aspergillus clavatus NRRL 1
gi|406603204|emb|CCH45241.1| glycyl-tRNA synthetase [Wickerhamom...   367   2e-99   Wickerhamomyces ciferrii
gi|303319141|ref|XP_003069570.1| glycyl-tRNA synthetase, putativ...   367   2e-99   Coccidioides posadasii C735 delta SOWgp
gi|392865224|gb|EAS31002.2| glycine-tRNA ligase [Coccidioides im...   367   2e-99   
gi|45187500|ref|NP_983723.1| ADL373Wp [Ashbya gossypii ATCC 1089...   367   2e-99   Eremothecium gossypii ATCC 10895
gi|513032911|gb|AGO12883.1| AaceriADL373Wp [Saccharomycetaceae s...   367   2e-99   Saccharomycetaceae sp. 'Ashbya aceri'
gi|119182388|ref|XP_001242329.1| hypothetical protein CIMG_06225...   367   3e-99   
gi|255716848|ref|XP_002554705.1| KLTH0F11660p [Lachancea thermot...   366   5e-99   Lachancea thermotolerans CBS 6340
gi|354544025|emb|CCE40747.1| hypothetical protein CPAR2_107820 [...   366   5e-99   Candida parapsilosis
gi|320041027|gb|EFW22960.1| glycyl-tRNA synthetase [Coccidioides...   365   8e-99   Coccidioides posadasii str. Silveira
gi|296808933|ref|XP_002844805.1| glycyl-tRNA synthetase 1 [Arthr...   365   8e-99   Arthroderma otae CBS 113480
gi|255730579|ref|XP_002550214.1| glycyl-tRNA synthetase 1 [Candi...   365   9e-99   Candida tropicalis MYA-3404
gi|472587902|gb|EMS25398.1| glycyl-tRNA synthetase [Rhodosporidi...   365   1e-98   Rhodotorula toruloides NP11
gi|443897920|dbj|GAC75259.1| glycyl-trna synthetase and related ...   364   2e-98   Moesziomyces antarcticus T-34
gi|68480224|ref|XP_715922.1| hypothetical protein CaO19.8067 [Ca...   364   2e-98   Candida albicans SC5314
gi|336469952|gb|EGO58114.1| glycyl-tRNA synthetase 1 [Neurospora...   363   2e-98   Neurospora tetrasperma FGSC 2508
gi|241948893|ref|XP_002417169.1| glycyl-tRNA ligase, putative; g...   363   4e-98   Candida dubliniensis CD36
gi|430813397|emb|CCJ29276.1| unnamed protein product [Pneumocyst...   363   5e-98   Pneumocystis jirovecii
gi|448090348|ref|XP_004197045.1| Piso0_004280 [Millerozyma farin...   362   5e-98   Millerozyma farinosa CBS 7064
gi|302664275|ref|XP_003023770.1| hypothetical protein TRV_02082 ...   362   6e-98   Trichophyton verrucosum HKI 0517
gi|302505475|ref|XP_003014444.1| hypothetical protein ARB_07006 ...   362   6e-98   Arthroderma benhamiae CBS 112371
gi|459369391|gb|EMG47787.1| Glycyl-tRNA synthetase 1 [Candida ma...   362   9e-98   Candida maltosa Xu316
gi|50303953|ref|XP_451926.1| hypothetical protein [Kluyveromyces...   362   9e-98   Kluyveromyces lactis NRRL Y-1140
gi|358055811|dbj|GAA98156.1| hypothetical protein E5Q_04839 [Mix...   362   1e-97   Mixia osmundae IAM 14324
gi|326468704|gb|EGD92713.1| glycyl-tRNA synthetase [Trichophyton...   362   1e-97   Trichophyton tonsurans CBS 112818
gi|326481313|gb|EGE05323.1| glycyl-tRNA synthetase [Trichophyton...   361   1e-97   Trichophyton equinum CBS 127.97
gi|328851152|gb|EGG00310.1| hypothetical protein MELLADRAFT_3983...   360   2e-97   Melampsora larici-populina 98AG31
gi|501306141|dbj|GAC95226.1| glycyl-tRNA synthetase [Pseudozyma ...   360   2e-97   Pseudozyma hubeiensis SY62
gi|50422167|ref|XP_459646.1| DEHA2E07722p [Debaryomyces hansenii...   360   2e-97   Debaryomyces hansenii CBS767
gi|255943789|ref|XP_002562662.1| Pc20g01010 [Penicillium chrysog...   360   2e-97   Penicillium rubens Wisconsin 54-1255
gi|85084305|ref|XP_957291.1| glycyl-tRNA synthetase 1 [Neurospor...   360   2e-97   
gi|327300907|ref|XP_003235146.1| glycyl-tRNA synthetase [Trichop...   360   2e-97   Trichophyton rubrum CBS 118892
gi|238879014|gb|EEQ42652.1| glycyl-tRNA synthetase 1 [Candida al...   360   3e-97   Candida albicans WO-1
gi|295660511|ref|XP_002790812.1| glycyl-tRNA synthetase [Paracoc...   360   4e-97   Paracoccidioides lutzii Pb01
gi|336257695|ref|XP_003343671.1| hypothetical protein SMAC_08842...   359   4e-97   Sordaria macrospora k-hell
gi|388854474|emb|CCF51861.1| probable glycine--tRNA ligase GRS1 ...   358   7e-97   Ustilago hordei
gi|388583196|gb|EIM23498.1| glycyl-tRNA synthetase [Wallemia seb...   358   9e-97   Wallemia mellicola CBS 633.66
gi|242794846|ref|XP_002482459.1| glycyl-tRNA synthetase [Talarom...   358   1e-96   Talaromyces stipitatus ATCC 10500
gi|325091800|gb|EGC45110.1| glycyl-tRNA synthetase [Ajellomyces ...   358   1e-96   Histoplasma capsulatum H88
gi|240277283|gb|EER40792.1| glycyl-tRNA synthetase [Ajellomyces ...   358   1e-96   Histoplasma capsulatum H143
gi|261189484|ref|XP_002621153.1| glycyl-tRNA synthetase [Ajellom...   358   1e-96   Blastomyces gilchristii SLH14081
gi|225562196|gb|EEH10476.1| glycyl-tRNA synthetase [Ajellomyces ...   358   1e-96   Histoplasma capsulatum G186AR
gi|149244764|ref|XP_001526925.1| glycyl-tRNA synthetase 1 [Lodde...   358   1e-96   Lodderomyces elongisporus NRRL YB-4239
gi|400599140|gb|EJP66844.1| glycyl-tRNA synthetase [Beauveria ba...   357   2e-96   Beauveria bassiana ARSEF 2860
gi|50553074|ref|XP_503947.1| YALI0E14597p [Yarrowia lipolytica] ...   357   2e-96   Yarrowia lipolytica CLIB122
gi|365982737|ref|XP_003668202.1| hypothetical protein NDAI_0A080...   357   2e-96   Naumovozyma dairenensis CBS 421
gi|116207946|ref|XP_001229782.1| hypothetical protein CHGG_03266...   357   2e-96   Chaetomium globosum CBS 148.51
gi|225685037|gb|EEH23321.1| glycyl-tRNA synthetase [Paracoccidio...   357   2e-96   Paracoccidioides brasiliensis Pb03
gi|226294349|gb|EEH49769.1| glycyl-tRNA synthetase [Paracoccidio...   357   2e-96   Paracoccidioides brasiliensis Pb18
gi|190348873|gb|EDK41420.2| hypothetical protein PGUG_05518 [Mey...   357   3e-96   Meyerozyma guilliermondii ATCC 6260
gi|444317783|ref|XP_004179549.1| hypothetical protein TBLA_0C021...   357   3e-96   Tetrapisispora blattae CBS 6284
gi|319411507|emb|CBQ73551.1| probable glycine--tRNA ligase GRS1 ...   357   3e-96   Sporisorium reilianum SRZ2
gi|189190276|ref|XP_001931477.1| glycyl-tRNA synthetase [Pyrenop...   357   3e-96   Pyrenophora tritici-repentis Pt-1C-BFP
gi|50287985|ref|XP_446421.1| hypothetical protein [Candida glabr...   356   4e-96   Candida glabrata CBS 138
gi|258571682|ref|XP_002544644.1| glycyl-tRNA synthetase [Uncinoc...   356   4e-96   Uncinocarpus reesii 1704
gi|212536096|ref|XP_002148204.1| glycyl-tRNA synthetase [Talarom...   356   4e-96   Talaromyces marneffei ATCC 18224
gi|146413054|ref|XP_001482498.1| hypothetical protein PGUG_05518...   356   5e-96   Meyerozyma guilliermondii ATCC 6260
gi|425766566|gb|EKV05172.1| Glycyl-tRNA synthetase [Penicillium ...   356   5e-96   Penicillium digitatum PHI26
gi|171686512|ref|XP_001908197.1| hypothetical protein [Podospora...   356   6e-96   Podospora anserina S mat+
gi|477529238|gb|ENH81002.1| glycyl-trna synthetase [Colletotrich...   356   6e-96   Colletotrichum orbiculare MAFF 240422
gi|341942098|sp|P38088.3|SYG_YEAST RecName: Full=Glycine--tRNA l...   355   6e-96   Saccharomyces cerevisiae S288c
gi|323356077|gb|EGA87882.1| Grs1p [Saccharomyces cerevisiae VL3]...   355   6e-96   Saccharomyces cerevisiae VL3
gi|330443451|ref|NP_009679.2| glycine--tRNA ligase [Saccharomyce...   355   9e-96   Saccharomyces cerevisiae S288c
gi|323334582|gb|EGA75956.1| Grs1p [Saccharomyces cerevisiae AWRI...   355   9e-96   Saccharomyces cerevisiae AWRI796
gi|154284101|ref|XP_001542846.1| glycyl-tRNA synthetase 1 [Ajell...   355   1e-95   Histoplasma capsulatum NAm1
gi|151946513|gb|EDN64735.1| glycyl-tRNA synthetase [Saccharomyce...   355   1e-95   Saccharomyces cerevisiae YJM789
gi|365762031|gb|EHN03648.1| Grs1p [Saccharomyces cerevisiae x Sa...   355   1e-95   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|190408722|gb|EDV11987.1| glycine-tRNA ligase [Saccharomyces c...   355   1e-95   Saccharomyces cerevisiae RM11-1a
gi|290878134|emb|CBK39193.1| Grs1p [Saccharomyces cerevisiae EC1...   355   1e-95   Saccharomyces cerevisiae EC1118
gi|401839450|gb|EJT42675.1| GRS1-like protein [Saccharomyces kud...   355   1e-95   Saccharomyces kudriavzevii IFO 1802
gi|363751064|ref|XP_003645749.1| hypothetical protein Ecym_3447 ...   355   1e-95   Eremothecium cymbalariae DBVPG#7215
gi|536402|emb|CAA85078.1| GRS1 [Saccharomyces cerevisiae] >gi|56...   355   1e-95   Saccharomyces cerevisiae [brewer's yeast]
gi|71018157|ref|XP_759309.1| hypothetical protein UM03162.1 [Ust...   354   2e-95   
gi|260943664|ref|XP_002616130.1| conserved hypothetical protein ...   354   2e-95   Clavispora lusitaniae ATCC 42720
gi|310789482|gb|EFQ25015.1| glycyl-tRNA synthetase [Glomerella g...   353   3e-95   Colletotrichum graminicola M1.001
gi|323338670|gb|EGA79886.1| Grs1p [Saccharomyces cerevisiae Vin13]    353   4e-95   Saccharomyces cerevisiae Vin13
gi|296414076|ref|XP_002836729.1| hypothetical protein [Tuber mel...   353   4e-95   Tuber melanosporum Mel28
gi|465796910|emb|CCU97662.1| unnamed protein product [Malassezia...   352   7e-95   Malassezia sympodialis ATCC 42132
gi|322699026|gb|EFY90791.1| glycyl-tRNA synthetase 1 [Metarhiziu...   352   9e-95   Metarhizium acridum CQMa 102
gi|322707106|gb|EFY98685.1| glycyl-tRNA synthetase 1 [Metarhiziu...   352   9e-95   Metarhizium robertsii ARSEF 23
gi|366998035|ref|XP_003683754.1| hypothetical protein TPHA_0A023...   352   1e-94   Tetrapisispora phaffii CBS 4417
gi|164657552|ref|XP_001729902.1| hypothetical protein MGL_2888 [...   351   1e-94   Malassezia globosa CBS 7966
gi|505759833|gb|EOR03907.1| Putative glycine--tRNA ligase [Walle...   351   1e-94   Wallemia ichthyophaga EXF-994
gi|429860674|gb|ELA35400.1| glycyl-trna synthetase [Colletotrich...   351   2e-94   Colletotrichum gloeosporioides Nara gc5
gi|344305125|gb|EGW35357.1| hypothetical protein SPAPADRAFT_5858...   351   2e-94   Spathaspora passalidarum NRRL Y-27907
gi|501752930|emb|CCG83277.1| Putative glycyl-tRNA synthetase [Ta...   351   2e-94   Taphrina deformans PYCC 5710
gi|254570979|ref|XP_002492599.1| Cytoplasmic and mitochondrial g...   350   4e-94   Komagataella phaffii GS115
gi|156846538|ref|XP_001646156.1| hypothetical protein Kpol_1039p...   350   4e-94   Vanderwaltozyma polyspora DSM 70294
gi|302916831|ref|XP_003052226.1| predicted protein [Nectria haem...   349   5e-94   Nectria haematococca mpVI 77-13-4
gi|396494587|ref|XP_003844340.1| similar to glycyl-tRNA syntheta...   349   5e-94   Leptosphaeria maculans JN3
gi|408395881|gb|EKJ75053.1| hypothetical protein FPSE_04765 [Fus...   349   7e-94   Fusarium pseudograminearum CS3096
gi|46125161|ref|XP_387134.1| hypothetical protein FG06958.1 [Fus...   348   8e-94   
gi|410078918|ref|XP_003957040.1| hypothetical protein KAFR_0D025...   348   1e-93   Kazachstania africana CBS 2517
gi|500260144|gb|EOO02847.1| putative glycyl-trna synthetase prot...   348   1e-93   Phaeoacremonium minimum UCRPA7
gi|340522557|gb|EGR52790.1| hypothetical protein TRIREDRAFT_1027...   348   1e-93   Trichoderma reesei QM6a
gi|392572897|gb|EIW66040.1| hypothetical protein TREMEDRAFT_4588...   348   1e-93   Tremella mesenterica DSM 1558
gi|367049748|ref|XP_003655253.1| hypothetical protein THITE_2118...   348   2e-93   Thielavia terrestris NRRL 8126
gi|367015096|ref|XP_003682047.1| hypothetical protein TDEL_0F002...   347   2e-93   Torulaspora delbrueckii
gi|320590421|gb|EFX02864.1| glycyl-tRNA synthetase [Grosmannia c...   347   2e-93   Grosmannia clavigera kw1407
gi|320580638|gb|EFW94860.1| Cytoplasmic and mitochondrial glycyl...   347   2e-93   
gi|444321426|ref|XP_004181369.1| hypothetical protein TBLA_0F031...   347   3e-93   Tetrapisispora blattae CBS 6284
gi|389742663|gb|EIM83849.1| glycyl-tRNA synthetase [Stereum hirs...   346   4e-93   Stereum hirsutum FP-91666 SS1
gi|409077211|gb|EKM77578.1| hypothetical protein AGABI1DRAFT_121...   346   5e-93   Agaricus bisporus var. burnettii JB137-S8
gi|358398566|gb|EHK47917.1| hypothetical protein TRIATDRAFT_2981...   346   5e-93   Trichoderma atroviride IMI 206040
gi|340959321|gb|EGS20502.1| glycyl-tRNA synthetase-like protein ...   346   5e-93   Chaetomium thermophilum var. thermophilum DSM 1495
gi|358387063|gb|EHK24658.1| hypothetical protein TRIVIDRAFT_3088...   346   6e-93   Trichoderma virens Gv29-8
gi|401887752|gb|EJT51731.1| glycine-tRNA ligase [Trichosporon as...   345   6e-93   Trichosporon asahii var. asahii CBS 2479
gi|449545596|gb|EMD36567.1| hypothetical protein CERSUDRAFT_8474...   345   7e-93   Gelatoporia subvermispora B
gi|380489909|emb|CCF36384.1| glycyl-tRNA synthetase [Colletotric...   345   8e-93   Colletotrichum higginsianum
gi|366996695|ref|XP_003678110.1| hypothetical protein NCAS_0I009...   345   1e-92   Naumovozyma castellii CBS 4309
gi|393234334|gb|EJD41898.1| glycyl-tRNA synthetase [Auricularia ...   345   1e-92   Auricularia subglabra TFB-10046 SS5
gi|342875536|gb|EGU77279.1| hypothetical protein FOXB_12202 [Fus...   345   1e-92   Fusarium oxysporum Fo5176
gi|440635819|gb|ELR05738.1| glycyl-tRNA synthetase [Geomyces des...   345   1e-92   Pseudogymnoascus destructans 20631-21
gi|346324760|gb|EGX94357.1| glycyl-tRNA synthetase 1 [Cordyceps ...   344   1e-92   Cordyceps militaris CM01
gi|409043806|gb|EKM53288.1| hypothetical protein PHACADRAFT_1248...   344   2e-92   Phanerochaete carnosa HHB-10118-sp
gi|512193240|gb|EPE08998.1| glycyl-trna synthetase 1 [Ophiostoma...   344   2e-92   Ophiostoma piceae UAMH 11346
gi|512207382|gb|EPE36200.1| Class II aaRS and biotin synthetase ...   344   2e-92   Glarea lozoyensis ATCC 20868
gi|402077342|gb|EJT72691.1| glycyl-tRNA synthetase [Gaeumannomyc...   343   3e-92   Gaeumannomyces graminis var. tritici R3-111a-1
gi|361125027|gb|EHK97089.1| putative Glycyl-tRNA synthetase 1, m...   343   4e-92   Glarea lozoyensis 74030
gi|336365962|gb|EGN94310.1| hypothetical protein SERLA73DRAFT_18...   343   4e-92   Serpula lacrymans var. lacrymans S7.3
gi|406864937|gb|EKD17980.1| glycyl-tRNA synthetase [Marssonina b...   343   4e-92   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|477512077|gb|ENH64638.1| Glycyl-tRNA synthetase 1, mitochondr...   343   5e-92   Fusarium oxysporum f. sp. cubense race 1
gi|392562608|gb|EIW55788.1| glycyl-tRNA synthetase [Trametes ver...   342   5e-92   Trametes versicolor FP-101664 SS1
gi|156065255|ref|XP_001598549.1| hypothetical protein SS1G_00638...   342   7e-92   Sclerotinia sclerotiorum 1980 UF-70
gi|407922814|gb|EKG15906.1| hypothetical protein MPH_06871 [Macr...   342   9e-92   Macrophomina phaseolina MS6
gi|346323714|gb|EGX93312.1| glycyl-tRNA synthetase [Cordyceps mi...   342   9e-92   Cordyceps militaris CM01
gi|390596183|gb|EIN05586.1| glycyl-tRNA synthetase [Punctularia ...   341   1e-91   Punctularia strigosozonata HHB-11173 SS5
gi|170116654|ref|XP_001889517.1| predicted protein [Laccaria bic...   341   2e-91   Laccaria bicolor S238N-H82
gi|302674551|ref|XP_003026960.1| hypothetical protein SCHCODRAFT...   341   2e-91   Schizophyllum commune H4-8
gi|395331560|gb|EJF63941.1| glycyl-tRNA synthetase [Dichomitus s...   340   2e-91   Dichomitus squalens LYAD-421 SS1
gi|393222980|gb|EJD08464.1| glycyl-tRNA synthetase [Fomitiporia ...   340   3e-91   Fomitiporia mediterranea MF3/22
gi|19114847|ref|NP_593935.1| mitochondrial and cytoplasmic glyci...   340   4e-91   Schizosaccharomyces pombe 972h-
gi|344234426|gb|EGV66296.1| hypothetical protein CANTEDRAFT_1014...   340   4e-91   Candida tenuis ATCC 10573
gi|426193058|gb|EKV42992.1| hypothetical protein AGABI2DRAFT_195...   340   4e-91   Agaricus bisporus var. bisporus H97
gi|392586435|gb|EIW75771.1| glycyl-tRNA synthetase [Coniophora p...   340   4e-91   Coniophora puteana RWD-64-598 SS2
gi|169856615|ref|XP_001834964.1| glycine-tRNA ligase [Coprinopsi...   340   5e-91   Coprinopsis cinerea okayama7#130
gi|494830052|gb|EON66621.1| glycyl-tRNA synthetase 1 [Coniospori...   339   5e-91   Coniosporium apollinis CBS 100218
gi|451854174|gb|EMD67467.1| hypothetical protein COCSADRAFT_2384...   338   1e-90   Bipolaris sorokiniana ND90Pr
gi|322706404|gb|EFY97985.1| glycyl-tRNA synthetase 1 [Metarhiziu...   337   2e-90   Metarhizium robertsii ARSEF 23
gi|330940966|ref|XP_003306011.1| hypothetical protein PTT_19018 ...   337   3e-90   Pyrenophora teres f. teres 0-1
gi|126274168|ref|XP_001387862.1| cyl-tRNA synthase [Scheffersomy...   337   4e-90   Scheffersomyces stipitis CBS 6054
gi|452000084|gb|EMD92546.1| hypothetical protein COCHEDRAFT_1174...   337   4e-90   Bipolaris maydis C5
gi|485920453|gb|EOD46475.1| putative glycyl-trna synthetase prot...   336   4e-90   Neofusicoccum parvum UCRNP2
gi|358372610|dbj|GAA89213.1| glycyl-tRNA synthetase [Aspergillus...   335   8e-90   Aspergillus kawachii IFO 4308
gi|11596253|gb|AAG38542.1|AF309805_7 glycyl tRNA synthetase [Pne...   335   8e-90   Pneumocystis carinii
gi|399168208|emb|CCE30914.1| probable glycine--tRNA ligase GRS1 ...   335   1e-89   Claviceps purpurea 20.1
gi|302410789|ref|XP_003003228.1| glycyl-tRNA synthetase [Vertici...   334   2e-89   Verticillium alfalfae VaMs.102
gi|350637470|gb|EHA25827.1| hypothetical protein ASPNIDRAFT_5034...   334   2e-89   Aspergillus niger ATCC 1015
gi|254580769|ref|XP_002496370.1| ZYRO0C16830p [Zygosaccharomyces...   333   3e-89   Zygosaccharomyces rouxii CBS 732
gi|367028000|ref|XP_003663284.1| hypothetical protein MYCTH_8052...   333   3e-89   Myceliophthora thermophila ATCC 42464
gi|482812403|gb|EOA89122.1| hypothetical protein SETTUDRAFT_1056...   333   4e-89   Setosphaeria turcica Et28A
gi|145246120|ref|XP_001395309.1| glycyl-tRNA synthetase 1 [Asper...   333   5e-89   Aspergillus niger CBS 513.88
gi|322695139|gb|EFY86952.1| glycyl-tRNA synthetase 1 [Metarhiziu...   332   1e-88   Metarhizium acridum CQMa 102
gi|296805896|ref|XP_002843772.1| glycyl-tRNA synthetase 1 [Arthr...   330   2e-88   Arthroderma otae CBS 113480
gi|405121451|gb|AFR96220.1| glycine-tRNA ligase [Cryptococcus ne...   327   2e-87   
gi|321260376|ref|XP_003194908.1| glycine-tRNA ligase [Cryptococc...   327   3e-87   Cryptococcus gattii WM276
gi|389639262|ref|XP_003717264.1| glycyl-tRNA synthetase [Magnapo...   327   4e-87   Magnaporthe oryzae 70-15
gi|156844100|ref|XP_001645114.1| hypothetical protein Kpol_538p1...   326   7e-87   Vanderwaltozyma polyspora DSM 70294
gi|58268176|ref|XP_571244.1| glycine-tRNA ligase [Cryptococcus n...   326   7e-87   Cryptococcus neoformans var. neoformans JEC21
gi|440468848|gb|ELQ37982.1| glycyl-tRNA synthetase 1 [Magnaporth...   325   7e-87   Magnaporthe oryzae Y34
gi|154311325|ref|XP_001554992.1| hypothetical protein BC1G_06515...   324   2e-86   Botrytis cinerea B05.10
gi|134113354|ref|XP_774702.1| hypothetical protein CNBF3810 [Cry...   323   3e-86   Cryptococcus neoformans var. neoformans B-3501A
gi|500259425|gb|EOO02238.1| putative glycyl-trna synthetase prot...   323   5e-86   Phaeoacremonium minimum UCRPA7
gi|66521713|ref|XP_391940.2| PREDICTED: glycyl-tRNA synthetase [...   321   2e-85   Apis mellifera [European honey bee]
gi|195129603|ref|XP_002009245.1| GI13931 [Drosophila mojavensis]...   321   2e-85   
gi|380027384|ref|XP_003697406.1| PREDICTED: LOW QUALITY PROTEIN:...   320   3e-85   Apis florea [dwarf honeybee]
gi|158293345|ref|XP_557743.2| AGAP008604-PA [Anopheles gambiae s...   318   9e-85   Anopheles gambiae str. PEST
gi|312376083|gb|EFR23277.1| hypothetical protein AND_13183 [Anop...   318   1e-84   
gi|198464323|ref|XP_001353177.2| GA19857 [Drosophila pseudoobscu...   318   1e-84   
gi|195378418|ref|XP_002047981.1| GJ13721 [Drosophila virilis] >g...   318   1e-84   Drosophila virilis
gi|403182736|gb|EAT42765.2| AAEL005728-PA [Aedes aegypti]             318   1e-84   Aedes aegypti
gi|157111109|ref|XP_001651394.1| glycyl-tRNA synthetase [Aedes a...   317   2e-84   
gi|195162783|ref|XP_002022233.1| GL24717 [Drosophila persimilis]...   317   2e-84   Drosophila persimilis
gi|71895709|ref|NP_001026681.1| glycine--tRNA ligase [Gallus gal...   317   3e-84   Gallus gallus [bantam]
gi|260821670|ref|XP_002606155.1| hypothetical protein BRAFLDRAFT...   317   4e-84   Branchiostoma floridae
gi|367040619|ref|XP_003650690.1| hypothetical protein THITE_2110...   316   4e-84   Thielavia terrestris NRRL 8126
gi|354483597|ref|XP_003503979.1| PREDICTED: glycyl-tRNA syntheta...   316   4e-84   
gi|148666302|gb|EDK98718.1| glycyl-tRNA synthetase, isoform CRA_...   315   7e-84   Mus musculus [mouse]
gi|478489084|ref|XP_004418923.1| PREDICTED: glycine--tRNA ligase...   315   8e-84   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|315048629|ref|XP_003173689.1| glycyl-tRNA synthetase 1 [Arthr...   315   1e-83   Microsporum gypseum CBS 118893
gi|504140023|ref|XP_004582459.1| PREDICTED: glycine--tRNA ligase...   315   1e-83   Ochotona princeps [southern American pika]
gi|195494469|ref|XP_002094853.1| GE22046 [Drosophila yakuba] >gi...   315   1e-83   
gi|194209766|ref|XP_001500496.2| PREDICTED: glycyl-tRNA syntheta...   315   1e-83   
gi|431909041|gb|ELK12632.1| Glycyl-tRNA synthetase [Pteropus ale...   315   1e-83   Pteropus alecto
gi|18256043|gb|AAH21747.1| Glycyl-tRNA synthetase [Mus musculus]      315   2e-83   Mus musculus [mouse]
gi|148666303|gb|EDK98719.1| glycyl-tRNA synthetase, isoform CRA_...   315   2e-83   Mus musculus [mouse]
gi|74139030|dbj|BAE38417.1| unnamed protein product [Mus musculus]    314   2e-83   Mus musculus [mouse]
gi|93102417|ref|NP_851009.2| glycine--tRNA ligase [Mus musculus]...   314   2e-83   Mus musculus [mouse]
gi|452982064|gb|EME81823.1| hypothetical protein MYCFIDRAFT_5032...   314   2e-83   Cercospora fijiensis CIRAD86
gi|281354615|gb|EFB30199.1| hypothetical protein PANDA_007924 [A...   314   2e-83   Ailuropoda melanoleuca
gi|194871168|ref|XP_001972794.1| GG15715 [Drosophila erecta] >gi...   314   2e-83   
gi|449270337|gb|EMC81023.1| Glycyl-tRNA synthetase, partial [Col...   314   2e-83   Columba livia [carrier pigeon]
gi|410952642|ref|XP_003982988.1| PREDICTED: LOW QUALITY PROTEIN:...   314   2e-83   
gi|66910298|gb|AAH96883.1| Si:dkey-276i5.1 protein [Danio rerio]      314   2e-83   Danio rerio [leopard danio]
gi|403288052|ref|XP_003935230.1| PREDICTED: glycine--tRNA ligase...   313   3e-83   Saimiri boliviensis boliviensis
gi|402794806|ref|NP_001258068.1| glycine--tRNA ligase [Rattus no...   313   4e-83   Rattus norvegicus [brown rat]
gi|472389368|ref|XP_004414006.1| PREDICTED: glycine--tRNA ligase...   313   4e-83   Odobenus rosmarus divergens
gi|511957664|ref|XP_004797110.1| PREDICTED: glycine--tRNA ligase...   313   4e-83   
gi|511885648|ref|XP_004762630.1| PREDICTED: glycine--tRNA ligase...   313   5e-83   Mustela putorius furo [black ferret]
gi|383850383|ref|XP_003700775.1| PREDICTED: glycine--tRNA ligase...   313   5e-83   Megachile rotundata
gi|170050075|ref|XP_001859192.1| glycyl-tRNA synthetase [Culex q...   313   6e-83   Culex quinquefasciatus
gi|81889021|sp|Q5I0G4.1|SYG_RAT RecName: Full=Glycine--tRNA liga...   313   6e-83   Rattus norvegicus [brown rat]
gi|512898971|ref|XP_004898882.1| PREDICTED: glycine--tRNA ligase...   313   6e-83   
gi|195018532|ref|XP_001984799.1| GH14827 [Drosophila grimshawi] ...   312   7e-83   Drosophila grimshawi
gi|512954329|ref|XP_004839531.1| PREDICTED: glycine--tRNA ligase...   312   7e-83   Heterocephalus glaber [naked mole rat]
gi|466009790|ref|XP_004269991.1| PREDICTED: glycine--tRNA ligase...   311   1e-82   Orcinus orca [Orca]
gi|301767770|ref|XP_002919302.1| PREDICTED: glycyl-tRNA syntheta...   311   1e-82   Ailuropoda melanoleuca
gi|74226707|dbj|BAE27003.1| unnamed protein product [Mus musculus]    311   1e-82   Mus musculus [mouse]
gi|359321220|ref|XP_003639538.1| PREDICTED: glycyl-tRNA syntheta...   311   1e-82   Canis lupus familiaris [dogs]
gi|507537593|ref|XP_004652820.1| PREDICTED: glycine--tRNA ligase...   311   1e-82   Jaculus jaculus
gi|119614366|gb|EAW93960.1| glycyl-tRNA synthetase, isoform CRA_...   311   1e-82   Homo sapiens [man]
gi|505783984|ref|XP_004604306.1| PREDICTED: glycine--tRNA ligase...   311   1e-82   Sorex araneus [Eurasian shrew]
gi|296209313|ref|XP_002751476.1| PREDICTED: glycine--tRNA ligase...   311   2e-82   Callithrix jacchus [common marmoset]
gi|90075272|dbj|BAE87316.1| unnamed protein product [Macaca fasc...   311   2e-82   Macaca fascicularis [crab eating macaque]
gi|498967996|ref|XP_004546800.1| PREDICTED: glycine--tRNA ligase...   311   2e-82   Maylandia zebra
gi|350595384|ref|XP_003134854.3| PREDICTED: glycyl-tRNA syntheta...   311   2e-82   Sus scrofa [pigs]
gi|402863813|ref|XP_003896193.1| PREDICTED: glycine--tRNA ligase...   311   2e-82   Papio anubis [Doguera baboon]
gi|189536638|ref|XP_692410.3| PREDICTED: glycyl-tRNA synthetase ...   310   2e-82   
gi|440911500|gb|ELR61161.1| Glycyl-tRNA synthetase [Bos grunnien...   310   3e-82   Bos mutus
gi|449492085|ref|XP_002193565.2| PREDICTED: glycine--tRNA ligase...   310   3e-82   Taeniopygia guttata
gi|281208581|gb|EFA82757.1| glycyl-tRNA synthetase [Polysphondyl...   310   3e-82   Polysphondylium pallidum PN500
gi|471379526|ref|XP_004377560.1| PREDICTED: glycine--tRNA ligase...   310   3e-82   Trichechus manatus latirostris
gi|332242726|ref|XP_003270534.1| PREDICTED: glycine--tRNA ligase...   310   3e-82   Nomascus leucogenys [White-cheeked Gibbon]
gi|156537409|ref|XP_001606827.1| PREDICTED: glycyl-tRNA syntheta...   310   3e-82   Nasonia vitripennis
gi|198438257|ref|XP_002130910.1| PREDICTED: glycine--tRNA ligase...   310   4e-82   Ciona intestinalis [sea vase]
gi|441651074|ref|XP_004091026.1| PREDICTED: glycine--tRNA ligase...   310   4e-82   
gi|197099206|ref|NP_001127342.1| glycine--tRNA ligase precursor ...   310   4e-82   Pongo abelii [Orang-utan]
gi|401842167|gb|EJT44424.1| GRS2-like protein [Saccharomyces kud...   310   4e-82   Saccharomyces kudriavzevii IFO 1802
gi|444727438|gb|ELW67931.1| Glycyl-tRNA synthetase [Tupaia chine...   310   4e-82   Tupaia chinensis
gi|24664462|ref|NP_730022.1| Glycyl-tRNA synthetase, isoform B [...   310   4e-82   Drosophila melanogaster
gi|195327692|ref|XP_002030552.1| GM25502 [Drosophila sechellia] ...   310   4e-82   Drosophila sechellia
gi|348503634|ref|XP_003439369.1| PREDICTED: glycyl-tRNA syntheta...   310   5e-82   
gi|498989451|ref|XP_004531613.1| PREDICTED: glycine--tRNA ligase...   310   5e-82   Ceratitis capitata
gi|46241865|gb|AAS83111.1| glycyl-tran synthetase [Bos taurus]        310   5e-82   Bos taurus [bovine]
gi|507646210|ref|XP_004702812.1| PREDICTED: glycine--tRNA ligase...   310   5e-82   Echinops telfairi [lesser hedgehog tenrec]
gi|21357965|ref|NP_648746.1| Glycyl-tRNA synthetase, isoform A [...   310   5e-82   Drosophila melanogaster
gi|260166733|gb|ACX32978.1| RE19272p [Drosophila melanogaster]        309   5e-82   Drosophila melanogaster
gi|391342705|ref|XP_003745656.1| PREDICTED: glycine--tRNA ligase...   309   6e-82   Metaseiulus occidentalis
gi|194380518|dbj|BAG58412.1| unnamed protein product [Homo sapiens]   309   6e-82   Homo sapiens [man]
gi|398393766|ref|XP_003850342.1| glycine--tRNA ligase [Zymosepto...   309   7e-82   Zymoseptoria tritici IPO323
gi|395830999|ref|XP_003788599.1| PREDICTED: glycine--tRNA ligase...   309   7e-82   Otolemur garnettii
gi|507931270|ref|XP_004676878.1| PREDICTED: glycine--tRNA ligase...   309   8e-82   Condylura cristata
gi|1311463|dbj|BAA06338.1| glycyl tRNA synthetase [Homo sapiens]...   309   8e-82   Homo sapiens [man]
gi|116805340|ref|NP_002038.2| glycine--tRNA ligase precursor [Ho...   309   9e-82   Homo sapiens [man]
gi|3845409|gb|AAC71652.1| glycyl tRNA synthetase [Homo sapiens]       308   9e-82   Homo sapiens [man]
gi|150261552|pdb|2Q5H|A Chain A, Crystal Structure Of Apo-Wildty...   308   1e-81   Homo sapiens [man]
gi|600727|gb|AAA57001.1| glycyl-tRNA synthetase [Homo sapiens] >...   308   1e-81   Homo sapiens [man]
gi|149243238|pdb|2PME|A Chain A, The Apo Crystal Structure Of Th...   308   1e-81   Homo sapiens [man]
gi|195018535|ref|XP_001984800.1| GH14826 [Drosophila grimshawi] ...   308   1e-81   Drosophila grimshawi
gi|332864412|ref|XP_519025.3| PREDICTED: glycine--tRNA ligase is...   308   1e-81   
gi|397527068|ref|XP_003833426.1| PREDICTED: glycine--tRNA ligase...   308   1e-81   Pan paniscus [bonobo]
gi|195590378|ref|XP_002084923.1| GD14521 [Drosophila simulans] >...   308   1e-81   
gi|493066|gb|AAA86443.1| glycyl-tRNA synthetase [Homo sapiens]        308   1e-81   Homo sapiens [man]
gi|147902079|ref|NP_001091035.1| glycine--tRNA ligase [Bos tauru...   308   1e-81   Bos taurus [bovine]
gi|449301684|gb|EMC97695.1| hypothetical protein BAUCODRAFT_3341...   308   1e-81   Baudoinia panamericana UAMH 10762
gi|507626045|ref|XP_004626577.1| PREDICTED: glycine--tRNA ligase...   308   1e-81   Octodon degus
gi|432928253|ref|XP_004081128.1| PREDICTED: glycine--tRNA ligase...   308   1e-81   
gi|343960062|dbj|BAK63885.1| glycyl-tRNA synthetase [Pan troglod...   308   2e-81   Pan troglodytes
gi|90077472|dbj|BAE88416.1| unnamed protein product [Macaca fasc...   308   2e-81   
gi|350425387|ref|XP_003494106.1| PREDICTED: glycyl-tRNA syntheta...   308   2e-81   
gi|150261553|pdb|2Q5I|A Chain A, Crystal Structure Of Apo S581l ...   307   2e-81   
gi|344270462|ref|XP_003407063.1| PREDICTED: glycyl-tRNA syntheta...   307   2e-81   
gi|353241401|emb|CCA73218.1| probable glycine--tRNA ligase GRS1 ...   307   2e-81   
gi|426227745|ref|XP_004007976.1| PREDICTED: glycine--tRNA ligase...   307   2e-81   
gi|307213760|gb|EFN89098.1| Glycyl-tRNA synthetase [Harpegnathos...   307   2e-81   
gi|453083782|gb|EMF11827.1| glycyl-tRNA synthetase [Mycosphaerel...   307   2e-81   
gi|488522727|ref|XP_004453261.1| PREDICTED: glycine--tRNA ligase...   307   3e-81   
gi|330840876|ref|XP_003292434.1| hypothetical protein DICPUDRAFT...   307   3e-81   
gi|410909119|ref|XP_003968038.1| PREDICTED: glycine--tRNA ligase...   306   3e-81   
gi|193786641|dbj|BAG51964.1| unnamed protein product [Homo sapiens]   306   5e-81   
gi|148230983|ref|NP_001086647.1| glycyl-tRNA synthetase [Xenopus...   306   5e-81   
gi|512187030|gb|EPE02813.1| glycyl-trna synthetase [Ophiostoma p...   306   5e-81   
gi|348564424|ref|XP_003468005.1| PREDICTED: glycyl-tRNA syntheta...   306   6e-81   
gi|55926180|ref|NP_001007492.1| glycyl-tRNA synthetase [Xenopus ...   305   8e-81   
gi|390355874|ref|XP_784166.2| PREDICTED: glycine--tRNA ligase-li...   305   9e-81   
gi|149243239|pdb|2PMF|A Chain A, The Crystal Structure Of A Huma...   305   1e-80   
gi|317419952|emb|CBN81988.1| Glycyl-tRNA synthetase [Dicentrarch...   304   2e-80   
gi|334343652|ref|XP_001373658.2| PREDICTED: glycyl-tRNA syntheta...   304   3e-80   
gi|322792871|gb|EFZ16704.1| hypothetical protein SINV_11422 [Sol...   304   3e-80   
gi|270007232|gb|EFA03680.1| hypothetical protein TcasGA2_TC01378...   303   4e-80   
gi|189237111|ref|XP_971520.2| PREDICTED: similar to glycyl-tRNA ...   303   4e-80   
gi|147906063|ref|NP_001089920.1| uncharacterized protein LOC7349...   303   4e-80   
gi|291239384|ref|XP_002739603.1| PREDICTED: glycyl-tRNA syntheta...   302   7e-80   
gi|332020039|gb|EGI60490.1| Glycyl-tRNA synthetase [Acromyrmex e...   302   7e-80   
gi|348503632|ref|XP_003439368.1| PREDICTED: glycyl-tRNA syntheta...   302   8e-80   
gi|207340338|gb|EDZ68719.1| YPR081Cp-like protein [Saccharomyces...   302   1e-79   
gi|323346310|gb|EGA80600.1| Grs2p [Saccharomyces cerevisiae Lalv...   302   1e-79   
gi|326428548|gb|EGD74118.1| glycyl-tRNA synthetase [Salpingoeca ...   301   1e-79   
gi|349581887|dbj|GAA27044.1| K7_Grs2p [Saccharomyces cerevisiae ...   301   2e-79   
gi|195442338|ref|XP_002068915.1| GK17767 [Drosophila willistoni]...   301   2e-79   
gi|241852984|ref|XP_002415867.1| glycyl-tRNA synthetase, putativ...   301   2e-79   
gi|6325338|ref|NP_015406.1| putative glycine--tRNA ligase [Sacch...   301   2e-79   
gi|365762555|gb|EHN04089.1| Grs2p [Saccharomyces cerevisiae x Sa...   300   2e-79   
gi|194751574|ref|XP_001958100.1| GF23682 [Drosophila ananassae] ...   300   3e-79   
gi|323335160|gb|EGA76450.1| Grs2p [Saccharomyces cerevisiae Vin13]    300   4e-79   
gi|498967992|ref|XP_004546799.1| PREDICTED: glycine--tRNA ligase...   300   4e-79   
gi|242024910|ref|XP_002432869.1| glycyl-tRNA synthetase, putativ...   299   7e-79   
gi|114053191|ref|NP_001040293.1| glycine--tRNA ligase [Bombyx mo...   298   1e-78   
gi|256272201|gb|EEU07196.1| Grs2p [Saccharomyces cerevisiae JAY291]   298   1e-78   
gi|307179331|gb|EFN67695.1| Glycyl-tRNA synthetase [Camponotus f...   298   1e-78   
gi|327274313|ref|XP_003221922.1| PREDICTED: LOW QUALITY PROTEIN:...   298   2e-78   
gi|47223387|emb|CAG04248.1| unnamed protein product [Tetraodon n...   298   2e-78   
gi|1351153|sp|Q04451.2|SYG_BOMMO RecName: Full=Glycine--tRNA lig...   297   2e-78   
gi|321476578|gb|EFX87538.1| hypothetical protein DAPPUDRAFT_1922...   297   2e-78   
gi|340723169|ref|XP_003399968.1| PREDICTED: LOW QUALITY PROTEIN:...   297   3e-78   
gi|326495766|dbj|BAJ85979.1| predicted protein [Hordeum vulgare ...   296   5e-78   
gi|219116973|ref|XP_002179281.1| predicted protein [Phaeodactylu...   296   6e-78   
gi|443926198|gb|ELU44917.1| glycyl-tRNA synthetase 1 [Rhizoctoni...   295   1e-77   
gi|345319351|ref|XP_001521270.2| PREDICTED: glycyl-tRNA syntheta...   295   2e-77   
gi|443733481|gb|ELU17836.1| hypothetical protein CAPTEDRAFT_1718...   294   2e-77   
gi|159488381|ref|XP_001702190.1| hypothetical protein CHLREDRAFT...   294   2e-77   
gi|300122388|emb|CBK22959.2| unnamed protein product [Blastocyst...   293   3e-77   
gi|300122461|emb|CBK23032.2| Glycyl-tRNA synthetase [Blastocysti...   293   4e-77   
gi|167525699|ref|XP_001747184.1| hypothetical protein [Monosiga ...   293   4e-77   
gi|470606952|ref|XP_004314437.1| PREDICTED: LOW QUALITY PROTEIN:...   293   5e-77   
gi|340375142|ref|XP_003386096.1| PREDICTED: glycyl-tRNA syntheta...   293   6e-77   
gi|255071855|ref|XP_002499602.1| predicted protein [Micromonas s...   291   2e-76   
gi|66809557|ref|XP_638501.1| glycyl-tRNA synthetase [Dictyosteli...   290   3e-76   
gi|156397416|ref|XP_001637887.1| predicted protein [Nematostella...   290   3e-76   
gi|116206210|ref|XP_001228914.1| hypothetical protein CHGG_02398...   289   7e-76   
gi|256078308|ref|XP_002575438.1| glycyl-tRNA synthetase [Schisto...   289   7e-76   
gi|452840956|gb|EME42893.1| hypothetical protein DOTSEDRAFT_4497...   289   8e-76   
gi|378755398|gb|EHY65425.1| glycyl-tRNA synthetase [Nematocida s...   288   1e-75   
gi|66359666|ref|XP_627011.1| glycyl-tRNA synthetase [Cryptospori...   288   2e-75   
gi|67588167|ref|XP_665340.1| glycyl-tRNA synthetase [Cryptospori...   287   2e-75   
gi|510902245|ref|XP_004829769.1| glycyl-tRNA synthetase, putativ...   286   4e-75   
gi|403220806|dbj|BAM38939.1| glycyl-tRNA synthetase [Theileria o...   286   6e-75   
gi|356527475|ref|XP_003532335.1| PREDICTED: glycyl-tRNA syntheta...   286   6e-75   
gi|501294352|dbj|BAN20718.1| hypothetical protein [Riptortus ped...   285   8e-75   
gi|302843196|ref|XP_002953140.1| hypothetical protein VOLCADRAFT...   285   1e-74   
gi|397636645|gb|EJK72358.1| hypothetical protein THAOC_06118 [Th...   285   1e-74   
gi|449673398|ref|XP_004207946.1| PREDICTED: glycine--tRNA ligase...   285   2e-74   
gi|449673396|ref|XP_002157134.2| PREDICTED: glycine--tRNA ligase...   285   2e-74   
gi|326501058|dbj|BAJ98760.1| predicted protein [Hordeum vulgare ...   284   2e-74   
gi|475622337|gb|EMT31842.1| Glycyl-tRNA synthetase 1, mitochondr...   284   3e-74   
gi|460410549|ref|XP_004250689.1| PREDICTED: glycine--tRNA ligase...   283   4e-74   
gi|196016607|ref|XP_002118155.1| hypothetical protein TRIADDRAFT...   283   5e-74   
gi|115477547|ref|NP_001062369.1| Os08g0538000 [Oryza sativa Japo...   283   6e-74   
gi|402587134|gb|EJW81070.1| glycyl-tRNA synthetase [Wuchereria b...   283   6e-74   
gi|357148650|ref|XP_003574845.1| PREDICTED: glycyl-tRNA syntheta...   283   6e-74   
gi|293336836|ref|NP_001169639.1| uncharacterized protein LOC1003...   282   8e-74   
gi|414587474|tpg|DAA38045.1| TPA: hypothetical protein ZEAMMB73_...   281   1e-73   
gi|414869731|tpg|DAA48288.1| TPA: hypothetical protein ZEAMMB73_...   281   2e-73   
gi|242072850|ref|XP_002446361.1| hypothetical protein SORBIDRAFT...   281   2e-73   
gi|449526656|ref|XP_004170329.1| PREDICTED: LOW QUALITY PROTEIN:...   280   5e-73   
gi|224053571|ref|XP_002297878.1| predicted protein [Populus tric...   280   6e-73   
gi|474389510|gb|EMS65218.1| Glycyl-tRNA synthetase 1, mitochondr...   279   6e-73   
gi|502127199|ref|XP_004499600.1| PREDICTED: glycine--tRNA ligase...   279   6e-73   
gi|297734516|emb|CBI15763.3| unnamed protein product [Vitis vini...   279   7e-73   
gi|225456501|ref|XP_002280957.1| PREDICTED: glycyl-tRNA syntheta...   279   7e-73   
gi|387597467|gb|EIJ95087.1| glycyl-tRNA synthetase [Nematocida p...   279   8e-73   
gi|460380205|ref|XP_004235848.1| PREDICTED: glycine--tRNA ligase...   279   9e-73   
gi|449470277|ref|XP_004152844.1| PREDICTED: glycine--tRNA ligase...   278   1e-72   
gi|507107576|emb|CDF41030.1| unnamed protein product [Chondrus c...   278   1e-72   
gi|242082049|ref|XP_002445793.1| hypothetical protein SORBIDRAFT...   278   1e-72   
gi|145349033|ref|XP_001418945.1| predicted protein [Ostreococcus...   278   2e-72   
gi|156083086|ref|XP_001609027.1| glycyl-tRNA synthetase [Babesia...   278   2e-72   
gi|482575626|gb|EOA39813.1| hypothetical protein CARUB_v10008480...   278   2e-72   
gi|357622115|gb|EHJ73716.1| glycyl-tRNA synthetase [Danaus plexi...   277   2e-72   
gi|308806117|ref|XP_003080370.1| putative glycyl-tRNA synthetase...   277   2e-72   
gi|387592190|gb|EIJ87214.1| glycyl-tRNA synthetase [Nematocida p...   277   3e-72   
gi|223994633|ref|XP_002287000.1| glycyl tRNA synthetase [Thalass...   277   3e-72   
gi|313760928|gb|ADR79441.1| glycyl-tRNA synthetase-like protein ...   277   3e-72   
gi|313760923|gb|ADR79437.1| glycyl-tRNA synthetase-like protein ...   277   3e-72   
gi|170582349|ref|XP_001896091.1| glycyl-tRNA synthetase [Brugia ...   276   4e-72   
gi|15292923|gb|AAK92832.1| putative glycyl tRNA synthetase [Arab...   276   4e-72   
gi|18397278|ref|NP_564337.1| glycyl-tRNA synthetase / glycine--t...   276   4e-72   
gi|222628790|gb|EEE60922.1| hypothetical protein OsJ_14640 [Oryz...   276   4e-72   
gi|470323282|ref|XP_004349457.1| glycyl-tRNA synthetase [Capsasp...   276   5e-72   
gi|508707712|gb|EOX99608.1| Glycyl-tRNA synthetase / glycine--tR...   276   5e-72   
gi|224075451|ref|XP_002304639.1| predicted protein [Populus tric...   276   6e-72   
gi|21592545|gb|AAM64494.1| glycyl tRNA synthetase, putative [Ara...   276   7e-72   
gi|38347165|emb|CAE05155.2| OSJNBa0039C07.11 [Oryza sativa Japon...   275   8e-72   
gi|218194779|gb|EEC77206.1| hypothetical protein OsI_15722 [Oryz...   275   8e-72   
gi|116309463|emb|CAH66534.1| H0209H04.1 [Oryza sativa Indica Group]   275   9e-72   
gi|470245525|ref|XP_004356903.1| glycyl-tRNA synthetase [Dictyos...   275   1e-71   
gi|297851412|ref|XP_002893587.1| glycyl-tRNA synthetase [Arabido...   275   1e-71   
gi|462418842|gb|EMJ23105.1| hypothetical protein PRUPE_ppa001964...   275   1e-71   
gi|384246346|gb|EIE19836.1| glycyl-tRNA synthetase [Coccomyxa su...   275   1e-71   
gi|224285368|gb|ACN40407.1| unknown [Picea sitchensis]                275   1e-71   
gi|470515328|ref|XP_004352908.1| glycine-tRNA ligase [Acanthamoe...   275   2e-71   
gi|294892656|ref|XP_002774168.1| glycyl-tRNA synthetase, putativ...   274   3e-71   
gi|452823887|gb|EME30894.1| glycyl-tRNA synthetase [Galdieria su...   273   3e-71   
gi|326511363|dbj|BAJ87695.1| predicted protein [Hordeum vulgare ...   273   3e-71   
gi|168059486|ref|XP_001781733.1| predicted protein [Physcomitrel...   273   4e-71   
gi|405971144|gb|EKC35998.1| Glycyl-tRNA synthetase [Crassostrea ...   272   7e-71   
gi|470149448|ref|XP_004310250.1| PREDICTED: glycine--tRNA ligase...   272   9e-71   
gi|7507632|pir||T16843 hypothetical protein T10F2.1 - Caenorhabd...   272   1e-70
gi|32564541|ref|NP_871640.1| Protein GARS-1, isoform b [Caenorha...   272   1e-70   
gi|17554996|ref|NP_498093.1| Protein GARS-1, isoform a [Caenorha...   271   1e-70   
gi|412991132|emb|CCO15977.1| glycyl-tRNA synthetase [Bathycoccus...   271   1e-70   
gi|301121300|ref|XP_002908377.1| glycyl-tRNA synthetase [Phytoph...   271   2e-70   
gi|508775405|gb|EOY22661.1| Glycyl-tRNA synthetase / glycine--tR...   270   3e-70   
gi|302761720|ref|XP_002964282.1| hypothetical protein SELMODRAFT...   270   3e-70   
gi|312077807|ref|XP_003141464.1| glycyl-tRNA synthetase [Loa loa...   270   5e-70   
gi|302815693|ref|XP_002989527.1| hypothetical protein SELMODRAFT...   270   5e-70   
gi|307110228|gb|EFN58464.1| hypothetical protein CHLNCDRAFT_3406...   269   7e-70   
gi|221060322|ref|XP_002260806.1| glycyl-tRNA synthetase [Plasmod...   266   5e-69   
gi|317106616|dbj|BAJ53123.1| JHL07K02.13 [Jatropha curcas]            266   5e-69   
gi|341895610|gb|EGT51545.1| CBN-GARS-1 protein [Caenorhabditis b...   266   7e-69   
gi|348681169|gb|EGZ20985.1| hypothetical protein PHYSODRAFT_5422...   265   1e-68   
gi|482565810|gb|EOA29999.1| hypothetical protein CARUB_v10013104...   265   1e-68   
gi|303277857|ref|XP_003058222.1| predicted protein [Micromonas p...   265   2e-68   
gi|297818950|ref|XP_002877358.1| hypothetical protein ARALYDRAFT...   264   3e-68   
gi|402470714|gb|EJW04825.1| glycine-tRNA ligase [Edhazardia aedi...   263   6e-68   
gi|399217364|emb|CCF74251.1| unnamed protein product [Babesia mi...   262   9e-68   
gi|84999162|ref|XP_954302.1| glycyl-tRNA synthetase  [Theileria ...   262   1e-67   
gi|221506889|gb|EEE32506.1| glycyl-tRNA synthetase, putative [To...   261   1e-67   
gi|471562761|gb|EMR64208.1| putative glycyl-trna synthetase prot...   261   2e-67   
gi|221487207|gb|EEE25453.1| glycyl-tRNA synthetase, putative [To...   261   2e-67   
gi|237831297|ref|XP_002364946.1| glycyl-tRNA synthetase, putativ...   261   2e-67   
gi|385301391|gb|EIF45583.1| glycyl-trna synthetase 1 [Dekkera br...   261   2e-67   
gi|473789702|gb|EMS46310.1| Glycyl-tRNA synthetase 1, mitochondr...   261   3e-67   
gi|308459706|ref|XP_003092168.1| CRE-GARS-1 protein [Caenorhabdi...   259   5e-67   
gi|296085531|emb|CBI29263.3| unnamed protein product [Vitis vini...   259   6e-67   
gi|225425272|ref|XP_002267943.1| PREDICTED: glycyl-tRNA syntheta...   259   6e-67   
gi|355560719|gb|EHH17405.1| Glycyl-tRNA synthetase [Macaca mulatta]   258   2e-66   
gi|313212317|emb|CBY36313.1| unnamed protein product [Oikopleura...   258   2e-66   
gi|268572551|ref|XP_002648989.1| C. briggsae CBR-GRS-1 protein [...   258   2e-66   
gi|403367190|gb|EJY83407.1| Glycyl-tRNA synthetase [Oxytricha tr...   257   3e-66   
gi|313229967|emb|CBY07672.1| unnamed protein product [Oikopleura...   257   3e-66   
gi|449015580|dbj|BAM78982.1| glycine--tRNA ligase, class II [Cya...   257   4e-66   
gi|401407584|ref|XP_003883241.1| tRNA synthetase Gly, related [N...   257   4e-66   
gi|457875831|ref|XP_004224441.1| glycine-tRNA ligase [Plasmodium...   256   5e-66   
gi|298705939|emb|CBJ29069.1| Glycyl-tRNA Synthetase [Ectocarpus ...   254   2e-65   
gi|82914985|ref|XP_728923.1| glycyl-tRNA synthetase [Plasmodium ...   254   2e-65   
gi|157877289|ref|XP_001686967.1| putative glycyl tRNA synthetase...   254   3e-65   
gi|302801640|ref|XP_002982576.1| hypothetical protein SELMODRAFT...   253   4e-65   
gi|154346178|ref|XP_001569026.1| putative glycyl tRNA synthetase...   253   4e-65   
gi|302798685|ref|XP_002981102.1| hypothetical protein SELMODRAFT...   253   4e-65   
gi|146103730|ref|XP_001469631.1| putative glycyl tRNA synthetase...   253   5e-65   
gi|398024712|ref|XP_003865517.1| glycyl tRNA synthetase, putativ...   253   5e-65   
gi|167377346|ref|XP_001734365.1| glycyl-tRNA synthetase [Entamoe...   253   7e-65   
gi|401420502|ref|XP_003874740.1| putative glycyl tRNA synthetase...   251   2e-64   
gi|169612057|ref|XP_001799446.1| hypothetical protein SNOG_09144...   251   2e-64   
gi|71032677|ref|XP_765980.1| glycyl-tRNA synthetase [Theileria p...   251   2e-64   
gi|472458479|gb|EMS12500.1| glycyl-tRNA synthetase, putative [En...   251   2e-64   
gi|407036878|gb|EKE38370.1| glycine--tRNA ligase [Entamoeba nutt...   251   2e-64   
gi|258597698|ref|XP_001348371.2| glycine-tRNA ligase, putative [...   250   3e-64   
gi|344249093|gb|EGW05197.1| Glycyl-tRNA synthetase [Cricetulus g...   250   4e-64   
gi|159112161|ref|XP_001706310.1| Glycyl-tRNA synthetase [Giardia...   249   6e-64   
gi|308158015|gb|EFO60895.1| Glycyl-tRNA synthetase [Giardia lamb...   248   2e-63   
gi|67482754|ref|XP_656678.1| glycyl-tRNA synthetase [Entamoeba h...   247   3e-63   
gi|449704469|gb|EMD44704.1| glycyl-tRNA synthetase, putative [En...   247   3e-63   
gi|482552030|gb|EOA16223.1| hypothetical protein CARUB_v10004365...   247   3e-63   
gi|156102126|ref|XP_001616756.1| glycine-tRNA ligase [Plasmodium...   247   4e-63   
gi|253743717|gb|EET00043.1| Glycyl-tRNA synthetase [Giardia inte...   246   6e-63   
gi|297801992|ref|XP_002868880.1| hypothetical protein ARALYDRAFT...   246   6e-63   
gi|325179649|emb|CCA14047.1| glycyltRNA synthetase putative [Alb...   246   8e-63   
gi|255543218|ref|XP_002512672.1| glycyl-tRNA synthetase, putativ...   243   4e-62   
gi|145518031|ref|XP_001444893.1| hypothetical protein [Parameciu...   243   4e-62   
gi|407399778|gb|EKF28421.1| glycyl-tRNA synthetase, putative [Tr...   243   5e-62   
gi|340059161|emb|CCC53544.1| putative glycyl-tRNA synthetase [Tr...   241   2e-61   
gi|407837786|gb|EKF99851.1| glycyl-tRNA synthetase, putative [Tr...   241   2e-61   
gi|209876788|ref|XP_002139836.1| glycyl-tRNA synthetase  [Crypto...   241   2e-61   
gi|145506787|ref|XP_001439354.1| hypothetical protein [Parameciu...   240   4e-61   
gi|71756227|ref|XP_829028.1| glycyl-tRNA synthetase [Trypanosoma...   239   6e-61   
gi|261334969|emb|CBH17963.1| glycyl-tRNA synthetase, putative [T...   239   6e-61   
gi|212544894|ref|XP_002152601.1| glycyl-tRNA synthetase, putativ...   239   6e-61   
gi|290985788|ref|XP_002675607.1| Glycyl-tRNA synthetase [Naegler...   239   7e-61   
gi|71414089|ref|XP_809159.1| glycyl-tRNA synthetase [Trypanosoma...   239   9e-61   
gi|428165049|gb|EKX34055.1| hypothetical protein GUITHDRAFT_1760...   238   2e-60   
gi|428165050|gb|EKX34056.1| glycyl-tRNA synthetase, PPC-targeted...   238   2e-60   
gi|485643671|gb|EOD37663.1| glycyl-tRNA synthetase [Emiliania hu...   238   2e-60   
gi|471201902|ref|XP_004257784.1| glycyl-tRNA synthetase, putativ...   237   3e-60   
gi|323331329|gb|EGA72747.1| Grs2p [Saccharomyces cerevisiae AWRI...   236   5e-60   
gi|323448245|gb|EGB04146.1| hypothetical protein AURANDRAFT_3914...   235   1e-59   
gi|118358180|ref|XP_001012338.1| glycyl-tRNA synthetase family p...   234   3e-59   
gi|339242615|ref|XP_003377233.1| glycyl-tRNA synthetase [Trichin...   233   5e-59   
gi|428165051|gb|EKX34057.1| glycyl-tRNA synthetase [Guillardia t...   232   1e-58   
gi|342186057|emb|CCC95542.1| unnamed protein product [Trypanosom...   232   1e-58   
gi|134084000|emb|CAK49155.1| unnamed protein product [Aspergillu...   230   3e-58   
gi|428185489|gb|EKX54341.1| hypothetical protein GUITHDRAFT_9981...   229   1e-57   
gi|19074790|ref|NP_586296.1| GLYCYL-tRNA SYNTHETASE [Encephalito...   227   4e-57   
gi|449330319|gb|AGE96576.1| glycyl-tRNA synthetase [Encephalitoz...   227   4e-57   
gi|308464759|ref|XP_003094644.1| hypothetical protein CRE_31457 ...   226   7e-57   
gi|256810410|ref|YP_003127779.1| glycyl-tRNA synthetase [Methano...   224   2e-56   
gi|289193291|ref|YP_003459232.1| glycyl-tRNA synthetase [Methano...   224   3e-56   
gi|328713386|ref|XP_003245057.1| PREDICTED: glycyl-tRNA syntheta...   223   4e-56   


>gi|384496179|gb|EIE86670.1| glycyl-tRNA synthetase [Rhizopus delemar RA 99-880]
          Length = 637

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 227/298 (76%), Gaps = 4/298 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFLTK+GIKPDRLRFRQHM NEMAHYACDCWDA+I  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIHLFLTKIGIKPDRLRFRQHMDNEMAHYACDCWDAEIKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLVVRE LAEP   +   +EINKK FGPK ++ +K VE+ L S          
Sbjct: 402 HSKRTGEKLVVREQLAEPRTVELWQVEINKKTFGPKFKKEAKAVEETLMSLSEEQYAQLA 461

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G G+ +V   +G ++EI+ + +T+KR T TEHVREYTPNVIEPSFGIGRILYSL
Sbjct: 462 KDLESSGAGSVEV---NGQKFEISQDNVTVKRGTVTEHVREYTPNVIEPSFGIGRILYSL 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W R+DDE R+VLSFPP VAPFKC L+PLS N  F   V + ++ +R+  ++I+ D
Sbjct: 519 LEHSWWVREDDEARNVLSFPPVVAPFKCCLLPLSGNAVFEPFVRKFSRELRQAGVSIRTD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           DS  SIGRRYARNDELG P+AITIDF +V D T+TLRERDSTKQIR+  + IL++LKD
Sbjct: 579 DSKASIGRRYARNDELGIPYAITIDFDTVEDNTVTLRERDSTKQIRDTFENILKILKD 636



>gi|328773234|gb|EGF83271.1| hypothetical protein BATDEDRAFT_18426 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 699

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 233/327 (71%), Gaps = 7/327 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL ++GI P R+RFRQH+ NEMAHYACDCWDA+I +SYGWIE VGCADRSA+DLT 
Sbjct: 371 RIYLFLVRIGIDPARIRFRQHLANEMAHYACDCWDAEIKSSYGWIESVGCADRSAFDLTA 430

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYL-------TSXXX 113
           HS +T EKLV R+ L EP+I D  +LEINK  FGP  ++++K V+ Y        +S   
Sbjct: 431 HSKKTGEKLVARDTLPEPIIRDALILEINKSKFGPAFKKDAKAVQGYFDALVVGSSSEWD 490

Query: 114 XXXXXXXXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIG 173
                        N   +V GTDG QY++T++ +++ ++T    VREYTPNVIEPSFGIG
Sbjct: 491 QVKLAEIDAQLKANSFVQVTGTDGKQYKVTADMISVVQKTIKISVREYTPNVIEPSFGIG 550

Query: 174 RILYSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLS 233
           RILY+L+EH Y+ R+ DEQR+V  FP  VAP K L+ P+SNN  F+  + E+   +R+  
Sbjct: 551 RILYALLEHSYYVRESDEQRAVFKFPASVAPIKALVAPISNNAEFSPFIKEIVASLRRSG 610

Query: 234 IAIKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQ 293
           +A KVDDS++SIGRRYARNDELGTPFAITIDFQ+V D+T+TLRERD+ KQIR  I  I++
Sbjct: 611 VANKVDDSTSSIGRRYARNDELGTPFAITIDFQTVQDKTVTLRERDTIKQIRSTIPIIVE 670

Query: 294 VLKDLLEESTTWEKVMETYPTFTQQEL 320
           ++ +L+E   TWE VM  +P F  QEL
Sbjct: 671 IVHNLVEGRITWEDVMAKHPAFVAQEL 697



>gi|511009370|gb|EPB90614.1| glycyl-tRNA synthetase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 638

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/296 (62%), Positives = 222/296 (75%), Gaps = 4/296 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GIK DRLRFRQHM NEMAHYACDCWDA+IH SYGWIECVGCADRSAYDL+V
Sbjct: 342 RIYQFLDKIGIKGDRLRFRQHMDNEMAHYACDCWDAEIHTSYGWIECVGCADRSAYDLSV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXX-XXXX 119
           HS RT EKLVVRE LAEP   +   +EINKK FGPK ++++K VE+ L +          
Sbjct: 402 HSKRTGEKLVVREQLAEPRTVELWQVEINKKTFGPKYKKDAKAVEEALMALSEDQYAQLA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G G+ +V   +G   E+  E +T+KR T TEHVREYTPNVIEPSFGIGRILYSL
Sbjct: 462 KDLEANGVGSVQV---NGQSVEVGKENVTVKRGTVTEHVREYTPNVIEPSFGIGRILYSL 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W R+DDE R+VLSFP  VAPFKC L+PLS N AF  LV + ++ +RK  ++++ D
Sbjct: 519 LEHSWWVREDDEARNVLSFPTVVAPFKCCLLPLSGNAAFEPLVRKYSRELRKAGVSLRTD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVL 295
           DS  SIGRRYARNDELG P+AITIDF +V D T+TLRERDSTKQIR+  + IL+ L
Sbjct: 579 DSKASIGRRYARNDELGIPYAITIDFDTVQDGTVTLRERDSTKQIRDTFENILKTL 634



>gi|259482954|tpe|CBF77921.1| TPA: glycyl-tRNA synthetase (AFU_orthologue; AFUA_5G05920)
           [Aspergillus nidulans FGSC A4]
          Length = 689

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/321 (57%), Positives = 231/321 (71%), Gaps = 12/321 (3%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYACDCWDA+++ SYGWIECVGCADRSAYDL V
Sbjct: 381 RIQLFLLKLGVDPTKLRFRQHMANEMAHYACDCWDAELYTSYGWIECVGCADRSAYDLNV 440

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  +E++KK FGP+ +++ KTVE  + +          
Sbjct: 441 HKNKTGAPLVVRETRAEPLKVEEWQIELDKKKFGPRFKKDGKTVEAAIDA---LSQELRE 497

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D   T K+              +TI+++T  E+VREYTPNVIEPSFGIGRILYSL+
Sbjct: 498 KLALDLEKTGKIE---------VGYIITIEKRTRVENVREYTPNVIEPSFGIGRILYSLM 548

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EHVY+ R+ DE R VLSFPP +AP K LLVPLS+NPAF  +V EL  ++R+L ++ +VDD
Sbjct: 549 EHVYYYREGDEARGVLSFPPVIAPTKVLLVPLSSNPAFRPMVQELTTKLRRLGVSSRVDD 608

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG+RYARNDELGTPF +T+DFQSV D TITLR+RDSTKQ+R + + ILQ LK L+E
Sbjct: 609 SSASIGKRYARNDELGTPFGVTVDFQSVKDNTITLRDRDSTKQVRASQEEILQALKSLVE 668

Query: 301 ESTTWEKVMETYPTFTQQELD 321
              TWE V +  P FT QE+D
Sbjct: 669 GEETWEDVRKRLPEFTGQEVD 689



>gi|67903696|ref|XP_682104.1| hypothetical protein AN8835.2 [Aspergillus nidulans FGSC A4]
 gi|40740933|gb|EAA60123.1| hypothetical protein AN8835.2 [Aspergillus nidulans FGSC A4]
          Length = 1309

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/320 (57%), Positives = 230/320 (71%), Gaps = 12/320 (3%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYACDCWDA+++ SYGWIECVGCADRSAYDL V
Sbjct: 334 RIQLFLLKLGVDPTKLRFRQHMANEMAHYACDCWDAELYTSYGWIECVGCADRSAYDLNV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  +E++KK FGP+ +++ KTVE  + +          
Sbjct: 394 HKNKTGAPLVVRETRAEPLKVEEWQIELDKKKFGPRFKKDGKTVEAAIDA---LSQELRE 450

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D   T K+              +TI+++T  E+VREYTPNVIEPSFGIGRILYSL+
Sbjct: 451 KLALDLEKTGKIE---------VGYIITIEKRTRVENVREYTPNVIEPSFGIGRILYSLM 501

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EHVY+ R+ DE R VLSFPP +AP K LLVPLS+NPAF  +V EL  ++R+L ++ +VDD
Sbjct: 502 EHVYYYREGDEARGVLSFPPVIAPTKVLLVPLSSNPAFRPMVQELTTKLRRLGVSSRVDD 561

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG+RYARNDELGTPF +T+DFQSV D TITLR+RDSTKQ+R + + ILQ LK L+E
Sbjct: 562 SSASIGKRYARNDELGTPFGVTVDFQSVKDNTITLRDRDSTKQVRASQEEILQALKSLVE 621

Query: 301 ESTTWEKVMETYPTFTQQEL 320
              TWE V +  P FT QEL
Sbjct: 622 GEETWEDVRKRLPEFTGQEL 641



>gi|213403660|ref|XP_002172602.1| glycyl-tRNA synthetase [Schizosaccharomyces japonicus yFS275]
 gi|212000649|gb|EEB06309.1| glycyl-tRNA synthetase [Schizosaccharomyces japonicus yFS275]
          Length = 653

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/317 (56%), Positives = 228/317 (71%), Gaps = 4/317 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI  +R+RFRQHM NEMAHYACDCWDA+IH SYGWIECVGCADRSAYDL+V
Sbjct: 334 RIYEFLKKIGIDMNRVRFRQHMSNEMAHYACDCWDAEIHCSYGWIECVGCADRSAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS  TK  L+V+E LAEP++ D+ V+E+NKK FGPK ++++K VE+ + +          
Sbjct: 394 HSAATKTPLIVQEKLAEPIVVDEFVVEVNKKKFGPKFKRDAKAVEEAMLAWTQAERQAKA 453

Query: 121 XXXXDGNGTTKVP-GTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                   T K+P   +G  + + SE +TI++Q  TEH+R Y PNVIEPSFG+GRILY L
Sbjct: 454 EELAS---TGKIPVSVNGVNFVVESELVTIEKQKRTEHIRSYIPNVIEPSFGLGRILYVL 510

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YWTR +D  R VLSFPP VAP K L+VPLS N  F  LV +L+ ++R+  I+ KVD
Sbjct: 511 MEHSYWTRPEDVNRGVLSFPPAVAPIKALIVPLSKNAEFDPLVRQLSAKLRRNGISNKVD 570

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS+ +IGRRYARNDELGTPF IT+DF S+ D T+TLRERDSTKQIR   D I+  L  L+
Sbjct: 571 DSNANIGRRYARNDELGTPFGITVDFDSLKDNTVTLRERDSTKQIRGTDDEIVATLVQLI 630

Query: 300 EESTTWEKVMETYPTFT 316
              TTW +V++ +  FT
Sbjct: 631 AGHTTWSEVLDKFGEFT 647



>gi|350634078|gb|EHA22442.1| hypothetical protein ASPNIDRAFT_57294 [Aspergillus niger ATCC 1015]
          Length = 656

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKLGVDPKKLRFRQHMANEMAHYATDCWDAELHTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ KTV   + +          
Sbjct: 395 HKNKTGAPLVVRETRAEPLKVEEWQIDLDKKKFGPRFKKDGKTVTAAIDALSQELREKLS 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G    +V G  G + E+  E + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 455 LDLEQTGKIEVEVEGVAGGKVELDKELIKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IE VYW+R+ DE R VLSFPP +AP K L+VPLS + +F  LV  L  ++R++ ++ +VD
Sbjct: 515 IEQVYWSREGDEARGVLSFPPAIAPTKVLIVPLSTHQSFAPLVQRLTTKLRRMGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF +T+DFQSV D T TLR+RDSTKQ+R + D I Q +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGVTVDFQSVKDNTFTLRDRDSTKQVRASEDEIAQAIKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P FT QE++
Sbjct: 635 EGEETWEDVRKRLPEFTGQEVE 656



>gi|470316809|gb|EMR08547.1| glycyl-tRNA synthetase [Pneumocystis murina B123]
          Length = 656

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/321 (57%), Positives = 233/321 (72%), Gaps = 1/321 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+  ++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADR+AYDLTV
Sbjct: 326 RIHLFLIKIGVNKNKLRFRQHMRNEMAHYASDCWDAELLTSYGWIECVGCADRAAYDLTV 385

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS++TKEKLVVRE L++PM   + V+ ++KK  GP L+++ K VE  ++S          
Sbjct: 386 HSDKTKEKLVVRELLSKPMEVKEWVVTVDKKKIGPLLKKDLKVVEQAISSWSNEDKIRYR 445

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G   V   DG Q+EI S   TI++   T  VREY PNVIEPSFGIGRILYSLI
Sbjct: 446 DQAV-SEGKIVVKVADGRQFEIPSSLFTIEQVKKTISVREYIPNVIEPSFGIGRILYSLI 504

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R DD  R VLSF P VAP KCLLVPLSNN AF  ++D+L+  +R+L I+ KVDD
Sbjct: 505 EHSYWIRSDDIDRCVLSFLPIVAPVKCLLVPLSNNSAFDPIIDKLSSELRRLGISYKVDD 564

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IGRRY+RNDELGTPF IT+DFQ+VND ++TLRERD+TKQIR +   IL+V+K+L E
Sbjct: 565 SSAAIGRRYSRNDELGTPFGITVDFQTVNDGSLTLRERDTTKQIRASEKEILKVVKELSE 624

Query: 301 ESTTWEKVMETYPTFTQQELD 321
              +W+ V++ +P F +Q  D
Sbjct: 625 GLISWDDVLKDFPIFNKQNTD 645



>gi|317036964|ref|XP_001398427.2| glycyl-tRNA synthetase 1 [Aspergillus niger CBS 513.88]
          Length = 738

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDLTV
Sbjct: 417 RIQLFLLKLGVDPKKLRFRQHMANEMAHYATDCWDAELHTSYGWIECVGCADRSAYDLTV 476

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ KTV   + +          
Sbjct: 477 HKNKTGAPLVVRETRAEPLKVEEWQIDLDKKKFGPRFKKDGKTVTAAIDALSQELREKLS 536

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G    +V G  G + E+  E + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 537 LDLEQTGKIEVEVEGVAGGKVELDKELIKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 596

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IE VYW+R+ DE R VLSFPP +AP K L+VPLS + +F  LV  L  ++R++ ++ +VD
Sbjct: 597 IEQVYWSREGDEARGVLSFPPAIAPTKVLIVPLSTHQSFAPLVQRLTTKLRRMGVSNRVD 656

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF +T+DFQSV D T TLR+RDSTKQ+R + D I Q +K L+
Sbjct: 657 DSSASIGKRYARNDELGTPFGVTVDFQSVKDNTFTLRDRDSTKQVRASEDEIAQAIKSLV 716

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P FT QE++
Sbjct: 717 EGEETWEDVRKRLPEFTGQEVE 738



>gi|238503462|ref|XP_002382964.1| glycyl-tRNA synthetase [Aspergillus flavus NRRL3357]
 gi|317138713|ref|XP_001817091.2| glycyl-tRNA synthetase 1 [Aspergillus oryzae RIB40]
 gi|220690435|gb|EED46784.1| glycyl-tRNA synthetase [Aspergillus flavus NRRL3357]
 gi|391863449|gb|EIT72760.1| Glycyl-tRNA synthetase [Aspergillus oryzae 3.042]
          Length = 708

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/322 (55%), Positives = 227/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 387 RIQLFLLKLGVDPAKLRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 446

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ KTV   + +          
Sbjct: 447 HKNKTGAPLVVREPRAEPLKIEEWQVDLDKKKFGPRFKKDGKTVAAAVEALSQELREKLA 506

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G     V G    + E+  E + I+++T  E+VREYTPNVIEPSFGIGRILYS 
Sbjct: 507 LDLEQQGKIEVDVEGVSSGKVELDKELIKIEKRTRVENVREYTPNVIEPSFGIGRILYST 566

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP +AP K L+VPLSN+ +F  L   L  ++R++ I+ +VD
Sbjct: 567 LEHVYWSREGDEARGVLSFPPAIAPTKVLIVPLSNHASFRPLSHRLMMKMRRMGISNRVD 626

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDSTKQ+R + D ILQ LK L+
Sbjct: 627 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSTKQVRASEDEILQALKSLV 686

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE + +  P FT QE+D
Sbjct: 687 EGDETWEDIRKRLPEFTGQEVD 708



>gi|83764945|dbj|BAE55089.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 656

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/322 (55%), Positives = 227/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKLGVDPAKLRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ KTV   + +          
Sbjct: 395 HKNKTGAPLVVREPRAEPLKIEEWQVDLDKKKFGPRFKKDGKTVAAAVEALSQELREKLA 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G     V G    + E+  E + I+++T  E+VREYTPNVIEPSFGIGRILYS 
Sbjct: 455 LDLEQQGKIEVDVEGVSSGKVELDKELIKIEKRTRVENVREYTPNVIEPSFGIGRILYST 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP +AP K L+VPLSN+ +F  L   L  ++R++ I+ +VD
Sbjct: 515 LEHVYWSREGDEARGVLSFPPAIAPTKVLIVPLSNHASFRPLSHRLMMKMRRMGISNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDSTKQ+R + D ILQ LK L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSTKQVRASEDEILQALKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE + +  P FT QE+D
Sbjct: 635 EGDETWEDIRKRLPEFTGQEVD 656



>gi|402216494|gb|EJT96581.1| glycyl-tRNA synthetase [Dacryopinax sp. DJM-731 SS1]
          Length = 661

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 230/316 (72%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLT++GI P RLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDL+V
Sbjct: 342 RIYLFLTRIGINPARLRFRQHMKNEMAHYAADCWDAEIHTSYGWIECVGCADRSAYDLSV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T +KLVVR+ L +P+I ++   EI KK+FGP+ ++++K VED + +          
Sbjct: 402 HSKKTGQKLVVRQALPDPIIVERWTAEIEKKLFGPRFKKDAKAVEDAIMALDEPRLVLLN 461

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G TK+   DG ++EITS+ LTI+++TF E VRE+TPNVIEPSFG+GRILYSL+
Sbjct: 462 GELV--KGPTKLKLDDGREFEITSDLLTIQKKTFKETVREFTPNVIEPSFGLGRILYSLL 519

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EHV+W R+ DE R VLS P  VAP K L+VP+S+N  FT  + +++ ++RK  +A +VDD
Sbjct: 520 EHVFWCRESDEARGVLSLPSVVAPIKALIVPISSNEVFTPFIRQISAQLRKAGVACRVDD 579

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG+RY+RNDELGTPF IT+DF +V + T+TLRERD+T Q     + ++ ++ DL++
Sbjct: 580 SSASIGKRYSRNDELGTPFGITVDFATVQNGTLTLRERDTTDQRIGKTEEVISLVIDLVD 639

Query: 301 ESTTWEKVMETYPTFT 316
               W +  E  P +T
Sbjct: 640 GRIDWAQACEKLPAYT 655



>gi|115438430|ref|XP_001218064.1| glycyl-tRNA synthetase 1 [Aspergillus terreus NIH2624]
 gi|114188879|gb|EAU30579.1| glycyl-tRNA synthetase 1 [Aspergillus terreus NIH2624]
          Length = 656

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDL+V
Sbjct: 335 RIQLFLLKLGVDPTKLRFRQHMANEMAHYAADCWDAELHTSYGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE   EP+  ++  ++++KK FGP+ +++ K V   + +          
Sbjct: 395 HKNKTGAPLVVRELRPEPLKVEEWQIDLDKKKFGPRFKKDGKAVAAAIDALSQELREKLA 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G     V G    + E+  + +TI+++T  E+VREYTPNVIEPSFGIGRI YSL
Sbjct: 455 LDLEQQGKIEVDVEGVGSGKVELDKDIVTIEKRTRVENVREYTPNVIEPSFGIGRIFYSL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEHVYW+R+ DE R VLSFPP +AP K L+VPLS + +F  L   L  ++R++ I+ +VD
Sbjct: 515 IEHVYWSREGDEARGVLSFPPVIAPTKVLIVPLSTHASFKPLSQRLMMKLRRMGISNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDSTKQ+R + D I+Q LK L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSTKQVRASEDEIVQALKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P FT QE+D
Sbjct: 635 EGEETWEDVRKRLPEFTGQEVD 656



>gi|70998636|ref|XP_754040.1| glycyl-tRNA synthetase [Aspergillus fumigatus Af293]
 gi|66851676|gb|EAL92002.1| glycyl-tRNA synthetase [Aspergillus fumigatus Af293]
 gi|159126226|gb|EDP51342.1| glycyl-tRNA synthetase [Aspergillus fumigatus A1163]
          Length = 699

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 230/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 378 RIQLFLLKLGVDPNKLRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTV 437

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ K V   + +          
Sbjct: 438 HKNKTGAPLVVREPRAEPLKIEEWQVDLDKKKFGPRFKKDGKAVAAAVEALSQELREKLA 497

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 498 IDLEKNGKIEVDVEGVGSGKVELDQDIVKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 557

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEHVYW R++DE R VLSFPP +AP K L+VPLS + +F  L+ +L  ++R++ I+ +VD
Sbjct: 558 IEHVYWAREEDEARGVLSFPPAIAPTKVLIVPLSTHASFRPLLQQLMTKLRRMGISNRVD 617

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RD+TKQ+R + D ILQ +K L+
Sbjct: 618 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDTTKQVRASEDEILQAIKSLV 677

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE + +  P FT QE+D
Sbjct: 678 DGEKTWEDIRKELPEFTGQEVD 699



>gi|345565896|gb|EGX48844.1| hypothetical protein AOL_s00079g483 [Arthrobotrys oligospora ATCC
           24927]
          Length = 752

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 230/321 (71%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+  +++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 431 RINLFLKKIGVDENKVRFRQHMENEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 490

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T + L VRE L EP + ++  ++INKKV GPK ++++K VE+ L            
Sbjct: 491 HQKKTGQFLGVRETLKEPRVIEEYEVDINKKVLGPKFKKDAKAVEERLAECSNQKEREAW 550

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                   +  V      + EI S+ +T++++  TE VREYTPNVIEPSFGIGRILYSL+
Sbjct: 551 SETLKNGQSISVLIEGLGKLEIGSDLVTVEKRKRTESVREYTPNVIEPSFGIGRILYSLM 610

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EHV+WTR +D  R+VLSFPP +AP K LLVPLSNN AF  LV+ ++ +IRKL I+ +VD 
Sbjct: 611 EHVFWTRPEDADRAVLSFPPTIAPTKVLLVPLSNNVAFNPLVNSISSKIRKLGISSRVDS 670

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S  +IG+RY+RNDELGTPF ITIDFQSV D TITLRERD+TKQ+R ++D +L  LK L+E
Sbjct: 671 SGATIGKRYSRNDELGTPFGITIDFQSVKDDTITLRERDTTKQVRGSVDEVLAHLKALVE 730

Query: 301 ESTTWEKVMETYPTFTQQELD 321
              TWE+ +   P FT Q+++
Sbjct: 731 GHETWEETLTKLPIFTGQDVE 751



>gi|358373298|dbj|GAA89897.1| glycyl-tRNA synthetase [Aspergillus kawachii IFO 4308]
          Length = 656

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 227/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKLGVDPKKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ KTV   + +          
Sbjct: 395 HKNKTGAPLVVRETRAEPLKVEEWQIDLDKKKFGPRFKKDGKTVTAAIDALSQELREKLS 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G    +V G  G + E+  E + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 455 LDLEQTGKIEVEVEGVAGGKVELDKELIKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IE VYW+R+ DE R VLSFPP +AP K L+VPLS + +F  LV  L  ++R++ ++ +VD
Sbjct: 515 IEQVYWSREGDEARGVLSFPPAIAPTKVLIVPLSTHQSFAPLVQRLTTKLRRMGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF +T+DFQSV D T TLR+RDSTKQ+R + D I   +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGVTVDFQSVKDNTFTLRDRDSTKQVRASEDEIALAIKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P FT QE++
Sbjct: 635 EGEETWEDVRKRLPEFTGQEVE 656



>gi|378730454|gb|EHY56913.1| glycyl-tRNA synthetase [Exophiala dermatitidis NIH/UT8656]
          Length = 702

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 226/318 (71%), Gaps = 1/318 (0%)

Query: 5   FLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTVHSNR 64
           FL KLGI   +LRFRQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTVH+ +
Sbjct: 385 FLLKLGIDHSKLRFRQHMANEMAHYAADCWDAELFTTYGWIECVGCADRSAYDLTVHAKK 444

Query: 65  TKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXXXX-X 123
           T   LVVRE LAEP++ ++  +++ +K  GPK R+++K VE  + +              
Sbjct: 445 TGAPLVVRETLAEPLVIEEYQIDLERKKLGPKFRKDAKAVEAAVDALSQELREKLSLELE 504

Query: 124 XDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLIEHV 183
            +G    + PG      E+  + + I+++  TEH+REYTPNVIEPSFGIGRILYSL+EHV
Sbjct: 505 KNGKIEVQTPGVGSGTTELDKDLIKIEKRKRTEHIREYTPNVIEPSFGIGRILYSLMEHV 564

Query: 184 YWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDDSSN 243
           YWTR+ D  R+VLSFPP VAP K LLVPLS++P F   V +L  R+R+  I+ +VDDSS 
Sbjct: 565 YWTREGDGARAVLSFPPTVAPTKVLLVPLSSHPDFKPFVKKLTTRLRRTGISNRVDDSSA 624

Query: 244 SIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLEEST 303
           SIG+RYARNDELGTPF ITIDFQ+V D ++TLRERDSTKQ+R + D I+  +K L++   
Sbjct: 625 SIGKRYARNDELGTPFGITIDFQTVKDGSLTLRERDSTKQVRASEDEIIAAVKSLVDGEE 684

Query: 304 TWEKVMETYPTFTQQELD 321
           TWE V +  P F  Q+L+
Sbjct: 685 TWEDVFKRLPVFEGQDLE 702



>gi|448519232|ref|XP_003868040.1| Grs1 tRNA-Gly synthetase [Candida orthopsilosis Co 90-125]
 gi|380352379|emb|CCG22605.1| Grs1 tRNA-Gly synthetase [Candida orthopsilosis]
          Length = 703

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 222/316 (70%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+G  P RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 387 RIYLFLTKIGTDPSRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSV 446

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           HS RT EKLVVR+ LAEP + +K  +EI KK FGPK R+++  VE +L S          
Sbjct: 447 HSARTGEKLVVRQPLAEPRVVEKFEIEIAKKKFGPKFRKDAGVVEKWLVSRTQCELEDLG 506

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  + ++ G +GN  E+ SE ++I + T TEH+REY PNVIEPSFGIGRILYS+
Sbjct: 507 EELKKNGKISVQIKGIEGN-VELDSELISIDKVTRTEHIREYIPNVIEPSFGIGRILYSI 565

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD +R VLS PP VAP K LLVPLSN+     +V  ++  +RK  I  KVD
Sbjct: 566 FEHQFWARGDDAERGVLSLPPIVAPTKVLLVPLSNSAELQPIVKSVSNVLRKEKIPFKVD 625

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF+SV D ++TLRERDSTKQ+R +I  ++  +K++ 
Sbjct: 626 DSSASIGKRYARNDELGTPFGITIDFESVKDESVTLRERDSTKQVRGSIKDVIDAIKEIT 685

Query: 300 EESTTWEKVMETYPTF 315
               +W++       F
Sbjct: 686 YSEVSWDEGTSKLEAF 701



>gi|119498573|ref|XP_001266044.1| glycyl-tRNA synthetase [Neosartorya fischeri NRRL 181]
 gi|119414208|gb|EAW24147.1| glycyl-tRNA synthetase [Neosartorya fischeri NRRL 181]
          Length = 656

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 230/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+ P++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKLGVDPNKLRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ K V   + +          
Sbjct: 395 HKNKTGAPLVVREPRAEPLKVEEWQVDLDKKKFGPRFKKDGKAVAAAVEALSQELREKLA 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 455 IDLEKNGKIEVDVEGVGSGKVELDQDIVKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEHVYW R++DE R VLSFPP +AP K L+VPLS + +F  L+ +L  ++R++ I+ +VD
Sbjct: 515 IEHVYWAREEDEARGVLSFPPVIAPTKVLIVPLSTHASFRPLLLQLMTKLRRMGISNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RD+TKQ+R + D ILQ ++ L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDTTKQVRASEDEILQAIRSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE + +  P FT QE+D
Sbjct: 635 DGEKTWEDIRKELPEFTGQEVD 656



>gi|403214084|emb|CCK68585.1| hypothetical protein KNAG_0B01380 [Kazachstania naganishii CBS
           8797]
          Length = 660

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 227/320 (70%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+G+  DRLRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSA+DLTV
Sbjct: 340 RIYMFLMKIGVDHDRLRFRQHMANEMAHYAADCWDAELHTSYGWIECVGCADRSAFDLTV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+TKEK+VVR+ L  P+   K  +++ KK+FGPK R+++  VE YL +          
Sbjct: 400 HSNKTKEKMVVRQKLETPIEVTKYEIDLVKKLFGPKFRKDAPKVESYLLNMTQDQLAVKA 459

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  T  VP  +G + E+  +++TI+ +T  EHVRE+ PNVIEPSFGIGRI+Y++
Sbjct: 460 KELADTGKITFSVPEVEG-ELELDDKFVTIEERTRVEHVREFVPNVIEPSFGIGRIIYAV 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  R VLSFPP VAP K LLVPLSNN     +V +++  +RK  I  KVD
Sbjct: 519 FEHSFWSRPEDAARGVLSFPPLVAPSKVLLVPLSNNKELQPIVSKVSTTLRKAEIPFKVD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF SV D ++TLRERDSTKQ+R +I+ I++ ++ + 
Sbjct: 579 DSGVSIGKRYARNDELGTPFGVTIDFDSVQDGSVTLRERDSTKQVRGSIEEIIEAIRQIA 638

Query: 300 EESTTWEKVMETYPTFTQQE 319
            +  TW++  +    F  QE
Sbjct: 639 YKGVTWDEGTKNLKPFVSQE 658



>gi|403165407|ref|XP_003325424.2| glycyl-tRNA synthetase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|375165710|gb|EFP81005.2| glycyl-tRNA synthetase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 718

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/309 (56%), Positives = 223/309 (72%), Gaps = 4/309 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI PDRLRFRQHM NEMAHYA DCWDA+IH+SYGWIECVGCADRSAYDLTV
Sbjct: 395 RIDLFLRKIGINPDRLRFRQHMDNEMAHYASDCWDAEIHSSYGWIECVGCADRSAYDLTV 454

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT  KLVVRE L E +  +K V   +KK+FGP+ RQ +K VE  + +          
Sbjct: 455 HSVRTGTKLVVREPLKEVIEIEKNVPMFDKKLFGPRFRQAAKVVEQTVLAFDEARLECLS 514

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + +GT+K+  +DGN+YE+T + L I+R+ F E  REYTPNVIEPSFGIGRILYSL+
Sbjct: 515 KEL-ETDGTSKIRASDGNEYELTKDILKIERKKFKETTREYTPNVIEPSFGIGRILYSLL 573

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R +D  R VLS PP +AP K L+VPLS    F  L+  ++K++R   IA +VDD
Sbjct: 574 EHCYWARAEDVNRGVLSLPPSIAPVKVLIVPLSGTEVFRPLIRSISKKLRNAGIASRVDD 633

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL- 299
           S+ SIG+RY+RNDELGTPF IT+DF SV + T+TLRERDSTKQ+   ID ++++++++  
Sbjct: 634 SNASIGKRYSRNDELGTPFGITVDFGSVKNGTVTLRERDSTKQVIGPIDEVIEIVREICL 693

Query: 300 --EESTTWE 306
             EE   W+
Sbjct: 694 GDEEGKGWQ 702



>gi|121712626|ref|XP_001273924.1| glycyl-tRNA synthetase [Aspergillus clavatus NRRL 1]
 gi|119402077|gb|EAW12498.1| glycyl-tRNA synthetase [Aspergillus clavatus NRRL 1]
          Length = 699

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 378 RIQSFLYKLGVDPSKLRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 437

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++++KK FGP+ +++ K V   + +          
Sbjct: 438 HKNKTGAPLVVREPRAEPLRIEEWQVDLDKKKFGPRFKKDGKAVAAAVEALSQEFREKLA 497

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRILYS+
Sbjct: 498 IDLEKNGKIEVEVEGVGSGKVELDQDIVKIEKRTRVENIREYTPNVIEPSFGIGRILYSM 557

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEHVYW+R+ DE R VLSFPP +AP K L+VPLS + +F  L+ +L  ++R+L ++ +VD
Sbjct: 558 IEHVYWSREGDEARGVLSFPPVIAPTKVLIVPLSTHASFRPLLQQLMTKLRRLGVSNRVD 617

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RD+TKQ+R + + ILQ +K L+
Sbjct: 618 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDTTKQVRASEEEILQAIKSLV 677

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   +WE + +  P FT QE+D
Sbjct: 678 DGEKSWEDIRKELPEFTGQEVD 699



>gi|406603204|emb|CCH45241.1| glycyl-tRNA synthetase [Wickerhamomyces ciferrii]
          Length = 658

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 171/308 (55%), Positives = 226/308 (73%), Gaps = 2/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+ P R RFRQHM NEMAHYA DCWDA++  SYGW+ECVGCADRSAYDLTV
Sbjct: 337 RIYQFLVKIGVDPKRCRFRQHMANEMAHYATDCWDAELQTSYGWVECVGCADRSAYDLTV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+N+TKEKLVVR+ L EP+   K  L++ KK FGPK R+N+  VE++LTS          
Sbjct: 397 HANKTKEKLVVRQKLDEPITVTKYELDLEKKKFGPKFRKNAPLVEEWLTSRSQDELVKLK 456

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T K+P  + +Q E+ + ++ I+++T  EHVREYTPNVIEPSFGIGRI+YS+
Sbjct: 457 EELSSNGKITFKIPEIE-DQIELDNTFIAIEQRTKVEHVREYTPNVIEPSFGIGRIIYSI 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +  +R+VLSFPP VAP K LLVPLSN+     +V E+++ +RK  I  KVD
Sbjct: 516 FEHTFWSRAEATERAVLSFPPIVAPTKVLLVPLSNSKELQPIVKEISRTLRKEQIPFKVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+SV D ++TLRERDSTKQ+R  +  I++ ++++ 
Sbjct: 576 DSGASIGKRYARNDELGTPFGVTIDFESVEDGSVTLRERDSTKQVRGEVKDIIKAIREIT 635

Query: 300 EESTTWEK 307
             + +WE+
Sbjct: 636 YNNISWEE 643



>gi|303319141|ref|XP_003069570.1| glycyl-tRNA synthetase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240109256|gb|EER27425.1| glycyl-tRNA synthetase, putative [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 698

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+GI   ++R RQHM NEMAHYA DCWDA++ +SYGWIECVGCADRSAYDL+V
Sbjct: 377 RIYMFLVKIGIDESKVRLRQHMANEMAHYATDCWDAELLSSYGWIECVGCADRSAYDLSV 436

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++I++K FGP+ +++ KTVE  + +          
Sbjct: 437 HKNKTGAPLVVRETRAEPLRIEEWQVDIDRKKFGPRFKKDGKTVEAAIDALSQELREKLA 496

Query: 121 XXX-XDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G +  + EI  + + I+++T  E++REYTPNVIEPSFGIGRILY L
Sbjct: 497 LDLDKDGKITIDVEGVNDGKVEIGKDLVKIEKRTRVENIREYTPNVIEPSFGIGRILYCL 556

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP  AP K LLVPLS++ +F  LV +L  ++R++ ++ +VD
Sbjct: 557 MEHVYWSREGDEARGVLSFPPLAAPTKVLLVPLSSHQSFQPLVRKLTLKLRRMGVSNRVD 616

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDS KQ+R + D I + +K L+
Sbjct: 617 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSMKQVRASEDEICKAVKSLV 676

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P F  QE+D
Sbjct: 677 EGEETWEDVRKRLPEFLGQEVD 698



>gi|392865224|gb|EAS31002.2| glycine-tRNA ligase [Coccidioides immitis RS]
          Length = 698

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+GI   ++R RQHM NEMAHYA DCWDA++ +SYGWIECVGCADRSAYDL+V
Sbjct: 377 RIYMFLVKIGIDESKVRLRQHMANEMAHYATDCWDAELLSSYGWIECVGCADRSAYDLSV 436

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++I++K FGP+ +++ KTVE  + +          
Sbjct: 437 HKNKTGAPLVVRETRAEPLRIEEWQVDIDRKKFGPRFKKDGKTVEAAIDALSQELREKLA 496

Query: 121 XXX-XDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G +  + EI  + + I+++T  E++REYTPNVIEPSFGIGRILY L
Sbjct: 497 LDLDKDGKITIDVEGVNDGKVEIGKDLVKIEKRTRVENIREYTPNVIEPSFGIGRILYCL 556

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP  AP K LLVPLS++ +F  LV +L  ++R++ ++ +VD
Sbjct: 557 MEHVYWSREGDEARGVLSFPPLAAPTKVLLVPLSSHQSFQPLVRKLTLKLRRMGVSNRVD 616

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDS KQ+R + D I + +K L+
Sbjct: 617 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSMKQVRASEDEICKAVKSLV 676

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P F  QE+D
Sbjct: 677 EGEETWEDVRKRLPEFLGQEVD 698



>gi|45187500|ref|NP_983723.1| ADL373Wp [Ashbya gossypii ATCC 10895]
 gi|44982238|gb|AAS51547.1| ADL373Wp [Ashbya gossypii ATCC 10895]
 gi|374106935|gb|AEY95843.1| FADL373Wp [Ashbya gossypii FDAG1]
          Length = 658

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 229/319 (71%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FLTK+G+  ++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 339 RIYQFLTKIGVDEEKLRFRQHMSNEMAHYATDCWDAELKTSYGWIECVGCADRSAYDLTV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+N+TK  LVVRE L  P    +  +E+ KK+FGPK R+++  VE+YL +          
Sbjct: 399 HANKTKTALVVREKLDVPRQVTQWEIELTKKLFGPKFRKDAPKVENYLLNLSQDELASKA 458

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG    +V G +G+  E+ S++++I+ +T TEHVREY PNVIEPSFGIGRI+Y++
Sbjct: 459 EQLSSDGKIVFQVEGIEGD-IELDSKFISIEHKTKTEHVREYVPNVIEPSFGIGRIIYAI 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  RSVLSFPP VAP K LLVPLSNN    ++V E+++ +RK  I  KVD
Sbjct: 518 FEHSFWSRPEDAARSVLSFPPLVAPTKVLLVPLSNNADLAEVVTEVSRVLRKEQIPFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF+S+ D ++TLRERDST+Q+R ++  I++ ++D+ 
Sbjct: 578 DSGVSIGKRYARNDELGTPFGITIDFESIKDGSVTLRERDSTRQVRGSVTDIIRAIRDIT 637

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+  ++   F  Q
Sbjct: 638 YNGVTWEEGTKSLTPFVSQ 656



>gi|513032911|gb|AGO12883.1| AaceriADL373Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 658

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 228/319 (71%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FLTK+G+  +++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 339 RIYQFLTKIGVDEEKMRFRQHMSNEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N+TK  LVVRE L  P    +  +E+ KK+FGPK R+++  VE YL +          
Sbjct: 399 HANKTKTALVVREKLDVPRQVTQWEIELTKKLFGPKFRKDAPKVESYLLNLSQEELANKA 458

Query: 121 XX-XXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG    +V G +G+  E+ S++++I+ +T TEHVREY PNVIEPSFGIGRI+Y++
Sbjct: 459 EQLSSDGKIVFQVEGIEGD-IELDSKFISIEHKTKTEHVREYVPNVIEPSFGIGRIIYAI 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  RSVLSFPP VAP K LLVPLSNN    D+V E+++ +RK  I  KVD
Sbjct: 518 FEHSFWSRPEDVARSVLSFPPLVAPTKVLLVPLSNNADLADVVTEVSRVLRKEQIPFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF+S+ D ++TLRERDST+Q+R ++  I++ ++D+ 
Sbjct: 578 DSGVSIGKRYARNDELGTPFGITIDFESIKDGSVTLRERDSTRQVRGSVADIIRAIRDIT 637

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+  ++   F  Q
Sbjct: 638 YNGVTWEEGTKSLTPFVSQ 656



>gi|119182388|ref|XP_001242329.1| hypothetical protein CIMG_06225 [Coccidioides immitis RS]
          Length = 654

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+GI   ++R RQHM NEMAHYA DCWDA++ +SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYMFLVKIGIDESKVRLRQHMANEMAHYATDCWDAELLSSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++I++K FGP+ +++ KTVE  + +          
Sbjct: 393 HKNKTGAPLVVRETRAEPLRIEEWQVDIDRKKFGPRFKKDGKTVEAAIDALSQELREKLA 452

Query: 121 XXX-XDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G +  + EI  + + I+++T  E++REYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLDKDGKITIDVEGVNDGKVEIGKDLVKIEKRTRVENIREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP  AP K LLVPLS++ +F  LV +L  ++R++ ++ +VD
Sbjct: 513 MEHVYWSREGDEARGVLSFPPLAAPTKVLLVPLSSHQSFQPLVRKLTLKLRRMGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDS KQ+R + D I + +K L+
Sbjct: 573 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSMKQVRASEDEICKAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P F  QE+D
Sbjct: 633 EGEETWEDVRKRLPEFLGQEVD 654



>gi|255716848|ref|XP_002554705.1| KLTH0F11660p [Lachancea thermotolerans]
 gi|238936088|emb|CAR24268.1| KLTH0F11660p [Lachancea thermotolerans CBS 6340]
          Length = 661

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 227/319 (71%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL  +G+  ++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYSFLMAIGVDSNKLRFRQHMANEMAHYAADCWDAELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N+TKEKLVVR+ L EP+   K  +E+ KK+FGPK R+++  VE +L +          
Sbjct: 402 HANKTKEKLVVRQKLEEPVQVTKWEIELTKKLFGPKFRKDAPKVESFLLNLSQEELEAKA 461

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                G     +V G D +Q E+  ++++I++ T TEHVRE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 KELKAGGKIVFEVEGMD-SQIELDDKFVSIEQVTRTEHVREFVPNVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHV+W+R +D  R+VLSFPP VAP K LLVPLSN+P  + +  +++K  RK  I  KVD
Sbjct: 521 FEHVFWSRPEDSARAVLSFPPLVAPTKVLLVPLSNHPDLSSVAHQVSKVFRKEKIPFKVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RY+RNDELGTPF +TIDF+S  D T+TLRERDSTKQ+R  ++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYSRNDELGTPFGVTIDFESAKDGTVTLRERDSTKQVRGTVEEVVKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+  ++   F  Q
Sbjct: 641 YNGVTWEEGTKSLKPFETQ 659



>gi|354544025|emb|CCE40747.1| hypothetical protein CPAR2_107820 [Candida parapsilosis]
          Length = 652

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 221/308 (71%), Gaps = 2/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+G  P RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIYLFLTKIGTDPSRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+ RT EKLVVR+ LAEP + +K  +EI KK FGP+ R+++  VE +L S          
Sbjct: 396 HAARTGEKLVVRQPLAEPRVVEKFEIEIAKKKFGPRFRKDAGVVEKWLVSRTQCELEDLG 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG    ++ G +GN  E+ S+ ++I++   TEH+REY PNVIEPSFGIGRILYS+
Sbjct: 456 KELKKDGKINVQIKGIEGN-IELDSDLISIEKVKRTEHIREYIPNVIEPSFGIGRILYSI 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD +R VLS PP VAP K LLVPLSN+     +V +++  +RK  I  KVD
Sbjct: 515 FEHQFWARGDDAERGVLSLPPIVAPTKVLLVPLSNSVELQPIVKKVSNVLRKEKIPFKVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF+SV D ++TLRERDSTKQ+R ++  ++  +K++ 
Sbjct: 575 DSSASIGKRYARNDELGTPFGITIDFESVKDESVTLRERDSTKQVRGSVKDVIDAIKEIT 634

Query: 300 EESTTWEK 307
               +W++
Sbjct: 635 YSEVSWDE 642



>gi|320041027|gb|EFW22960.1| glycyl-tRNA synthetase [Coccidioides posadasii str. Silveira]
          Length = 698

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 173/322 (53%), Positives = 229/322 (71%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+GI   ++R RQHM NEMAHYA DCWDA++ +SYGWIECVGCADRSAYDL+V
Sbjct: 377 RIYMFLVKIGIDESKVRLRQHMANEMAHYATDCWDAELLSSYGWIECVGCADRSAYDLSV 436

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVRE  AEP+  ++  ++I++K FGP+ +++ KTVE  + +          
Sbjct: 437 HKNKTGAPLVVRETRAEPLRIEEWQVDIDRKKFGPRFKKDGKTVEAAIDALSQELREKLA 496

Query: 121 XXX-XDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G +  + EI  + + I+++T  E++REYTPNVIEPSFGIGRILY L
Sbjct: 497 LDLDKDGKITIDVEGVNDGKVEIGKDLVKIEKRTRVENIREYTPNVIEPSFGIGRILYCL 556

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R+ DE R VLSFPP  AP K LLVPLS++ +F  LV +L  ++R++ ++ +VD
Sbjct: 557 MEHVYWSREGDEARGVLSFPPLAAPTKVLLVPLSSHQSFQPLVRKLTLKLRRMGVSNRVD 616

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDS KQ+R + + I + +K L+
Sbjct: 617 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSMKQVRASEEEICKAVKSLV 676

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P F  QE+D
Sbjct: 677 EGEETWEDVRKRLPEFLGQEVD 698



>gi|296808933|ref|XP_002844805.1| glycyl-tRNA synthetase 1 [Arthroderma otae CBS 113480]
 gi|238844288|gb|EEQ33950.1| glycyl-tRNA synthetase 1 [Arthroderma otae CBS 113480]
          Length = 654

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 227/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R+RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 333 RIYLFLKKIGIDESKIRWRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLTV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   LVVR+  AEP+  ++ +++I+KK FGP+ +++SKTVE  + +          
Sbjct: 393 HKNKTGAPLVVRQTRAEPLRIEEWLVDIDKKKFGPRFKKDSKTVEAAIEALTQDVREKLS 452

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G      EI  + + I+++T  E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 FDLEKNGKIEIAVEGVGEGTVEIGKDLVQIEKRTRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAIKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE +++  P FT QE++
Sbjct: 633 DGDETWEDILKRLPEFTGQEIE 654



>gi|255730579|ref|XP_002550214.1| glycyl-tRNA synthetase 1 [Candida tropicalis MYA-3404]
 gi|240132171|gb|EER31729.1| glycyl-tRNA synthetase 1 [Candida tropicalis MYA-3404]
          Length = 652

 Score =  365 bits (937), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 220/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+ P RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYQFLIKIGVDPSRLRFRQHMSNEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           HS RT EKLV R+ LAEP   +   +EI KK FGPK R+++ TVE +LTS          
Sbjct: 393 HSARTGEKLVARQALAEPRTVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEDLG 452

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G +G+  E+ ++ + I++   TEHVRE+ PNVIEPSFGIGRILYS+
Sbjct: 453 KELEANGKIVVQVKGVEGD-IELDTDLIKIEKVKRTEHVREFVPNVIEPSFGIGRILYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD  R VLS PP VAP K LLVPLSNNP    +V ++++ +RK  I  K+D
Sbjct: 512 FEHQFWCRPDDADRGVLSLPPIVAPTKVLLVPLSNNPELQPVVKKVSQALRKEKIPFKID 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF SV D ++TLRERDSTKQ+R +I+ I++ +KD+ 
Sbjct: 572 DSGASIGKRYARNDELGTPFGITIDFDSVKDDSVTLRERDSTKQVRGSIEEIVEAIKDIT 631

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TW +       F  Q
Sbjct: 632 YNDGTWAEGTAKLKPFEGQ 650



>gi|472587902|gb|EMS25398.1| glycyl-tRNA synthetase [Rhodosporidium toruloides NP11]
          Length = 691

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 170/306 (55%), Positives = 219/306 (71%), Gaps = 4/306 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+GI P RLRFRQHM NEMAHYA DCWDA+I  SYGWIECVGCADRSAYDLTV
Sbjct: 373 RIYLFLTKIGINPARLRFRQHMANEMAHYAADCWDAEIETSYGWIECVGCADRSAYDLTV 432

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T+ KLVVR+ L EP I ++ V  I+KK FGP  ++++K +E+ + +          
Sbjct: 433 HSVKTQNKLVVRQALKEPRIVERNVPAIDKKAFGPLFKKDAKAIEEAINALSEEELVKAM 492

Query: 121 XXXXDGN-GTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               +    T KV   +G ++++ +  LTI      E VRE+ PNVIEPSFGIGRILYSL
Sbjct: 493 QQLKEQQQATVKV---NGQEFQVPANVLTITPTQIKEMVREFVPNVIEPSFGIGRILYSL 549

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W R DD  R VLS PP VAP KCL+VPLS+N  F  LV ++++++R L IA +VD
Sbjct: 550 LEHSFWARADDVNRGVLSLPPAVAPIKCLIVPLSSNSEFKPLVAQVSQKLRSLGIASRVD 609

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS+ SIG+RYARNDELGTPF +T+DF SV + T+TLRERD+T Q+  +ID ++QV+ +L 
Sbjct: 610 DSNASIGKRYARNDELGTPFGVTLDFASVKNNTMTLRERDTTLQLIGSIDEVIQVVSELC 669

Query: 300 EESTTW 305
             S +W
Sbjct: 670 NGSLSW 675



>gi|443897920|dbj|GAC75259.1| glycyl-trna synthetase and related class II tRNA synthetase
           [Pseudozyma antarctica T-34]
          Length = 713

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 171/319 (53%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P RLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 393 RIYLFLVKIGIDPRRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 452

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ LVV++   EP +YDK V  I KK  GPK ++++K VE+ +            
Sbjct: 453 HSKRTKKDLVVQKAHKEPKVYDKLVATIVKKNIGPKFKKDAKIVEEAILEMDQKKLGELE 512

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +G+    V    G  +E+T++ +T++ +T  E VRE+TPNVIEPSFGIGRI YSL+
Sbjct: 513 SQLKNGSAPLTV--CTGQTFELTTDVVTVEMKTIRETVREFTPNVIEPSFGIGRIFYSLL 570

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR +D+ R VLS PP VAP K L+VP+S+N     LV ++++++R   +A +VDD
Sbjct: 571 EHSFWTRAEDQDRGVLSLPPLVAPIKALIVPISSNEKLAPLVKQVSRKLRSAGVASRVDD 630

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPFA T+DF S++  T+TLRERDST Q    ID ++ V++ L +
Sbjct: 631 SNASIGRRYARNDELGTPFACTLDFASLSKGTMTLRERDSTAQRIGPIDQVIDVIRQLCD 690

Query: 301 ESTTWEKVMETYPTFTQQE 319
            S  WE   +  P ++ Q+
Sbjct: 691 ASLDWEGACKILPEYSGQQ 709



>gi|68480224|ref|XP_715922.1| hypothetical protein CaO19.8067 [Candida albicans SC5314]
 gi|68480339|ref|XP_715872.1| hypothetical protein CaO19.437 [Candida albicans SC5314]
 gi|46437515|gb|EAK96860.1| hypothetical protein CaO19.437 [Candida albicans SC5314]
 gi|46437567|gb|EAK96911.1| hypothetical protein CaO19.8067 [Candida albicans SC5314]
          Length = 652

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/319 (55%), Positives = 219/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+  +RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLVKIGVDTNRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLV R+ LAEP   +   +EI KK FGPK R+++ TVE +LTS          
Sbjct: 393 HSARTGEKLVARQTLAEPRTVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEELG 452

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G    ++ G +G+  E+  + + I +   TEHVRE+ PNVIEPSFGIGRILYS+
Sbjct: 453 KELSEKGKIVVQIKGVEGD-VELDGDLIKIDKVKRTEHVREFVPNVIEPSFGIGRILYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD  R VLS PP VAP K LLVPLSNN     +V ++++ +RK  I  KVD
Sbjct: 512 FEHQFWCRPDDADRGVLSLPPIVAPTKVLLVPLSNNSELQPIVKKVSQALRKEKIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SV D ++TLRERDSTKQ+R +I  I++ +KD+ 
Sbjct: 572 DSSASIGKRYARNDELGTPFGITIDFDSVKDDSVTLRERDSTKQVRGSIQEIVEAIKDIT 631

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+       F  Q
Sbjct: 632 YNDGTWEEGTAKLKPFEGQ 650



>gi|336469952|gb|EGO58114.1| glycyl-tRNA synthetase 1 [Neurospora tetrasperma FGSC 2508]
 gi|350290363|gb|EGZ71577.1| glycyl-tRNA synthetase 1 [Neurospora tetrasperma FGSC 2509]
          Length = 663

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 221/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 336 RIHLFLQKIGIDQSKIRFRQHMSNEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSX-XXXXXXXX 119
           H+ RT   LVVRE L  P I +K   EIN K FGP  R+++KTVE  + +          
Sbjct: 396 HAKRTGAPLVVRETLETPEIVEKWEPEINSKKFGPTFRKDAKTVEAAILALPQEELAKLA 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG    + E++ + L I+ +  T ++REYTPNVIEPSFGIGRILYSL
Sbjct: 456 EELKTNGKIVVDVPGVGDGKVEVSKDLLAIEWKKHTINIREYTPNVIEPSFGIGRILYSL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R+ DE R V+SFPP VAP K L+VP+S+   F   V  L++++R + I+ +VD
Sbjct: 516 LEHNYWVREGDEARGVISFPPAVAPVKVLIVPISSKAEFAPHVRRLSQKLRSVGISSRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIGRRYARNDELGTPF +TIDFQ++ D T TLRERDST+Q+R   + I+  +K L+
Sbjct: 576 DSSASIGRRYARNDELGTPFGLTIDFQTLQDGTFTLRERDSTRQVRAEEEKIVDAIKALV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E S TW+ V    P F  QEL+
Sbjct: 636 EGSKTWQDVESELPIFEGQELE 657



>gi|241948893|ref|XP_002417169.1| glycyl-tRNA ligase, putative; glycyl-tRNA synthetase, putative
           [Candida dubliniensis CD36]
 gi|223640507|emb|CAX44761.1| glycyl-tRNA ligase, putative [Candida dubliniensis CD36]
          Length = 652

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 178/319 (55%), Positives = 219/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ P+RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLVKIGVDPNRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLV RE LAEP   +   +EI KK FGPK R+++ TVE +LTS          
Sbjct: 393 HSARTGEKLVARETLAEPRTVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEDMG 452

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G    ++   +G+  E+  + + I +   TEHVRE+ PNVIEPSFGIGRILYS+
Sbjct: 453 KELNEKGKIVAQIKDVEGD-VELDGDLIKIDKVKRTEHVREFVPNVIEPSFGIGRILYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD  R VLS PP VAP K LLVPLSNN     +V ++++ +RK  I  KVD
Sbjct: 512 FEHQFWCRPDDADRGVLSLPPIVAPTKVLLVPLSNNSELQPIVKKVSQALRKEKIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SV D ++TLRERDSTKQ+R +I  I++ +KD+ 
Sbjct: 572 DSSASIGKRYARNDELGTPFGITIDFDSVKDDSVTLRERDSTKQVRGSIQEIVEAIKDIT 631

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TW++       F  Q
Sbjct: 632 YNDGTWKEGTAKLKPFEGQ 650



>gi|430813397|emb|CCJ29276.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 643

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 230/335 (68%), Gaps = 15/335 (4%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  +FL K+G+  ++LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADR+AYDL V
Sbjct: 298 RIQMFLIKIGVDKNKLRFRQHMQNEMAHYASDCWDAELLTSYGWIECVGCADRAAYDLIV 357

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS + KEKLVVRE L +PM   + V+ ++KK  GP  +++ K VE+ + +          
Sbjct: 358 HSKKIKEKLVVRELLPKPMEIKEWVVNLDKKKIGPLFKKDLKFVEEAICNWNDEDKMKYR 417

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                 +  T V   DG Q+++ S   TI+    T +VREY PNVIEPSFGIGRILYSLI
Sbjct: 418 DQAVSESKIT-VQVADGRQFDVPSSLFTIEEVKKTINVREYVPNVIEPSFGIGRILYSLI 476

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R DD  R VLSF P VAP KCLLVPLSNN  F  ++D L+ ++ +L I+ KVDD
Sbjct: 477 EHSYWIRSDDIDRGVLSFLPIVAPVKCLLVPLSNNSMFDPIIDRLSSKLSRLGISYKVDD 536

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND--------------RTITLRERDSTKQIRE 286
           SS +IGRRY+RNDELG PF IT+DFQ+VND              R+ITLRERD+TKQIR 
Sbjct: 537 SSAAIGRRYSRNDELGIPFGITVDFQTVNDGRYAFSVNSAPLIFRSITLRERDTTKQIRA 596

Query: 287 NIDTILQVLKDLLEESTTWEKVMETYPTFTQQELD 321
           + + IL+V+K LLE   +WE +++++P F +QE++
Sbjct: 597 SEEEILEVIKKLLEGIISWEDILKSFPVFNKQEIN 631



>gi|448090348|ref|XP_004197045.1| Piso0_004280 [Millerozyma farinosa CBS 7064]
 gi|448094740|ref|XP_004198076.1| Piso0_004280 [Millerozyma farinosa CBS 7064]
 gi|359378467|emb|CCE84726.1| Piso0_004280 [Millerozyma farinosa CBS 7064]
 gi|359379498|emb|CCE83695.1| Piso0_004280 [Millerozyma farinosa CBS 7064]
          Length = 653

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 218/308 (70%), Gaps = 2/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+   RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLLKIGVDSSRLRFRQHMSNEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+ RT EKL+VRE L EP+  +K  +EI+KK FGPK R+N+  VE +L S          
Sbjct: 393 HAARTNEKLIVREQLPEPVTVEKFEVEISKKKFGPKFRKNAGVVEKWLLSRTQCELEDFA 452

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    K+ G    + EIT E + I++   TEH+RE+TPNVIEPSFGIGRI+Y +
Sbjct: 453 AELAKNGKFNPKIDGV-SEEIEITDELVKIEKVKRTEHIREFTPNVIEPSFGIGRIIYCI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R   E+R VLS PP VAP K LLVPLS+N     LV +++  +RK  I  KVD
Sbjct: 512 FEHQFWNRAGAEERGVLSLPPLVAPTKVLLVPLSSNQDLQPLVKKVSSYLRKEQIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SVND ++TLRERDSTKQ+R +ID +++ +K++ 
Sbjct: 572 DSSASIGKRYARNDELGTPFGITIDFDSVNDESVTLRERDSTKQVRGSIDDVVKAIKNIT 631

Query: 300 EESTTWEK 307
               +W+K
Sbjct: 632 YNEGSWDK 639



>gi|302664275|ref|XP_003023770.1| hypothetical protein TRV_02082 [Trichophyton verrucosum HKI 0517]
 gi|291187783|gb|EFE43152.1| hypothetical protein TRV_02082 [Trichophyton verrucosum HKI 0517]
          Length = 1327

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE+ + +          
Sbjct: 393 HKKKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVENAIEALTQDVREKLS 452

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + EI  + + I+++   E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIEVDGVGEGKVEIGKDLVQIEKRMRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE V++  P FT QE++
Sbjct: 633 DGEETWEDVLKRLPEFTGQEVE 654



>gi|302505475|ref|XP_003014444.1| hypothetical protein ARB_07006 [Arthroderma benhamiae CBS 112371]
 gi|291178265|gb|EFE34055.1| hypothetical protein ARB_07006 [Arthroderma benhamiae CBS 112371]
          Length = 1327

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE+ + +          
Sbjct: 393 HKKKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVENAIEALTQDMREKLS 452

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + EI  + + I+++   E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIEVDGVGEGKVEIGKDLVQIEKRMRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE V++  P FT QE++
Sbjct: 633 DGEETWEDVLKRLPEFTGQEVE 654



>gi|459369391|gb|EMG47787.1| Glycyl-tRNA synthetase 1 [Candida maltosa Xu316]
          Length = 652

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+  +RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLMKIGVDANRLRFRQHMSNEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLV R+ L+EP + +   +EI KK FGPK R+++ TVE +LTS          
Sbjct: 393 HSARTGEKLVARKTLSEPRVVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEDLG 452

Query: 121 XXXXDGNG-TTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + +    +VPG +G+  E+  + + I +   TEHVRE+ PNVIEPSFGIGRILYS+
Sbjct: 453 KELAEKSKIVVQVPGVEGD-IELDGDLIKIDKVKRTEHVREFVPNVIEPSFGIGRILYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD  R VLS PP VAP K LLVPLSNN     +V ++++ ++K  I  KVD
Sbjct: 512 FEHQFWCRPDDADRGVLSLPPIVAPTKVLLVPLSNNADLQPIVKKVSQALKKEKIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF S+ D ++TLRERDSTKQ+R +I  I++ +KD+ 
Sbjct: 572 DSSASIGKRYARNDELGTPFGITIDFDSLKDDSVTLRERDSTKQVRGSIAEIVEAIKDIT 631

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+       F  Q
Sbjct: 632 YNDGTWEEDTAKLKPFEGQ 650



>gi|50303953|ref|XP_451926.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641058|emb|CAH02319.1| KLLA0B08932p [Kluyveromyces lactis]
          Length = 663

 Score =  362 bits (928), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 171/319 (53%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+ P+RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLIKIGVDPERLRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXX-X 119
           HSN+TKEKLVVRE L  P+   K    + KK+FGPK R+++  VE  L +          
Sbjct: 402 HSNKTKEKLVVREALETPIEVTKWEATLVKKLFGPKFRKDAPKVEARLLAFSQEELESYS 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T KV G +G+  E+  + ++I++ T TEH+RE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 AQLKKDGKITLKVEGMEGD-VEVDDKMVSIEKVTNTEHIREFVPNVIEPSFGIGRIIYSI 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  R+VLSFPP VAP K LLVPL NNP  + +  ++++ +RK  I  KVD
Sbjct: 521 FEHSFWSRPEDTARAVLSFPPLVAPTKVLLVPLLNNPELSKITAQVSQILRKEQIPFKVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +S  SIG+RYARNDELGTPF +TIDF SV D +ITLRERDSTKQ+R ++  +++ ++++ 
Sbjct: 581 ESGVSIGKRYARNDELGTPFGVTIDFDSVTDGSITLRERDSTKQVRGSVADVIKAIREIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
            +  +WE+  +    F  Q
Sbjct: 641 YQGVSWEEGTKDLAPFNSQ 659



>gi|358055811|dbj|GAA98156.1| hypothetical protein E5Q_04839 [Mixia osmundae IAM 14324]
          Length = 709

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/316 (52%), Positives = 217/316 (68%), Gaps = 1/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLF+ K+GI P R+RFRQHM NEMAHYA DCWD +IH+SYGWIECVGCADRSAYDLT 
Sbjct: 390 RVYLFMIKIGIDPARMRFRQHMANEMAHYAADCWDLEIHSSYGWIECVGCADRSAYDLTK 449

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT  K+VVR  L EP+  D+     ++K  GP  ++++K +ED + +          
Sbjct: 450 HAARTSTKMVVRVPLPEPVEVDEIRASFDRKKMGPVFKKDAKIIEDTVAAYDDARLECVE 509

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                 +G TK+   DG  YE+TS+ ++I RQ   +  R++ PNVIEPSFGIGRILYSL+
Sbjct: 510 QELAK-DGKTKIEAADGKTYELTSDLISITRQKTKQFTRDFVPNVIEPSFGIGRILYSLL 568

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R +D QR+V+SFPP +AP K L+VPLSNN AF  L+ ++  ++R   IA ++DD
Sbjct: 569 EHSYWARAEDSQRAVMSFPPLIAPVKVLIVPLSNNDAFKPLIRQVQSKLRAHGIASRIDD 628

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S  SIG+RYARNDELGTPF  TIDF SV + T+TLRERDST Q   +ID ++ V+ DL +
Sbjct: 629 SGASIGKRYARNDELGTPFGCTIDFASVKNNTMTLRERDSTSQRIGSIDEVVAVVNDLCD 688

Query: 301 ESTTWEKVMETYPTFT 316
              TW +  E  P F+
Sbjct: 689 ARATWAQACERLPEFS 704



>gi|326468704|gb|EGD92713.1| glycyl-tRNA synthetase [Trichophyton tonsurans CBS 112818]
          Length = 654

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE+ + +          
Sbjct: 393 HKKKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVENAIEALTQDMREKLS 452

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + EI  + + I+++   E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIEVDGVGEGKVEIGKDLVQIEKRMRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE V++  P FT QE++
Sbjct: 633 DGEETWEDVLKRLPEFTGQEVE 654



>gi|326481313|gb|EGE05323.1| glycyl-tRNA synthetase [Trichophyton equinum CBS 127.97]
          Length = 654

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXX-X 119
           H  +T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE+ + +          
Sbjct: 393 HKKKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVENAIEALTQDMREKFS 452

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + EI  + + I+++   E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIEVDGVGEGKVEIGKDLVQIEKRMRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE V++  P FT QE++
Sbjct: 633 DGEETWEDVLKRLPEFTGQEVE 654



>gi|328851152|gb|EGG00310.1| hypothetical protein MELLADRAFT_39835 [Melampsora larici-populina
           98AG31]
          Length = 658

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 232/322 (72%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI   RLRFRQHM NEMAHYA DCWDA+I +SYGWIECVGCADRSAYDLTV
Sbjct: 338 RIYEFLIKIGIDDSRLRFRQHMDNEMAHYATDCWDAEILSSYGWIECVGCADRSAYDLTV 397

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT  KLVVRE L E + ++K V   +KK+FGP+ ++++K +E+ +            
Sbjct: 398 HSIRTGTKLVVREPLKEGIEFEKNVPVFDKKLFGPRFKKDAKPIEESMMEMDQERLECIG 457

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G++KV  ++G +YE+TS+ L I+++TF E  RE+TPNVIEPSFGIGRILYSL+
Sbjct: 458 NELSS-TGSSKVKVSNGKEYELTSDVLKIEKRTFKETTREFTPNVIEPSFGIGRILYSLL 516

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR++D  R VLS PP ++P K L+VPLS    F  ++  ++ ++RK+ +A +VDD
Sbjct: 517 EHTFWTREEDINRGVLSLPPSISPIKVLIVPLSGTEVFRPIIKIISDKLRKVGLANRVDD 576

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF IT+DF SV ++T+TLRERDSTKQ+  +ID +L+VL+DL  
Sbjct: 577 SNASIGKRYARNDELGTPFGITVDFGSVKNQTVTLRERDSTKQLIGSIDEVLKVLEDLCF 636

Query: 301 ESTTWEKVMETYPTFTQ-QELD 321
               WE+  E    ++  Q+LD
Sbjct: 637 CKIQWEEACERLKEYSGTQDLD 658



>gi|501306141|dbj|GAC95226.1| glycyl-tRNA synthetase [Pseudozyma hubeiensis SY62]
          Length = 721

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 225/322 (69%), Gaps = 3/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   RLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 401 RIYLFLVKIGIDATRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 460

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ LVV++   EP +YD  V  I KK  GPK ++++K VE+ +            
Sbjct: 461 HSKRTKKDLVVQKAHKEPKVYDAWVPTIVKKNIGPKFKKDAKLVEEAILEMNQKQLEELQ 520

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +G+    V    G  +E+T++ +T++ +T  E VRE+TPNVIEPSFGIGRI YSL+
Sbjct: 521 SKLKNGSAPLSV--CTGQTFELTTDVVTVEMKTIRETVREFTPNVIEPSFGIGRIFYSLL 578

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR +D+ R VLS PP VAP K L+VP+S+N     LV ++++++R   +A +VDD
Sbjct: 579 EHSFWTRAEDQDRGVLSLPPLVAPIKALIVPISSNEKLAPLVKQVSRKLRSAGVASRVDD 638

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPFA T+DF S++  T+TLRERDST Q    ID ++ V++ L +
Sbjct: 639 SNASIGRRYARNDELGTPFACTLDFASLSKGTMTLRERDSTAQRIGAIDQVIDVIRQLCD 698

Query: 301 ESTTWEKVMETYPTFT-QQELD 321
            S  WEK  +  P ++ QQ++D
Sbjct: 699 GSLDWEKACKILPEYSGQQDVD 720



>gi|50422167|ref|XP_459646.1| DEHA2E07722p [Debaryomyces hansenii CBS767]
 gi|49655314|emb|CAG87877.1| DEHA2E07722p [Debaryomyces hansenii CBS767]
          Length = 655

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 220/305 (72%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+ P RLRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDL+V
Sbjct: 335 RIYSFLIKIGVDPSRLRFRQHMSNEMAHYAADCWDAELHTSYGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLVVR+ L EP++ +K  + I KK FGPK R+++ TVE++L +          
Sbjct: 395 HSARTNEKLVVRQPLPEPVLVEKYEVNIAKKKFGPKFRKDAGTVENWLLARTQCELEDLC 454

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + N       +  N  E+ +E++ I++   TEH+RE+TPNVIEPSFGIGRILYS+ 
Sbjct: 455 KELNENNKIVFKIDSIPNSIELDTEFVKIEKVKRTEHIREFTPNVIEPSFGIGRILYSIF 514

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W R +D+ R+VLS PP VAP K LLVPLS+N     +V +++  +RK  +  KVDD
Sbjct: 515 EHQFWARPEDKDRTVLSLPPLVAPTKVLLVPLSSNAELQPIVKKISAFLRKEQVPFKVDD 574

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG+RYARNDELGTPF ITIDF SV D ++TLR+RDSTKQ+R +++ I++ +KD+  
Sbjct: 575 SSASIGKRYARNDELGTPFGITIDFDSVKDESVTLRDRDSTKQVRGSLEDIVEAIKDIAY 634

Query: 301 ESTTW 305
            + +W
Sbjct: 635 NNVSW 639



>gi|255943789|ref|XP_002562662.1| Pc20g01010 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587397|emb|CAP85430.1| Pc20g01010 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1334

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQSFLLKLGVDPAKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H ++T   LVVR+  AEP+  ++  +++ KK FGP+ ++++KTVE  + +          
Sbjct: 395 HKDKTGAPLVVRQTRAEPLRIEEYQIDLEKKKFGPRFKKDAKTVEAAIEALSQDLREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG     V G    + EI  + + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 455 LDLEKDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSV 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEH YW R  DE R VLSFPP +AP K LLVPLS + +F  L   L  ++RK  ++ +VD
Sbjct: 515 IEHSYWYRAGDETRGVLSFPPAIAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF +T+DFQSV D T TLR+RD+TKQ+R + D ILQ +K L+
Sbjct: 575 DSSASIGKRYSRNDELGTPFGVTVDFQSVQDNTFTLRDRDTTKQVRASEDEILQAVKSLV 634

Query: 300 EESTTWEKVMETYP 313
           E   TWE + +  P
Sbjct: 635 EGDETWEDIRKRLP 648



>gi|85084305|ref|XP_957291.1| glycyl-tRNA synthetase 1 [Neurospora crassa OR74A]
 gi|28918380|gb|EAA28055.1| glycyl-tRNA synthetase 1 [Neurospora crassa OR74A]
          Length = 663

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 221/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 336 RIHLFLKKIGVDQSKIRFRQHMGNEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSX-XXXXXXXX 119
           H+ +T   LVVRE L  P I +K   EIN K FGP  R+++KTVE  + +          
Sbjct: 396 HAKKTGAPLVVRETLETPEIVEKWEPEINSKKFGPTFRKDAKTVEAAILALPQEELAKLA 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG    + E++ + + I+ +  T ++REYTPNVIEPSFGIGRILYSL
Sbjct: 456 EELKTNGKIVVDVPGVGDGKVEVSKDLVAIEWKKHTINIREYTPNVIEPSFGIGRILYSL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R+ DE R V+SFPP VAP K L+VP+S+   F   V  L++++R + I+ +VD
Sbjct: 516 LEHNYWVREGDEARGVISFPPAVAPVKVLIVPISSKAEFAPHVRRLSQKLRSVGISSRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIGRRYARNDELGTPF +TIDFQ++ D T TLRERDST+Q+R   + I+  +K L+
Sbjct: 576 DSSASIGRRYARNDELGTPFGLTIDFQTLQDGTFTLRERDSTRQVRAEEEKIVDAIKALV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E S TW+ V    P F  QEL+
Sbjct: 636 EGSKTWQDVESELPIFEGQELE 657



>gi|327300907|ref|XP_003235146.1| glycyl-tRNA synthetase [Trichophyton rubrum CBS 118892]
 gi|326462498|gb|EGD87951.1| glycyl-tRNA synthetase [Trichophyton rubrum CBS 118892]
          Length = 654

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDAELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE+ + +          
Sbjct: 393 HKKKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVENAIEALTQDMREKLS 452

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G    + EI  + + I+++   E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIEVDGVGEGKVEIGKDLVQIEKRMRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R VLSFPP VAP K LLVPLS + +F  L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARGVLSFPPAVAPTKVLLVPLSTHASFQPLIQRLTLKLRRLGVSNRVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L+
Sbjct: 573 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLV 632

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE V +  P FT QE++
Sbjct: 633 DGEETWEDVFKRLPEFTGQEVE 654



>gi|238879014|gb|EEQ42652.1| glycyl-tRNA synthetase 1 [Candida albicans WO-1]
          Length = 652

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 218/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+  +RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLVKIGVDTNRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLV R+ LAEP   +   +EI KK FGPK R+++ TVE +LTS          
Sbjct: 393 HSARTGEKLVARQTLAEPRTVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEDLG 452

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G    ++ G +G+  E+  + + I +   TEHVRE+ PNVIE SFGIGRILYS+
Sbjct: 453 KELSEKGKIVAQIKGVEGD-VELDGDLIKIDKVKRTEHVREFVPNVIELSFGIGRILYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R DD  R VLS PP VAP K LLVPLSNN     +V ++++ +RK  I  KVD
Sbjct: 512 FEHQFWCRPDDADRGVLSLPPIVAPTKVLLVPLSNNSELQPIVKKVSQALRKEKIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SV D ++TLRERDSTKQ+R +I  I++ +KD+ 
Sbjct: 572 DSSASIGKRYARNDELGTPFGITIDFDSVKDDSVTLRERDSTKQVRGSIQEIVEAIKDIT 631

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+       F  Q
Sbjct: 632 YNDGTWEEGTAKLKPFEGQ 650



>gi|295660511|ref|XP_002790812.1| glycyl-tRNA synthetase [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281365|gb|EEH36931.1| glycyl-tRNA synthetase [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 655

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 334 RIQLFLLKIGIDESKIRMRQHMQNEMAHYAKDCWDAELFTTYGWIECVGCADRSAYDLTV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE  +EP+  ++  ++++KK FGP+ R++SK VE  + +          
Sbjct: 394 HKNKTGAPLFVRETRSEPLRIEEWQIDLDKKKFGPRFRKDSKAVEAAVNALSQDLRAKLS 453

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 454 LDLKENGKIEIDVDGVRSGKVELEKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 513

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSNNP+F  LV  L  ++R+L ++ +VD
Sbjct: 514 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNNPSFQPLVHRLTLKLRRLGVSNRVD 573

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 574 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICKAVKSLV 633

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TWE + +  P F  Q+++
Sbjct: 634 DGEETWEDIKKRLPEFVSQDVE 655



>gi|336257695|ref|XP_003343671.1| hypothetical protein SMAC_08842 [Sordaria macrospora k-hell]
 gi|380091904|emb|CCC10633.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 733

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 219/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 406 RIHLFLKKIGIDQSKIRFRQHMGNEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLTV 465

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   L+VR+ L  P I +K   EIN K FGP  R+++KTVE   L           
Sbjct: 466 HAKKTGAPLIVRQTLETPEIVEKWDAEINSKKFGPAFRKDAKTVEAAILALSQEELAKLA 525

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG    + +++ + L I+ +  T ++REYTPNVIEPSFGIGRILYSL
Sbjct: 526 EELKTNGKIVIDVPGVGEGKVDVSKDLLAIEWKKHTINIREYTPNVIEPSFGIGRILYSL 585

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R+ DE R V+SFPP VAP K L+VPLS+   F   V  L++++R + I+ +VD
Sbjct: 586 LEHNYWVREGDEARGVISFPPAVAPVKVLIVPLSSKDEFAPHVRRLSQKLRSVGISSRVD 645

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIGRRYARNDELGTPF +TIDFQ++ D T TLRERDST+Q+R     I+  +K L+
Sbjct: 646 DSSASIGRRYARNDELGTPFGLTIDFQTLQDGTFTLRERDSTRQVRAEEAKIVDAIKALV 705

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E S TW+ +    P F  QEL+
Sbjct: 706 EGSKTWQDIESELPVFEGQELE 727



>gi|388854474|emb|CCF51861.1| probable glycine--tRNA ligase GRS1 [Ustilago hordei]
          Length = 681

 Score =  358 bits (920), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P RLRFRQHM NEMAHYA DCWDA+I  SYGWIECVGCADRSAYDLTV
Sbjct: 361 RIYLFLVKIGIDPSRLRFRQHMSNEMAHYASDCWDAEIQTSYGWIECVGCADRSAYDLTV 420

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK++LVV++   E  +YDK V  I KK  GPK ++++K VE+ +            
Sbjct: 421 HSKRTKKELVVQKAHKEAKVYDKLVATIVKKNIGPKFKKDAKMVEEAILEMDQNKLAELE 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G  +  +    G  +E+T++ +T++ +T  E VRE+TPNVIEPSFGIGRI YSL+
Sbjct: 481 SQLKKGAASLTI--CTGQTFELTTDVVTVEMKTIRETVREFTPNVIEPSFGIGRIFYSLL 538

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR +DE R VLS PP VAP K L+VP+S+N     LV ++++++R   +A + DD
Sbjct: 539 EHSFWTRAEDEDRGVLSLPPLVAPIKALIVPISSNEKLAPLVKQVSRKLRSAGLACRADD 598

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPFA T+DF S++  T+TLRERDST Q    ID +++V++ L +
Sbjct: 599 SNASIGRRYARNDELGTPFACTLDFASLSKGTMTLRERDSTAQRIGPIDQVIEVIRQLCD 658

Query: 301 ESTTWEKVMETYPTFTQQE 319
            S  W+   +  P ++ Q+
Sbjct: 659 GSLDWQGACKVLPEYSGQQ 677



>gi|388583196|gb|EIM23498.1| glycyl-tRNA synthetase [Wallemia sebi CBS 633.66]
          Length = 649

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 218/308 (70%), Gaps = 1/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI  DRLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 331 RINLFLQKIGINKDRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 390

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT + LVVRE L E  I +K   EINKK FGP  R N K VE  + +          
Sbjct: 391 HAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFGPTFRANQKIVESTIFALDQPRLECIK 450

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D  G + V   DGN+YE+T E LTI+++TF E  RE+TPNVIEPSFGIGRILY+L+
Sbjct: 451 KEF-DEQGKSDVQAADGNKYELTPELLTIEKKTFKETKREFTPNVIEPSFGIGRILYALL 509

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH ++ R+ DE R+VL FPP VAP K L+VP+SN+  F  ++ +++ ++RK  +A +VDD
Sbjct: 510 EHSFYAREQDESRTVLGFPPLVAPIKALVVPISNSKEFEPIIKDISLQLRKNGVASRVDD 569

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG+RYARNDELGTP+ IT+DF +V ++TITLRERD+T+Q    ID ++  L  L +
Sbjct: 570 SSATIGKRYARNDELGTPYGITVDFATVKNKTITLRERDTTEQKIGTIDQVIDTLVKLSK 629

Query: 301 ESTTWEKV 308
               W +V
Sbjct: 630 SEIEWSQV 637



>gi|242794846|ref|XP_002482459.1| glycyl-tRNA synthetase [Talaromyces stipitatus ATCC 10500]
 gi|218719047|gb|EED18467.1| glycyl-tRNA synthetase [Talaromyces stipitatus ATCC 10500]
          Length = 698

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 221/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL K+G+   +LRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDLTV
Sbjct: 377 RIQQFLLKIGVDYSKLRFRQHMANEMAHYAADCWDAELHTSYGWIECVGCADRSAYDLTV 436

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE L EP ++++  + I K  FGP+ ++++K VE  + S          
Sbjct: 437 HKNKTGAPLFVREALPEPKVFEQWQVNITKSKFGPRFKKDAKKVEAAIESLTEDLREKLS 496

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G DG + E+  + + I+++T T+HVREYTPNV+EPSFGIGRILYSL
Sbjct: 497 LDLAKNGKIEIDVEGIDGGKAELDKDLVAIEKKTVTQHVREYTPNVVEPSFGIGRILYSL 556

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R  DE R VLSFPP V+P K LLVPLS + +F   V  L  + R+  I+ KVD
Sbjct: 557 LEHSYWHRAGDEARGVLSFPPVVSPTKVLLVPLSTHESFVPFVKRLGLKFRRAGISSKVD 616

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS+SIG+RYARNDELGTPF ITIDFQSV D T TLR+RDSTKQ+R   D ILQ +K ++
Sbjct: 617 DSSSSIGKRYARNDELGTPFGITIDFQSVKDNTFTLRDRDSTKQVRATEDEILQAVKSMV 676

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TW  V +  P FT QE D
Sbjct: 677 DGEETWADVAKRLPEFTSQETD 698



>gi|325091800|gb|EGC45110.1| glycyl-tRNA synthetase [Ajellomyces capsulatus H88]
          Length = 656

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 223/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMMNEMAHYAQDCWDAELFTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H NRT   L VRE  AEP+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 395 HKNRTGAPLFVRETRAEPLRIEEWQIDLDKKKFGPRFKKDGKIVEAAVNALTQDLREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLKQNGKIEIDVEGVGSGKVELGKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSN+P+F  L+  L  ++R+L ++ KVD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNHPSFQPLIHRLTLKLRRLGVSNKVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICEAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    WE + +  P F  Q+++
Sbjct: 635 DGEEVWEDIKKRLPEFVSQDVE 656



>gi|240277283|gb|EER40792.1| glycyl-tRNA synthetase [Ajellomyces capsulatus H143]
          Length = 656

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 224/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMMNEMAHYAQDCWDAELFTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H NRT   L VRE  AEP+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 395 HKNRTGAPLFVRETRAEPLRIEEWQIDLDKKKFGPRFKKDGKIVEAAVNALTQDLREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G   ++ E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLKQNGKIEIDVEGVGSSKVELGKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSN+P+F  L+  L  ++R+L ++ KVD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNHPSFQPLIHRLTLKLRRLGVSNKVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICEAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    WE + +  P F  Q+++
Sbjct: 635 DGEEVWEDIKKRLPEFVSQDVE 656



>gi|261189484|ref|XP_002621153.1| glycyl-tRNA synthetase [Ajellomyces dermatitidis SLH14081]
 gi|239591730|gb|EEQ74311.1| glycyl-tRNA synthetase [Ajellomyces dermatitidis SLH14081]
 gi|239608956|gb|EEQ85943.1| glycyl-tRNA synthetase [Ajellomyces dermatitidis ER-3]
 gi|327354027|gb|EGE82884.1| glycyl-tRNA synthetase [Ajellomyces dermatitidis ATCC 18188]
          Length = 656

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 223/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMMNEMAHYAQDCWDAELFTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE  AEP+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 395 HKNKTGAPLFVRETRAEPLRIEEWQIDLDKKKFGPRFKKDGKLVEAAVNALTQDLREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLKQNGKIEIDVEGVGSGKVELEKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSN+P+F  LV  L  ++R+L ++ +VD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNHPSFQPLVHRLTLKLRRLGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICKAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE +    P F  Q+++
Sbjct: 635 EGEETWEDIKNRLPEFVSQDVE 656



>gi|225562196|gb|EEH10476.1| glycyl-tRNA synthetase [Ajellomyces capsulatus G186AR]
          Length = 656

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 223/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMMNEMAHYAQDCWDAELFTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H NRT   L VRE  AEP+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 395 HKNRTGAPLFVRETRAEPLRIEEWQIDLDKKKFGPRFKKDGKIVEAAVNALTQDLREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLKQNGKIEIDVEGVGSGKVELGKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSN+P+F  L+  L  ++R+L ++ KVD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNHPSFQPLIHRLTLKLRRLGVSNKVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICEAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    WE + +  P F  Q+++
Sbjct: 635 DGEEVWEDIKKRLPEFVSQDVE 656



>gi|149244764|ref|XP_001526925.1| glycyl-tRNA synthetase 1 [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449319|gb|EDK43575.1| glycyl-tRNA synthetase 1 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 652

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 217/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G  P RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 335 RIYAFLVKIGTDPSRLRFRQHMSNEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+ RT EKLV R+ L+EP   ++  +E+ KK FGPK R+++ TVE +LTS          
Sbjct: 395 HAARTGEKLVARQMLSEPRTVEEYEIELQKKKFGPKFRKDAGTVEKWLTSRTQCELEDLS 454

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T  + G +G   E+ S+ + I +   TEHVREY PNVIEPSFGIGRILYS+
Sbjct: 455 KELQENGKITASIKGVEGT-VELDSDLIKIAKVKRTEHVREYIPNVIEPSFGIGRILYSV 513

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH YW RKD+ +R VLS PP VAP K L+VPLSN+     +V +++  ++K  I  K+D
Sbjct: 514 FEHQYWARKDEAERGVLSLPPLVAPTKVLIVPLSNSAELQPMVKKVSTILKKEKIPFKID 573

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF+SV D ++TLRERDSTKQ+R +I  ++  +KD+ 
Sbjct: 574 DSGASIGKRYARNDELGTPFGITIDFESVQDESVTLRERDSTKQVRGSIQAVVDAIKDIT 633

Query: 300 EESTTWEKVMETYPTFTQQ 318
                W++       F  +
Sbjct: 634 YSDGNWKEGTAHLAAFNSE 652



>gi|400599140|gb|EJP66844.1| glycyl-tRNA synthetase [Beauveria bassiana ARSEF 2860]
          Length = 662

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 227/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   +LRFRQHM NEMAHYACDCWDA++  + GW+ECVGCADRSAYDLTV
Sbjct: 334 RIHLFLQKIGVDMSKLRFRQHMANEMAHYACDCWDAELLTTTGWVECVGCADRSAYDLTV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE L +P + ++  L+I+KK FGP  ++++K VE  L +          
Sbjct: 394 HAKKTGAPLLVRERLEQPRVIEEWQLDIDKKKFGPLFKKDAKAVETALEATTQEQREAFS 453

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               +G   +  VPG    + E+TS+ + I+ +   E+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 454 KQLAEGGKISLDVPGVGDGKAEVTSDSIKIEFRKRVENTREFTPNVIEPSFGIGRILYSL 513

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR  D   E R VLSFPP VAP K LLVPLS+N  F   V +L++R+R + I+ 
Sbjct: 514 IEHNFWTRGSDGSDEARGVLSFPPPVAPTKVLLVPLSSNAQFKPEVRKLSQRLRAMGISS 573

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  IT+DFQ++ D+TITLR+RDST Q+R +   IL+ +K
Sbjct: 574 RVDDSSASIGKRYSRNDELGTPLGITVDFQTLQDQTITLRDRDSTTQVRADEARILEAIK 633

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  W K+ E  P F  QE++
Sbjct: 634 SLVDGSKNWAKIQEELPKFEGQEVE 658



>gi|50553074|ref|XP_503947.1| YALI0E14597p [Yarrowia lipolytica]
 gi|49649816|emb|CAG79540.1| YALI0E14597p [Yarrowia lipolytica CLIB122]
          Length = 656

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/318 (52%), Positives = 220/318 (69%), Gaps = 3/318 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ PDRLRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLIKIGVNPDRLRFRQHMSNEMAHYATDCWDAELHTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  RTK KL V++ L  P++ DK V E +KK FGP L++ +K VE++  S          
Sbjct: 393 HEARTKVKLQVQQKLDAPLVEDKFVCEYDKKKFGPLLKKAAKPVEEWFESRTQCELEDLA 452

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                G     ++ G +    E+   ++ I+++T T HVR+YTPNVIEPSFGIGRILYSL
Sbjct: 453 KALEAGKIVLPEIEGVEVAGTELDKSHIKIEKKTITTHVRDYTPNVIEPSFGIGRILYSL 512

Query: 180 IEHVYWTRKDDEQ--RSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           IEH +WTR +D    + VLSFPPR+AP K L+VPLS+         E++K++R+  I+ K
Sbjct: 513 IEHCFWTRPEDASGAKGVLSFPPRIAPTKVLVVPLSSQKELAPFTQEVSKKLRQARISAK 572

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VDDSS SIG+RYARNDE+GTPF IT+DF +V D ++TLRERDST+Q+R +ID ++  +  
Sbjct: 573 VDDSSASIGKRYARNDEMGTPFGITVDFDTVKDNSVTLRERDSTRQVRGSIDAVIAAINV 632

Query: 298 LLEESTTWEKVMETYPTF 315
           +  +   WE+  +    F
Sbjct: 633 MTADDVAWEEATKDLTPF 650



>gi|365982737|ref|XP_003668202.1| hypothetical protein NDAI_0A08050 [Naumovozyma dairenensis CBS 421]
 gi|343766968|emb|CCD22959.1| hypothetical protein NDAI_0A08050 [Naumovozyma dairenensis CBS 421]
          Length = 663

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 169/319 (52%), Positives = 222/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 340 RIYLFLIKIGVDKTKLRFRQHMANEMAHYAADCWDGELQTSYGWIECVGCADRSAYDLTV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TKEK+VVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 400 HSKKTKEKMVVRQKLDTPIEVTKWEIDLTKKLFGPKFRKDAPKVEAFLLNLSQEELEAKS 459

Query: 121 XXXX-DGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G +G   E+  +++TI+++T  EHVREY PNVIEPSFGIGRI+YS+
Sbjct: 460 EELKRNGKIVIEVEGVEGAA-ELDDKFITIEKRTKVEHVREYVPNVIEPSFGIGRIIYSV 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH YW R +D  R VLSFPP VAP K LLVPLSN+     +  E++K +RK  I  KVD
Sbjct: 519 FEHSYWNRPEDAARGVLSFPPLVAPSKVLLVPLSNHKDLQPVTKEVSKILRKEQIPFKVD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+SV D ++TLRERDSTKQ+R +I+ I++ ++D+ 
Sbjct: 579 DSGVSIGKRYARNDELGTPFGVTIDFESVRDNSVTLRERDSTKQVRGSIEEIIKAIRDIT 638

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +W++  +    F  Q
Sbjct: 639 YNGVSWDEGTKNLKPFVSQ 657



>gi|116207946|ref|XP_001229782.1| hypothetical protein CHGG_03266 [Chaetomium globosum CBS 148.51]
 gi|88183863|gb|EAQ91331.1| hypothetical protein CHGG_03266 [Chaetomium globosum CBS 148.51]
          Length = 677

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 172/326 (52%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 348 RIHLFLKKIGIDQSKIRFRQHMANEMAHYACDCWDAELLTSTGWVECVGCADRSAYDLSV 407

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   L+VR+ L EP I ++  +EI KK FGP  +++ KT+E   L +         
Sbjct: 408 HAKKTGAPLIVRQRLDEPKIIEEWAVEIEKKKFGPFYKKDGKTIEAAILATTQEERGKLA 467

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    KVP       E++ + L IK Q   E++REYTPNVIEPSFGIGRILYSL
Sbjct: 468 KDLEENGKTIVKVPSVGDGNVEVSKDLLAIKWQKRVENIREYTPNVIEPSFGIGRILYSL 527

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSFPP VAP K L+VPLS++  F   V +L++++R   I+ 
Sbjct: 528 MEHNYWTRASEGGDEARGVLSFPPAVAPTKVLIVPLSSHKDFAPAVRKLSQKLRSAGISS 587

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTPF IT+DFQ+V D TITLRERDST+Q+R   D I++ ++
Sbjct: 588 RVDDSSASIGKRYSRNDELGTPFGITVDFQTVKDDTITLRERDSTRQVRAEEDKIIEAIR 647

Query: 297 DLLEESTTWEKVMETYPTF-TQQELD 321
            L+E + TW+ +    P F  QQE++
Sbjct: 648 ALVEGTKTWQDIESELPLFEGQQEVE 673



>gi|225685037|gb|EEH23321.1| glycyl-tRNA synthetase [Paracoccidioides brasiliensis Pb03]
          Length = 656

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 222/320 (69%), Gaps = 1/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMQNEMAHYAKDCWDAELFTTYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE  +EP+  ++  ++++KK FGP+ R++ K VE  + +          
Sbjct: 395 HKNKTGAPLFVRETRSEPLRIEEWQIDLDKKKFGPRFRKDGKAVEAAVNALSQDLRAKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLKENGKIEIDVDGVRSGKVELEKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSNNP+F  LV  L  ++R+L ++ +VD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNNPSFQPLVHRLTLKLRRLGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICKAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQE 319
           E   TW+ + +  P F  Q+
Sbjct: 635 EGEETWDDIKKRLPEFVSQD 654



>gi|226294349|gb|EEH49769.1| glycyl-tRNA synthetase [Paracoccidioides brasiliensis Pb18]
          Length = 656

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 222/320 (69%), Gaps = 1/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGIDESKIRMRQHMQNEMAHYAKDCWDAELFTTYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE  +EP+  ++  ++++KK FGP+ R++ K VE  + +          
Sbjct: 395 HKNKTGAPLFVRETRSEPLRIEEWQIDLDKKKFGPRFRKDGKAVEAAVNALSQDLLAKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 455 LDLTENGKIEIDVDGVRSGKVELEKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R DDE R VLSFPP VAP K LLVPLSNNP+F  LV  L  ++R+L ++ +VD
Sbjct: 515 MEHVYWSRPDDEARGVLSFPPIVAPTKVLLVPLSNNPSFQPLVHRLTLKLRRLGVSNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 575 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICKAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQE 319
           E   TW+ + +  P F  Q+
Sbjct: 635 EGEETWDDIKKRLPEFVSQD 654



>gi|190348873|gb|EDK41420.2| hypothetical protein PGUG_05518 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 651

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 173/322 (53%), Positives = 223/322 (69%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ PDRLRFRQH+ NEMAHYA DCWDA++  S+GWIECVGCADRSAYDL+V
Sbjct: 330 RIYLFLVKIGVNPDRLRFRQHLSNEMAHYAADCWDAELETSFGWIECVGCADRSAYDLSV 389

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           HS RT EKLVVR+ L  P+  +K  + IN+K FGP  R+++K VE+ L +          
Sbjct: 390 HSARTNEKLVVRKALPSPVTVEKFEVSINRKKFGPSFRKDAKAVENALLNRTQCELEDLA 449

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  +  V G       ITSE  TI++ T TEH+RE+TPNVIEPSFGIGRI+YS+
Sbjct: 450 AELKKEGKVSLNVEGLS-EPAVITSELATIEKVTRTEHIREFTPNVIEPSFGIGRIIYSI 508

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHV+W+R +D+ R VLS PP VAP K LLVPLS++   + +V +++  +RK  I  KVD
Sbjct: 509 FEHVFWSRPEDKDRCVLSLPPAVAPTKVLLVPLSSHADLSPIVKKVSAYLRKEQIPFKVD 568

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SV D +ITLRERDSTKQ+R +++ ++  +K + 
Sbjct: 569 DSSASIGKRYARNDELGTPFGITIDFDSVKDASITLRERDSTKQVRGSLEDVVAAIKAVT 628

Query: 300 EESTTWEKVMETYPTFTQQELD 321
               +W +  +    F  Q  D
Sbjct: 629 YNDESWAEATKKLTPFEGQSGD 650



>gi|444317783|ref|XP_004179549.1| hypothetical protein TBLA_0C02180 [Tetrapisispora blattae CBS 6284]
 gi|387512590|emb|CCH60030.1| hypothetical protein TBLA_0C02180 [Tetrapisispora blattae CBS 6284]
          Length = 663

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 227/320 (70%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL  +G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSA+DLTV
Sbjct: 340 RIYLFLVSIGVDDTKLRFRQHMANEMAHYATDCWDGELLTSYGWIECVGCADRSAFDLTV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TKEK+VVR+ L +P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 400 HSKKTKEKMVVRQKLEKPIEVTKYEIDLTKKLFGPKFRKDAPKVEAFLLNLSQEELEKNA 459

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  T  V G + ++ E+  +++ I+++T  EHVREY PNVIEPSFGIGRI+Y++
Sbjct: 460 KLLKDNGKITFNVEGVE-SEVELDEKFVVIEKRTKIEHVREYVPNVIEPSFGIGRIIYAV 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  RSVLSFPP VAP K LLVPLSNN     +  E++K +RK  I  KVD
Sbjct: 519 FEHSFWSRPEDTARSVLSFPPLVAPTKVLLVPLSNNKELVPVTTEVSKILRKEKIPFKVD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RY+RNDELGTPF ITIDF+S  D+++TLRERDSTKQ+R +I+ +++ +K++ 
Sbjct: 579 DSGVSIGKRYSRNDELGTPFGITIDFESAKDKSVTLRERDSTKQVRGSIEEVIKAIKEIT 638

Query: 300 EESTTWEKVMETYPTFTQQE 319
            E ++WE+  +    FT  +
Sbjct: 639 YEGSSWEESTKNLTPFTSTQ 658



>gi|319411507|emb|CBQ73551.1| probable glycine--tRNA ligase GRS1 [Sporisorium reilianum SRZ2]
          Length = 681

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   RLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 361 RIYLFLVKIGIDATRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 420

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TK+ LVV++   EP +YD  V  I KK  GPK ++++K VE+ +            
Sbjct: 421 HSKKTKKDLVVQKAHKEPKVYDALVPTIVKKNIGPKFKKDAKIVEEAILEMDQKKLAELE 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +G+    V    G  +E+T++ +T++ +T  E VRE+TPNVIEPSFGIGRI YSL+
Sbjct: 481 SKLKNGSAPLTV--CTGQTFELTTDVVTVEMKTIRETVREFTPNVIEPSFGIGRIFYSLL 538

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR +D+ R VLS PP VAP K L+VP+S+N     LV ++++++R   +A +VDD
Sbjct: 539 EHSFWTRAEDQDRGVLSLPPLVAPIKALIVPISSNEKLAPLVKQVSRQLRSAGVASRVDD 598

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPFA T+DF S++  T+TLRERDST Q    ID ++ V++ L +
Sbjct: 599 SNASIGRRYARNDELGTPFACTLDFASLSKGTMTLRERDSTAQRIGPIDQVIDVIRQLCD 658

Query: 301 ESTTWEKVMETYPTFTQQE 319
            S  WE   +  P ++ Q+
Sbjct: 659 ASLDWEGACKILPEYSGQQ 677



>gi|189190276|ref|XP_001931477.1| glycyl-tRNA synthetase [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973083|gb|EDU40582.1| glycyl-tRNA synthetase [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 657

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 220/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIQLFLLKIGVDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  RT   L+VRE   EP+  ++   +++KK FGPK +++ KTVE  + +          
Sbjct: 396 HMKRTGAPLIVRETRKEPLQIEEWQCDLDKKRFGPKFKKDGKTVEAAIDALSQEVREKLS 455

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VP     + EI  E +TI+++T  E +REYTPNVIEPSFGIGRI Y+L
Sbjct: 456 LDLEKEGKIVIDVPEVGNGKVEIPKELITIEKRTRVETMREYTPNVIEPSFGIGRIFYAL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHVYWTR+ DE R+VLSFPP VAP K L+VPLS+NP F   V +L  ++R+L I+ +VD
Sbjct: 516 CEHVYWTREQDEARAVLSFPPAVAPTKVLIVPLSSNPDFEPFVRKLKDKLRRLGISNRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RYARNDELGTP  ITIDFQS+ D T TLR+RD+T+Q+R ++D I + + +++
Sbjct: 576 ASGASIGKRYARNDELGTPLGITIDFQSIKDNTFTLRDRDTTEQVRSSLDEIAKAIANIV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    W  V    P F  QE+D
Sbjct: 636 KGEEKWSDVAARLPKFEGQEVD 657



>gi|50287985|ref|XP_446421.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525729|emb|CAG59348.1| unnamed protein product [Candida glabrata]
          Length = 663

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+   +LRFRQHM NEMAHYA DCWDA++  S+GWIECVGCADRSAYDLTV
Sbjct: 342 RIYLFLIKIGVDDTKLRFRQHMANEMAHYAADCWDAELKTSFGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTS-XXXXXXXXX 119
           H+N+TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE YLT           
Sbjct: 402 HANKTKEKLVVRQKLETPVEVTKYEIDLTKKLFGPKFRKDAPKVEAYLTELSQEELEKKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G +G + E+  +++ I+++T  EHVRE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 EELKTNGKIVFTVKGIEG-EIELDDKFVVIEKRTKVEHVREFVPNVIEPSFGIGRIIYSI 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  R+VLSFPP VAP K LLVPLSN+     +  +++K +RK  IA +VD
Sbjct: 521 FEHSFWSRPEDTARAVLSFPPLVAPTKVLLVPLSNHKDLAPVTAQVSKILRKEQIAFRVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF SV D ++TLRERDSTKQ+R +++ +++ ++++ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGITIDFDSVKDGSVTLRERDSTKQVRGSVEAVIKAVREIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLAPFVSQ 659



>gi|258571682|ref|XP_002544644.1| glycyl-tRNA synthetase [Uncinocarpus reesii 1704]
 gi|237904914|gb|EEP79315.1| glycyl-tRNA synthetase [Uncinocarpus reesii 1704]
          Length = 641

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 226/322 (70%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+GI   ++R RQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 320 RIYMFLMKIGIDQSKVRMRQHMANEMAHYATDCWDAELLTSYGWIECVGCADRSAYDLSV 379

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVRE  AEP+  ++  ++I++K FGP+ +++ KTVE  + +          
Sbjct: 380 HKKKTGAPLVVRETRAEPLRIEEWQIDIDRKKFGPRFKKDGKTVEAAIDALSQELREKLA 439

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  + +V   +  + E+  + + I+++T  E+VREYTPNVIEPSFGIGRILY L
Sbjct: 440 LDLTKDGKISVEVENVNDGKVELGKDLIQIEKRTRVENVREYTPNVIEPSFGIGRILYCL 499

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +E  YW+R+ DE R VLSFPP VAP K LLVPLS++ +F  LV +L  ++R++ ++ +VD
Sbjct: 500 MEQTYWSREGDEARGVLSFPPIVAPTKVLLVPLSSHSSFQPLVRQLTLKLRRMGVSNRVD 559

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLR+RDS KQ+R + D I + +K L+
Sbjct: 560 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSMKQVRASEDEICKAVKSLV 619

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V +  P F  QE++
Sbjct: 620 EGDETWEDVRKRLPEFLGQEVE 641



>gi|212536096|ref|XP_002148204.1| glycyl-tRNA synthetase [Talaromyces marneffei ATCC 18224]
 gi|210070603|gb|EEA24693.1| glycyl-tRNA synthetase [Talaromyces marneffei ATCC 18224]
          Length = 657

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 175/320 (54%), Positives = 224/320 (70%), Gaps = 1/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL K+G+   +LRFRQHM NEMAHYA DCWDA++H SYGWIECVGCADRSAYDLTV
Sbjct: 336 RIQQFLLKIGVDYSKLRFRQHMANEMAHYAADCWDAELHTSYGWIECVGCADRSAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L VRE L EP ++++  ++I K  FGP+ ++++K VE  + +          
Sbjct: 396 HKNKTGAPLFVREALPEPRVFEEWQIDIAKSKFGPRFKKDAKKVEAAIDALSEELREKLS 455

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G +G + E+ ++ +TI+++T T+H+REYTPNV+EPSFGIGRILYSL
Sbjct: 456 LDLAQNGKIEIDVEGIEGGKAELDNDLVTIEKRTVTQHIREYTPNVVEPSFGIGRILYSL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R  DE R VLSFPP V+P K LLVPLS + +F   V  L  + R+  I+ KVD
Sbjct: 516 LEHSYWHRAGDEARGVLSFPPLVSPTKVLLVPLSTHESFVPFVKRLGLKFRRAGISSKVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS+SIG+RYARNDELGTPF ITIDFQSV D T TLR+RDSTKQ+R + D ILQ +K ++
Sbjct: 576 DSSSSIGKRYARNDELGTPFGITIDFQSVKDNTFTLRDRDSTKQVRGSEDEILQAVKSMV 635

Query: 300 EESTTWEKVMETYPTFTQQE 319
           +   TW  V +  P FT QE
Sbjct: 636 DGEETWADVFKRLPEFTSQE 655



>gi|146413054|ref|XP_001482498.1| hypothetical protein PGUG_05518 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 651

 Score =  356 bits (914), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 173/322 (53%), Positives = 223/322 (69%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ PDRLRFRQH+ NEMAHYA DCWDA++  S+GWIECVGCADRSAYDL+V
Sbjct: 330 RIYLFLVKIGVNPDRLRFRQHLLNEMAHYAADCWDAELETSFGWIECVGCADRSAYDLSV 389

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           HS RT EKLVVR+ L  P+  +K  + IN+K FGP  R+++K VE+ L +          
Sbjct: 390 HSARTNEKLVVRKALPSPVTVEKFEVSINRKKFGPSFRKDAKAVENALLNRTQCELEDLA 449

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  +  V G       ITSE  TI++ T TEH+RE+TPNVIEPSFGIGRI+YS+
Sbjct: 450 AELKKEGKVSLNVEGLS-EPAVITSELATIEKVTRTEHIREFTPNVIEPSFGIGRIIYSI 508

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHV+W+R +D+ R VLS PP VAP K LLVPLS++   + +V +++  +RK  I  KVD
Sbjct: 509 FEHVFWSRPEDKDRCVLSLPPAVAPTKVLLVPLSSHADLSPIVKKVSAYLRKEQIPFKVD 568

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF SV D +ITLRERDSTKQ+R +++ ++  +K + 
Sbjct: 569 DSSASIGKRYARNDELGTPFGITIDFDSVKDASITLRERDSTKQVRGSLEDVVAAIKAVT 628

Query: 300 EESTTWEKVMETYPTFTQQELD 321
               +W +  +    F  Q  D
Sbjct: 629 YNDESWAEATKKLTPFEGQSGD 650



>gi|425766566|gb|EKV05172.1| Glycyl-tRNA synthetase [Penicillium digitatum PHI26]
 gi|425781719|gb|EKV19666.1| Glycyl-tRNA synthetase [Penicillium digitatum Pd1]
          Length = 657

 Score =  356 bits (914), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 179/322 (55%), Positives = 224/322 (69%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL KLG+ P +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIQSFLLKLGVDPTKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   LVVR+  AEP+  ++  +E+ KK FGPK ++++KTVE  + +          
Sbjct: 395 HKEKTGAPLVVRQARAEPLRIEEYQIELEKKKFGPKFKKDAKTVEAAVEALSQELREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG     V G    + EI  + + I+++T  E+VREYTPNVIEPSFGIGRILYS+
Sbjct: 455 LDLEKDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSM 514

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEH YW+R  DE R VLSFPP VAP K LLVPLS + +F  L   L  ++RK  I+ +VD
Sbjct: 515 IEHSYWSRAGDETRGVLSFPPAVAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGISNRVD 574

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT+DFQSV D T TLR+RD+TKQ+R + D ILQ +K L+
Sbjct: 575 DSSASIGKRYSRNDELGTPFGITVDFQSVQDSTFTLRDRDTTKQVRASEDEILQAVKSLV 634

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE + +  P FT QE++
Sbjct: 635 EGDETWEDIRKRLPEFTSQEIE 656



>gi|171686512|ref|XP_001908197.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943217|emb|CAP68870.1| unnamed protein product [Podospora anserina S mat+]
          Length = 734

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 227/326 (69%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++RFRQHM NEMAHYACDCWDA++H S GW+ECVGCADRSAYDL+V
Sbjct: 405 RILLFLKKIGIDEKKIRFRQHMDNEMAHYACDCWDAELHTSAGWVECVGCADRSAYDLSV 464

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   LVVR+ L EP+  ++  + I+KK FGP  +++ KT+E+  L +         
Sbjct: 465 HAKKTGAPLVVRQRLEEPITIEEWDIAIDKKNFGPFYKKDGKTIENALLATTQEQRGELV 524

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG +  + E++ + L IK     E+VREYTPNVIEPSFGIGRILYSL
Sbjct: 525 KQLEENGKVVIDVPGVNDGKVEVSKDLLAIKWVKRVENVREYTPNVIEPSFGIGRILYSL 584

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSFPP VAP K L+VPLS+N  FT  V +L++++R   ++ 
Sbjct: 585 MEHNYWTRASEGGDEARGVLSFPPAVAPTKVLIVPLSSNKDFTPEVRKLSQKLRSAGVSS 644

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIG+RY+RNDELGTPF +T+DFQ++ D T+TLRERDST+Q+R   D I+  +K
Sbjct: 645 RIDDSSASIGKRYSRNDELGTPFGVTVDFQTLKDGTVTLRERDSTRQVRAEEDKIIAAIK 704

Query: 297 DLLEESTTWEKVMETYPTF-TQQELD 321
            L+E + TW+ V    P F  QQE++
Sbjct: 705 ALVEGTKTWQDVEGELPIFEGQQEVE 730



>gi|477529238|gb|ENH81002.1| glycyl-trna synthetase [Colletotrichum orbiculare MAFF 240422]
          Length = 663

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 224/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFLAKIGVDMTKVRFRQHMENEMAHYAADCWDAELLTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE L EP ++++  +EI KK FGP  +++ KTVE  L +          
Sbjct: 395 HAKKTGAPLLVRERLDEPRVFEEWQVEIEKKKFGPAFKKDGKTVETALLATSQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     VPG    + +++ + +T++ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 455 KQLTDNGELELDVPGVGDGKVKVSKDLVTVEFRKRVENTREYTPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YW R     DE R VLSFPP +AP K L+VPLS N  F   + ++++++RK+ I+ 
Sbjct: 515 IEHCYWNRATDGGDEARGVLSFPPTIAPTKVLIVPLSANAQFKPFIKKISQKLRKIGISA 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS +IG+RY+RNDELGTP  ITIDFQ+V D TITLR+RDSTKQ+R + DTI+  ++
Sbjct: 575 RVDDSSATIGKRYSRNDELGTPLGITIDFQTVKDNTITLRDRDSTKQVRADEDTIVSAIQ 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  W+ V    P F  QE+D
Sbjct: 635 TLVDGSKEWKDVEAALPAFEGQEVD 659



>gi|341942098|sp|P38088.3|SYG_YEAST RecName: Full=Glycine--tRNA ligase 1, mitochondrial; AltName:
           Full=Diadenosine tetraphosphate synthetase; Short=AP-4-A
           synthetase; AltName: Full=Glycyl-tRNA synthetase 1;
           Short=GlyRS 1; Short=GlyRS1; Flags: Precursor
          Length = 690

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 365 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 424

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 425 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 484

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 485 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 543

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 544 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 603

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 604 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDIT 663

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 664 YNGASWEEGTKDLTPFIAQ 682



>gi|323356077|gb|EGA87882.1| Grs1p [Saccharomyces cerevisiae VL3]
 gi|365767160|gb|EHN08648.1| Grs1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 597

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 272 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 331

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 332 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 391

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 392 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 450

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 451 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 510

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 511 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 570

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 571 YNGASWEEGTKDLTPFIAQ 589



>gi|330443451|ref|NP_009679.2| glycine--tRNA ligase [Saccharomyces cerevisiae S288c]
 gi|329136729|tpg|DAA07239.2| TPA: glycine--tRNA ligase [Saccharomyces cerevisiae S288c]
 gi|392300961|gb|EIW12050.1| Grs1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 667

 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLTPFIAQ 659



>gi|323334582|gb|EGA75956.1| Grs1p [Saccharomyces cerevisiae AWRI796]
          Length = 597

 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 272 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 331

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 332 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 391

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 392 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKIEHVREYVPSVIEPSFGIGRIIYSV 450

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 451 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 510

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 511 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 570

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 571 YNGASWEEGTKDLTPFIAQ 589



>gi|154284101|ref|XP_001542846.1| glycyl-tRNA synthetase 1 [Ajellomyces capsulatus NAm1]
 gi|150411026|gb|EDN06414.1| glycyl-tRNA synthetase 1 [Ajellomyces capsulatus NAm1]
          Length = 582

 Score =  355 bits (911), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 222/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI   ++R RQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 261 RIQLFLLKIGIDETKIRMRQHMMNEMAHYAQDCWDTELFTSYGWIECVGCADRSAYDLTV 320

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H NRT   L VRE  AEP+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 321 HKNRTGASLFVRETRAEPLRIEEWQIDLDKKKFGPRFKKDGKIVEAAVNALTQDLREKLS 380

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + E+  + + I+++T  E++REYTPNVIEPSFGIGRIL  L
Sbjct: 381 LDLKQNGKIEIDVEGVGSGKVELGKDIINIEKRTRVENIREYTPNVIEPSFGIGRILACL 440

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW+R +DE R VLSFPP VAP K LLVPLSN+P+F  L+  L  ++R+L ++ KVD
Sbjct: 441 MEHVYWSRPNDEARGVLSFPPIVAPTKVLLVPLSNHPSFQPLIHRLTLKLRRLGVSNKVD 500

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF IT+DFQSV D T TLRERD+TKQ+R + + I + +K L+
Sbjct: 501 DSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRERDTTKQVRASEEEICEAVKSLV 560

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    WE + +  P F  Q+++
Sbjct: 561 DGEEVWEDIKKRLPEFVSQDVE 582



>gi|151946513|gb|EDN64735.1| glycyl-tRNA synthetase [Saccharomyces cerevisiae YJM789]
          Length = 667

 Score =  355 bits (911), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLTPFIAQ 659



>gi|365762031|gb|EHN03648.1| Grs1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 665

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLENPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLAAKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T KV G D  + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLEADGKFTIKVDGVD-KEVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E++K +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVSKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++++++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVESVIEAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGVSWEEGTKNLVPFVAQ 659



>gi|190408722|gb|EDV11987.1| glycine-tRNA ligase [Saccharomyces cerevisiae RM11-1a]
 gi|207347667|gb|EDZ73764.1| YBR121Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256268958|gb|EEU04303.1| Grs1p [Saccharomyces cerevisiae JAY291]
 gi|323349729|gb|EGA83944.1| Grs1p [Saccharomyces cerevisiae Lalvin QA23]
 gi|349576498|dbj|GAA21669.1| K7_Grs1p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 667

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLTPFIAQ 659



>gi|290878134|emb|CBK39193.1| Grs1p [Saccharomyces cerevisiae EC1118]
          Length = 667

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLTPFIAQ 659



>gi|401839450|gb|EJT42675.1| GRS1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 665

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLENPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLAAKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T KV G D  + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLEADGKFTIKVDGVD-KEVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E++K +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVSKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++++++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVESVIEAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGVSWEEGTKNLVPFVAQ 659



>gi|363751064|ref|XP_003645749.1| hypothetical protein Ecym_3447 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889383|gb|AET38932.1| Hypothetical protein Ecym_3447 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 658

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 217/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+  D+LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL V
Sbjct: 339 RIYQFLIKIGVDSDKLRFRQHMSNEMAHYAADCWDAELKTSYGWIECVGCADRSAYDLNV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +TK  LVVR+ L +P    K  +E+NKK+FGPK R+N+  VE YL            
Sbjct: 399 HARKTKTALVVRQKLDKPREVTKWEIELNKKLFGPKFRKNAPKVESYLLHLSQEELATKS 458

Query: 121 XX-XXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     + G D    E++ E++ I+ +T  EH+REY PNVIEPSFGIGRI+Y++
Sbjct: 459 EQLTSNGKVVFNLEGID-EDIELSHEFIKIEEKTTVEHIREYIPNVIEPSFGIGRIIYAV 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W+R  D  R+VLSFPP VAP K LLVPLS+N     +V E++K +RK  I  KVD
Sbjct: 518 LEHCFWSRPQDTARAVLSFPPLVAPTKVLLVPLSSNDELAPIVTEVSKILRKQQIPFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF+SV D ++TLRERDSTKQ+R +I  +++ + D+ 
Sbjct: 578 DSGVSIGKRYARNDELGTPFGITIDFESVKDGSVTLRERDSTKQVRGSIADVIKAVYDIT 637

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TW+K       F  Q
Sbjct: 638 YNDITWDKGTAHLAPFVSQ 656



>gi|536402|emb|CAA85078.1| GRS1 [Saccharomyces cerevisiae]
 gi|565058|emb|CAA55623.1| probable transfer RNA-Gly synthetase [Saccharomyces cerevisiae]
          Length = 667

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 402 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 462 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 521 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVHHEVAKILRKSQIPFKID 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YNGASWEEGTKDLTPFIAQ 659



>gi|71018157|ref|XP_759309.1| hypothetical protein UM03162.1 [Ustilago maydis 521]
 gi|46099159|gb|EAK84392.1| hypothetical protein UM03162.1 [Ustilago maydis 521]
          Length = 681

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   RLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 361 RIYLFLVKIGIDATRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 420

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ LVV++   EP +YD  V  I KK  GPK ++++K VE+ +            
Sbjct: 421 HSKRTKKDLVVQKAHKEPKVYDALVPTIVKKNLGPKFKKDAKFVEEAILEMNQQQLAKLQ 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                 NG+ ++    G  Y +T++ +T++ +T  E VRE+TPNVIEPSFGIGRI YSL+
Sbjct: 481 RKLK--NGSARLSICTGETYVLTTDVVTVEMKTIRETVREFTPNVIEPSFGIGRIFYSLL 538

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +WTR +D+ R VLS PP VAP K  +VP+S+N   + LV ++++++R   +A +VDD
Sbjct: 539 EHSFWTRAEDQDRGVLSLPPLVAPIKASIVPISSNEKLSPLVKQVSRKLRSAGVASRVDD 598

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPFA T+DF S++  T+TLRERD+T Q    ID ++ V++ L +
Sbjct: 599 SNASIGRRYARNDELGTPFACTLDFASLSKGTMTLRERDTTAQRIGPIDQVIDVIRQLCD 658

Query: 301 ESTTWEKVMETYPTFTQQE 319
            S  WE   +  P ++ Q+
Sbjct: 659 GSLDWEGACKILPEYSGQQ 677



>gi|260943664|ref|XP_002616130.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238849779|gb|EEQ39243.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 653

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 173/321 (53%), Positives = 224/321 (69%), Gaps = 3/321 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+ P RLRFRQH+ NEMAHYA DCWDA++H SYGWIECVGCADRSAYDL+V
Sbjct: 332 RIYHFLLKIGVDPQRLRFRQHLSNEMAHYASDCWDAELHTSYGWIECVGCADRSAYDLSV 391

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+ RT EKLVVR+ L EP+  +K  ++I+KK FGPK R+++  V  YL            
Sbjct: 392 HAARTNEKLVVRQALPEPVTVEKFEVDIDKKKFGPKFRKDAGAVTKYLEERTQCELEDLA 451

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G +G+  EI S+ + I +   TEHVRE+TPNVIEPSFGIGRILYS+
Sbjct: 452 QELSANGKIVVQVKGIEGD-VEIGSDLVKIAKVKRTEHVREFTPNVIEPSFGIGRILYSI 510

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D+ RSVLS PP VAP K L+VPLS++     LV +++  +RK  I  KVD
Sbjct: 511 FEHQFWSRPEDKDRSVLSLPPLVAPTKVLVVPLSSHADLLPLVKKISAVLRKEQIPFKVD 570

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF +  D ++TLRERDSTKQ+R +++ I++ +K++ 
Sbjct: 571 DSSASIGKRYARNDELGTPFGITIDFDTAKDGSVTLRERDSTKQVRGSVEDIVRAVKEIT 630

Query: 300 EESTTW-EKVMETYPTFTQQE 319
               +W E   +  P  TQ E
Sbjct: 631 YGGVSWAEGTSKLTPFETQSE 651



>gi|310789482|gb|EFQ25015.1| glycyl-tRNA synthetase [Glomerella graminicola M1.001]
          Length = 664

 Score =  353 bits (907), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFLQKIGVDMSKVRFRQHMENEMAHYAADCWDAELLTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE L EP+I+++  +EI+KK FGP+ +++ KTVE  L +          
Sbjct: 395 HAKKTGAPLVVRERLDEPLIFEEWQVEIDKKKFGPQFKKDGKTVEAALEATTQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G    +V G      +++ + + I+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 455 KQLTDNGELELEVAGVGSGTVKVSKDLVKIEFRKRIENTREYTPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK----DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIA 235
           IEHVYW R      DE R VLSFPP VAP K L+VPLS N  F   ++++++++RK+ I+
Sbjct: 515 IEHVYWNRATEDGGDEARGVLSFPPTVAPTKVLIVPLSANKQFQPFINKISQKLRKIGIS 574

Query: 236 IKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVL 295
            +VD SS +IG+RY+RNDELGTP  ITIDFQ+V D TITLR+RDSTKQ+R + +TI+  +
Sbjct: 575 ARVDSSSATIGKRYSRNDELGTPLGITIDFQTVQDSTITLRDRDSTKQVRADEETIVAAI 634

Query: 296 KDLLEESTTWEKVMETYPTFTQQELD 321
           + L+  +  W+ V    P F  QE+D
Sbjct: 635 QSLVTGAKEWKDVAAELPAFEGQEVD 660



>gi|323338670|gb|EGA79886.1| Grs1p [Saccharomyces cerevisiae Vin13]
          Length = 590

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 166/316 (52%), Positives = 221/316 (69%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 272 RIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTV 331

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           HS +TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 332 HSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKA 391

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T KV G DG + E+  + + I+++T  EHVREY P+VIEPSFGIGRI+YS+
Sbjct: 392 ELLKANGKFTIKVDGVDG-EVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSV 450

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLSFPP VAP K LLVPLSN+     +  E+AK +RK  I  K+D
Sbjct: 451 FEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKID 510

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 511 DSGVSIGKRYARNDELGTPFGVTIDFESXXDHSVTLRERDSTKQVRGSVEDVIKAIRDIT 570

Query: 300 EESTTWEKVMETYPTF 315
               +W +  + + +F
Sbjct: 571 YNGASWGRRYQGFDSF 586



>gi|296414076|ref|XP_002836729.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631567|emb|CAZ80920.1| unnamed protein product [Tuber melanosporum]
          Length = 609

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 223/322 (69%), Gaps = 5/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL +LG+  +++RFRQHMPNEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 291 RIHLFLKELGVDQEKVRFRQHMPNEMAHYAADCWDAELFTSYGWIECVGCADRSAYDLTV 350

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS+RT E+LVVRE L  P ++++  ++++KK  GPK R+++K +E+ +            
Sbjct: 351 HSSRTGEQLVVRETLEPPKVWEEWDMDVDKKWLGPKFRKDAKKIEEAVARISQGAREKLA 410

Query: 121 XXXXDGNGT-TKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               DG     +V G       +  E +TI +     ++REYTPNVIEPSFGIGRI YSL
Sbjct: 411 SVQKDGGKVFIEVEGLG----SVELEKVTIAKNKKAVNIREYTPNVIEPSFGIGRIFYSL 466

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEH+YW+R  DE R VLSFPP++AP K L+VPLS +  F  +V  L+ +IR+  I+ +VD
Sbjct: 467 IEHIYWSRPGDEARGVLSFPPKIAPTKILIVPLSGHSDFAPIVTALSAKIRRAGISNRVD 526

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +SS +IG+RYARNDELGTPF +T+DFQS+ D TITLRERD  KQ+R   D +++ +  +L
Sbjct: 527 NSSATIGKRYARNDELGTPFGVTVDFQSLKDGTITLRERDGMKQVRGTQDEVIETVSQIL 586

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   T++  +  +  F  QELD
Sbjct: 587 DGDITFDDALAKFGEFQGQELD 608



>gi|465796910|emb|CCU97662.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 668

 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 230/323 (71%), Gaps = 6/323 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL  +GI   RLRFRQHM NEMAHYACDCWDA+IH SYGWIECVGCADRSA+DLT+
Sbjct: 348 RIYLFLEAIGIDTSRLRFRQHMENEMAHYACDCWDAEIHTSYGWIECVGCADRSAFDLTM 407

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+TK  L+V+E L EP +Y K V  +NKKV GP  ++N+K +ED + +          
Sbjct: 408 HSNKTKRDLMVQEPLKEPKVYQKYVPTVNKKVLGPLFKKNAKLIEDTIMALDQDSLKQMQ 467

Query: 121 XXXXDGNGTTKVPGTDGNQ-YEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 +G+ KV  T G++ +++T E++T++ +T  E VR + PNVIEPSFGIGRI Y+L
Sbjct: 468 ADLE--SGSAKV--TAGSETFDVTKEHVTVEYKTIKESVRNFIPNVIEPSFGIGRIFYAL 523

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W R++D++R VLS PP VAPFK L+VP+S+N   + L  +L+K++R L IA ++D
Sbjct: 524 LEHSFWAREEDKERGVLSLPPLVAPFKVLIVPISSNEQLSPLARQLSKKLRSLGIASRID 583

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS +IGRRYARNDELGTPFA TIDF SV+  TITLRERD+T Q    +D ++ V+K L 
Sbjct: 584 DSSATIGRRYARNDELGTPFACTIDFASVSKGTITLRERDTTTQRIGTVDQVVDVVKQLC 643

Query: 300 EESTTWEKVMETYPTFTQ-QELD 321
           +    W+   +  P +T  Q++D
Sbjct: 644 DGRLDWKGACQILPAYTGTQDVD 666



>gi|322699026|gb|EFY90791.1| glycyl-tRNA synthetase 1 [Metarhizium acridum CQMa 102]
          Length = 662

 Score =  352 bits (902), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 334 RIHLFLDKIGVDLSKMRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE L EP++ ++  ++I KK FGP  ++++KTVE  L +          
Sbjct: 394 HAKKTGAPLVVRERLEEPLVIEEWQVDIEKKKFGPLFKKDAKTVETALLATSQEEREKLA 453

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  +  V G    + E+ S+ L I+ +   E+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 454 KQLKDTGKISLDVAGVGDGKVEVASDTLKIEFRKRIENTREFTPNVIEPSFGIGRILYSL 513

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR  D   E R VLSFPP VAP K L+VPLSNN  F  ++ +L++++R   I+ 
Sbjct: 514 IEHNFWTRGSDGGDEARGVLSFPPTVAPTKVLIVPLSNNTQFRPIIKKLSQQLRLAGISS 573

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIG+RY+RNDELGTP  IT+DFQ++ D TITLR+RDST Q+R     IL  +K
Sbjct: 574 RIDDSSASIGKRYSRNDELGTPLGITVDFQTLQDSTITLRDRDSTAQVRAEEFKILDAIK 633

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  WEKV    P F  QE++
Sbjct: 634 ALVDGSKNWEKVASELPKFEGQEVE 658



>gi|322707106|gb|EFY98685.1| glycyl-tRNA synthetase 1 [Metarhizium anisopliae ARSEF 23]
          Length = 662

 Score =  352 bits (902), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 334 RIHLFLDKIGVDLSKMRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE L EP++ ++  ++I KK FGP  ++++KTVE  L +          
Sbjct: 394 HAKKTGAPLVVRERLEEPLVIEEWQVDIEKKKFGPLFKKDAKTVETALLATSQEEREKLA 453

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  +  V G    + E+ S+ L I+ +   E+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 454 KQLKDSGKISLDVAGVGDGKVEVGSDTLKIEFRKRIENTREFTPNVIEPSFGIGRILYSL 513

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR  D   E R VLSFPP VAP K L+VPLSNN  F  ++ +L++++R   I+ 
Sbjct: 514 IEHNFWTRGSDGGDEARGVLSFPPTVAPTKVLIVPLSNNVQFRPIIKKLSQQLRLAGISS 573

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIG+RY+RNDELGTP  IT+DFQ++ D TITLR+RDST Q+R     IL  +K
Sbjct: 574 RIDDSSASIGKRYSRNDELGTPLGITVDFQTLQDDTITLRDRDSTAQVRAEESKILDAIK 633

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  WEKV    P F  QE++
Sbjct: 634 ALVDGSKNWEKVASELPKFEGQEVE 658



>gi|366998035|ref|XP_003683754.1| hypothetical protein TPHA_0A02380 [Tetrapisispora phaffii CBS 4417]
 gi|357522049|emb|CCE61320.1| hypothetical protein TPHA_0A02380 [Tetrapisispora phaffii CBS 4417]
          Length = 660

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/308 (53%), Positives = 222/308 (72%), Gaps = 2/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FLT +G+   +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 339 RIYQFLTTIGVDETKLRFRQHMGNEMAHYATDCWDAELKTSYGWIECVGCADRSAYDLTV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N+TKEKLVVR+ L  P+   +  +++ KK+FGPK R+++  VE +L +          
Sbjct: 399 HANKTKEKLVVRQKLETPVEVTQWEIDLTKKLFGPKFRKDAPKVEAFLLNLSQEELEKNA 458

Query: 121 XX-XXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  VP  + ++ E+  +++TI+++T  EHVREY PNVIEPSFGIGRI+Y++
Sbjct: 459 ALLKSDGKLTFTVPEVE-SEVELDDKFITIEKRTKVEHVREYIPNVIEPSFGIGRIIYAV 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH YW+R +D  RSVLSFPP VAP K LLVPLSN+     +  +++K +RK  I  KVD
Sbjct: 518 FEHSYWSRPEDTARSVLSFPPLVAPTKVLLVPLSNHKDLAPVTAKISKVLRKEKIPFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RY+RNDELGTPF +TIDF+SV D ++TLRERDSTKQ+R + + I++ ++++ 
Sbjct: 578 DSGVSIGKRYSRNDELGTPFGVTIDFESVKDGSVTLRERDSTKQVRGSAEDIIKAIREIT 637

Query: 300 EESTTWEK 307
               TWE+
Sbjct: 638 YNGVTWEE 645



>gi|164657552|ref|XP_001729902.1| hypothetical protein MGL_2888 [Malassezia globosa CBS 7966]
 gi|159103796|gb|EDP42688.1| hypothetical protein MGL_2888 [Malassezia globosa CBS 7966]
          Length = 671

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 219/317 (69%), Gaps = 4/317 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL  +GI P+RLRFRQHM NEMAHYA DCWD +IH SYGWIECVGCADRSA+DLT+
Sbjct: 349 RIFLFLEAIGINPERLRFRQHMDNEMAHYASDCWDTEIHTSYGWIECVGCADRSAFDLTM 408

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK  L+V+E L EP +Y K V  INKKV GP  ++N+K +ED + S          
Sbjct: 409 HSQRTKHDLMVQEPLKEPKVYQKYVPTINKKVLGPFFKKNAKVIEDTILSMGQECLRKMQ 468

Query: 121 XXXXDGNGTTKVPGTDGNQ-YEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D   + K P    N+ +E+T E++ I+ +T  E VR + PNVIEPSFG+GRI Y+L
Sbjct: 469 N---DLESSGKAPLQANNETFEVTKEHVQIEYKTIKESVRNFIPNVIEPSFGLGRIFYAL 525

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +W R++D++R VLS PP VAPFK L+VP+S+N   + +  +++K++R L+IA ++D
Sbjct: 526 LEHSFWAREEDKERGVLSLPPLVAPFKVLIVPISSNEQLSPMARDISKKLRSLNIASRID 585

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS+ +IGRRYARNDELGTPFA TIDF SV+  TITLRERD+T Q    +D ++ V+  L 
Sbjct: 586 DSNATIGRRYARNDELGTPFACTIDFASVSKGTITLRERDTTLQRIGTVDQVIDVVARLC 645

Query: 300 EESTTWEKVMETYPTFT 316
                W    +  P +T
Sbjct: 646 SGRLDWNGACQILPAYT 662



>gi|505759833|gb|EOR03907.1| Putative glycine--tRNA ligase [Wallemia ichthyophaga EXF-994]
          Length = 649

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 216/308 (70%), Gaps = 1/308 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI  DRLRFRQHM NEMAHYA DCWDA+IH SYGWIECVGCADRSAYDLTV
Sbjct: 331 RINLFLEKIGINKDRLRFRQHMSNEMAHYASDCWDAEIHTSYGWIECVGCADRSAYDLTV 390

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT + LVVRE L E  I +K   EINKK FGP  R N K VE  + +          
Sbjct: 391 HAVRTGQPLVVREPLPEIKIEEKWAPEINKKKFGPTFRANQKIVESTIFALDQPRLECIK 450

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D  G + +   DGN+Y++T E LTI+++TF E  RE+TPNVIEPSFGIGRILY+L+
Sbjct: 451 KDF-DSQGKSDIQAADGNKYDLTPELLTIEKKTFKETKREFTPNVIEPSFGIGRILYALL 509

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH ++ R+ DE R+VL FPP VAP K L+VP+SN+  F  ++ +++ R+RK  +A +VDD
Sbjct: 510 EHSFYAREQDEGRTVLGFPPLVAPIKALVVPISNSKEFEPIIKDISLRLRKNGVASRVDD 569

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG+RYARNDELGTP+ IT+DF +V   TITLRERD+T+Q    ++ ++  +  L +
Sbjct: 570 SSATIGKRYARNDELGTPYGITVDFATVKKNTITLRERDTTEQKIGTVEQVVDAIVKLSK 629

Query: 301 ESTTWEKV 308
               W +V
Sbjct: 630 GEIEWPQV 637



>gi|429860674|gb|ELA35400.1| glycyl-trna synthetase [Colletotrichum gloeosporioides Nara gc5]
          Length = 743

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 166/326 (50%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL+K+G+   ++RFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDLTV
Sbjct: 414 RIHLFLSKIGVDMTKVRFRQHMANEMAHYAADCWDAELFTSSGWIECVGCADRSAYDLTV 473

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE   +P++ D+  +E++KK FGP+ +++ + VE  L +          
Sbjct: 474 HAKKTGAPLLVRERREKPLVIDEWQVEVDKKKFGPQFKKDGRAVEVALMATTQEQREKFA 533

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G    +V G    + +I+ + + I+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 534 KQLTDNGELELEVAGVADGKVKISKDLVKIEFRQRIENTREYTPNVIEPSFGIGRILYSL 593

Query: 180 IEHVYWTRKD----DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIA 235
           IEH YW R      DE R VLSFPP VAP K L+VPLS+N  F   + ++++++RK  I+
Sbjct: 594 IEHCYWNRASADGGDEARGVLSFPPTVAPTKVLIVPLSSNAQFKPFIKQISQKLRKFGIS 653

Query: 236 IKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVL 295
            +VDDSS +IG+RY+RNDELGTP  ITIDFQ+V D TITLR+RDSTKQ+R + DTI+  +
Sbjct: 654 ARVDDSSATIGKRYSRNDELGTPLGITIDFQTVQDNTITLRDRDSTKQVRGDEDTIIAAI 713

Query: 296 KDLLEESTTWEKVMETYPTFTQQELD 321
           + L++ S  W+ V  T P F  QE++
Sbjct: 714 QTLVDGSKEWKDVAATLPAFESQEVE 739



>gi|344305125|gb|EGW35357.1| hypothetical protein SPAPADRAFT_58584 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 455

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 216/319 (67%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P R+R RQHM NEMAHYA DCWD +I  SYGWIECVGCADRSAYDLTV
Sbjct: 133 RIYLFLVKIGINPQRMRLRQHMSNEMAHYASDCWDTEIETSYGWIECVGCADRSAYDLTV 192

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           HS RT  KLVVR+ L EP+  +K  +EI KK FGP+ R+++ TVE +L +          
Sbjct: 193 HSARTNTKLVVRQTLDEPITVEKLEIEIEKKKFGPRFRKDAATVEKFLLAQTECELEEFD 252

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     +PG      E+  + + I +   TEHVREYTPNVIEPSFGIGRI+Y+ 
Sbjct: 253 KELKANGKIVVTIPGI-AEPVELGPDLIKIDKIKRTEHVREYTPNVIEPSFGIGRIVYAA 311

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +WTR +DE R VLS PP VAP K L+VPLSN+P    +V +++  +RK  I  KVD
Sbjct: 312 LEHAFWTRPEDEDRGVLSLPPLVAPTKVLVVPLSNSPELLPIVKKVSDYLRKQHIPFKVD 371

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +SS SIG+RYARNDELGTPF IT+DF S+ D ++TLR+RD+TKQ+R +   I++ ++++ 
Sbjct: 372 NSSASIGKRYARNDELGTPFGITVDFDSLKDESVTLRDRDTTKQLRGSFHEIIKAVREMS 431

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +W++       F  Q
Sbjct: 432 YHHVSWDEATTNLSAFEGQ 450



>gi|501752930|emb|CCG83277.1| Putative glycyl-tRNA synthetase [Taphrina deformans PYCC 5710]
          Length = 676

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/319 (52%), Positives = 212/319 (66%), Gaps = 10/319 (3%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI P RLRFRQHM  EMAHYACDCWDA+I  SYGWIECVGCADRSAYDLTV
Sbjct: 367 RIFLFLMKIGIDPRRLRFRQHMSTEMAHYACDCWDAEIETSYGWIECVGCADRSAYDLTV 426

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   L+VRE L EP++  K +  I +K FG K ++++KT+E  +            
Sbjct: 427 HSKKTGHPLIVREQLKEPIVEQKWIPTIERKAFGMKFKKDAKTLEAAIEDLSME------ 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D     K      N +E+  E + ++ +    ++R+YTPNVIEPSFGIGRILY+++
Sbjct: 481 ----DKAQAAKDKVIKVNGFEVPEELVKLELKEVRSNIRDYTPNVIEPSFGIGRILYAVL 536

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W R +  +R VLSFPP +AP   LLVPLS+NP    LV  L+ ++R L I+ KVDD
Sbjct: 537 EHSFWIRPESTERGVLSFPPSIAPTSVLLVPLSSNPDLLRLVPALSSKLRALEISNKVDD 596

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG+RYARNDELGTPF ITIDFQ+  D ++TLRERDSTKQIR +   IL VL  L  
Sbjct: 597 SSAAIGKRYARNDELGTPFGITIDFQTTTDGSLTLRERDSTKQIRASEAEILDVLGKLTR 656

Query: 301 ESTTWEKVMETYPTFTQQE 319
               W  V+  Y  FT QE
Sbjct: 657 SQIEWSAVLAQYGEFTSQE 675



>gi|254570979|ref|XP_002492599.1| Cytoplasmic and mitochondrial glycyl-tRNA synthase [Komagataella
           pastoris GS115]
 gi|238032397|emb|CAY70420.1| Cytoplasmic and mitochondrial glycyl-tRNA synthase [Komagataella
           pastoris GS115]
 gi|328353394|emb|CCA39792.1| glycyl-tRNA synthetase [Komagataella pastoris CBS 7435]
          Length = 653

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 212/307 (69%), Gaps = 2/307 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL  +G+ P RLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYQFLITIGVDPSRLRFRQHMDNEMAHYAQDCWDAELLTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+ RT EKL VRE L EP+  D+  ++I KK FGPK R+N+  VE +L +          
Sbjct: 393 HAARTNEKLCVREKLPEPITVDRLEIDIEKKKFGPKFRKNAGAVEKWLLARTECELETLQ 452

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG    ++PG +  + E+    + I+R+T TEH+REYTPNVIEPSFGIGRI+YS+
Sbjct: 453 KDLSTDGKILVEIPGIE-EKIELDDSLIHIERRTRTEHIREYTPNVIEPSFGIGRIIYSI 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH ++ R DD  R VL  PP VAP K LLVPL  N  F  +V E+++ +RK  I  KVD
Sbjct: 512 FEHAFYPRPDDADRCVLKLPPIVAPTKVLLVPLQTNAEFKPIVKEISQVLRKEKIPFKVD 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF ++ D T+TLRERDST Q+R ++  I++ +K + 
Sbjct: 572 DSGASIGKRYARNDELGTPFGITIDFDTIADGTVTLRERDSTTQVRGSVADIVKAIKTIT 631

Query: 300 EESTTWE 306
            +  +WE
Sbjct: 632 YDGLSWE 638



>gi|156846538|ref|XP_001646156.1| hypothetical protein Kpol_1039p49 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116829|gb|EDO18298.1| hypothetical protein Kpol_1039p49 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 663

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 165/319 (51%), Positives = 219/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL  +G+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 342 RIYKFLVTIGVDESKMRFRQHMANEMAHYAADCWDAELKTSYGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXX-XX 119
           HS +TKEK+VVR+ L  P+   +  +++ KK+FGPK R+++  VE +L            
Sbjct: 402 HSIKTKEKMVVRQKLETPVEVTQWEIDLTKKLFGPKFRKDAPKVEAFLLGMSQEELADNA 461

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                D     KV G +G+  E+ S ++TI+++T  EHVRE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 EKLKADNKIVLKVDGVEGD-VELDSNFVTIEKRTKVEHVREFVPNVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH YW R +D  RSVLSFPP VAP K LLVPLSN+     +  +++K +RK  I  KVD
Sbjct: 521 FEHSYWNRPEDTARSVLSFPPLVAPTKVLLVPLSNHKDLAPITSQVSKILRKEKIPFKVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF S  D ++TLRERDSTKQ+R +++ +++ ++D+ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFDSTKDGSVTLRERDSTKQVRGSVEDVIKAIRDIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
             +  WE+  +    F  Q
Sbjct: 641 YNNVAWEEGTKNLVPFVSQ 659



>gi|302916831|ref|XP_003052226.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733165|gb|EEU46513.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 663

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LF+ K+G+   ++RFRQHM NEMAHYACDCWD ++  + GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFMQKIGVDLSKMRFRQHMANEMAHYACDCWDCELFTTSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE   EP++ ++  +EI KK FGP  ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVRERREEPLVIEEWQIEIEKKKFGPLFKKDAKTVEAALNATSQEQREQLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G+ + +V G    + +I  E + I+ +   E+ RE+ PNVIEPSFGIGRILYSL
Sbjct: 455 KELSETGSISIEVAGVGDGKAKIGKESIAIEFRKRVENTREFVPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH +WTR  D   E R VLSFPP VAP K LLVPLS+NP F  L+ +L++R+R   I+ 
Sbjct: 515 MEHSFWTRASDGGDEARGVLSFPPTVAPTKVLLVPLSSNPQFKPLLKQLSQRLRTAGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQ+V D T+TLR+RDST Q+R + + I+  ++
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQTVQDGTVTLRDRDSTSQVRADQEKIIDAIR 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+E   +W ++    P F  QE++
Sbjct: 635 SLVEGEKSWSQIESELPKFEGQEVE 659



>gi|396494587|ref|XP_003844340.1| similar to glycyl-tRNA synthetase [Leptosphaeria maculans JN3]
 gi|312220920|emb|CBY00861.1| similar to glycyl-tRNA synthetase [Leptosphaeria maculans JN3]
          Length = 658

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 167/324 (51%), Positives = 217/324 (66%), Gaps = 5/324 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 337 RIQLFLLKIGIDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVE---DYLTSXXXXXXX 117
           H  +T   L VRE   EP+  ++   +++KK FG K +++ K VE   D LT        
Sbjct: 397 HMKKTGAPLFVREPRKEPLKIEEWQYDLDKKSFGQKFKKDGKAVEAAIDALTQDLREKLS 456

Query: 118 XXXXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILY 177
                  +G     VPG    + E+  E + ++++T  E+VREYTPNVIEPSFGIGRI Y
Sbjct: 457 LDLEK--EGKVVLDVPGVGDGKVEVPKELIKLEKRTRVENVREYTPNVIEPSFGIGRIFY 514

Query: 178 SLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           +L EHVYWTR+ D+ R VLSFPP VAP K L+VPLS++P F+  V  L  ++R + I+ +
Sbjct: 515 ALCEHVYWTREQDKARGVLSFPPAVAPTKVLIVPLSSHPDFSPFVQTLRSKLRSIGISSR 574

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           +D S  SIG+RY+RNDELGTP  IT+DFQSV D T TLR+RDST+Q+R +ID I+  + +
Sbjct: 575 IDASGASIGKRYSRNDELGTPLGITVDFQSVKDNTFTLRDRDSTEQVRASIDEIIAAISN 634

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           ++  S  W  V    P F  QE+D
Sbjct: 635 IVNGSEKWSDVAARLPKFEGQEVD 658



>gi|408395881|gb|EKJ75053.1| hypothetical protein FPSE_04765 [Fusarium pseudograminearum CS3096]
          Length = 663

 Score =  349 bits (895), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL K+GI   +LRFRQHM NEMAHYACDCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHQFLQKIGIDMTKLRFRQHMANEMAHYACDCWDAELFTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE    P++ ++  ++I +K FGP+ ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVREQRETPLVIEEWQIDIERKKFGPQFKKDAKTVEAALLASPQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+ T +V G    + +++ + + I+ +   E+ RE+ PNVIEPSFGIGRILYSL
Sbjct: 455 KELSDNGSITLEVAGVGDGKVQVSKDSIAIEFRKRVENTREFVPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH +WTR     DE R VLSFPP VAP K LLVPLS+NP F  L+ +L++R+R   I+ 
Sbjct: 515 MEHSFWTRGTEGGDEARGVLSFPPIVAPTKVLLVPLSSNPQFKPLLKQLSQRLRSAGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQ+  D ++TLR+RDST Q+R   + I+  +K
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQTAQDGSVTLRDRDSTNQVRAEQEKIIDAIK 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S TW +V    P F  QE++
Sbjct: 635 SLVDGSKTWAQVESELPKFEGQEVE 659



>gi|46125161|ref|XP_387134.1| hypothetical protein FG06958.1 [Fusarium graminearum PH-1]
          Length = 663

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 224/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL K+G+  ++LRFRQHM NEMAHYACDCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHQFLQKIGVDMNKLRFRQHMANEMAHYACDCWDAELFTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE    P++ ++  ++I +K FGP+ ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVREQRETPLVIEEWQIDIERKKFGPQFKKDAKTVEAALLATPQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+ T +V G    + +++ + + I+ +   E+ RE+ PNVIEPSFGIGRILYSL
Sbjct: 455 KELSDNGSITLEVAGVGDGKVQVSKDSIAIEFRKRVENTREFVPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH +WTR     DE R VLSFPP VAP K LLVPLS+NP F  L+ +L++R+R   I+ 
Sbjct: 515 MEHSFWTRGTEGGDEARGVLSFPPIVAPTKVLLVPLSSNPQFKPLLKQLSQRLRSAGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQ+  D ++TLR+RDST Q+R   + I+  +K
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQTAQDGSVTLRDRDSTNQVRAEQEKIIDAIK 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S TW ++    P F  QE++
Sbjct: 635 SLVDGSKTWAQIESELPKFEGQEVE 659



>gi|410078918|ref|XP_003957040.1| hypothetical protein KAFR_0D02580 [Kazachstania africana CBS 2517]
 gi|372463625|emb|CCF57905.1| hypothetical protein KAFR_0D02580 [Kazachstania africana CBS 2517]
          Length = 657

 Score =  348 bits (894), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 219/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSA+DLTV
Sbjct: 340 RIYQFLVKIGVDASKMRFRQHMSNEMAHYAADCWDAELKTSYGWIECVGCADRSAFDLTV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+TKEKLVVR+ L  P+   K  +++ KK+FGPK R+++  VE YL +          
Sbjct: 400 HSNKTKEKLVVRQKLDTPIEVTKFEIDLTKKLFGPKFRKDAPKVESYLLNLSQEELKAKS 459

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                      K+   +G+  E+  +++ I+ +T  EHVRE+ PNVIEPSFGIGRI+Y++
Sbjct: 460 EELEKNQKIVFKIDAIEGD-VELDDKFVKIEERTKVEHVREFVPNVIEPSFGIGRIIYAV 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  R VLSFPP VAP K LLVPLSN+     +  E++K +RK  I  KVD
Sbjct: 519 FEHSFWNRPEDVARGVLSFPPLVAPSKVLLVPLSNHKDLQPITKEVSKILRKAQIPFKVD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RY+RNDELGTPF ITIDF+SVND ++TLRERDSTKQ+R +++ I+  ++++ 
Sbjct: 579 DSGVSIGKRYSRNDELGTPFGITIDFESVNDNSVTLRERDSTKQVRGSVEDIINAIREIT 638

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +W++  +    F  Q
Sbjct: 639 YNGVSWDEGTKNLEPFVSQ 657



>gi|500260144|gb|EOO02847.1| putative glycyl-trna synthetase protein [Togninia minima UCRPA7]
          Length = 664

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL KLG+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIHLFLEKLGVDQTKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVE-DYLTSXXXXXXXXX 119
           H+ +T   L+VRE L +P + ++  +EI KK FGP+ +++ K VE   L +         
Sbjct: 396 HAQKTGAPLIVRERLDQPKVIEEWAVEIEKKKFGPQFKKDGKAVEAAVLATTQEQREKLA 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G+ T  V G    + E++ + ++I+    TE+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 456 KELEEKGSFTIDVAGVKDGKVEVSKDLVSIQWTKRTENTREFTPNVIEPSFGIGRILYSL 515

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YWTR     DE R VLSFPP +AP K L+VPLS+N  FT +  +L++++R L ++ 
Sbjct: 516 IEHCYWTRAHEGGDEARGVLSFPPTIAPTKVLIVPLSSNKDFTPVARKLSQKLRSLGVSS 575

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS +IG+RY+RNDELGTP  +TIDFQ++ D TITLR+RDST Q+R + D I+  ++
Sbjct: 576 RVDDSSATIGKRYSRNDELGTPLGVTIDFQTIKDGTITLRDRDSTTQVRADEDKIIAAVQ 635

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++   TW+ +    P F  Q+ +
Sbjct: 636 SLVDGKKTWKDIETELPAFEGQDAE 660



>gi|340522557|gb|EGR52790.1| hypothetical protein TRIREDRAFT_102700 [Trichoderma reesei QM6a]
          Length = 663

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LF+ K+G+   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 335 RIHLFMEKIGVDLSKMRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE L EP + ++  ++I KK FGP  ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLIVRERLDEPRVIEEWQIDIQKKKFGPLFKKDAKTVETALEATTQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T  V G    +  I  + + I+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 455 KELAETGKITLDVEGVADGKAVIDKDTVAIEFRKRVENTREYTPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR     DE R VLSFPP VAP K LLVPLS+NP F   V +L++++R L ++ 
Sbjct: 515 IEHNFWTRASEGGDEARGVLSFPPPVAPTKVLLVPLSSNPQFKPTVRKLSQKLRSLGVSS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  IT+DFQ++ D T+TLR+RDST Q+R   D IL  ++
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITVDFQTLQDGTLTLRDRDSTTQVRAEEDKILDAIR 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S TW ++    P F  QE+D
Sbjct: 635 ALVDGSKTWAQIETELPKFQGQEID 659



>gi|392572897|gb|EIW66040.1| hypothetical protein TREMEDRAFT_45889 [Tremella mesenterica DSM
           1558]
          Length = 667

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 167/316 (52%), Positives = 214/316 (67%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFL K+GI P+RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 348 RTQLFLIKIGIDPERLRCRQHMANEMAHYAADCWDFEIQSSYGWIECVGCADRSAYDLTV 407

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ L V+  L +P + +K     + K FG K ++ +  +++ L            
Sbjct: 408 HSVRTKQPLRVQVKLDQPRVVEKLECTFDAKAFGMKFKKEAGMLKETLAGMDRDRLQCVK 467

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G   V GTDG  YEI+SE L I+    TEHVRE+TPNVIEPSFGIGRILYSL+
Sbjct: 468 DELE--TGVASVKGTDGKSYEISSELLKIEPVIVTEHVREFTPNVIEPSFGIGRILYSLL 525

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D+ R VLS P  VAP KCL+V +S +P    L+ +++ ++RKL IA +VDD
Sbjct: 526 EHSYWAREADKARVVLSLPSLVAPIKCLIVTISQDPQLRTLIHDISHKMRKLGIASRVDD 585

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG++YARNDELGTPF  T+DF S+   T+TLRERDST Q+   IDT++ V+  L++
Sbjct: 586 SSASIGKKYARNDELGTPFGCTVDFASLQKGTMTLRERDSTSQLIGPIDTVIDVVDRLVK 645

Query: 301 ESTTWEKVMETYPTFT 316
            +  W+   E   T++
Sbjct: 646 GTIDWQGATEVLETYS 661



>gi|367049748|ref|XP_003655253.1| hypothetical protein THITE_2118733 [Thielavia terrestris NRRL 8126]
 gi|347002517|gb|AEO68917.1| hypothetical protein THITE_2118733 [Thielavia terrestris NRRL 8126]
          Length = 727

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 227/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  SYGW+ECVGCADRSAYDL+V
Sbjct: 399 RIHLFLKKIGIDQTKIRFRQHMANEMAHYACDCWDAELLTSYGWVECVGCADRSAYDLSV 458

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   L+VR+ L EP   ++  +EI+KK FGP  +++ KT+E   L +         
Sbjct: 459 HAKKTGAPLIVRQRLDEPKTIEEWEVEIDKKKFGPFFKKDGKTIEAAILATTQEERGQLA 518

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG    + E++ + L IK Q   E++REYTPNVIEPSFGIGRILY+L
Sbjct: 519 KEMEANGKVIINVPGVGDGKVEVSKDLLAIKWQKRVEYIREYTPNVIEPSFGIGRILYAL 578

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YWTR     DE R VLSFPP VAP K L+VPLS+N  FT +V +L++ +R   ++ 
Sbjct: 579 IEHNYWTRASEGGDEARGVLSFPPAVAPTKVLIVPLSSNKDFTPVVRKLSQMLRSAGVSS 638

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTPF +T+DFQ++ D T+TLRERDST+Q+R   D I++ ++
Sbjct: 639 RVDDSSASIGKRYSRNDELGTPFGVTVDFQTLKDGTVTLRERDSTRQVRAEEDKIIEAIR 698

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+E + TW+ +    P F  QE+D
Sbjct: 699 ALVEGTKTWQDIESELPLFEGQEVD 723



>gi|367015096|ref|XP_003682047.1| hypothetical protein TDEL_0F00250 [Torulaspora delbrueckii]
 gi|359749709|emb|CCE92836.1| hypothetical protein TDEL_0F00250 [Torulaspora delbrueckii]
          Length = 664

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +G+   ++RFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 339 RISQFLLSIGVDETKMRFRQHMANEMAHYAADCWDGELLTSYGWIECVGCADRSAYDLTV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TK+KLVVR+ L EP+   K  +++ KK+FGPK R+++  VE +L +          
Sbjct: 399 HSKKTKQKLVVRQKLDEPVEVTKWEIDLTKKLFGPKFRKDAPKVEAHLLNLSQEELASKG 458

Query: 121 XX-XXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    KV G +G+  E+  +++TI+++T TEHVRE+TPNVIEPSFGIGRI+YS+
Sbjct: 459 EELKNNGKIVFKVDGVEGD-VEMDDKFVTIEQRTKTEHVREFTPNVIEPSFGIGRIIYSV 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  R+VLSFPP VAP K LLVPLSN+     +  E++K +R+  I  KVD
Sbjct: 518 FEHCFWSRPEDTARAVLSFPPLVAPSKVLLVPLSNHKDLAPVTAEISKLLRREKIPFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF+S+ D ++TLRERDSTKQ+R +   I++ ++++ 
Sbjct: 578 DSGVSIGKRYARNDELGTPFGVTIDFESIKDGSVTLRERDSTKQVRGSAADIIKAIREIT 637

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 638 YNGASWEEGTKGLAPFVSQ 656



>gi|320590421|gb|EFX02864.1| glycyl-tRNA synthetase [Grosmannia clavigera kw1407]
          Length = 665

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 224/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL ++G+   ++RFRQHM NEMAHYA DCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 337 RIHLFLKRIGVDMSKVRFRQHMANEMAHYATDCWDAELQTSSGWVECVGCADRSAYDLTV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVR+ L  P + ++  LEI+KK FGP+ ++++K VE  L +          
Sbjct: 397 HAKKTGAPLVVRQRLETPKVVEEWTLEIDKKKFGPRFKKDAKAVETALLALSQEQLETLA 456

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               +  + +  V   DG + E+ +E +TI     TE+VRE+TPNVIEPSFGIGRILYSL
Sbjct: 457 KEQKEKASISVDVASVDGGKVELANELVTIAWTKRTENVREFTPNVIEPSFGIGRILYSL 516

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YW+R     DE R V+SF P VAP K L+VP+S+   F  +V +L++++R L +A 
Sbjct: 517 LEHNYWSRGAEGGDEARGVISFSPAVAPTKVLIVPISSKDEFKPVVRDLSQKLRSLGLAS 576

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDS+ SIG+RY+RNDELGTPF ITIDFQ++ D ++TLRERDST+Q+R +  TIL  ++
Sbjct: 577 RVDDSTASIGKRYSRNDELGTPFGITIDFQTIKDGSVTLRERDSTRQVRADEATILAAVQ 636

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+    TW+ +    P F  QE++
Sbjct: 637 SLVRGDKTWQDIQAELPAFESQEVE 661



>gi|320580638|gb|EFW94860.1| Cytoplasmic and mitochondrial glycyl-tRNA synthase [Ogataea
           parapolymorpha DL-1]
          Length = 650

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 172/319 (53%), Positives = 216/319 (67%), Gaps = 1/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G  PD++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 329 RIYQFLLKIGANPDKVRFRQHMANEMAHYAQDCWDAELQTSYGWIECVGCADRSAYDLSV 388

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTKEKL VRE LAEP + +K   EI+KK FGPK R+++  VE +L S          
Sbjct: 389 HSARTKEKLCVREPLAEPKVVEKLECEIDKKKFGPKFRKDAPKVEQWLLSRTECELEDLA 448

Query: 121 XXXXDG-NGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               +    T K+P T   + EI +E L I +   TEH+REY PNVIEPSFGIGRI+YS+
Sbjct: 449 KELDEKLKITVKIPETTVPEVEIPAELLKISKVKKTEHIREYIPNVIEPSFGIGRIIYSV 508

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +WTR +D  R VLS PP VAP K LLVPLSN+     ++  +  +++   I  KVD
Sbjct: 509 FEHSFWTRPEDSARCVLSLPPLVAPTKVLLVPLSNHETLLPVLKLVKDKLKVKQIPFKVD 568

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF S+ D ++TLRERDST Q+R +ID ++  +  L 
Sbjct: 569 DSSASIGKRYARNDELGTPFGITIDFDSLKDNSVTLRERDSTLQVRGSIDDVVDAIVKLT 628

Query: 300 EESTTWEKVMETYPTFTQQ 318
            E   W++  +   +F  +
Sbjct: 629 YEGVDWKEGTKGLESFESK 647



>gi|444321426|ref|XP_004181369.1| hypothetical protein TBLA_0F03110 [Tetrapisispora blattae CBS 6284]
 gi|387514413|emb|CCH61850.1| hypothetical protein TBLA_0F03110 [Tetrapisispora blattae CBS 6284]
          Length = 655

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 217/316 (68%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G  P +LRFRQH+  EMAHYA DCWD ++  SYGWIECVGCADRSAYDLTV
Sbjct: 339 RIYQFLIKVGADPKKLRFRQHLDTEMAHYAADCWDTELKTSYGWIECVGCADRSAYDLTV 398

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVE-DYLTSXXXXXXXXX 119
           HS ++ EK+VV++ L  P+   +  ++IN+K+FGP+ R++SK +E   L S         
Sbjct: 399 HSKKSNEKMVVKQMLPSPVEITRWEIDINRKLFGPRFRKDSKIIETALLKSTQKELQKYA 458

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG+    VPG    ++ I SE +TI+++   EHVREY PNVIEPSFGIGRI+YS+
Sbjct: 459 SSLLKDGSFAITVPGFT-EEFSIDSELVTIEKKKKLEHVREYVPNVIEPSFGIGRIIYSI 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  R VLSFPP VAP K L+VPLSNN     +  ++++ ++ + I  K+D
Sbjct: 518 FEHSFWVRPEDSARGVLSFPPLVAPTKVLIVPLSNNKDLIPITTKVSEALKSIKIPFKID 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF S+ D ++TLRERDSTKQIR +I  I+Q +KD+ 
Sbjct: 578 DSGVSIGKRYARNDELGTPFGITIDFDSLKDESVTLRERDSTKQIRGSISDIIQSIKDIS 637

Query: 300 EESTTWEKVMETYPTF 315
             + +WE   ++   F
Sbjct: 638 YNNISWEDSTKSLKIF 653



>gi|389742663|gb|EIM83849.1| glycyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
          Length = 656

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 215/315 (68%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL K+G+  +RLRFRQHM NEMAHYA DCWDADI NSYGW ECVGCADR+AYDLTV
Sbjct: 336 RIKQFLIKIGVDENRLRFRQHMANEMAHYATDCWDADIENSYGWTECVGCADRAAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS++T   LVVR+ L EP++ +K   E NKKV G    +++  ++               
Sbjct: 396 HSDKTGHPLVVRQALKEPIVTEKLTAEFNKKVVGKAFGKDAGVLQKMFADMDETKLEKVQ 455

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+ T   P  DG + ++T E LTI+R+TF + +RE+TPNVIEPSFG+GRILY L+
Sbjct: 456 GELAQGSSTVATP--DGKEIKLTPEMLTIERKTFKQSIREFTPNVIEPSFGLGRILYVLL 513

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W R+ D +R VLS PP VAP K L+VPLS    F  L+ E++ ++RK  +  +VDD
Sbjct: 514 EHNFWAREQDVERGVLSLPPVVAPTKVLIVPLSAKEEFDPLIREVSSKLRKAGVFSRVDD 573

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF +T+DF SV +RT+TLRERD+T Q+  +ID ++ +L +L++
Sbjct: 574 SNTSIGKRYARNDELGTPFGVTLDFASVQNRTMTLRERDTTGQLIGDIDQVIGILTELVD 633

Query: 301 ESTTWEKVMETYPTF 315
            +  W +  +  P +
Sbjct: 634 GTIDWAEACKRLPAY 648



>gi|409077211|gb|EKM77578.1| hypothetical protein AGABI1DRAFT_121963 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 680

 Score =  346 bits (888), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 219/315 (69%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI P+RLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDL+V
Sbjct: 361 RIYQFLIKIGINPERLRFRQHMGNEMAHYATDCWDAEIHNSTGWTECVGCADRAAYDLSV 420

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++ ++  +E NKK+ G   +Q++  ++  + S          
Sbjct: 421 HSAKTGHPLVVRQALKEPIVTEREAVEWNKKILGKTFKQDAGVIQKTVESLDEAALAKLK 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+    +   DG +++I+ + LTI+R+TF + +RE+TPNVIEPSFG+GRILY+L+
Sbjct: 481 EQLVQGSAV--ITSQDGKEFQISPDILTIERKTFKQSIREFTPNVIEPSFGLGRILYTLL 538

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP VAP K L+VPLS    F  LV E++ R+R+  +  +VDD
Sbjct: 539 EHSFWSRESDVERGVLSIPPLVAPTKVLIVPLSARAEFDPLVQEVSSRLRRAGVFSRVDD 598

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTP+ ITIDF SV +RT+TLRERD+  Q   ++D ++  + +L++
Sbjct: 599 SNTSIGKRYARNDELGTPYGITIDFASVQNRTMTLRERDTMDQRIGSMDDVIAAVTELVD 658

Query: 301 ESTTWEKVMETYPTF 315
            +  W +  +  P +
Sbjct: 659 GTIDWAEACQRLPAY 673



>gi|358398566|gb|EHK47917.1| hypothetical protein TRIATDRAFT_298172 [Trichoderma atroviride IMI
           206040]
          Length = 719

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 219/325 (67%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LF+ K+G+   ++RFRQHM NEMAHYA DCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 391 RIHLFMEKIGVDLSKMRFRQHMANEMAHYATDCWDAELLTSTGWVECVGCADRSAYDLSV 450

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE L EP + ++  ++I KK FGP  ++++KTVE  L +          
Sbjct: 451 HAKKTGAPLVVRERLDEPKVIEEWQVDIQKKKFGPLFKKDAKTVETALEATSQEQREKLA 510

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G     V G  G +  I  + + I+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 511 KELTETGKIVLDVEGIAGGKATIDKDSVAIEFRKRVENTREYTPNVIEPSFGIGRILYSL 570

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR  D   E R VLSFPP VAP K LLVPLS+NP F   V +L++++R L ++ 
Sbjct: 571 IEHNFWTRGSDGGDEARGVLSFPPTVAPTKVLLVPLSSNPQFKPTVKKLSQKLRSLGVSS 630

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  IT+DFQ++ D TITLR+RDST Q+R   D IL+ ++
Sbjct: 631 RVDDSSASIGKRYSRNDELGTPLGITVDFQTLQDGTITLRDRDSTTQVRAEEDKILEAIQ 690

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L   S  W ++    P F  QE+D
Sbjct: 691 SLANGSKKWAQIESELPKFQGQEVD 715



>gi|340959321|gb|EGS20502.1| glycyl-tRNA synthetase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 664

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 226/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 336 RIHLFLKKIGIDQKKIRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   LVVR+ L EP + ++  +EI+KK FGP  +++ K VE   L +         
Sbjct: 396 HAKKTGAPLVVRQRLDEPKVIEEWAVEIDKKKFGPFFKKDGKVVEAAILATSQEERGRLA 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VPG    Q E + + ++IK Q   E++REY PNVIEPSFGIGRILYSL
Sbjct: 456 KELEENGKAVINVPGVGDGQVEFSKDLVSIKWQKRVENIREYIPNVIEPSFGIGRILYSL 515

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YWTR     DE R VLSFPP VAP K L+VPLS+N  FT  V +L++++R + I+ 
Sbjct: 516 IEHNYWTRASEGGDEARGVLSFPPAVAPTKVLIVPLSSNKDFTPTVRKLSQKLRSIGISS 575

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RYARNDELGTPF +T+DFQ++ D T+TLRERDS +Q+R + + I++ ++
Sbjct: 576 RVDDSSASIGKRYARNDELGTPFGVTVDFQTLKDGTVTLRERDSMRQVRADEEKIIEAIR 635

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ + TW+ +    P F  QELD
Sbjct: 636 ALVDGTKTWKDIEAELPLFEGQELD 660



>gi|358387063|gb|EHK24658.1| hypothetical protein TRIVIDRAFT_30887 [Trichoderma virens Gv29-8]
          Length = 663

 Score =  346 bits (887), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 219/325 (67%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LF+ ++G+   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 335 RIHLFMKRIGVDMSKMRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE L EP + ++  ++I KK FGP  ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVRERLDEPKVIEEWQIDIQKKKFGPLFKKDAKTVETALEATSQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G     V G    +  I  + + I+ +   E+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 455 KELAETGKIVLDVEGIADGKAVIDKDSVAIEFRKRVENTREFTPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +WTR  D   E R VLSFPP VAP K LLVPLS+NP F   V  L++++R L ++ 
Sbjct: 515 IEHNFWTRASDGGDESRGVLSFPPTVAPTKVLLVPLSSNPQFKPAVKALSQKLRSLGVSS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  IT+DFQ++ D +ITLR+RDST Q+R     IL  +K
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITVDFQTLQDGSITLRDRDSTTQVRAEESKILDAIK 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S +WE +    P F  QE++
Sbjct: 635 SLVDGSKSWETIASELPKFEGQEIE 659



>gi|401887752|gb|EJT51731.1| glycine-tRNA ligase [Trichosporon asahii var. asahii CBS 2479]
 gi|406699661|gb|EKD02860.1| glycine-tRNA ligase [Trichosporon asahii var. asahii CBS 8904]
          Length = 660

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 224/315 (71%), Gaps = 4/315 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFLTK+GI   RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 340 RTQLFLTKIGIDAARLRCRQHMANEMAHYAADCWDFEIQSSYGWIECVGCADRSAYDLTV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +TK+ L V++ L +P   +K  ++ + K FG K ++++ T++  L +          
Sbjct: 400 HAAKTKQPLRVQQRLDQPRTVEKLDVQYDAKAFGIKFKKDAATIKSTL-AESDKERLQCI 458

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D +G + V   DG +YE+T + + I   T TEH+RE+TPNVIEPSFGIGRILYSL+
Sbjct: 459 KDEMDKDGKSLVKCADGKEYELTPDLVKINPITVTEHMREFTPNVIEPSFGIGRILYSLL 518

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D+ R VLSFPP VAP K L+V +SN+PA T ++ +++ ++RKL IA +VDD
Sbjct: 519 EHSYWAREQDKARGVLSFPPLVAPIKVLIVAISNDPALTAVIHDISIKLRKLGIASRVDD 578

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS SIG++YARNDELGTPF IT+DF +  + T+TLRERD+TKQ+  + + +L+ +  L++
Sbjct: 579 SSASIGKKYARNDELGTPFGITVDFATAKNGTLTLRERDTTKQLIGSTEDVLKTVDQLVK 638

Query: 301 ESTTWE---KVMETY 312
            +  WE   KV++ Y
Sbjct: 639 GTIDWEGASKVLQEY 653



>gi|449545596|gb|EMD36567.1| hypothetical protein CERSUDRAFT_84740 [Ceriporiopsis subvermispora
           B]
          Length = 653

 Score =  345 bits (886), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 217/315 (68%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P RLRFRQHM NEMAHYA DCWDA+I NS GW ECVGCADR+AYDLTV
Sbjct: 335 RIYLFLVKIGINPRRLRFRQHMGNEMAHYATDCWDAEIENSTGWTECVGCADRAAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+T   LVVR+ L EP++ +K   E NKKV G    +++ T++  +            
Sbjct: 395 HSNKTGHPLVVRQALKEPVVTEKETAEFNKKVLGRTFGKDAGTIQTIVNDMDEAALLRLK 454

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  GT  +  +DG ++ +  + LTI+R+TF + +RE+TPNVIEPSFG+GRILY+L+
Sbjct: 455 GEL--AQGTATITSSDGREFTLAPDLLTIERKTFKQSIREFTPNVIEPSFGLGRILYTLL 512

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R++D +R VLS P  VAP K L+VPLS    F  L+ E++ ++R+  +  +VDD
Sbjct: 513 EHSFWSREEDVERGVLSLPAVVAPTKVLIVPLSAKEEFNPLIREVSSKLRQAGVFSRVDD 572

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTP+ +TIDF S+ +RT+TLRERD+T Q+  +I+ ++  + +L++
Sbjct: 573 SNTSIGRRYARNDELGTPYGLTIDFASIQNRTVTLRERDTTGQLIGSIEEVIATVTELVD 632

Query: 301 ESTTWEKVMETYPTF 315
            S  W +     P +
Sbjct: 633 GSIDWAEACRRLPAY 647



>gi|380489909|emb|CCF36384.1| glycyl-tRNA synthetase [Colletotrichum higginsianum]
          Length = 664

 Score =  345 bits (886), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 223/326 (68%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFLQKIGVDMTKVRFRQHMENEMAHYATDCWDAELLTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYL-TSXXXXXXXXX 119
           H+ +T   LVVRE L EP ++++  +EI++K FGP+ +++ KTVE  L  +         
Sbjct: 395 HAKKTGAPLVVRERLDEPRVFEEWQVEIDRKKFGPQFKKDGKTVEAALEATNQEQREKLA 454

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G      +++ + + ++ +   E+ REYTPNVIEPSFGIGRI+YSL
Sbjct: 455 KQLAENGELELEVAGVGNGIVKVSKDLVKVEFRKRVENTREYTPNVIEPSFGIGRIMYSL 514

Query: 180 IEHVYWTRK----DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIA 235
           IEHVYW R      DE R VLSFPP VAP K L+VPLS N  F   V ++++++RK+ I+
Sbjct: 515 IEHVYWNRATEDGGDEARGVLSFPPTVAPTKVLIVPLSANKQFQPFVSKISQKLRKIGIS 574

Query: 236 IKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVL 295
            +VD SS +IG+RY+RNDELGTP  +TIDFQ+V D TITLR+RDSTKQ+R + DTI+  +
Sbjct: 575 ARVDSSSATIGKRYSRNDELGTPLGVTIDFQTVQDSTITLRDRDSTKQVRADEDTIVAAI 634

Query: 296 KDLLEESTTWEKVMETYPTFTQQELD 321
           + L+  +  W+ +    P F  QE+D
Sbjct: 635 QSLVTGAREWKDIATELPAFEGQEVD 660



>gi|366996695|ref|XP_003678110.1| hypothetical protein NCAS_0I00970 [Naumovozyma castellii CBS 4309]
 gi|342303981|emb|CCC71765.1| hypothetical protein NCAS_0I00970 [Naumovozyma castellii CBS 4309]
          Length = 665

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 216/319 (67%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+   +LRFRQHM NEMAHYA DCWD ++  SYGWIECVGCADRSA+DLTV
Sbjct: 342 RIYQFLMKIGVDSTKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAFDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RT EKLVVR+ L  P+   +  +++ KK+FGPK R+++  VE  L +          
Sbjct: 402 HSKRTGEKLVVRQKLETPIEVTQWEIDLTKKLFGPKFRKDAPKVEKILLNLSQEELAAKA 461

Query: 121 XX-XXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +V G +G   E+  +++TI+++T  EHVRE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 EELKSNGKIAFQVEGIEGT-VELDDKFVTIEKRTKVEHVREFVPNVIEPSFGIGRIIYSI 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  R VLSFPP VAP K LLVPLS +     +  E++K +RK  I  KVD
Sbjct: 521 FEHSFWNRPEDAARGVLSFPPLVAPTKVLLVPLSTHKDLQPVTKEVSKILRKAQIPFKVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF ITIDF+S  D ++TLRERDSTKQ+R +++ I+  ++++ 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGITIDFESAKDGSVTLRERDSTKQVRGSVEEIINAIREIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +WE+  +    F  Q
Sbjct: 641 YSGVSWEEGTKNLKPFVSQ 659



>gi|393234334|gb|EJD41898.1| glycyl-tRNA synthetase [Auricularia delicata TFB-10046 SS5]
          Length = 647

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 163/320 (50%), Positives = 217/320 (67%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI PDRLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDL+V
Sbjct: 327 RISLFLLKIGINPDRLRFRQHMDNEMAHYATDCWDAEIHNSSGWTECVGCADRAAYDLSV 386

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L   E L EP++ D+ V E+NKK FG    +++  V   L +          
Sbjct: 387 HAKKTGANLSATELLKEPVLTDEFVAEVNKKTFGKHFARDTGDVMQALLALQQPALIAAA 446

Query: 121 XXXXDGNGTTKVPGTDGNQ-YEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D NG  ++P  DG + +E+T E +TI  +T  E VR YTPNVIEPSFG+GRILY L
Sbjct: 447 AEL-DKNGKVQIPSADGARSFELTKELVTISMRTKKESVRTYTPNVIEPSFGLGRILYCL 505

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW R++ E R VLSF P VAP K L+VP+S+NP F  L+ +++ ++R+  I  +VD
Sbjct: 506 LEHSYWAREESETRGVLSFNPLVAPTKVLIVPISSNPDFHPLIKDVSAKLRRAGIYARVD 565

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTP+ +TIDF SV + T+TLRERD+ +Q    +D ++ V+ +L+
Sbjct: 566 DSSASIGKRYARNDELGTPYGVTIDFASVQNGTMTLRERDTMRQRIGPVDEVIAVVTELI 625

Query: 300 EESTTWEKVMETYPTFTQQE 319
             +  W+   E  P ++ Q+
Sbjct: 626 NGTLDWDAACERLPVYSGQQ 645



>gi|342875536|gb|EGU77279.1| hypothetical protein FOXB_12202 [Fusarium oxysporum Fo5176]
 gi|475667639|gb|EMT65428.1| Glycyl-tRNA synthetase 1, mitochondrial [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 663

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 221/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   +LRFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFLEKIGVDLTKLRFRQHMANEMAHYATDCWDAELFTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE    P++ ++  ++I +K FGP+ ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVREQRETPLVIEEWQIDIERKKFGPQFKKDAKTVETALLATSQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+ T +V G    + ++  + + I+ +   E+ RE+ PNVIEPSFGIGRILYSL
Sbjct: 455 KELSDNGSITLEVAGVGDGKVQVNKDSIAIEFRKRVENTREFVPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH +WTR     DE R VLSFPP VAP K LLVPLS+N  F  L+ +L++R+R   I+ 
Sbjct: 515 MEHSFWTRGTEGGDEARGVLSFPPTVAPTKVLLVPLSSNAQFKPLLKQLSQRLRSAGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQ+V D T+TLR+RDST Q+R   + I+  +K
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQTVQDGTVTLRDRDSTNQVRAEQEKIIDAIK 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+  S TW ++    P F  QE++
Sbjct: 635 SLVNGSKTWSQIENELPKFEGQEVE 659



>gi|440635819|gb|ELR05738.1| glycyl-tRNA synthetase [Geomyces destructans 20631-21]
          Length = 710

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 225/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL KLG+   ++RFRQHM NEMAHYA DCWDA++  SYGW+ECVGCADRSAYDLTV
Sbjct: 380 RVQLFLKKLGVDQTKIRFRQHMANEMAHYATDCWDAELLTSYGWVECVGCADRSAYDLTV 439

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVRE  AEP++ ++   E++KK FGP  +++ K VE  + +          
Sbjct: 440 HSKKTGIPLVVRETRAEPLVIEEFAAEVDKKKFGPFFKKDGKAVEAAIAATTQEQRESLA 499

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G    +VPG      EI+ + L I+++T TEH REYTPNVIEPSFGIGRILYSL
Sbjct: 500 KDLIQNGKIAIEVPGVGSGTVEISKDLLVIEKRTRTEHTREYTPNVIEPSFGIGRILYSL 559

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR    +DE R VLSFPP +AP K LLVPLS + +F  ++  L+ ++R + I+ 
Sbjct: 560 LEHNYWTRATEGNDESRGVLSFPPPIAPTKVLLVPLSGHESFKPIIKHLSHKLRAMGISN 619

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIGRRY+RNDELGTP  IT+DFQSV D+T TLR+RDSTKQ+R +  TI++ ++
Sbjct: 620 RIDDSSASIGRRYSRNDELGTPLGITVDFQSVQDKTFTLRDRDSTKQVRADEATIIKAIQ 679

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +++     W+ V +  P F  Q+ +
Sbjct: 680 EVVNGEKEWKDVEKELPAFEGQDAE 704



>gi|346324760|gb|EGX94357.1| glycyl-tRNA synthetase 1 [Cordyceps militaris CM01]
          Length = 689

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 226/350 (64%), Gaps = 29/350 (8%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYACDCWDA+++ + GW+ECVGCADRSAYDLTV
Sbjct: 336 RIHLFLKKIGVDMSKMRFRQHMANEMAHYACDCWDAELYTTTGWVECVGCADRSAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE L +P + ++  +EI+KK FGP  ++++K VE  L +          
Sbjct: 396 HAKKTGAALLVRERLEQPRVIEEWQVEIDKKKFGPLFKKDAKAVETALEATTQEQREVLS 455

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               DG   +  VPG    + E+TS+ + I+ +   E+ RE+TPNVIEPSFGIGRILYSL
Sbjct: 456 KQLADGGKISLDVPGVGDGKAEVTSDSIKIEFRKRVENTREFTPNVIEPSFGIGRILYSL 515

Query: 180 IEHVYWTRKDD----------------------------EQRSVLSFPPRVAPFKCLLVP 211
           IEH +WTR  D                             Q  VLSFPP VAP K LLVP
Sbjct: 516 IEHNFWTRGSDGSDEARGVSDYYQDTCYSPVAENAIFTNTQLQVLSFPPPVAPTKVLLVP 575

Query: 212 LSNNPAFTDLVDELAKRIRKLSIAIKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDR 271
           LS+N  F   V +L++R+R + I+ +VDDSS SIG+RY+RNDELGTP  IT+DFQ++ D+
Sbjct: 576 LSSNTQFKPEVRKLSQRLRAMGISSRVDDSSASIGKRYSRNDELGTPLGITVDFQTLQDQ 635

Query: 272 TITLRERDSTKQIRENIDTILQVLKDLLEESTTWEKVMETYPTFTQQELD 321
           TITLR+RDST Q+R +   IL+ +K L++ S  W K+    P F  QE++
Sbjct: 636 TITLRDRDSTTQVRADEAKILEAVKSLVDGSKDWAKIQSELPKFEGQEVE 685



>gi|409043806|gb|EKM53288.1| hypothetical protein PHACADRAFT_124831 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 656

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 214/316 (67%), Gaps = 3/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ P RLRFRQHM NEMAHYA DCWDA+I NS GW ECVGCADR+AYDL+V
Sbjct: 338 RIYLFLAKIGVNPKRLRFRQHMANEMAHYATDCWDAEIENSTGWTECVGCADRAAYDLSV 397

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT   LVVRE L EP++ +K V E NKK+ G    ++   V   +++          
Sbjct: 398 HAKRTGAPLVVREALKEPIVTEKEVPEFNKKLMGKTFGKDLPVVTQVVSTMSEEELIKLK 457

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G      P  DG ++++T E LTI+RQT  + +RE+TPNVIEPSFG+GRILY+L+
Sbjct: 458 GQLAQGEAVIISP--DGRKFKLTPEILTIERQTLKQSIREFTPNVIEPSFGLGRILYTLL 515

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D  R VLS P  VAP K L+VPLS    F +LV E++ ++RK  +  +VDD
Sbjct: 516 EHSFWSREQDADRGVLSLPVIVAPTKVLIVPLSTK-KFDELVQEVSSKLRKAGVFSRVDD 574

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIGRRYARNDELGTPF +T+DF SV  RT+TLRERD+T+Q+  NI+ ++ V+ DL  
Sbjct: 575 SNQSIGRRYARNDELGTPFGLTLDFASVQHRTMTLRERDTTEQLIGNIEEVIAVVIDLCN 634

Query: 301 ESTTWEKVMETYPTFT 316
               W +  +  P +T
Sbjct: 635 GMIEWAEACQRLPRYT 650



>gi|512193240|gb|EPE08998.1| glycyl-trna synthetase 1 [Ophiostoma piceae UAMH 11346]
          Length = 745

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 223/324 (68%), Gaps = 5/324 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 420 RIHLFLKKIGVDQTKIRFRQHMANEMAHYATDCWDAELQTSGGWVECVGCADRSAYDLTV 479

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L  P + ++  +EI++K FGP  +++++ VE  L +          
Sbjct: 480 HAKKTGAPLIVRQRLDTPKVIEEWTVEIDRKKFGPHFKKDARAVEAGLVALDQKALEAAA 539

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+ T + PG      E+T   + I+    TE+VRE+TPNVIEPSFGIGRILYSL+
Sbjct: 540 AKLKAGSFTVEAPGV--GPAEVTGNLVKIEFTKRTENVREFTPNVIEPSFGIGRILYSLL 597

Query: 181 EHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           EH YW+R     DE R V+SF P VAP K L+VP+S+   F  +V EL++++R L +A +
Sbjct: 598 EHNYWSRGAEGGDEARGVISFSPAVAPTKVLIVPISSKDEFKPIVRELSQKLRGLGVASR 657

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VDDS+ SIG+RY+RNDELGTPF +T+DFQ+V D ++TLRERDSTKQ+R +   IL+ ++ 
Sbjct: 658 VDDSTASIGKRYSRNDELGTPFGLTVDFQTVADGSVTLRERDSTKQVRASQSVILETIQA 717

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           L++ + TW  +    P F QQE++
Sbjct: 718 LVKGTKTWADIQAELPAFEQQEVE 741



>gi|512207382|gb|EPE36200.1| Class II aaRS and biotin synthetase [Glarea lozoyensis ATCC 20868]
          Length = 665

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 225/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIHLFLKKIGVDQSKIRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L VRE L +P+  ++  ++++KK FGP  +++ KT+E  + +          
Sbjct: 395 HAKKTGAPLFVRERLDKPITIEEWQIDLDKKKFGPFFKKDGKTIETAIEALSQEKREALA 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G    + E++ + + I+R+T TE+ REYTPNVIEPSFGIGRILY L
Sbjct: 455 QDLKADGKITVDVEGVGNGKVEVSKDLIAIERRTRTENTREYTPNVIEPSFGIGRILYCL 514

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
            EH YWTR  D   E R VLSFPP VAP K LLVPLS+N +F  LV +++ ++R L I+ 
Sbjct: 515 FEHNYWTRGSDGGDEARGVLSFPPTVAPTKVLLVPLSSNESFKPLVKDMSLKLRALGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQSV D+T TLR+RDSTKQ+R + D+I   ++
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQSVKDKTFTLRDRDSTKQVRADEDSIFAAIR 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  W  + +  P F  Q+L+
Sbjct: 635 SLVDGSKVWADIEKELPVFEGQDLE 659



>gi|402077342|gb|EJT72691.1| glycyl-tRNA synthetase [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 742

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYACDCWDA++  SYGW+ECVGCADRSAYDL+V
Sbjct: 414 RIHLFLKKIGVDQTKIRFRQHMANEMAHYACDCWDAELLTSYGWVECVGCADRSAYDLSV 473

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSX-XXXXXXXX 119
           H+ +T   L+VR+ L EP I ++  ++IN+K+FGPK ++ ++ VE  L +          
Sbjct: 474 HAKKTGAPLIVRQRLEEPKIVEEWTVDINRKMFGPKFKKEARFVEGVLMAIPQEQLGALA 533

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  +  VP   G +  +  E ++IK    TE+VRE+ PNVIEPSFGIGRILYSL
Sbjct: 534 KKLDEEGAISLDVPEAAGGKTNVDKEAISIKWTKRTENVREFVPNVIEPSFGIGRILYSL 593

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSF P VAP K L+VPLS    F   V ++++++R + ++ 
Sbjct: 594 LEHNYWTRGSEGGDEARGVLSFTPVVAPTKVLIVPLSGKDEFRPFVQKISQKLRSVGVSN 653

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS +IG+RY+RNDELGTP  ITIDFQ+V D TITLR+RDST+Q+R + D I+  ++
Sbjct: 654 RIDDSSATIGKRYSRNDELGTPLGITIDFQTVQDNTITLRDRDSTRQVRASEDKIVDAIQ 713

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+    TW+ +    P F  QE++
Sbjct: 714 SLVSGDKTWKDIESELPLFEGQEVE 738



>gi|361125027|gb|EHK97089.1| putative Glycyl-tRNA synthetase 1, mitochondrial [Glarea lozoyensis
           74030]
          Length = 711

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 225/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 335 RIHLFLKKIGVDQSKIRFRQHMANEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L VRE L +P+  ++  ++++KK FGP  +++ KT+E  + +          
Sbjct: 395 HAKKTGAPLFVRERLDKPITIEEWQIDLDKKKFGPFFKKDGKTIETAIEALSQEKREALA 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G    + E++ + + I+R+T TE+ REYTPNVIEPSFGIGRILY L
Sbjct: 455 QDLKADGKITVDVEGVGNGKVEVSKDLIAIERRTRTENTREYTPNVIEPSFGIGRILYCL 514

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
            EH YWTR  D   E R VLSFPP VAP K LLVPLS+N +F  LV +++ ++R L I+ 
Sbjct: 515 FEHNYWTRGSDGGDEARGVLSFPPTVAPTKVLLVPLSSNESFKPLVKDMSLKLRALGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQSV D+T TLR+RDSTKQ+R + D+I   ++
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQSVKDKTFTLRDRDSTKQVRADEDSIFAAIR 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  W  + +  P F  Q+L+
Sbjct: 635 SLVDGSKVWADIEKELPVFEGQDLE 659



>gi|336365962|gb|EGN94310.1| hypothetical protein SERLA73DRAFT_188118 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336378643|gb|EGO19800.1| hypothetical protein SERLADRAFT_478110 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 682

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 217/315 (68%), Gaps = 3/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FLTK+GI P RLRFRQHM NEMAHYA DCWDA+I NS GW ECVGCADR+AYDL+V
Sbjct: 364 RIYQFLTKIGINPARLRFRQHMANEMAHYATDCWDAEIENSTGWTECVGCADRAAYDLSV 423

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++ +K V E+NKK+ G    ++S  ++  +            
Sbjct: 424 HSAKTGHPLVVRQALKEPIVTEKEVAELNKKLVGKTFGRDSALLQKIVAEMDEAQLLKLK 483

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+    +   +G ++++T E +TI+R+T  + +RE+TPNVIEPSFG+GRILY+L+
Sbjct: 484 GEVAQGSA---IVSAEGKEFKLTPELITIERKTLKQSIREFTPNVIEPSFGLGRILYTLL 540

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP VAP K L+VPLS    F  LV E++ ++R+  I  +VDD
Sbjct: 541 EHSFWSREQDVERGVLSLPPVVAPTKVLIVPLSAREEFDPLVKEVSSKLRRAGIFSRVDD 600

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF +T+DF SV +RT+TLRERD+T Q+  +ID ++ V+ +L++
Sbjct: 601 SNTSIGKRYARNDELGTPFGVTLDFASVQNRTMTLRERDTTGQLIGSIDEVIAVVTELVQ 660

Query: 301 ESTTWEKVMETYPTF 315
               W +     P +
Sbjct: 661 GGLDWAEACRRLPAY 675



>gi|406864937|gb|EKD17980.1| glycyl-tRNA synthetase [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 723

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 229/325 (70%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 390 RIHLFLEKIGVDQSKIRFRQHMANEMAHYATDCWDAELLTSYGWIECVGCADRSAYDLTV 449

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSX-XXXXXXXX 119
           H+ +T   L+VRE LAEP+  ++  ++++KK FGP  +++ KTVE  + +          
Sbjct: 450 HAKKTGAPLMVRERLAEPLTIEEWQIDLDKKKFGPFFKKDGKTVEAAIEALPQDKREALA 509

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  V G    + EI+ + + I+R+T TE+ RE+TPNVIEPSFGIGRI+YSL
Sbjct: 510 QDLKLDGKITIDVEGVGNGKVEISKDLIVIERRTRTENTREFTPNVIEPSFGIGRIIYSL 569

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YWTR     DE R VLSFPP VAP K LLVPLS++ +F  L+  ++ ++R L ++ 
Sbjct: 570 IEHNYWTRGTDGGDEARGVLSFPPPVAPTKVLLVPLSSHESFKPLLKYMSLKLRSLGVSS 629

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQSV D+T TLR+RDSTKQ+R + +TIL+ +K
Sbjct: 630 RVDDSSASIGKRYSRNDELGTPLGITIDFQSVKDKTYTLRDRDSTKQVRADEETILKAIK 689

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+E    W  V +  P F  Q+++
Sbjct: 690 ALVEGEKKWADVEKELPAFEGQDVE 714



>gi|477512077|gb|ENH64638.1| Glycyl-tRNA synthetase 1, mitochondrial [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 663

 Score =  343 bits (879), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 220/325 (67%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   +LRFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDL+V
Sbjct: 335 RIHLFLEKIGVDLTKLRFRQHMANEMAHYATDCWDAELFTSSGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVRE    P++ ++  ++I +K FGP+ ++++KTVE  L +          
Sbjct: 395 HAKKTGAPLVVREQRETPLVIEEWQIDIERKKFGPQFKKDAKTVETALLATSQEQREKLA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+   +V G    + ++  + + I+ +   E+ RE+ PNVIEPSFGIGRILYSL
Sbjct: 455 KELSDNGSINLEVAGVGDGKVQVNKDSIAIEFRKRVENTREFVPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRK---DDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH +WTR     DE R VLSFPP VAP K LLVPLS+N  F  L+ +L++R+R   I+ 
Sbjct: 515 MEHSFWTRGTEGGDEARGVLSFPPTVAPTKVLLVPLSSNAQFKPLLKQLSQRLRSAGISS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  ITIDFQ+V D T+TLR+RDST Q+R   + I+  +K
Sbjct: 575 RVDDSSASIGKRYSRNDELGTPLGITIDFQTVQDGTVTLRDRDSTNQVRAEQEKIIDAIK 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L+  S TW ++    P F  QE++
Sbjct: 635 SLVNGSKTWSQIENELPKFEGQEVE 659



>gi|392562608|gb|EIW55788.1| glycyl-tRNA synthetase [Trametes versicolor FP-101664 SS1]
          Length = 655

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 214/315 (67%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL K+GI P RLRFRQHM NEMAHYA DCWDA+I NSYGW ECVGCADR+AYDLTV
Sbjct: 336 RIHQFLIKIGINPTRLRFRQHMANEMAHYATDCWDAEIQNSYGWTECVGCADRAAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++ +K   E NKK FG    ++S  ++  +            
Sbjct: 396 HSAKTGHPLVVRQALKEPIVTEKLTAEFNKKTFGKTFGKDSAAIQTIIGVMDEALLAKLQ 455

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G T V  +DG ++++T + LTI+++TF + +RE+TPNVIEPSFG+GRILY+L+
Sbjct: 456 GEL--AQGATTVTSSDGREFKLTPDLLTIEKKTFKQSIREFTPNVIEPSFGLGRILYALL 513

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D QR VLS P  VAP K L+VPLS  P F  LV +++ ++RK  I  +VDD
Sbjct: 514 EHSFWSREQDGQRGVLSLPTVVAPTKVLIVPLSAKPEFEPLVRDVSAKLRKAGIFSRVDD 573

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTP+ IT+DF SV + T+TLRERD+T Q+   ++ ++  + +L+ 
Sbjct: 574 SNTSIGKRYARNDELGTPYGITLDFASVQNGTMTLRERDTTGQLIGQVEEVIATVIELVN 633

Query: 301 ESTTWEKVMETYPTF 315
            +  W +     P +
Sbjct: 634 GTIDWAEACNRLPAY 648



>gi|156065255|ref|XP_001598549.1| hypothetical protein SS1G_00638 [Sclerotinia sclerotiorum 1980]
 gi|154691497|gb|EDN91235.1| hypothetical protein SS1G_00638 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 665

 Score =  342 bits (878), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 223/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+   ++RFRQHM NEMAHYA DCWDA++H S GW+ECVGCADRSAYDL+V
Sbjct: 337 RIQLFLAKIGVDQSKVRFRQHMANEMAHYAADCWDAELHTSSGWVECVGCADRSAYDLSV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L  P+  ++  ++++KK FGP+ +++ K VE  + +          
Sbjct: 397 HAKKTGAPLMVRQRLDTPITIEEWQIDLDKKKFGPQFKKDGKAVEAAIEALSQEKRESFA 456

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G    +V G    + E+ ++ + I+ +T  E+ REYTPNVIEPSFGIGRILY+L
Sbjct: 457 KELKDNGKIVIEVDGIADGKAEVGADLIKIELRTRVENTREYTPNVIEPSFGIGRILYAL 516

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSFPP VAP K LLVPLS++ +F   + +++ ++R + I+ 
Sbjct: 517 MEHNYWTRGSEGGDEARGVLSFPPIVAPTKVLLVPLSSHESFKPFLKQISYKLRSMGISS 576

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTP  IT+DFQSVND T TLR+RDSTKQ+R + + IL  +K
Sbjct: 577 RVDDSSASIGKRYSRNDELGTPLGITVDFQSVNDSTFTLRDRDSTKQVRASQEKILAAIK 636

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +L++ +  W  + +  P F  QE +
Sbjct: 637 ELVDGTKVWADIEKELPIFEGQEAE 661



>gi|407922814|gb|EKG15906.1| hypothetical protein MPH_06871 [Macrophomina phaseolina MS6]
          Length = 658

 Score =  342 bits (877), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 224/324 (69%), Gaps = 3/324 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G  P ++RFRQHM NEMAHYA DCWDA++H S GWIECVGCADRSAYDLTV
Sbjct: 335 RIQLFLLKIGADPKKIRFRQHMANEMAHYAADCWDAELHTSSGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L+VRE  AEP+  ++  ++I+KK FGPK +++ K VE  + S          
Sbjct: 395 HMNKTGAPLLVREKRAEPLKVEEWQVDIDKKKFGPKFKKDGKAVEAAVESLTQELREKLS 454

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +VPG    + E+  + + I+++T  ++ REYTPNVIEPSFGIGRILYS+
Sbjct: 455 LDLKSSGKITVEVPGVGDGKVELDKDLVNIEKRTRIDYTREYTPNVIEPSFGIGRILYSV 514

Query: 180 IEHVYWTRKDDEQ--RSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           IEH YW R  DE+  R VLSFPP VAP K LLVPLSNNP F  LV  +  ++RK+ I+ +
Sbjct: 515 IEHNYWVRPGDEEGARGVLSFPPLVAPTKVLLVPLSNNPDFKPLVQRIGLKLRKMGISSR 574

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VDDS  SIG+RY+RNDELGTP  IT+DF+S+ + TITLR+RDSTKQ+R + D I+  +K 
Sbjct: 575 VDDSGASIGKRYSRNDELGTPLGITVDFESLQNSTITLRDRDSTKQVRASEDEIIAAVKS 634

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           ++E   TW  V +  P F  Q+++
Sbjct: 635 VVEGEQTWADVEKRLPIFEGQQVE 658



>gi|346323714|gb|EGX93312.1| glycyl-tRNA synthetase [Cordyceps militaris CM01]
          Length = 652

 Score =  342 bits (876), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 214/325 (65%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+G    ++RFRQH+ NEMAHYACDCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 327 RIYMFLIKIGADSQKIRFRQHLDNEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLTV 386

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS  T   L V+ENL EP+   +    + KK+ GP+ ++++K VE  + +          
Sbjct: 387 HSKATGTPLTVKENLPEPLEITEWQASLEKKLLGPRFKKDAKKVEAAVQALDQNTLENLA 446

Query: 121 XXXXDGNGTTKVPG---TDGNQ-YEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRIL 176
               +    +   G    DG    E++ +  +IK+ T  EH+REYTPNVIEPSFGIGRIL
Sbjct: 447 AELAEKASISIPTGEALADGKTTAELSGDMCSIKKITRVEHIREYTPNVIEPSFGIGRIL 506

Query: 177 YSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           YS++EHVYW R  D  R VLS P   AP K LLVPLSN+ +F   +  LA R+R + IA 
Sbjct: 507 YSILEHVYWYRPQDTAREVLSLPILTAPTKVLLVPLSNHDSFKPTIKSLASRLRSIGIAN 566

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
             D SS SIGRRYARNDELGTP  IT+DF +V D +ITLRERDST Q+R + D I++ +K
Sbjct: 567 NTDTSSVSIGRRYARNDELGTPLGITVDFDTVKDGSITLRERDSTAQVRASEDDIIEAIK 626

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +L+  S TW++V +  P FT Q  D
Sbjct: 627 NLISGSETWKQVSQRLPAFTGQAQD 651



>gi|390596183|gb|EIN05586.1| glycyl-tRNA synthetase [Punctularia strigosozonata HHB-11173 SS5]
          Length = 654

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 214/316 (67%), Gaps = 2/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P RLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDL+V
Sbjct: 335 RIYLFLVKIGIDPQRLRFRQHMANEMAHYATDCWDAEIHNSTGWTECVGCADRAAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   LVVR+ L+ P+  +  V+E NKK  G    ++S  ++  +            
Sbjct: 395 HAKKTGAPLVVRQALSTPISREAEVVEFNKKNLGKTFGKDSAVIQKIVGDMSEEQLIKLK 454

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  GT  +   DG Q ++T  +LTI+R+T  +HVRE+ PNVIEPSFG+GRILY+L+
Sbjct: 455 GEL--AQGTATITAEDGRQLKLTPGFLTIERKTIKQHVREFIPNVIEPSFGLGRILYTLL 512

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS P  VAP K L+VPLS    F  LV E+  ++R   +  +VDD
Sbjct: 513 EHSFWSREQDVERGVLSLPALVAPTKVLIVPLSAKEEFVPLVREVHSKLRAAGVFSRVDD 572

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF +T+DF SV +RT+TLRERD+T Q+  +ID +++V+ +L+E
Sbjct: 573 SNTSIGKRYARNDELGTPFGVTLDFASVQNRTMTLRERDTTTQLIGDIDEVVKVVIELVE 632

Query: 301 ESTTWEKVMETYPTFT 316
            +  W++       +T
Sbjct: 633 GTIEWKEACGRLSVYT 648



>gi|170116654|ref|XP_001889517.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164635519|gb|EDQ99825.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 652

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 215/315 (68%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P+RLRFRQHM NEMAHYA DCWDA+IHN+ GW ECVGCADR+AYDL+V
Sbjct: 333 RIYLFLLKIGINPERLRFRQHMGNEMAHYATDCWDAEIHNATGWTECVGCADRAAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++ +K V E NKK  G   +Q++  ++  + S          
Sbjct: 393 HSAKTGHPLVVRQALKEPILTEKEVSEWNKKNLGKTFKQDAALIQSLVESMDEPELLRIK 452

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G    K    DG ++++T + LT++R+T  + +REYTPNVIEPSFG+GRILY+L+
Sbjct: 453 GELAQGAAIIK--SEDGREFQLTPDVLTVERKTLKQSIREYTPNVIEPSFGLGRILYTLL 510

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP VAP K L+VPLS    F  LV E++ ++RK  +  +VDD
Sbjct: 511 EHSFWSREQDVERGVLSLPPLVAPTKVLIVPLSARDEFNPLVQEVSSKLRKAGVFSRVDD 570

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF +T+DF SV +RT+TLRERD+  Q   +ID ++  + +L+ 
Sbjct: 571 SNTSIGKRYARNDELGTPFGVTLDFASVQNRTMTLRERDTMDQRIGSIDDVIATVTELVF 630

Query: 301 ESTTWEKVMETYPTF 315
            +  W +     P +
Sbjct: 631 GNIDWAEACTRLPAY 645



>gi|302674551|ref|XP_003026960.1| hypothetical protein SCHCODRAFT_79562 [Schizophyllum commune H4-8]
 gi|300100645|gb|EFI92057.1| hypothetical protein SCHCODRAFT_79562 [Schizophyllum commune H4-8]
          Length = 660

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 210/320 (65%), Gaps = 7/320 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL K+GI P RLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDLTV
Sbjct: 336 RIHTFLLKIGINPQRLRFRQHMANEMAHYATDCWDAEIHNSTGWTECVGCADRAAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+T   LVVRE L EP++ +K V E NKKV G   + ++  + + +            
Sbjct: 396 HSNKTGHPLVVREALKEPIVEEKDVPEWNKKVLGKTYKADASKITEAVEKLDQAALAEVK 455

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G  T  +   DG Q+++TSE LTI R+T    VRE+TPNVIEPSFG+GRILY+L+
Sbjct: 456 KSLEGGKATVTL--ADGRQFDLTSEVLTIPRKTLKTSVREFTPNVIEPSFGLGRILYTLL 513

Query: 181 EHVYWTR---KDDE--QRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIA 235
           EH +W R   KD E  +R VLS PP VAP K L+VPLS    F  LV E++ + RK  I 
Sbjct: 514 EHSFWIRAPTKDGERAERGVLSLPPLVAPTKVLIVPLSAKEEFDPLVAEVSAKFRKAGIF 573

Query: 236 IKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVL 295
            +VDDS+ SIG+RYARNDELGTP+ +T+DF SV  RT+TLRERD+  Q   +ID ++  +
Sbjct: 574 SRVDDSNASIGKRYARNDELGTPYGVTLDFASVQKRTMTLRERDTMDQRIGSIDEVIATV 633

Query: 296 KDLLEESTTWEKVMETYPTF 315
            DL+     WE      P +
Sbjct: 634 ADLVHHRIDWEGACARLPAY 653



>gi|395331560|gb|EJF63941.1| glycyl-tRNA synthetase [Dichomitus squalens LYAD-421 SS1]
          Length = 655

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 215/315 (68%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL K+GI P RLRFRQHM NEMAHYA DCWDA+I NSYGW ECVGCADR+AYDL+V
Sbjct: 336 RINQFLLKIGIDPARLRFRQHMANEMAHYATDCWDAEIQNSYGWTECVGCADRAAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++ +K V E NK+ FG    ++S  ++  +            
Sbjct: 396 HSAKTGHPLVVRQALKEPIVTEKLVAEFNKRTFGQTFGKDSAVIQTLVGGLDEALLAKLQ 455

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G+T V  +DG ++++T + LTI+++TF + +RE+TPNVIEPSFG+GRILY L+
Sbjct: 456 GEL--AQGSTTVTSSDGREFKLTPDLLTIEKKTFKQSIREFTPNVIEPSFGLGRILYVLL 513

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS P  VAP K L+VPLS    F  LV E++ ++RK  +  +VDD
Sbjct: 514 EHSFWSREQDVERGVLSLPAVVAPTKVLIVPLSAKTEFDPLVREVSTKLRKAGVFSRVDD 573

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTP+ +T+DF SV +RT+TLRERD+T Q+  +ID ++  + +L+ 
Sbjct: 574 SNTSIGKRYARNDELGTPYGLTLDFASVQNRTMTLRERDTTGQLIGSIDEVIDTVIELVS 633

Query: 301 ESTTWEKVMETYPTF 315
            S  W +     P +
Sbjct: 634 GSIDWAEACRRLPAY 648



>gi|393222980|gb|EJD08464.1| glycyl-tRNA synthetase [Fomitiporia mediterranea MF3/22]
          Length = 652

 Score =  340 bits (873), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 214/315 (67%), Gaps = 3/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI P RLRFRQHM NEMAHYA DCWDA+IHN+ GW ECVGCADR+AYDL+V
Sbjct: 334 RVQLFLLKIGIDPARLRFRQHMANEMAHYATDCWDAEIHNATGWTECVGCADRAAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L  P++ +K V E NKK FG    ++S  ++  ++           
Sbjct: 394 HSAKTGHPLVVRQALKVPIVTEKLVPEFNKKNFGKTFGRDSAAIQKAISDLTEEGLAKIQ 453

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G   + V   DG ++ +  ++L I+R+T  + +RE+TPNVIEPSFG+GRILY L+
Sbjct: 454 GELAQG---STVISADGKEFTLIPDHLVIERKTIKQSIREFTPNVIEPSFGLGRILYILL 510

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP +AP K L+VPLS    F  LV E++ ++RK  +  +VDD
Sbjct: 511 EHSFWSREQDVERGVLSLPPIIAPTKVLIVPLSAREEFDPLVREVSLKLRKAGVYSRVDD 570

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF +T+DF SV  RT+TLRERD+T Q+  +ID ++ V+ DL++
Sbjct: 571 SNTSIGKRYARNDELGTPFGLTLDFASVQKRTMTLRERDTTGQLIGDIDQVISVVTDLVQ 630

Query: 301 ESTTWEKVMETYPTF 315
            + TW    +  P +
Sbjct: 631 GNITWADACQILPAY 645



>gi|19114847|ref|NP_593935.1| mitochondrial and cytoplasmic glycine-tRNA ligase Grs1 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|1711632|sp|Q10179.1|SYG_SCHPO RecName: Full=Putative glycine--tRNA ligase; AltName:
           Full=Diadenosine tetraphosphate synthetase; Short=AP-4-A
           synthetase; AltName: Full=Glycyl-tRNA synthetase;
           Short=GlyRS
 gi|1182050|emb|CAA93301.1| mitochondrial and cytoplasmic glycine-tRNA ligase Grs1 (predicted)
           [Schizosaccharomyces pombe]
          Length = 652

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 224/316 (70%), Gaps = 4/316 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+GI  +R+RFRQHM NEMAHYACDCWDA+I  SYGWIECVGCADRSAYDL+V
Sbjct: 335 RISLFLEKIGIDMNRVRFRQHMSNEMAHYACDCWDAEIQCSYGWIECVGCADRSAYDLSV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTS-XXXXXXXXX 119
           HS  TK  LVV+E L EP++ ++  +E+N+K FGP+ ++++K VE+ + S          
Sbjct: 395 HSKATKTPLVVQEALPEPVVVEQFEVEVNRKKFGPRFKRDAKAVEEAMISWPESEKVEKS 454

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V   +G ++ + S+ +TI+++  TEH+R YTPNVIEPSFG+GRILY L
Sbjct: 455 AQLVAEGKIIVNV---NGVEHTVESDLVTIEKRKHTEHIRTYTPNVIEPSFGLGRILYVL 511

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YWTR +D  R VLSFP  +AP K L+VPLS N  F   V +L+ ++R L I+ K+D
Sbjct: 512 MEHAYWTRPEDVNRGVLSFPASIAPIKALIVPLSRNAEFAPFVKKLSAKLRNLGISNKID 571

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS+ +IGRRYARNDELGTPF +T+DF+++ + TITLRERDSTKQ+R + D ++  L  ++
Sbjct: 572 DSNANIGRRYARNDELGTPFGLTVDFETLQNETITLRERDSTKQVRGSQDEVIAALVSMV 631

Query: 300 EESTTWEKVMETYPTF 315
           E  +++E  +  +  F
Sbjct: 632 EGKSSFEDALAKFGEF 647



>gi|344234426|gb|EGV66296.1| hypothetical protein CANTEDRAFT_101439 [Candida tenuis ATCC 10573]
          Length = 654

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 214/319 (67%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+  +RLRFRQH+ NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 334 RIYKFLLKIGVDKNRLRFRQHLSNEMAHYAADCWDAELQTSYGWIECVGCADRSAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT EKLVVR+ L  P+  +K  ++I KK FGP  R+++  V+D+L +          
Sbjct: 394 HAARTNEKLVVRKALDAPVTVEKFEVDIEKKKFGPTFRKDAGKVQDWLLARTQCELEDLS 453

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D      KV G +  + E+   ++ I + T TEH+RE+TPNVIEPSFGIGRI+YS+
Sbjct: 454 KELKDNAKIVFKVDGIE-QEVELDETFVKIGKVTRTEHIREFTPNVIEPSFGIGRIIYSI 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W R +D  RSVLS PP VAP K LLVPLS+N     +V  +   +RK  I  KVD
Sbjct: 513 FEHQFWARPEDTDRSVLSLPPLVAPTKVLLVPLSSNAELQPMVKRVTNFLRKEQIPFKVD 572

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF ITIDF S+ D ++TLRERDSTKQ+R + + +++ +K++ 
Sbjct: 573 DSSTSIGKRYSRNDELGTPFGITIDFDSIKDDSVTLRERDSTKQVRGSFEDVIRAIKEIT 632

Query: 300 EESTTWEKVMETYPTFTQQ 318
               +W +       F  Q
Sbjct: 633 YNGVSWAEGTAKLTPFESQ 651



>gi|426193058|gb|EKV42992.1| hypothetical protein AGABI2DRAFT_195260 [Agaricus bisporus var.
           bisporus H97]
          Length = 680

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 216/315 (68%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI P+RLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDL+V
Sbjct: 361 RIYQFLIKIGINPERLRFRQHMSNEMAHYATDCWDAEIHNSTGWTECVGCADRAAYDLSV 420

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T   LVVR+ L EP++  +  +E NKK  G   +Q++  ++  + S          
Sbjct: 421 HSAKTGHPLVVRQALKEPIVTKREAVEWNKKNLGKTFKQDAGVIQKTVESLDEAALAKLK 480

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+    +   DG +++I+ + LTI+R+TF + +RE+TPNVIEPSFG+GRIL +L+
Sbjct: 481 GQLVQGSAV--ITSQDGKEFQISPDILTIERKTFKQSIREFTPNVIEPSFGLGRILSTLL 538

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP VAP K L+VPLS    F  LV E++ R+R+  +  +VDD
Sbjct: 539 EHSFWSRESDVERGVLSIPPLVAPTKVLIVPLSARAEFDPLVQEVSSRLRRAGVFSRVDD 598

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTP+ ITIDF SV +RT+TLRERD+  Q   ++D ++  + +L++
Sbjct: 599 SNTSIGKRYARNDELGTPYGITIDFASVQNRTMTLRERDTMDQRIGSMDDVIAAVTELVD 658

Query: 301 ESTTWEKVMETYPTF 315
            +  W +  +  P +
Sbjct: 659 GTIDWAEACQRLPAY 673



>gi|392586435|gb|EIW75771.1| glycyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
          Length = 653

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 160/315 (50%), Positives = 219/315 (69%), Gaps = 3/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL K+G+   RLRFRQHM NEMAHYA DCWDA+IHNS GW ECVGCADR+AYDLTV
Sbjct: 335 RIHSFLLKIGVNETRLRFRQHMDNEMAHYATDCWDAEIHNSTGWTECVGCADRAAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N+T + LVVR  L EP++ ++   E NKKV G    +++  ++  +            
Sbjct: 395 HANKTGQPLVVRVALKEPVVTERETAEFNKKVLGKTFGKDAGLIQKVVGEMDDVKLLKLK 454

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+ TT V   +G +  +T+E +TI+R+TF + +RE+TPNVIEPSFG GRILY+L+
Sbjct: 455 GELAQGS-TTIV--AEGKELTLTAEMVTIERKTFKQSIREFTPNVIEPSFGFGRILYTLL 511

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W+R+ D +R VLS PP VAP K L+VPLS    F  LV E++ ++RK  I  +VDD
Sbjct: 512 EHSFWSREQDVERGVLSLPPVVAPTKVLIVPLSAREEFDPLVREVSSKLRKAGIFSRVDD 571

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTPF IT+DF SV +RT+TLRERD+T Q+  +ID ++ V+ +L++
Sbjct: 572 SNTSIGKRYARNDELGTPFGITLDFASVQNRTMTLRERDTTDQLIGSIDDVIAVVTELVD 631

Query: 301 ESTTWEKVMETYPTF 315
            +  W++  E  P +
Sbjct: 632 GTIEWKEACERLPKY 646



>gi|169856615|ref|XP_001834964.1| glycine-tRNA ligase [Coprinopsis cinerea okayama7#130]
 gi|116503951|gb|EAU86846.1| glycine-tRNA ligase [Coprinopsis cinerea okayama7#130]
          Length = 653

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y +L  +GI P RLRFRQHM NEMAHYA DCWDA+I NSYGW ECVGCADR+AYDL+V
Sbjct: 334 RIYQYLINIGIDPARLRFRQHMGNEMAHYATDCWDAEIQNSYGWTECVGCADRAAYDLSV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HSN+T   L+VR+ L EP++ +K V E NKKV G   + ++  ++ ++ S          
Sbjct: 394 HSNKTGTPLIVRQALKEPIVTEKEVPEWNKKVMGKTFKGDAGILQKHIDSLDEAALIKLK 453

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+   K    +G ++ +T E LTI+R+TF + +RE+ PNVIEPSFG+GRILY L+
Sbjct: 454 GELAQGSAVVKT--EEGKEFTLTPEVLTIERKTFKQSIREFVPNVIEPSFGLGRILYCLL 511

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +W R+ D +R VLS PP VAP K L+VPLS    F  LV E+  ++RK  +  +VDD
Sbjct: 512 EHSFWAREQDIERGVLSLPPLVAPTKVLIVPLSAREEFDPLVQEITAKLRKAGVFSRVDD 571

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG+RYARNDELGTP+ +TIDF SV +RT+T+RERD+  Q    ID ++  + DL+ 
Sbjct: 572 SNTSIGKRYARNDELGTPYGLTIDFASVQNRTVTIRERDTMDQRIGKIDEVVATVTDLVN 631

Query: 301 ESTTWEKVMETYPTF 315
            +  W +  E  P +
Sbjct: 632 GNIDWAQACERLPKY 646



>gi|494830052|gb|EON66621.1| glycyl-tRNA synthetase 1 [Coniosporium apollinis CBS 100218]
          Length = 655

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 221/324 (68%), Gaps = 5/324 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL KLG+   +LRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 334 RIQQFLIKLGVDEKKLRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTV 393

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVE---DYLTSXXXXXXX 117
           H+ +T   L VRE   EP+  ++  ++++KK FGPK +++ KTVE   D LT        
Sbjct: 394 HAKKTGAPLCVRETRKEPLRIEEWQIDLDKKKFGPKFKKDGKTVEAAIDALTQDMREKLS 453

Query: 118 XXXXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILY 177
                  DG  +  V G    + E+  + + I+++T  E+VREYTPNVIEPSFGIGRILY
Sbjct: 454 LDLKN--DGKISVDVEGVANGKVELEKDIINIEKRTRVENVREYTPNVIEPSFGIGRILY 511

Query: 178 SLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           SLIEH YWTR+ DE R V+SFPP +AP K LLVPLS    F  L+  ++ R+R L I+ +
Sbjct: 512 SLIEHSYWTREGDEARGVISFPPMIAPTKVLLVPLSGVSDFKPLIKRISHRLRALGISNR 571

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VDDSS SIG+RYARNDELGT F IT+DFQSV D T TLR+RDSTKQ+R + D I   ++ 
Sbjct: 572 VDDSSASIGKRYARNDELGTAFGITVDFQSVKDNTFTLRDRDSTKQVRASEDEICAAVQS 631

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           L++ + TW  V    P F QQEL+
Sbjct: 632 LVDGNETWADVAGRLPKFEQQELE 655



>gi|451854174|gb|EMD67467.1| hypothetical protein COCSADRAFT_23841 [Bipolaris sorokiniana
           ND90Pr]
          Length = 657

 Score =  338 bits (868), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 220/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIQLFLLKIGVDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   L+VRE   EP+  ++   +I+KK FGPK +++ K VE  + S          
Sbjct: 396 HMKKTGAPLIVRETRKEPLKVEEWQCDIDKKKFGPKFKKDGKAVETAIESLSQDLREKLS 455

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VP     + E+  E +TI+++T  E +REYTPNVIEPSFGIGRI Y+L
Sbjct: 456 LDLEKEGKIVIDVPEVADGKVEVPKELITIEKRTRVETMREYTPNVIEPSFGIGRIFYAL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHVYWTR+ D+ R+VLSFPP VAP K L+VPLS+NP F   V  L  ++RKL I+ +VD
Sbjct: 516 CEHVYWTREQDDARAVLSFPPAVAPTKVLIVPLSSNPDFDPFVKTLKDKLRKLGISNRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RYARNDELGTP  IT+DFQS+ D T TLR+RD+T+Q+R ++D I Q + +++
Sbjct: 576 ASGASIGKRYARNDELGTPLGITVDFQSIKDNTFTLRDRDTTEQVRSSLDDIAQAISNIV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TW  V +  P F  QE+D
Sbjct: 636 KGEETWSDVAKRLPKFEGQEVD 657



>gi|322706404|gb|EFY97985.1| glycyl-tRNA synthetase 1 [Metarhizium anisopliae ARSEF 23]
          Length = 650

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 209/322 (64%), Gaps = 5/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+ P +LRFRQH+ NEMAHYACDCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 326 RVYLFLLKIGVDPQKLRFRQHLDNEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLTV 385

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS  T   L V+E  A P+   +    + K++ GP+ ++++K +E               
Sbjct: 386 HSRETGTSLTVKEARATPLEITEWKATLEKRLVGPRFKKDAKKIE-LAVGQLDQDHLRQL 444

Query: 121 XXXXDGNGTTKVP----GTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRIL 176
                G G   +P        +  E+TS+  +I++ T  E  REYTPNVIEPSFGIGRIL
Sbjct: 445 ATELAGKGVVTIPTDELANGAHSVELTSDVCSIRQTTRVETTREYTPNVIEPSFGIGRIL 504

Query: 177 YSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           YS++EHVYW+R  D  R VLS P  VAP K LLVPLSNN  F  ++  LA R+R + IA 
Sbjct: 505 YSILEHVYWSRPQDVAREVLSLPILVAPVKVLLVPLSNNVGFKPVIKALASRLRAMGIAN 564

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
            VD SS SIGRRYARNDELGTP  IT+DF ++ D ++TLRERDS  Q+R + D I++ ++
Sbjct: 565 NVDSSSVSIGRRYARNDELGTPLGITVDFYTLKDGSVTLRERDSRVQVRASQDEIVEAIR 624

Query: 297 DLLEESTTWEKVMETYPTFTQQ 318
           +L   +  W++V    P FT Q
Sbjct: 625 NLTAGAEAWDQVARRLPVFTGQ 646



>gi|330940966|ref|XP_003306011.1| hypothetical protein PTT_19018 [Pyrenophora teres f. teres 0-1]
 gi|311316712|gb|EFQ85899.1| hypothetical protein PTT_19018 [Pyrenophora teres f. teres 0-1]
          Length = 657

 Score =  337 bits (864), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 219/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIQLFLLKIGVDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  RT   L+VRE   EP+   +   +++KK FGPK +++ KTVE  + +          
Sbjct: 396 HMKRTGAPLIVRETRKEPLHIGEWQCDLDKKKFGPKFKKDGKTVEAAIDALSQEVREKLS 455

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VP     + E+  E +TI+++T  E +REYTPNVIEPSFGIGRI Y+L
Sbjct: 456 LDLEKEGKIVIDVPEVGNGKVEVPKELITIEKRTRVETMREYTPNVIEPSFGIGRIFYAL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHVYWTR+ DE R+VLSFPP VAP K L+VPLS+NP F   V +L  ++R+L I+ +VD
Sbjct: 516 CEHVYWTREQDEARAVLSFPPAVAPTKVLIVPLSSNPDFEPFVRKLKDKLRRLGISNRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RYARNDELGTP  ITIDFQS+ D T TLR+RD+T+Q+R ++D I + + +++
Sbjct: 576 ASGASIGKRYARNDELGTPLGITIDFQSIKDNTFTLRDRDTTEQVRSSLDEIAKAIANIV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    W  V    P F  QE+D
Sbjct: 636 KGEEKWSDVAARLPKFEGQEVD 657



>gi|126274168|ref|XP_001387862.1| cyl-tRNA synthase [Scheffersomyces stipitis CBS 6054]
 gi|126213732|gb|EAZ63839.1| cyl-tRNA synthase [Scheffersomyces stipitis CBS 6054]
          Length = 661

 Score =  337 bits (863), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 215/322 (66%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+G+  DRLRFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 340 RVYQFLIKVGVDTDRLRFRQHMGNEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLSV 399

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT   LVVR+ L EP+  +   ++I+KK FGPK +++   ++ +L S          
Sbjct: 400 HAARTNASLVVRQPLPEPITVENYEVDIDKKKFGPKFKKDGGAIQKWLGSRSQCELEDYS 459

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     V G + N  E+TSEYL I +   TEH+RE+TPNVIEPSFGIGRILYS+
Sbjct: 460 KELADKGKIEINVKGVE-NTVELTSEYLKIAKVKRTEHIREFTPNVIEPSFGIGRILYSI 518

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH YW R  D  R VLS PP VAP K LLVPLSN+     +V +++  +RK  I  KVD
Sbjct: 519 FEHQYWARPGDADRGVLSLPPLVAPTKVLLVPLSNSADLQPIVTKVSAYLRKQQIPFKVD 578

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RYARNDELGTPF ITIDF S+ D ++TLRERDSTKQ+R + + ++  +K++ 
Sbjct: 579 DSSASIGKRYARNDELGTPFGITIDFDSIKDESVTLRERDSTKQVRGSFEDVVAAIKEIT 638

Query: 300 EESTTWEKVMETYPTFTQQELD 321
              TTW +       F  Q  D
Sbjct: 639 YTGTTWAEGTSKLTPFESQSTD 660



>gi|452000084|gb|EMD92546.1| hypothetical protein COCHEDRAFT_1174639 [Bipolaris maydis C5]
 gi|477591169|gb|ENI08242.1| hypothetical protein COCC4DRAFT_162840 [Bipolaris maydis ATCC
           48331]
          Length = 628

 Score =  337 bits (863), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 219/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 307 RIQLFLLKIGVDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 366

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   L+VRE   EP+  ++   +I+KK FGPK +++ K VE  + S          
Sbjct: 367 HMKKTGAPLIVRETRKEPLKVEEWQCDIDKKKFGPKFKKDGKAVETAIESLSQDLREKLS 426

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +      VP     + E+  E +TI+++T  E +REYTPNVIEPSFGIGRI Y+L
Sbjct: 427 LDLEKEDKIVIDVPEVADGKVEVPKELITIEKRTRVETMREYTPNVIEPSFGIGRIFYAL 486

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHVYWTR+ DE R+VLSFPP VAP K L+VPLS+NP F   V  L  ++RKL I+ +VD
Sbjct: 487 CEHVYWTREQDEARAVLSFPPAVAPTKVLIVPLSSNPDFDPFVKTLKDKLRKLGISNRVD 546

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RYARNDELGTP  IT+DFQS+ D T TLR+RD+T+Q+R ++D I Q + +++
Sbjct: 547 ASGASIGKRYARNDELGTPLGITVDFQSIKDNTFTLRDRDTTEQVRSSLDDIAQAISNIV 606

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +   TW  V +  P F  QE+D
Sbjct: 607 KGEETWSDVAKRLPKFEGQEVD 628



>gi|485920453|gb|EOD46475.1| putative glycyl-trna synthetase protein [Neofusicoccum parvum
           UCRNP2]
          Length = 711

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 221/324 (68%), Gaps = 3/324 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G  P ++RFRQHM NEMAHYA DCWDA++H S GWIECVGCADRSAYDLTV
Sbjct: 388 RIQLFLLKIGADPKKIRFRQHMANEMAHYAADCWDAELHTSSGWIECVGCADRSAYDLTV 447

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H N+T   L+VRE  AEP+  ++  ++I+KK FGPK +++ KTVE  + +          
Sbjct: 448 HMNKTGAPLLVREKRAEPLKVEEWQVDIDKKKFGPKFKKDGKTVEAAVEALTQELREKLS 507

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG  T  VP     + E+  + + I+++T  E+ REYTPNVIEPSFGIGRILYS+
Sbjct: 508 LDLKNDGKITIDVPNVGDGKVELGKDLVNIEKRTRVENTREYTPNVIEPSFGIGRILYSI 567

Query: 180 IEHVYWTRKDDEQ--RSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           IEH YW R  DE+  R VLSFPP V+P K LLVPLS +  F  LV  L+ ++RK+ I+ +
Sbjct: 568 IEHNYWVRPGDEEGARGVLSFPPVVSPTKVLLVPLSTHSDFAPLVQRLSSKLRKMGISSR 627

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VDDSS SIG+RY+RNDELGTP  IT+DF+SV   T TLR+RDSTKQ+R + D I+  +K 
Sbjct: 628 VDDSSASIGKRYSRNDELGTPLGITVDFESVQKGTFTLRDRDSTKQVRASEDEIIAAVKS 687

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           + E   TW  V +  P F  Q+L+
Sbjct: 688 VCEGEETWADVQKRLPLFEGQQLE 711



>gi|358372610|dbj|GAA89213.1| glycyl-tRNA synthetase [Aspergillus kawachii IFO 4308]
          Length = 667

 Score =  335 bits (860), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 215/322 (66%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G+  +++RFRQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 346 RIYLFLLKIGVDANKVRFRQHMANEMAHYATDCWDAELQTTYGWIECVGCADRSAYDLTV 405

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T+E LVVRE+  EP+  ++  ++INK   GP  ++N+K VE  L+S          
Sbjct: 406 HSKKTEEPLVVRESWREPLKVEEWQIDINKPKLGPLFKKNAKAVEAALSSLSQSERESLA 465

Query: 121 XXXXDGNGTTKVPGTD-GNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + NG   V   +   Q EI+ + ++I ++T TE++REY P VIEPSFGIGRI YSL
Sbjct: 466 TTLEE-NGIVSVTVPEMAEQVEISKDLISIVKRTRTENIREYIPIVIEPSFGIGRIFYSL 524

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW R +D  R VLS P  VAP K L+VPLS +  F  L  ++A+ +R L I+ + D
Sbjct: 525 LEHVYWHRANDPARGVLSLPISVAPTKVLIVPLSTHQDFVPLTKKIAEDLRGLGISCRAD 584

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +SS SIG+RYARNDELG P  +TIDF SV + TITLRERDSTKQ+R + + +   ++ L+
Sbjct: 585 ESSASIGKRYARNDELGIPLGVTIDFDSVKNGTITLRERDSTKQVRASQEEVFGAIECLI 644

Query: 300 EESTTWEKVMETYPTFTQQELD 321
                WE V    P F  Q  D
Sbjct: 645 SGKEKWEDVFARLPEFLGQSGD 666



>gi|11596253|gb|AAG38542.1|AF309805_7 glycyl tRNA synthetase [Pneumocystis carinii]
          Length = 615

 Score =  335 bits (860), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 216/321 (67%), Gaps = 44/321 (13%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL ++G+  ++LRFRQHM NEMAHYA  CWDA++  SYGWIECVGCADR+AYDLTV
Sbjct: 328 RIHLFLIRIGMNQEKLRFRQHMNNEMAHYASVCWDAELLTSYGWIECVGCADRAAYDLTV 387

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TKEKLVVRE L +PM   + V+ ++KK            +E+              
Sbjct: 388 HSEKTKEKLVVRELLPKPMEVTEWVVNVDKK-----------KIENL------------- 423

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                     K P          S   TI++   T  VREY PNVIEPSFGIGRILYSLI
Sbjct: 424 ----------KFP----------SSLFTIEQVKKTISVREYIPNVIEPSFGIGRILYSLI 463

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R DD  R VLSFPP VAP KCLLVPLSNN AF  ++D+L+  +R+L I+ KVDD
Sbjct: 464 EHSYWIRSDDVDRCVLSFPPIVAPVKCLLVPLSNNSAFDPIIDKLSFELRQLGISHKVDD 523

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IGRRY+RNDELGTPF IT+DFQ+VND ++TLRERD+T+QIR +   IL+V+K+L E
Sbjct: 524 SSAAIGRRYSRNDELGTPFGITVDFQTVNDGSLTLRERDTTRQIRASEKEILRVIKELSE 583

Query: 301 ESTTWEKVMETYPTFTQQELD 321
              +W+ V++ +P F +Q  D
Sbjct: 584 GLISWDDVLKDFPIFNKQITD 604



>gi|399168208|emb|CCE30914.1| probable glycine--tRNA ligase GRS1 [Claviceps purpurea 20.1]
          Length = 661

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 217/325 (66%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDL+V
Sbjct: 333 RIHLFLEKIGIDLTKMRFRQHMANEMAHYACDCWDAEMLTSTGWVECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VRE   EP++ ++  +++ +K FGP  ++++K VE  L +          
Sbjct: 393 HAKKTGAPLLVRERREEPLVIEEWEIDLIRKNFGPLFKKDAKAVEAALMASSQEERARMA 452

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               +    T +VP       E   E + I+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 453 KQMQETSKATLEVPDIGNGTVEFNDECIKIEFRKRVENTREYTPNVIEPSFGIGRILYSL 512

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH +W R  D   E R VLSFPP +AP K L+VPLS+N  FT  + +L++++R L I+ 
Sbjct: 513 IEHNFWMRGSDGGDETRGVLSFPPTIAPIKVLIVPLSSNSQFTPHIKKLSQQLRNLGISN 572

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIG+RY+RNDELGTP  IT+DFQ++ D T+TLR+RD+T Q+R     IL  +K
Sbjct: 573 RIDDSSASIGKRYSRNDELGTPLGITVDFQTLQDGTVTLRDRDTTDQLRAEASKILDAIK 632

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            L++ S  W+ V    P F  QE++
Sbjct: 633 ALVDGSKNWDMVASELPKFEGQEVE 657



>gi|302410789|ref|XP_003003228.1| glycyl-tRNA synthetase [Verticillium albo-atrum VaMs.102]
 gi|261358252|gb|EEY20680.1| glycyl-tRNA synthetase [Verticillium albo-atrum VaMs.102]
          Length = 663

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 225/325 (69%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+   ++RFRQHM NEMAHYA DCWDA++  S GWIECVGCADRSAYDLTV
Sbjct: 335 RIALFLKKIGVDMSKVRFRQHMQNEMAHYATDCWDAELLTSSGWIECVGCADRSAYDLTV 394

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L EP++ +   +E++KK FGPK +++ KTVE  L +          
Sbjct: 395 HAKKTGAPLIVRDRLDEPIVRELWEVEVDKKKFGPKFKKDGKTVEAALEATSQEQREALA 454

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G+   +V G    + EI+ + +TI+ +   E+ REYTPNVIEPSFGIGRILYSL
Sbjct: 455 KQLSEKGSLELEVAGVADGKVEISKDLVTIEFRKKVENTREYTPNVIEPSFGIGRILYSL 514

Query: 180 IEHVYWTRKDD---EQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           IEH YWTR  D   E RSVLSFPP VAP K L+VPLS N AF   + ++++++RK+ ++ 
Sbjct: 515 IEHSYWTRGSDGGDEARSVLSFPPTVAPTKVLIVPLSANKAFKPFIQKISQKLRKVGVSS 574

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS +IG+RY+RNDELGTP  ITIDFQSV D T TLR+RDSTKQ+R + D I+  + 
Sbjct: 575 RIDDSSATIGKRYSRNDELGTPLGITIDFQSVQDSTYTLRDRDSTKQVRADEDAIVAAVL 634

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
            ++E S  W+ +    P F  QE+D
Sbjct: 635 SIVEGSKEWKDIEAELPAFEGQEVD 659



>gi|350637470|gb|EHA25827.1| hypothetical protein ASPNIDRAFT_50342 [Aspergillus niger ATCC 1015]
          Length = 667

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 212/322 (65%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+G+  +++RFRQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 346 RIYIFLLKIGVDTNKVRFRQHMANEMAHYATDCWDAELQTTYGWIECVGCADRSAYDLTV 405

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TKE LVVRE   EP+  ++  ++I+K   GP  ++N+K VE  L +          
Sbjct: 406 HSRKTKEPLVVREPRREPLRVEEWQIDISKPKLGPLFKKNAKAVEAALIALSQSERESLA 465

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T  VP     Q EI+ + ++I ++T  E++REY PNVIEPSFG GRILYSL
Sbjct: 466 TILEKKGIITVTVPEM-AEQVEISKDLISIVKRTRIENIREYIPNVIEPSFGFGRILYSL 524

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW R +D  R VLS P  VAP K L+VPLS +  F  +   + + +R+L I+ + D
Sbjct: 525 LEHVYWHRANDPARGVLSLPISVAPTKVLIVPLSTHQDFVPITKRITEDLRELGISCRAD 584

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +SS SIG+RYARNDELG P  ITIDF SV D TITLRERDSTKQ+R + + IL  ++ L+
Sbjct: 585 ESSASIGKRYARNDELGIPLGITIDFDSVKDGTITLRERDSTKQVRASKEEILGAIESLI 644

Query: 300 EESTTWEKVMETYPTFTQQELD 321
                WE V    P F  Q  D
Sbjct: 645 SGKMNWEDVFARLPEFLGQSGD 666



>gi|254580769|ref|XP_002496370.1| ZYRO0C16830p [Zygosaccharomyces rouxii]
 gi|238939261|emb|CAR27437.1| ZYRO0C16830p [Zygosaccharomyces rouxii]
          Length = 663

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 218/319 (68%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +G+   +LRFRQH+ NEMAHYA DCWD ++  S+GWIECVGCADRSAYDLTV
Sbjct: 342 RISQFLLAIGVDATKLRFRQHLANEMAHYAADCWDGELLTSFGWIECVGCADRSAYDLTV 401

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TK+KLVVR+ L +P+   +  +++ KK+FGPK R+++  VE YL +          
Sbjct: 402 HSEKTKQKLVVRQKLEKPVEVTRWEIDLTKKLFGPKFRKDTPLVEAYLLNLSQEELASKA 461

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G    +V G DG + ++  +++ I+++T  EHVRE+ PNVIEPSFGIGRI+YS+
Sbjct: 462 EELKNTGKIVFQVEGIDG-KLDLDDKFVQIEKRTKIEHVREFVPNVIEPSFGIGRIIYSV 520

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +W+R +D  RSVLSF P VAP K LLVPLSN+     +  +++K++R   I  +VD
Sbjct: 521 FEHSFWSRPEDTARSVLSFAPLVAPTKVLLVPLSNHKDLAPVTAQVSKQLRTEKIPFRVD 580

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS  SIG+RYARNDELGTPF +TIDF S  D ++TLRERDSTKQ+R +   +++ ++ + 
Sbjct: 581 DSGVSIGKRYARNDELGTPFGVTIDFDSCKDGSVTLRERDSTKQVRGSTKDVIEAIRSIT 640

Query: 300 EESTTWEKVMETYPTFTQQ 318
               TWE+  ++   FT Q
Sbjct: 641 YGGVTWEEGTKSLTPFTSQ 659



>gi|367028000|ref|XP_003663284.1| hypothetical protein MYCTH_80528 [Myceliophthora thermophila ATCC
           42464]
 gi|347010553|gb|AEO58039.1| hypothetical protein MYCTH_80528 [Myceliophthora thermophila ATCC
           42464]
          Length = 665

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+GI   ++RFRQHM NEMAHYACDCWDA++  S GW+ECVGCADRSAYDLTV
Sbjct: 336 RIHLFLKKIGIDQTKIRFRQHMANEMAHYACDCWDAELLTSSGWVECVGCADRSAYDLTV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVED-YLTSXXXXXXXXX 119
           H+ +T   L+VR+ L EP + ++  +EI KK FGP  +++ KT+E   L +         
Sbjct: 396 HAKKTGAPLIVRQRLDEPKVIEEWEVEIEKKKFGPFFKKDGKTIEAAILATTQEERGKLA 455

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T  VP     + E++ + L IK Q   E++REYTPNVIEPSFGIGRILY+L
Sbjct: 456 KELEETGKATINVPSIGDGKVEVSKDLLAIKWQKRVENIREYTPNVIEPSFGIGRILYAL 515

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSFPP VAP K L+VPLS++  FT  V +L++++R   I+ 
Sbjct: 516 MEHNYWTRASEGGDEARGVLSFPPAVAPTKVLIVPLSSHKDFTPTVRKLSQKLRSAGISS 575

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS SIG+RY+RNDELGTPF IT+DFQ+V D T+TLRERDST+Q+R +   I+  +K
Sbjct: 576 RVDDSSASIGKRYSRNDELGTPFGITVDFQTVKDGTVTLRERDSTRQVRADEGKIIDAIK 635

Query: 297 DLLEESTTWEKVMETYPTF-TQQELD 321
            L+E + TW+ +    P F  QQE++
Sbjct: 636 ALVEGTKTWQDIESELPIFEGQQEVE 661



>gi|482812403|gb|EOA89122.1| hypothetical protein SETTUDRAFT_105658 [Setosphaeria turcica Et28A]
          Length = 657

 Score =  333 bits (854), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 220/322 (68%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P ++RFRQHM NEMAHYA DCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 336 RIQLFLLKIGVDPKKIRFRQHMANEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLSV 395

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H  +T   L+VRE   EP+  ++   +I+KK FGPK ++N KTV+  + +          
Sbjct: 396 HMKKTGAPLIVRETRKEPLKVEEWQCDIDKKKFGPKFKKNGKTVKAAIEALTQDMREKLS 455

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     VP     + E+  E +TI+++T  E +REYTPNVIEPSFGIGRI Y+L
Sbjct: 456 LDLEKEGKIVIDVPDVGDGKVEVPKELITIEKRTRVETMREYTPNVIEPSFGIGRIFYAL 515

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EHVYWTR+ D+ R+VLSFPP VAP K L+VPLS+NP F   + ++   +RKL I+ +VD
Sbjct: 516 CEHVYWTREQDDARAVLSFPPAVAPTKVLIVPLSSNPDFEPFIKKVKDELRKLGISNRVD 575

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RYARNDE+GTP  +T+DFQS+ D+T TLR+RD+T+Q+R ++  I Q + +++
Sbjct: 576 ASGASIGKRYARNDEVGTPLGVTVDFQSIKDKTFTLRDRDTTEQVRSSLGDIAQAISNIV 635

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           +    W  V +  P F  QE+D
Sbjct: 636 KGEEQWSDVAKRLPKFEGQEVD 657



>gi|145246120|ref|XP_001395309.1| glycyl-tRNA synthetase 1 [Aspergillus niger CBS 513.88]
 gi|134080022|emb|CAK41069.1| unnamed protein product [Aspergillus niger]
          Length = 667

 Score =  333 bits (853), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 211/322 (65%), Gaps = 2/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y+FL K+G+  +++RFRQHM NEMAHYA DCWDA++  +YGWIECVGCADRSAYDLTV
Sbjct: 346 RIYIFLLKIGVDTNKVRFRQHMANEMAHYATDCWDAELQTTYGWIECVGCADRSAYDLTV 405

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +TKE LVVRE   EP+  ++  ++I+K   GP  ++N+K VE  L +          
Sbjct: 406 HSRKTKEPLVVREPRREPLRVEEWQIDISKPKLGPLFKKNAKAVEAALIALSQSERESLA 465

Query: 121 X-XXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T  VP     Q EI+ + ++I ++T  E++REY PNVIEPSFG GRI YSL
Sbjct: 466 TILEKKGIITVTVPEM-AEQVEISKDLISIVKRTRIENIREYIPNVIEPSFGFGRIFYSL 524

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYW R +D  R VLS P  VAP K L+VPLS +  F  +   + + +R+L I+ + D
Sbjct: 525 LEHVYWHRANDPARGVLSLPISVAPTKVLIVPLSTHQDFVPITKRITEDLRELGISCRAD 584

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           +SS SIG+RYARNDELG P  ITIDF SV D TITLRERDSTKQ+R + + IL  ++ L+
Sbjct: 585 ESSASIGKRYARNDELGIPLGITIDFDSVKDGTITLRERDSTKQVRASKEEILGAIESLI 644

Query: 300 EESTTWEKVMETYPTFTQQELD 321
                WE V    P F  Q  D
Sbjct: 645 SGKMNWEDVFARLPEFLGQSGD 666



>gi|322695139|gb|EFY86952.1| glycyl-tRNA synthetase 1 [Metarhizium acridum CQMa 102]
          Length = 650

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 208/321 (64%), Gaps = 3/321 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+G    +LRFRQH+ NEMAHYACDCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 326 RVYLFLLKIGADAQKLRFRQHLDNEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLTV 385

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS  T   L V+E  A P+   +    + K++ GP+ + ++K +E  +            
Sbjct: 386 HSRETGTALTVKEARATPLEVTEWKATLEKRLAGPRFKMDAKKIELAMGQLDQDRLRQLA 445

Query: 121 XXXXDGNG---TTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILY 177
               + +    +T          E+TS+  +IK+ T  E  REYTPNVIEPSFGIGRILY
Sbjct: 446 TELAEKDVITISTDELANGAKSVELTSDICSIKQTTRVETTREYTPNVIEPSFGIGRILY 505

Query: 178 SLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
           S++EHVYW R  D  R VLS P  VAP K LLVPLSNNP F  ++  LA ++R + IA  
Sbjct: 506 SILEHVYWNRPQDVAREVLSLPILVAPVKVLLVPLSNNPDFKPVIKSLASQLRAMGIANN 565

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           VD SS SIGRRYARNDELGTP  IT+DF ++ D ++TLRERDS  Q+R + D I++ +++
Sbjct: 566 VDSSSVSIGRRYARNDELGTPLGITVDFDTLKDESVTLRERDSRVQVRASQDEIVEAIRN 625

Query: 298 LLEESTTWEKVMETYPTFTQQ 318
           L   + TW++V E  P FT Q
Sbjct: 626 LTAGAETWDEVSERLPVFTGQ 646



>gi|296805896|ref|XP_002843772.1| glycyl-tRNA synthetase 1 [Arthroderma otae CBS 113480]
 gi|238845074|gb|EEQ34736.1| glycyl-tRNA synthetase 1 [Arthroderma otae CBS 113480]
          Length = 685

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 217/339 (64%), Gaps = 25/339 (7%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI   +LRFRQH+ NEMAHYACDCWDA++  + GW+ECVGCADRSAYDLTV
Sbjct: 349 RIYQFLIKIGIDQSKLRFRQHLANEMAHYACDCWDAELLTTSGWVECVGCADRSAYDLTV 408

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RT ++L V+E L EP+  +K    ++KK  GPK R++++ VE  + S          
Sbjct: 409 HAGRTGQRLTVQEPLPEPIQIEKLEAILDKKKLGPKFRKDARAVESAI-SALSQDALERL 467

Query: 121 XXXXDGNG-----TTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRI 175
               + NG        + G DG    I  + L IKR +  E+ REYTPNVIEPSFGIGRI
Sbjct: 468 SPVLEKNGEILIRVADLSGGDGT-VAIGKDLLNIKRVSKIENTREYTPNVIEPSFGIGRI 526

Query: 176 LYSLIEHVYWTRKDDEQR------------------SVLSFPPRVAPFKCLLVPLSNNPA 217
           LYSL+EHVYW+R  D  R                   VLS PP VAP K LLVPLS++ +
Sbjct: 527 LYSLLEHVYWSRPSDAARVVGINSGLSISLEANINVQVLSLPPSVAPTKVLLVPLSSHQS 586

Query: 218 FTDLVDELAKRIRKLSIAIKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRE 277
           F  ++  L+ ++R L I+ ++DDS+ SIG+RYARNDELGTPF IT+DF +V D TITLRE
Sbjct: 587 FRPIIKNLSSQLRSLGISNRIDDSNASIGKRYARNDELGTPFGITVDFDTVKDSTITLRE 646

Query: 278 RDSTKQIRENIDTILQVLKDLLEESTTWEKVMETYPTFT 316
           RD+TKQ+R   + I+  +K L++    WE+ +   P FT
Sbjct: 647 RDTTKQVRGTTEEIISTVKRLVDGVENWEQTLCRLPVFT 685



>gi|405121451|gb|AFR96220.1| glycine-tRNA ligase [Cryptococcus neoformans var. grubii H99]
          Length = 668

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 212/322 (65%), Gaps = 3/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFLTK+GI P RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 348 RTQLFLTKIGIDPARLRCRQHMANEMAHYATDCWDFEIQSSYGWIECVGCADRSAYDLTV 407

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ L V++ L +P   +K     + K FG K ++++  +++ L            
Sbjct: 408 HSVRTKQPLRVQQRLEQPRTVEKLECTFDAKAFGMKFKKDATMIKETLLGLEKDKLQCIK 467

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+ + K    DG  YEIT++ + I   T TEH+RE+ PNVIEPSFGIGRILYS++
Sbjct: 468 DELEKGSSSVKC--ADGKSYEITADLVKINPITVTEHMREFIPNVIEPSFGIGRILYSVL 525

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D  R VLS P  VAP KCL+V +S +      + E+++ +RK  IA +VDD
Sbjct: 526 EHTYWAREQDAARGVLSLPALVAPIKCLIVSISQDAQLRSKIHEVSREMRKRGIASRVDD 585

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG++YARNDELGTPF  T+DF ++ + T+TLRERDST Q+   I+ ++ V+  L++
Sbjct: 586 SSATIGKKYARNDELGTPFGCTVDFATIQNGTMTLRERDSTSQLIGPIEDVISVVDQLVK 645

Query: 301 ESTTWEKVMETYPTFTQ-QELD 321
               WE   +    ++  Q++D
Sbjct: 646 GVLDWEGASQKLEAYSGVQDVD 667



>gi|321260376|ref|XP_003194908.1| glycine-tRNA ligase [Cryptococcus gattii WM276]
 gi|317461380|gb|ADV23121.1| Glycine-tRNA ligase, putative [Cryptococcus gattii WM276]
          Length = 699

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 211/322 (65%), Gaps = 3/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFLTK+GI P RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 379 RTQLFLTKIGIDPTRLRCRQHMANEMAHYAADCWDFEIQSSYGWIECVGCADRSAYDLTV 438

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ L V++ L +P   +K     + K FG K ++++  +++ L            
Sbjct: 439 HSVRTKQPLRVQQRLEQPRTVEKLECTFDAKAFGMKFKKDATMIKETLLGLEKDKLQCIK 498

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+   K    DG  YEIT + + I   T TEH+RE+ PNVIEPSFGIGRILYS++
Sbjct: 499 DELEKGSSNVKC--ADGKSYEITPDLIKINPITVTEHMREFIPNVIEPSFGIGRILYSVL 556

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D  R VLS P  VAP KCL+V +S +      + E+++ +RK  IA +VDD
Sbjct: 557 EHTYWAREQDAARGVLSLPTVVAPIKCLIVSISQDAQLRSKIHEVSREMRKRGIASRVDD 616

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG++YARNDELGTPF  T+DF ++ + T+TLRERDST Q+   I+ ++ V+  L++
Sbjct: 617 SSATIGKKYARNDELGTPFGCTVDFATIQNGTMTLRERDSTAQLIGPIEDVISVVDQLVK 676

Query: 301 ESTTWEKVMETYPTFTQ-QELD 321
            +  WE   +    ++  Q++D
Sbjct: 677 GTLDWEGASQKLQAYSGVQDVD 698



>gi|389639262|ref|XP_003717264.1| glycyl-tRNA synthetase [Magnaporthe oryzae 70-15]
 gi|351643083|gb|EHA50945.1| glycyl-tRNA synthetase [Magnaporthe oryzae 70-15]
          Length = 726

 Score =  327 bits (837), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   +LRFRQHM NEMAHYACDCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 398 RIHLFLEKIGVDKSKLRFRQHMANEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLSV 457

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L EP I ++  +E++KK FGPK ++++K VE  L            
Sbjct: 458 HAKKTNAPLIVRQRLPEPKIVEEWTVEVDKKKFGPKFKKDAKAVETVLLELNQDQRGKLE 517

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+ T  VPG    + ++  + ++I     TE+ RE+ PNVIEPSFGIGRILY L
Sbjct: 518 KELKDNGSITVDVPGVGDGKVQVEKDLVSITWTKRTENTREFIPNVIEPSFGIGRILYCL 577

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSF P VAP K L+VPLS +  F   V ++++++R + ++ 
Sbjct: 578 LEHNYWTRASDGGDEARGVLSFTPVVAPTKVLIVPLSRHDDFVPFVQKISQKLRSVGVSS 637

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS +IGRRY+RNDELGTP  IT+DFQ+V D TITLR+RD+T Q+R + D I++ ++
Sbjct: 638 RVDDSSATIGRRYSRNDELGTPLGITVDFQTVKDGTITLRDRDTTVQVRADQDKIVEAIQ 697

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +L+  +  W+ V    P F  QE++
Sbjct: 698 ELVSGNKVWKDVQAELPAFEGQEIE 722



>gi|156844100|ref|XP_001645114.1| hypothetical protein Kpol_538p16 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115771|gb|EDO17256.1| hypothetical protein Kpol_538p16 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 639

 Score =  326 bits (835), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 162/319 (50%), Positives = 212/319 (66%), Gaps = 2/319 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL  +GI   +LRFRQHM NEMAHYA DCWDA+I  SYGWIECVGCADRSAYDLTV
Sbjct: 318 RIYHFLISIGIDNSKLRFRQHMANEMAHYATDCWDAEILTSYGWIECVGCADRSAYDLTV 377

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ RTKEKL+VR+ L  P+      ++     F  KLR+ S  V+D+LTS          
Sbjct: 378 HAKRTKEKLIVRQTLENPVNVSIWDIDFKSGNFYKKLRKQSALVKDHLTSLSQSSLKELS 437

Query: 121 XXXXDGNGTTKVPGTD-GNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                  G+ ++   D  N  E+T++ + I  +T T HVREY PNVIEPSFGIGRI+Y+L
Sbjct: 438 LKLEL-EGSIQLHVDDIENDIELTNDDIKIVNETKTIHVREYIPNVIEPSFGIGRIIYAL 496

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEH +W R++DE R+V SFP ++AP + L+VPLS+N     + +     ++K  I+ KVD
Sbjct: 497 IEHCFWRRQEDEARAVFSFPAKIAPSRVLVVPLSSNKELVPMTNLTTSLLKKCKISFKVD 556

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIGRRYARNDELGTPFAITIDF+S  D T+TLRERDS  Q+R +I++I+  +  ++
Sbjct: 557 DSSVSIGRRYARNDELGTPFAITIDFESKKDETVTLRERDSKLQVRGSIESIVNAIDSII 616

Query: 300 EESTTWEKVMETYPTFTQQ 318
            +  +W+   +    F  Q
Sbjct: 617 NDELSWKDATKNLTKFEIQ 635



>gi|58268176|ref|XP_571244.1| glycine-tRNA ligase [Cryptococcus neoformans var. neoformans JEC21]
 gi|57227479|gb|AAW43937.1| glycine-tRNA ligase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 699

 Score =  326 bits (835), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 211/322 (65%), Gaps = 3/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFLTK+GI P RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 379 RTQLFLTKIGIDPARLRCRQHMANEMAHYATDCWDFEIQSSYGWIECVGCADRSAYDLTV 438

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ L V++ L +P   +K     + K FG K ++++  +++ L            
Sbjct: 439 HSVRTKQPLRVQQRLDQPRTVEKLECTFDAKAFGMKFKKDATMIKETLLGLEKEKLQCIK 498

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                 NG++ V   DG  YEIT + + I   T TEH+RE+ PNVIEPSFGIGRILY ++
Sbjct: 499 DELE--NGSSNVQCADGKSYEITPDLVKINPITVTEHMREFIPNVIEPSFGIGRILYCVL 556

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D  R VLS P  VAP KCL+V +S +      + E+++ +RK  IA +VDD
Sbjct: 557 EHTYWAREQDAARGVLSLPALVAPIKCLIVSISQDAQLRSKIHEVSREMRKRGIASRVDD 616

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG++YARNDELGTPF  T+DF ++ + T+TLRERDST Q+   I+ ++ V+  L++
Sbjct: 617 SSATIGKKYARNDELGTPFGCTVDFATIQNGTMTLRERDSTSQLIGPIEDVISVVDQLVK 676

Query: 301 ESTTWEKVMETYPTFTQ-QELD 321
               WE   +    ++  Q++D
Sbjct: 677 GVLDWEGASQKLEAYSGVQDVD 698



>gi|440468848|gb|ELQ37982.1| glycyl-tRNA synthetase 1 [Magnaporthe oryzae Y34]
 gi|440484735|gb|ELQ64764.1| glycyl-tRNA synthetase 1 [Magnaporthe oryzae P131]
          Length = 741

 Score =  325 bits (834), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LFL K+G+   +LRFRQHM NEMAHYACDCWDA++  SYGWIECVGCADRSAYDL+V
Sbjct: 337 RIHLFLEKIGVDKSKLRFRQHMANEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLSV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L EP I ++  +E++KK FGPK ++++K VE  L            
Sbjct: 397 HAKKTNAPLIVRQRLPEPKIVEEWTVEVDKKKFGPKFKKDAKAVETVLLELNQDQRGKLE 456

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G+ T  VPG    + ++  + ++I     TE+ RE+ PNVIEPSFGIGRILY L
Sbjct: 457 KELKDNGSITVDVPGVGDGKVQVEKDLVSITWTKRTENTREFIPNVIEPSFGIGRILYCL 516

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSF P VAP K L+VPLS +  F   V ++++++R + ++ 
Sbjct: 517 LEHNYWTRASDGGDEARGVLSFTPVVAPTKVLIVPLSRHDDFVPFVQKISQKLRSVGVSS 576

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           +VDDSS +IGRRY+RNDELGTP  IT+DFQ+V D TITLR+RD+T Q+R + D I++ ++
Sbjct: 577 RVDDSSATIGRRYSRNDELGTPLGITVDFQTVKDGTITLRDRDTTVQVRADQDKIVEAIQ 636

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +L+  +  W+ V    P F  QE++
Sbjct: 637 ELVSGNKVWKDVQAELPAFEGQEIE 661



>gi|154311325|ref|XP_001554992.1| hypothetical protein BC1G_06515 [Botryotinia fuckeliana B05.10]
 gi|347829135|emb|CCD44832.1| similar to glycyl-tRNA synthetase [Botryotinia fuckeliana T4]
 gi|472238557|gb|EMR83416.1| putative glycyl-trna synthetase protein [Botryotinia fuckeliana
           BcDW1]
          Length = 665

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+   ++RFRQHM NEMAHYA DCWDA++H S GW+ECVGCADRSAYDL+V
Sbjct: 337 RIQLFLAKIGVDQSKVRFRQHMANEMAHYAADCWDAELHTSSGWVECVGCADRSAYDLSV 396

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+ +T   L+VR+ L  P+  ++  ++++KK FGPK +++ K VE  + +          
Sbjct: 397 HAKKTGAALMVRQRLDTPISVEEWQVDLDKKKFGPKFKKDGKAVEAAIEALSQEKLESLA 456

Query: 121 XXXXDGNGTT-KVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D      +V G    + E+ ++ + I+ +T  E+ REYTPNVIEPSFGIGRILY+L
Sbjct: 457 KELKDNAKIIIEVDGVADGKAEVGADLIKIELRTRVENTREYTPNVIEPSFGIGRILYAL 516

Query: 180 IEHVYWTRKD---DEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           +EH YWTR     DE R VLSFPP VAP K LLVPLS++ +F   + +++ ++R + ++ 
Sbjct: 517 MEHNYWTRGSEGGDEARGVLSFPPIVAPTKVLLVPLSSHESFKPFLKQISYKLRSMGVSS 576

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLK 296
           ++DDSS SIG+RY+RNDELGTP  IT+DFQSVND T TLR+RDSTKQ+R + + IL  +K
Sbjct: 577 RIDDSSASIGKRYSRNDELGTPLGITVDFQSVNDSTFTLRDRDSTKQVRASQEKILAAIK 636

Query: 297 DLLEESTTWEKVMETYPTFTQQELD 321
           +L++ +  W  + +  P F  QE D
Sbjct: 637 ELVDGTKVWADIEKELPIFEGQEAD 661



>gi|134113354|ref|XP_774702.1| hypothetical protein CNBF3810 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257346|gb|EAL20055.1| hypothetical protein CNBF3810 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 673

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 210/322 (65%), Gaps = 3/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFLTK+G+ P RLR RQHM NEMAHYA DCWD +I +SYGWIECVGCADRSAYDLTV
Sbjct: 353 RTQLFLTKIGVDPARLRCRQHMANEMAHYATDCWDFEIQSSYGWIECVGCADRSAYDLTV 412

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS RTK+ L V++ L +P   +K     + K FG K ++++  +++ L            
Sbjct: 413 HSVRTKQPLRVQQRLDQPRTVEKLECTFDAKAFGMKFKKDATMIKETLLGLEKEKLQCIK 472

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                  G++ V   DG  YEIT + + I   T TEH+RE+ PNVIEPSFGIGRILY ++
Sbjct: 473 DELE--KGSSNVQCADGKSYEITPDLVKINPITVTEHMREFIPNVIEPSFGIGRILYCVL 530

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH YW R+ D  R VLS P  VAP KCL+V +S +      + E+++ +RK  IA +VDD
Sbjct: 531 EHTYWAREQDAARGVLSLPALVAPIKCLIVSISQDAQLRSKIHEVSREMRKRGIASRVDD 590

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           SS +IG++YARNDELGTPF  T+DF ++ + T+TLRERDST Q+   I+ ++ V+  L++
Sbjct: 591 SSATIGKKYARNDELGTPFGCTVDFATIQNGTMTLRERDSTSQLIGPIEDVISVVDQLVK 650

Query: 301 ESTTWEKVMETYPTFTQ-QELD 321
               WE   +    ++  Q++D
Sbjct: 651 GVLDWEGASQKLEAYSGVQDVD 672



>gi|500259425|gb|EOO02238.1| putative glycyl-trna synthetase protein [Togninia minima UCRPA7]
          Length = 649

 Score =  323 bits (827), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 215/327 (65%), Gaps = 7/327 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL K+G+ P +LRFRQH+ NEMAHYACDCWDA++  SYGWIECVGCADRSAYDLTV
Sbjct: 322 RIMLFLLKIGVDPSKLRFRQHLDNEMAHYACDCWDAELLTSYGWIECVGCADRSAYDLTV 381

Query: 61  HSNRTKEKLVVRENL-AEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXX 119
           HSN T   LVV+E L   P+  ++    ++KK+ GP+ ++++K V+  +           
Sbjct: 382 HSNFTGTPLVVKEALRTGPVKVERWQASLDKKLVGPRFKRDAKAVQASVEGLDQSLLERL 441

Query: 120 XXXXXDGNGT----TKVPGTDG-NQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGR 174
                +  G     T  P  DG +  E++SE LTI++ T  + +REYTPNVIEPSFGIGR
Sbjct: 442 ASEL-NAKGVVTIDTATPLADGTSSVELSSELLTIQKVTQVQTIREYTPNVIEPSFGIGR 500

Query: 175 ILYSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSI 234
           ILY L+E  YW R  D  R+VLS P  VAP K L+VP+S    FT +V  L+ R+R L I
Sbjct: 501 ILYCLLEQTYWHRPQDAARAVLSLPLIVAPTKVLIVPISAQSQFTPIVRRLSSRLRVLGI 560

Query: 235 AIKVDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQV 294
              +D SS SIG+RYARNDELGTP  ITIDF +V D +ITLRERDST Q+R + D +L+ 
Sbjct: 561 TNTIDASSASIGKRYARNDELGTPLGITIDFDTVTDGSITLRERDSTTQVRGSEDEVLRA 620

Query: 295 LKDLLEESTTWEKVMETYPTFTQQELD 321
           + +L+  + +W+++ +    F+ Q  D
Sbjct: 621 VNNLVHGTESWDQITQYLTAFSTQGQD 647



>gi|66521713|ref|XP_391940.2| PREDICTED: glycyl-tRNA synthetase [Apis mellifera]
          Length = 740

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/320 (49%), Positives = 207/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P +LRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 418 RIYLFLIKVGIDPKKLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 477

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  KLV  + L  P   D   +  NK + G   +++SK V+D L +          
Sbjct: 478 HTKATGVKLVAEKKLPAPKTVDVCEIVSNKVIIGKMFKKDSKLVQDALAALTENNINAIE 537

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG T++  ++ +  +IT   + IKR   T HV E  P+VIEPSFGIGRI+Y++ 
Sbjct: 538 TEINE-NGETELRLSNDSTVKITKNMIEIKRYQKTVHVEEIIPSVIEPSFGIGRIMYAIF 596

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DE+R+  S PP VAP KC ++PLS+N  F   V +L++ + K+ ++ KVDD
Sbjct: 597 EHNFKAREGDEKRTYFSLPPVVAPLKCSVLPLSSNNEFVPFVKQLSQNLTKIDVSHKVDD 656

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  PF ITIDF ++    T TLRERDS  Q+R N+D I +V+K+L 
Sbjct: 657 SSGSIGRRYARTDEIAIPFGITIDFDTLKTPHTATLRERDSMGQVRINLDQIPEVVKNLS 716

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW ++ E YP F QQE
Sbjct: 717 NGKLTWLEIEEKYPKFEQQE 736



>gi|195129603|ref|XP_002009245.1| GI13931 [Drosophila mojavensis]
 gi|193920854|gb|EDW19721.1| GI13931 [Drosophila mojavensis]
          Length = 679

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 206/321 (64%), Gaps = 4/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 358 RIQQFLHAIGIKPECLRFRQHMGNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + LA P   + + +  NK+  G   ++ +K + D L            
Sbjct: 418 HTAATGVRLVAEKRLAAPKTVEVSEIVPNKQALGKTFKKEAKAITDALAKLSLDDIKKAE 477

Query: 121 XXXXDGNG-TTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                G   T  +P  DG  +E+ +E + +K  T T HV E+ P+V+EPSFGIGR++Y+L
Sbjct: 478 TQLAAGEQYTLTLP--DGATHELGTESIAVKHATKTVHVEEFIPSVVEPSFGIGRVMYAL 535

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR   + PP VAP+KC ++PLSNN  F     +L+  + K  ++ KVD
Sbjct: 536 LEHSFQCREGDEQRCYFTLPPLVAPYKCSILPLSNNAEFQPYTQQLSSALTKAELSHKVD 595

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  +DT++ V+KDL
Sbjct: 596 DSSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRIGLDTVVSVVKDL 655

Query: 299 LEESTTWEKVMETYPTFTQQE 319
                TW +V+E YP F QQE
Sbjct: 656 ATTKLTWAQVLEQYPAFEQQE 676



>gi|380027384|ref|XP_003697406.1| PREDICTED: LOW QUALITY PROTEIN: glycine--tRNA ligase-like [Apis
           florea]
          Length = 740

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/320 (49%), Positives = 207/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI P +LRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 418 RIYLFLIKVGIDPKKLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 477

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  KLV  + L  P   D   +  NK + G   +++SK V+D L +          
Sbjct: 478 HTKATGVKLVAEKKLPAPKNVDVCEIVSNKVIIGKMFKKDSKLVQDALAALTENNINAIE 537

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + +G T++  ++G+  +IT   + +KR   T HV E  P+VIEPSFGIGRI+Y++ 
Sbjct: 538 TEINE-SGETELRLSNGSIVKITKNMIEVKRYQKTVHVEEIIPSVIEPSFGIGRIMYAIF 596

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DE+R+  S PP VAP KC ++PLS N  F   V +L++ + K+ ++ KVDD
Sbjct: 597 EHNFKAREGDEKRTYFSLPPVVAPLKCSVLPLSGNNEFVPFVKQLSQNLTKVDVSHKVDD 656

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  PF ITIDF ++    T TLRERDS  Q+R N+D I +V+K+L 
Sbjct: 657 SSGSIGRRYARTDEIAIPFGITIDFDTLKTPHTATLRERDSMGQVRINLDQIPEVVKNLS 716

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW +V E YP F QQE
Sbjct: 717 NGKLTWLEVEEKYPKFEQQE 736



>gi|158293345|ref|XP_557743.2| AGAP008604-PA [Anopheles gambiae str. PEST]
 gi|157016660|gb|EAL40245.2| AGAP008604-PA [Anopheles gambiae str. PEST]
          Length = 703

 Score =  318 bits (816), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 205/321 (63%), Gaps = 5/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  ++L ++GI P+RLRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 382 RIQMYLHRIGILPERLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 441

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N T  KLV  + L  P   + T +  NK   G   ++ +K + + L            
Sbjct: 442 HTNATGVKLVAEKKLPAPKTIEVTEVVPNKAAIGKAFKKEAKAITEALAKLSLGEVETIG 501

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     V GTD    ++T++ + +K  + T HV E TP+VIEPSFGIGRI+YSL
Sbjct: 502 KSLGDSGEHLLAVNGTD---VKLTNDLIAVKTTSKTVHVEEITPSVIEPSFGIGRIMYSL 558

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQRS  S PP VAP KC ++PLSNN  F   V +++  +  + ++ KVD
Sbjct: 559 LEHSFRMREGDEQRSYFSLPPVVAPLKCSVLPLSNNAEFAPFVKKISSALTSVDVSHKVD 618

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ ITIDF ++ +  T+TLRERDS KQ+R  +D +   ++DL
Sbjct: 619 DSSGSIGRRYARTDEIAIPYGITIDFDTLKEPHTVTLRERDSMKQVRIGLDEVANTIRDL 678

Query: 299 LEESTTWEKVMETYPTFTQQE 319
               T+W +V + YP F QQE
Sbjct: 679 ATGRTSWAEVEQKYPRFEQQE 699



>gi|312376083|gb|EFR23277.1| hypothetical protein AND_13183 [Anopheles darlingi]
          Length = 679

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 203/321 (63%), Gaps = 5/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL ++GI P+RLRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 358 RIQQFLHRIGILPERLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXX-XXXXX 119
           H+  T  KLV  + L  P   + T +  NK   G   ++ +K + D L            
Sbjct: 418 HTQATGVKLVAEKKLPAPKTIEVTEVVPNKAAIGKAFKKEAKGITDALAKLSLDDVSEIG 477

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G  T  V G D    +++ + + +K+ T T HV E TP+VIEPSFGIGRI+YSL
Sbjct: 478 KNLETNGEHTLVVNGAD---VKLSGDLIAVKKTTKTVHVEEITPSVIEPSFGIGRIMYSL 534

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R  DEQRS  S PP VAP KC ++PLSNN  FT  V +++  +  + ++ KVD
Sbjct: 535 LEHSFRMRDGDEQRSYFSLPPVVAPLKCSVLPLSNNAEFTPFVKKISSALTSVDVSHKVD 594

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ ITIDF ++ +  T+TLRERDS KQ+R  +D + Q ++DL
Sbjct: 595 DSSGSIGRRYARTDEIAIPYGITIDFDTLKEPHTVTLRERDSMKQVRIALDEVAQTIRDL 654

Query: 299 LEESTTWEKVMETYPTFTQQE 319
                +W ++ E YP F QQE
Sbjct: 655 ATGRNSWAQIEEKYPRFEQQE 675



>gi|198464323|ref|XP_001353177.2| GA19857 [Drosophila pseudoobscura pseudoobscura]
 gi|198149667|gb|EAL30679.2| GA19857 [Drosophila pseudoobscura pseudoobscura]
          Length = 679

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 208/320 (65%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 358 RIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   + + +  NK+  G   ++ +KT+ + L +          
Sbjct: 418 HTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKTITEAL-AKLSLEEISRA 476

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG  K+   DGN +E+  + +++K  + T HV E+ P+V+EPSFGIGRI+Y+L+
Sbjct: 477 EQELNANGQYKLILADGNTHELAKDTISVKHSSKTVHVEEFIPSVVEPSFGIGRIMYALL 536

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ D+QR   + PP VAP KC ++PLSNN  F     +L+  + K  ++ KVDD
Sbjct: 537 EHSFQCREGDDQRCYFTLPPLVAPLKCSILPLSNNAEFQPYTQKLSSSLTKAELSHKVDD 596

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  ++ ++ V+KDL 
Sbjct: 597 SSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRVGLEQVVGVVKDLA 656

Query: 300 EESTTWEKVMETYPTFTQQE 319
              T+WE+V+  YP F QQE
Sbjct: 657 TARTSWEQVVAQYPVFEQQE 676



>gi|195378418|ref|XP_002047981.1| GJ13721 [Drosophila virilis]
 gi|194155139|gb|EDW70323.1| GJ13721 [Drosophila virilis]
          Length = 679

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 203/320 (63%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL+ 
Sbjct: 358 RIQQFLHAIGIKPECLRFRQHMGNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLSQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   + + +  NK+  G   ++ +K + D L            
Sbjct: 418 HTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKAITDALAKLSLDDIKQVE 477

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G G  K+   DG  +E+ +E + +K  T T HV E+ P+V+EPSFGIGRI+Y+L+
Sbjct: 478 AQLATG-GPYKLTLPDGATHELGAETIGVKHATKTVHVEEFIPSVVEPSFGIGRIMYALL 536

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R  DEQR   + PP VAP KC ++PLSNN  F     +L+  + K  ++ KVDD
Sbjct: 537 EHSFQCRDGDEQRCYFTLPPLVAPLKCSILPLSNNAEFQPYTQQLSAALTKAELSHKVDD 596

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  +D ++ V+KDL 
Sbjct: 597 SSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRIGLDVVVGVVKDLA 656

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW +V+E YP F QQE
Sbjct: 657 TTRLTWAQVLEQYPAFEQQE 676



>gi|403182736|gb|EAT42765.2| AAEL005728-PA [Aedes aegypti]
          Length = 758

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 200/321 (62%), Gaps = 5/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   F+ K+GI PDRLRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 437 RIQQFMLKIGILPDRLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 496

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N T  KLV  + L  P   + T +  NK   G   ++ +K + + L            
Sbjct: 497 HTNATGVKLVAEKKLPAPKTIEVTEVVPNKAALGKVFKKEAKNITELLAKLSLSDVEAIG 556

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     V G+D     + S+ + +K  + T HV E TP+VIEPSFG+GRI+YSL
Sbjct: 557 KNLADKGEHVLDVNGSD---VSLNSDMIAVKTTSKTIHVEEITPSVIEPSFGVGRIMYSL 613

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR   S PP VAP KC ++PLSNN  F   V +++  +  + I+ KVD
Sbjct: 614 LEHSFQMREGDEQRGYFSLPPIVAPLKCSVLPLSNNAEFAPFVKKISSALTSVDISHKVD 673

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ ITIDF ++ +  ++TLRERDS KQ+R  +D + QV++DL
Sbjct: 674 DSSGSIGRRYARTDEIAIPYGITIDFDTLKEPHSVTLRERDSMKQVRIGVDEVSQVVRDL 733

Query: 299 LEESTTWEKVMETYPTFTQQE 319
                TW  V   YP F QQE
Sbjct: 734 ARSRLTWSDVEAKYPKFEQQE 754



>gi|157111109|ref|XP_001651394.1| glycyl-tRNA synthetase [Aedes aegypti]
          Length = 764

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 200/321 (62%), Gaps = 5/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   F+ K+GI PDRLRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 443 RIQQFMLKIGILPDRLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 502

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+N T  KLV  + L  P   + T +  NK   G   ++ +K + + L            
Sbjct: 503 HTNATGVKLVAEKKLPAPKTIEVTEVVPNKAALGKVFKKEAKNITELLAKLSLSDVEAIG 562

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     V G+D     + S+ + +K  + T HV E TP+VIEPSFG+GRI+YSL
Sbjct: 563 KNLADKGEHVLDVNGSD---VSLNSDMIAVKTTSKTIHVEEITPSVIEPSFGVGRIMYSL 619

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR   S PP VAP KC ++PLSNN  F   V +++  +  + I+ KVD
Sbjct: 620 LEHSFQMREGDEQRGYFSLPPIVAPLKCSVLPLSNNAEFAPFVKKISSALTSVDISHKVD 679

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ ITIDF ++ +  ++TLRERDS KQ+R  +D + QV++DL
Sbjct: 680 DSSGSIGRRYARTDEIAIPYGITIDFDTLKEPHSVTLRERDSMKQVRIGVDEVSQVVRDL 739

Query: 299 LEESTTWEKVMETYPTFTQQE 319
                TW  V   YP F QQE
Sbjct: 740 ARSRLTWSDVEAKYPKFEQQE 760



>gi|195162783|ref|XP_002022233.1| GL24717 [Drosophila persimilis]
 gi|194104194|gb|EDW26237.1| GL24717 [Drosophila persimilis]
          Length = 679

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 207/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 358 RIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   + + +  NK+  G   ++ +KT+ + L +          
Sbjct: 418 HTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKTITEAL-AKLSLEEISRA 476

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG  K+   DGN +E+  + +++K  + T HV E+ P+V+EPSFGIGRI+Y+L+
Sbjct: 477 EQELNANGQYKLILADGNTHELAKDTISVKHSSKTVHVEEFIPSVVEPSFGIGRIMYALL 536

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ D+QR   + PP VAP KC ++PLSNN  F     +L+    K  ++ KVDD
Sbjct: 537 EHSFQCREGDDQRCYFTLPPLVAPLKCSILPLSNNAEFQPYTKKLSSSFTKAELSHKVDD 596

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  ++ ++ V+KDL 
Sbjct: 597 SSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRVGLEQVVGVVKDLA 656

Query: 300 EESTTWEKVMETYPTFTQQE 319
              T+WE+V+  YP F QQE
Sbjct: 657 TARTSWEQVVAQYPVFEQQE 676



>gi|71895709|ref|NP_001026681.1| glycine--tRNA ligase [Gallus gallus]
 gi|326921448|ref|XP_003206971.1| PREDICTED: glycyl-tRNA synthetase-like [Meleagris gallopavo]
 gi|53136800|emb|CAG32729.1| hypothetical protein RCJMB04_34b10 [Gallus gallus]
          Length = 685

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 358 RIYLFLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  L+  + L EP   +    E NK   G   ++++K V +YL+           
Sbjct: 418 HARATKVPLIAEKLLKEPKTVNIVQFEANKGAIGKAYKKDAKVVMEYLSMCDECYVTEME 477

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  T +   T+G  + +T + +T+KR   T HV E  PNVIEPSFGIGRI+Y++
Sbjct: 478 QLLNDKGEFTVE---TEGKTFTLTKDMVTVKRFQKTLHVEEIVPNVIEPSFGIGRIMYTV 534

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ KVD
Sbjct: 535 FEHTFRIREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGISHKVD 594

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVN--DRTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 595 DSSGSIGRRYARTDEVGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAEVSELPAIIRD 654

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L     TW  V   YP F  QE
Sbjct: 655 LANGYLTWADVEAKYPQFEGQE 676



>gi|260821670|ref|XP_002606155.1| hypothetical protein BRAFLDRAFT_126484 [Branchiostoma floridae]
 gi|229291494|gb|EEN62165.1| hypothetical protein BRAFLDRAFT_126484 [Branchiostoma floridae]
          Length = 682

 Score =  317 bits (811), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R +LF+TK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGW+ECVGCADRS +DL  
Sbjct: 358 RIFLFMTKVGVHPDKLRFRQHMENEMAHYACDCWDAECKTSYGWVECVGCADRSCFDLLQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS  TK  L   + L EP++ D T +E  K V G  L++++K V ++L S          
Sbjct: 418 HSKATKTALCYSKPLPEPVMVDVTEIEPQKSVLGKTLKKDAKPVTEHLQSLQEEDILQLE 477

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G     V G D     I  + + +KR    + V E TP VIEPSFGIGR++Y++
Sbjct: 478 KELQDKGEAVVSVKGKD---VSIKPDMIKVKRYQKKKFVEEITPGVIEPSFGIGRVMYAV 534

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  S P  VAP+KC ++PLS N  F   V +L+  + K  I+ KVD
Sbjct: 535 LEHNFRMREGDEQRTFFSLPAMVAPYKCSVLPLSGNEEFVPFVKQLSDSLTKADISHKVD 594

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDR--TITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+  PF IT+DF +VN    T+TLRERDS  Q+R  ID + QV+ D
Sbjct: 595 DSSGSIGRRYARTDEIAIPFGITVDFDTVNKEPSTVTLRERDSMGQVRLPIDDVPQVVSD 654

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L     TW  V   YP F  QE
Sbjct: 655 LSAGRITWADVENKYPKFQAQE 676



>gi|367040619|ref|XP_003650690.1| hypothetical protein THITE_2110427 [Thielavia terrestris NRRL 8126]
 gi|346997951|gb|AEO64354.1| hypothetical protein THITE_2110427 [Thielavia terrestris NRRL 8126]
          Length = 457

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 208/324 (64%), Gaps = 3/324 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LFL +LG+   ++RFRQH+ NEMAHYACDCWDA++  SYGW+ECVGCADRSAYDLTV
Sbjct: 133 RIVLFLVRLGVDRSKVRFRQHLANEMAHYACDCWDAELLTSYGWVECVGCADRSAYDLTV 192

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSX-XXXXXXXX 119
           HS  T   L V+E L EP+  ++    ++KK+ G + ++++K V+  +            
Sbjct: 193 HSRYTGASLTVKEALPEPVKVEEWQAALDKKLTGLRFKKDAKVVQAAVERLDQPALEALA 252

Query: 120 XXXXXDGNGTTKVPG-TDGN-QYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILY 177
                 G    + P   DG  + E+  E L+I + T  +  REYTPNVIEPSFGIGRILY
Sbjct: 253 AELEQHGAVALETPALADGTTRVELPKELLSISKTTRMQTTREYTPNVIEPSFGIGRILY 312

Query: 178 SLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIK 237
            L+E VYW R +D  R+VLS P  VAP K L+VPLS+NP    +   L+ R+R+L IA  
Sbjct: 313 CLLEQVYWHRPNDAARAVLSLPLSVAPNKVLIVPLSSNPQLNPIAHALSARLRRLGIANV 372

Query: 238 VDDSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKD 297
           +D SS SIGRRYARNDELGTP  +T+DF ++ D ++TLRERDS  Q+R + D ++  +K 
Sbjct: 373 IDASSASIGRRYARNDELGTPLGVTVDFDTLKDGSVTLRERDSMVQVRGSEDEVVMAIKG 432

Query: 298 LLEESTTWEKVMETYPTFTQQELD 321
           L+E + TWE+V      F  Q  D
Sbjct: 433 LVEGTETWEQVTARMEIFGGQGED 456



>gi|354483597|ref|XP_003503979.1| PREDICTED: glycyl-tRNA synthetase [Cricetulus griseus]
          Length = 709

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 382 RIYLYLMKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 441

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP I +    E NK   G   ++++K V +YL+S          
Sbjct: 442 HARVTKVPLVAEKPLKEPKIVNVVQFEPNKGAVGKAYKKDAKLVMEYLSSCDECYITEME 501

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 502 QLLNEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 558

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 559 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 618

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 619 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPGVVRD 678

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 679 LANGSITWADVESRYPLFEGQE 700



>gi|148666302|gb|EDK98718.1| glycyl-tRNA synthetase, isoform CRA_a [Mus musculus]
          Length = 729

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 207/322 (64%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 402 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 461

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP+  +    E NK   G   ++++K V +YL++          
Sbjct: 462 HARATKVPLVAEKPLKEPITVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 521

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 522 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 578

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 579 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 638

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 639 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 698

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 699 LANGNITWADVEARYPLFEGQE 720



>gi|478489084|ref|XP_004418923.1| PREDICTED: glycine--tRNA ligase [Ceratotherium simum simum]
          Length = 739

 Score =  315 bits (808), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K + +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLLMEYLALCDECYVTEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 532 ELLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   STTW  V   YP F  QE
Sbjct: 709 LANGSTTWANVEARYPLFEGQE 730



>gi|315048629|ref|XP_003173689.1| glycyl-tRNA synthetase 1 [Arthroderma gypseum CBS 118893]
 gi|311341656|gb|EFR00859.1| glycyl-tRNA synthetase 1 [Arthroderma gypseum CBS 118893]
          Length = 629

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 205/322 (63%), Gaps = 26/322 (8%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFL K+GI   ++R RQHM NEMAHYA DCWD ++  SYGWIECVGCADRSAYDL+V
Sbjct: 333 RIYLFLKKIGIDESKIRLRQHMQNEMAHYATDCWDVELFTSYGWIECVGCADRSAYDLSV 392

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H N+T   LVVR+  AEP+  ++  ++I+KK FGP+ +++SKTVE  + +          
Sbjct: 393 HKNKTGAPLVVRQTRAEPLRIEEWQVDIDKKKFGPRFKKDSKTVETAIEALTQDVREKLS 452

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                +G     V G    + EI  + + I+++T  E+VREYTPNVIEPSFGIGRILY L
Sbjct: 453 LDLEKNGKIEIAVDGVGDGKVEIGKDLVQIEKRTRVENVREYTPNVIEPSFGIGRILYCL 512

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH YW+R DDE R                           L+  L  ++R+L ++ +VD
Sbjct: 513 MEHAYWSRPDDEARG-------------------------PLIQRLTLKLRRLGVSNRVD 547

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DSS SIG+RY+RNDELGTPF IT DFQSV D T TLR+RD+TKQ+R + D I   +K L 
Sbjct: 548 DSSASIGKRYSRNDELGTPFGITADFQSVKDNTFTLRDRDTTKQVRASEDEICNAVKSLA 607

Query: 300 EESTTWEKVMETYPTFTQQELD 321
           E   TWE V++  P FT QE++
Sbjct: 608 EGEETWEDVLKRLPEFTGQEVE 629



>gi|504140023|ref|XP_004582459.1| PREDICTED: glycine--tRNA ligase [Ochotona princeps]
          Length = 736

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ P++LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDLT 
Sbjct: 409 RIYLYLTKVGVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLTC 468

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YLT+          
Sbjct: 469 HARATKVPLVAEKPLKEPKTINVIQFEPNKGAIGKAYKKDAKLVMEYLTACDECCVSEME 528

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 529 VLLHEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTV 585

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 586 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 645

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 646 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPTVVRD 705

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 706 LANGSITWADVEARYPLFEGQE 727



>gi|195494469|ref|XP_002094853.1| GE22046 [Drosophila yakuba]
 gi|194180954|gb|EDW94565.1| GE22046 [Drosophila yakuba]
          Length = 767

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 205/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 446 RIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 505

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   + + +  NK+  G   ++ +K + D L +          
Sbjct: 506 HTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKNITDAL-AKLSLEEITKV 564

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+G  K+   DG  +E+  + +++K  T T HV E+ P+V+EPSFGIGRI+YSL+
Sbjct: 565 EEQLSGDGQYKLTTADGQSHELGKDTISVKHSTKTVHVEEFIPSVVEPSFGIGRIMYSLL 624

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R  DEQR   + PP VAP KC ++PLSNN  F     +L+  + K  ++ KVDD
Sbjct: 625 EHSFQCRDGDEQRCYFTLPPLVAPIKCSILPLSNNTDFQPYTQKLSSALTKAELSHKVDD 684

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  ++ ++ V+KDL 
Sbjct: 685 SSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRVGLEEVVGVVKDLA 744

Query: 300 EESTTWEKVMETYPTFTQQE 319
              TTWEKV E YP F QQE
Sbjct: 745 TARTTWEKVTEQYPLFEQQE 764



>gi|194209766|ref|XP_001500496.2| PREDICTED: glycyl-tRNA synthetase-like [Equus caballus]
          Length = 829

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 203/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 502 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 561

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 562 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAVCDECYITEME 621

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 622 ELLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 678

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 679 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 738

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 739 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 798

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   STTW  V   YP F  QE
Sbjct: 799 LANGSTTWADVEARYPLFEGQE 820



>gi|431909041|gb|ELK12632.1| Glycyl-tRNA synthetase [Pteropus alecto]
          Length = 737

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 204/322 (63%), Gaps = 7/322 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 411 RIYLYLVKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 470

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP I++    E NK   G   ++++K V +YL            
Sbjct: 471 HARATKVPLVAEKPLKEP-IFNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 529

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + +++KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 530 KLLNEKGEFTVE---TEGKTFQLTGDMVSVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 586

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 587 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 646

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  I  +  +++D
Sbjct: 647 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVRD 706

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 707 LANGSVTWADVEARYPLFEGQE 728



>gi|18256043|gb|AAH21747.1| Glycyl-tRNA synthetase [Mus musculus]
          Length = 729

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 402 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 461

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL++          
Sbjct: 462 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 521

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 522 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 578

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 579 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 638

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 639 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 698

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 699 LANGNITWADVEARYPLFEGQE 720



>gi|148666303|gb|EDK98719.1| glycyl-tRNA synthetase, isoform CRA_b [Mus musculus]
          Length = 741

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 414 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 473

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL++          
Sbjct: 474 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 533

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 534 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 590

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 591 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 650

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 651 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 710

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 711 LANGNITWADVEARYPLFEGQE 732



>gi|74139030|dbj|BAE38417.1| unnamed protein product [Mus musculus]
          Length = 725

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 398 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 457

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL++          
Sbjct: 458 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 517

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 518 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 574

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 575 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 634

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 635 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRD 694

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 695 LANGNITWADVEARYPLFEGQE 716



>gi|93102417|ref|NP_851009.2| glycine--tRNA ligase [Mus musculus]
 gi|21264024|sp|Q9CZD3.1|SYG_MOUSE RecName: Full=Glycine--tRNA ligase; AltName: Full=Diadenosine
           tetraphosphate synthetase; Short=AP-4-A synthetase;
           AltName: Full=Glycyl-tRNA synthetase; Short=GlyRS
          Length = 729

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 402 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 461

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL++          
Sbjct: 462 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 521

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 522 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 578

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 579 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 638

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 639 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRD 698

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 699 LANGNITWADVEARYPLFEGQE 720



>gi|452982064|gb|EME81823.1| hypothetical protein MYCFIDRAFT_50321 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 660

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 211/322 (65%), Gaps = 1/322 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R  LF+ ++G+   +LRFRQHM NEMAHYA DCWD ++ NSYGWIECVGCADRSAYDL+V
Sbjct: 338 RIMLFMERIGVDMKKLRFRQHMANEMAHYAADCWDCELFNSYGWIECVGCADRSAYDLSV 397

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+  T   L VRE L EP   ++ + +++KK  GPK ++++  V+  L S          
Sbjct: 398 HAKATGVPLEVRERLDEPKKVEEWIAQLDKKKSGPKFKKDAGKVQAALDSLSQDLKEKLS 457

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                DG     VP     + E+ S+ + I+++T TE +R YTPNVIEPSFGIGRILYSL
Sbjct: 458 VSLQKDGKVEVDVPDVANGKVELESDIVKIEKETRTETMRTYTPNVIEPSFGIGRILYSL 517

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EHVYWTR  DE RSV+SF P +AP K L+VPL  +  F  L+ EL +R+   +++ KVD
Sbjct: 518 LEHVYWTRDGDEARSVMSFKPSIAPVKVLVVPLQKDTKFAPLLRELEQRLDDAALSFKVD 577

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
            S  SIG+RY+RNDELG PF IT+D++S+  +  TLR+RDSTKQ+R ++D I+  +  ++
Sbjct: 578 QSGVSIGKRYSRNDELGIPFGITVDYESLEGKGFTLRDRDSTKQVRSSLDDIIGSISQVV 637

Query: 300 EESTTWEKVMETYPTFTQQELD 321
               TW  + +  P F  +  D
Sbjct: 638 AGKATWADIQKKLPAFESKGAD 659



>gi|281354615|gb|EFB30199.1| hypothetical protein PANDA_007924 [Ailuropoda melanoleuca]
          Length = 737

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 203/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 410 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 469

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP+ ++    E NK   G   ++++K V +YL            
Sbjct: 470 HARATKVPLVAEKRLKEPISFNVVQFEPNKGAIGKAYKKDAKLVLEYLAVCDECYITEME 529

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++ R   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 530 KLLNEKGEFTIE---TEGKTFQLTKDMVSVNRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 586

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 587 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 646

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 647 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 706

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 707 LANGSITWADVEARYPVFEGQE 728



>gi|194871168|ref|XP_001972794.1| GG15715 [Drosophila erecta]
 gi|190654577|gb|EDV51820.1| GG15715 [Drosophila erecta]
          Length = 767

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 205/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 446 RIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 505

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   +   +  NK+  G   ++ +K + D L +          
Sbjct: 506 HTAATGVRLVAEKRLPAPKTVEVCEIVPNKQALGKTFKKEAKNITDAL-AKLSLEEITKV 564

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G+G  K+   DG  +E+  + +++K  T T HV E+ P+V+EPSFGIGRI+YSL+
Sbjct: 565 EEQLTGDGQYKLTTADGQSHELGKDTISVKHSTKTVHVEEFIPSVVEPSFGIGRIMYSLL 624

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR   + PP VAP KC ++PLSNN  F     +L+  + K  ++ KVDD
Sbjct: 625 EHSFQCREGDEQRCYFTLPPLVAPIKCSILPLSNNTDFQPYTQKLSSALTKAELSHKVDD 684

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++ +  T+TLR+R++ KQ+R  ++ ++ V+KDL 
Sbjct: 685 SSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRDRNTMKQVRVGLEEVVGVVKDLA 744

Query: 300 EESTTWEKVMETYPTFTQQE 319
              TTWEKV E YP F QQE
Sbjct: 745 TARTTWEKVAEQYPLFEQQE 764



>gi|449270337|gb|EMC81023.1| Glycyl-tRNA synthetase, partial [Columba livia]
          Length = 669

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 204/325 (62%), Gaps = 8/325 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+G+ P++LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 338 RIYLFLTKVGVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 397

Query: 61  HSNRTKEKLVVRENLAEPMIY----DKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXX 116
           H+  TK  L+  + L EP+ +    D    E NK   G   ++++K V +YL S      
Sbjct: 398 HARATKVPLIAEKPLKEPISFQNKPDSLQFEANKGAIGKAYKKDAKVVMEYL-SMCDECY 456

Query: 117 XXXXXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRIL 176
                   +  G   V  T+G  +++T + +T+KR   T HV E  PNVIEPSFGIGRI+
Sbjct: 457 ITEMEQLLNEKGEFTVE-TEGKTFKLTKDMVTVKRFQKTLHVEEIIPNVIEPSFGIGRIM 515

Query: 177 YSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           Y++ EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ 
Sbjct: 516 YTVFEHTFQIREGDEQRTYFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGISH 575

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVN--DRTITLRERDSTKQIRENIDTILQV 294
           KVDDSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  I  +  +
Sbjct: 576 KVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAEISELPAI 635

Query: 295 LKDLLEESTTWEKVMETYPTFTQQE 319
           ++DL     TW  V   YP F  QE
Sbjct: 636 IRDLANGYLTWADVEAKYPQFEGQE 660



>gi|410952642|ref|XP_003982988.1| PREDICTED: LOW QUALITY PROTEIN: glycine--tRNA ligase, partial
           [Felis catus]
          Length = 720

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 393 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 452

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YLT           
Sbjct: 453 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVLEYLTICEECYITEME 512

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 513 KLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 569

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 570 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 629

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 630 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 689

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 690 LANGSITWADVEARYPVFEGQE 711



>gi|66910298|gb|AAH96883.1| Si:dkey-276i5.1 protein [Danio rerio]
          Length = 764

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 203/321 (63%), Gaps = 4/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+  D+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL  
Sbjct: 437 RIYLYLVKVGVAKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLC 496

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP + +    E NK   G   ++++K   +YL +          
Sbjct: 497 HARATKVPLVAEKPLKEPKVVNVVQFEPNKGAIGKAYKKDAKFAMEYL-AICDECYITEQ 555

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG   +  T+G  +++T + + IKR   T HV E  PNVIEPSFGIGRI+YS+ 
Sbjct: 556 EKLLNENGEFTIE-TEGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIF 614

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR+  SFP  VAP+KC ++PLS NP F   V EL++ + +  ++ KVDD
Sbjct: 615 EHTFRIREGDEQRTYFSFPATVAPYKCSVLPLSQNPEFMPFVRELSEALTRNGVSHKVDD 674

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKDL 298
           SS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  + ++++DL
Sbjct: 675 SSGSIGRRYARTDEIGVAFGITIDFDTVNKNPHTATLRDRDSMRQIRAEVGELPEIIRDL 734

Query: 299 LEESTTWEKVMETYPTFTQQE 319
              + TW +V   YP F  QE
Sbjct: 735 ANGAITWAEVESKYPIFEGQE 755



>gi|403288052|ref|XP_003935230.1| PREDICTED: glycine--tRNA ligase [Saimiri boliviensis boliviensis]
          Length = 739

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           HS  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 472 HSRATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 532 MLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSESLTRHGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW+ V   YP F  QE
Sbjct: 709 LASGSITWDDVEARYPLFEGQE 730



>gi|402794806|ref|NP_001258068.1| glycine--tRNA ligase [Rattus norvegicus]
 gi|293346809|ref|XP_001061006.2| PREDICTED: glycine--tRNA ligase [Rattus norvegicus]
 gi|149033299|gb|EDL88100.1| rCG52516 [Rattus norvegicus]
          Length = 728

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 401 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 460

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL +          
Sbjct: 461 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLGACDECYITEME 520

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 521 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 577

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 578 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 637

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 638 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 697

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 698 LANGNITWADVEARYPLFEGQE 719



>gi|472389368|ref|XP_004414006.1| PREDICTED: glycine--tRNA ligase [Odobenus rosmarus divergens]
          Length = 739

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP        E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVSVVQFEPNKGAIGKAYKKDAKLVLEYLAVCDECYITEME 531

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 532 KLLNEKGEFTIE---TEGKSFQLTKDMVSVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 709 LANGSITWADVEARYPVFEGQE 730



>gi|511957664|ref|XP_004797110.1| PREDICTED: glycine--tRNA ligase [Mustela putorius furo]
          Length = 772

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 445 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 504

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 505 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVLEYLAVCDECYITEME 564

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + + +KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 565 KLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 621

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 622 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 681

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 682 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 741

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 742 LANGSITWADVEARYPVFEGQE 763



>gi|511885648|ref|XP_004762630.1| PREDICTED: glycine--tRNA ligase [Mustela putorius furo]
          Length = 739

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVLEYLAVCDECYITEME 531

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + + +KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 532 KLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 709 LANGSITWADVEARYPVFEGQE 730



>gi|383850383|ref|XP_003700775.1| PREDICTED: glycine--tRNA ligase-like [Megachile rotundata]
          Length = 740

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 205/320 (64%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R Y FL K+GI   +LRFRQHM NEMAHYACDCWDA+   SYGWIECVGCADRSAYDLT 
Sbjct: 418 RIYQFLVKVGIDKKKLRFRQHMGNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQ 477

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  KLV  + L+ P   D   +  NK + G   +++SK V+D L S          
Sbjct: 478 HTKATGVKLVAEKKLSAPKNVDVCEIVPNKVLIGKTFKKDSKLVQDAL-SELNENSINIM 536

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG   +  ++  + +IT + + +KR   T HV E  P+VIEPSFGIGRI+Y++ 
Sbjct: 537 ETELNENGEYNLKLSNDTEVKITKDMIQVKRYKKTVHVEEIIPSVIEPSFGIGRIMYAIF 596

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH + TR+ DE+R+ LS PP VAP KC ++PLS+N  F   V +L++ + K+ I+ KVDD
Sbjct: 597 EHNFRTREGDEKRTYLSLPPVVAPLKCSVLPLSSNEEFMPYVKQLSQNLTKVDISHKVDD 656

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVN-DRTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  PF ITIDF ++    + TLRERDS  Q+R N+D +  V++DL 
Sbjct: 657 SSGSIGRRYARTDEIAIPFGITIDFDTLKMPHSATLRERDSMGQVRINLDELPNVVRDLA 716

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW +V   YP F QQE
Sbjct: 717 NGKITWAEVEAKYPKFEQQE 736



>gi|170050075|ref|XP_001859192.1| glycyl-tRNA synthetase [Culex quinquefasciatus]
 gi|167871658|gb|EDS35041.1| glycyl-tRNA synthetase [Culex quinquefasciatus]
          Length = 736

 Score =  313 bits (801), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 200/321 (62%), Gaps = 5/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   F+ K+GI PDRLRFRQHM NEMAHYACDCWDA+   SYGW+ECVGCADRSAYDLT 
Sbjct: 415 RIQQFMLKIGILPDRLRFRQHMGNEMAHYACDCWDAECLTSYGWVECVGCADRSAYDLTQ 474

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXX-XXXXXX 119
           H+N T  KLV  + L  P   + T +  NK   G   ++++K + + L            
Sbjct: 475 HTNATGVKLVAEKKLPAPKTIEVTEVVPNKAAIGKVFKKDAKNITELLAKLSLDEVETIG 534

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T  V GT      + S+ + +K  + T HV E TP+VIEPSFG+GRI+YSL
Sbjct: 535 KNLAGSGEHTLDVNGT---AVTLKSDMIAVKSSSKTVHVEEITPSVIEPSFGVGRIMYSL 591

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR   S PP VAP KC ++PLSNN  FT  V +++  +  + I+ KVD
Sbjct: 592 LEHSFQMREGDEQRCYFSLPPVVAPLKCSVLPLSNNADFTPFVKKISSALTSVDISHKVD 651

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDL 298
           DSS SIGRRYAR DE+  P+ +TIDF ++ +  T+TLRERDS KQ+R  +D +  V++DL
Sbjct: 652 DSSGSIGRRYARTDEIAIPYGVTIDFDTLKEPHTVTLRERDSLKQVRIGLDEVAGVVRDL 711

Query: 299 LEESTTWEKVMETYPTFTQQE 319
                +W  V   YP F QQE
Sbjct: 712 ATGRLSWADVEAKYPKFEQQE 732



>gi|81889021|sp|Q5I0G4.1|SYG_RAT RecName: Full=Glycine--tRNA ligase; AltName: Full=Diadenosine
           tetraphosphate synthetase; Short=AP-4-A synthetase;
           AltName: Full=Glycyl-tRNA synthetase; Short=GlyRS
 gi|56971386|gb|AAH88347.1| Gars protein, partial [Rattus norvegicus]
          Length = 637

 Score =  313 bits (801), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 310 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 369

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL +          
Sbjct: 370 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLGACDECYITEME 429

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 430 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 486

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 487 LEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 546

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 547 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 606

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 607 LANGNITWADVEARYPLFEGQE 628



>gi|512898971|ref|XP_004898882.1| PREDICTED: glycine--tRNA ligase [Heterocephalus glaber]
          Length = 685

 Score =  313 bits (801), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 358 RIYLYLVKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 418 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVMEYLAICDECYIAEME 477

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 478 MLLNEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 534

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 535 LEHTFHVREGDEQRTFFSFPAMVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 594

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 595 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPGIVRD 654

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 655 LANGSITWADVEARYPVFEGQE 676



>gi|195018532|ref|XP_001984799.1| GH14827 [Drosophila grimshawi]
 gi|193898281|gb|EDV97147.1| GH14827 [Drosophila grimshawi]
          Length = 679

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 147/320 (45%), Positives = 204/320 (63%), Gaps = 2/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL  +GIKP+ LRFRQHM NEMAHYACDCWDA+I  SYGW+ECVGCADRSAYDL  
Sbjct: 358 RIQQFLHAIGIKPECLRFRQHMGNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQ 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  +LV  + L  P   + + +  NK+  G   ++++K + + L            
Sbjct: 418 HTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTYKKDAKAITEALAKLSLDDIKQVE 477

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                G G  K+   DG  +E+ +E + +K  T T HV E+ P+V+EPSFGIGRI+YSL+
Sbjct: 478 TQLASG-GQYKLTLPDGATHELDAETIGVKHATKTVHVEEFIPSVVEPSFGIGRIMYSLL 536

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR   + PP VAP KC ++PLSNN  F     +L+  + K  ++ KVDD
Sbjct: 537 EHSFQCREGDEQRCYFTLPPVVAPIKCSILPLSNNAEFQPYTQKLSGALTKAELSHKVDD 596

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  P+ IT+DF ++    T+TLR+R++ KQ+R +++ ++ V+KDL 
Sbjct: 597 SSGSIGRRYARTDEIAIPYGITVDFDTLKAPHTVTLRDRNTMKQVRIDLEAVVGVVKDLA 656

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW +V++ YP F QQE
Sbjct: 657 TTRLTWSQVLQQYPAFEQQE 676



>gi|512954329|ref|XP_004839531.1| PREDICTED: glycine--tRNA ligase [Heterocephalus glaber]
          Length = 740

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 413 RIYLYLVKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 472

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 473 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVMEYLAICDECYIAEME 532

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 533 MLLNEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 589

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 590 LEHTFHVREGDEQRTFFSFPAMVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 649

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 650 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPGIVRD 709

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 710 LANGSITWADVEARYPVFEGQE 731



>gi|466009790|ref|XP_004269991.1| PREDICTED: glycine--tRNA ligase [Orcinus orca]
          Length = 739

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLMKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAVCDECYITEME 531

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + + +KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 532 KLLSEKGEFTIE---TEGKTFQLTKDMVIVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ KVD
Sbjct: 589 FEHTFQIREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGISHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKAPHTATLRDRDSMRQIRAEVSELPSVVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 709 LANGSITWADVEARYPLFEGQE 730



>gi|301767770|ref|XP_002919302.1| PREDICTED: glycyl-tRNA synthetase-like [Ailuropoda melanoleuca]
          Length = 737

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 410 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 469

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 470 HARATKVPLVAEKRLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVLEYLAVCDECYITEME 529

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++ R   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 530 KLLNEKGEFTIE---TEGKTFQLTKDMVSVNRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 586

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 587 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 646

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 647 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 706

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 707 LANGSITWADVEARYPVFEGQE 728



>gi|74226707|dbj|BAE27003.1| unnamed protein product [Mus musculus]
          Length = 729

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 402 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 461

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL++          
Sbjct: 462 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEME 521

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 522 LLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 578

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           +EH +  R+ DEQR+  S P  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 579 LEHTFNVREGDEQRTFFSLPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 638

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 639 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRD 698

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 699 LANGNITWADVEARYPLFEGQE 720



>gi|359321220|ref|XP_003639538.1| PREDICTED: glycyl-tRNA synthetase-like [Canis lupus familiaris]
          Length = 749

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 202/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 414 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 473

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E +K   G   ++++K V +YL            
Sbjct: 474 HARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVLEYLAVCDECYITEME 533

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + +++KR   T HV E  PNVIEPSFG+GRI+Y++
Sbjct: 534 KLLNEKGEFTVE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTV 590

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 591 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 650

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 651 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 710

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 711 LANGSITWADVEARYPVFEGQE 732



>gi|507537593|ref|XP_004652820.1| PREDICTED: glycine--tRNA ligase [Jaculus jaculus]
          Length = 685

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 358 RIYLYLMKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 417

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYL-TSXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL T          
Sbjct: 418 HAQATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVMEYLATCDEGYVTEME 477

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 478 TLLSEKGEFTIE---TEGKTFQLTKDMVAVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTI 534

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 535 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVD 594

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F IT+DF +VN    T TLR+RDS +QIR  +  +  V+ D
Sbjct: 595 DSSGSIGRRYARTDEIGVAFGITVDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCD 654

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 655 LANGSITWADVEARYPLFEGQE 676



>gi|119614366|gb|EAW93960.1| glycyl-tRNA synthetase, isoform CRA_a [Homo sapiens]
          Length = 739

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 203/322 (63%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP+ ++    E +K   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPISFNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 532 MLLNEKGEFTIE---TEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  I  +  +++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 709 LANGNITWADVEARYPLFEGQE 730



>gi|505783984|ref|XP_004604306.1| PREDICTED: glycine--tRNA ligase [Sorex araneus]
          Length = 668

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 203/321 (63%), Gaps = 4/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ P++LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 341 RIYLYLTKVGVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 400

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL +          
Sbjct: 401 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGRAYKKDAKLVMEYLATCEECYITEME 460

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               D  G   +  T+G  +++T + +++KR + T HV E  PNVIEPSFG+GRI+Y++ 
Sbjct: 461 KLL-DEKGEFTIE-TEGKTFQLTRDMVSVKRFSKTLHVEEVVPNVIEPSFGLGRIMYTVF 518

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL+  + +  ++ KVDD
Sbjct: 519 EHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVRELSDALTRNGVSHKVDD 578

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKDL 298
           SS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++DL
Sbjct: 579 SSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPGVVRDL 638

Query: 299 LEESTTWEKVMETYPTFTQQE 319
              + TW  V   YP F  QE
Sbjct: 639 ASGTLTWADVEARYPLFEGQE 659



>gi|296209313|ref|XP_002751476.1| PREDICTED: glycine--tRNA ligase isoform 1 [Callithrix jacchus]
          Length = 739

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           HS  TK  LV  + L EP   +    E +K   G   ++++K V +YL            
Sbjct: 472 HSQATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 532 MLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLYVEEIVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 709 LANGSITWADVEARYPLFEGQE 730



>gi|90075272|dbj|BAE87316.1| unnamed protein product [Macaca fascicularis]
          Length = 392

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 65  RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 124

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP        E NK   G   ++++K V +YL            
Sbjct: 125 HARATKVPLVAEKPLKEPKTVSVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 184

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 185 MLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 241

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 242 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 301

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 302 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 361

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 362 LANGSITWADVEARYPLFEGQE 383



>gi|498967996|ref|XP_004546800.1| PREDICTED: glycine--tRNA ligase-like [Maylandia zebra]
          Length = 749

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 201/321 (62%), Gaps = 4/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI  D+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL  
Sbjct: 422 RIYLYLTKVGIAKDKLRFRQHMDNEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLQC 481

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL+           
Sbjct: 482 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKIVMEYLSVCDECFITDQE 541

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +    T    T+G  +++T + +++KR   T HV E  PNVIEPSFGIGRI+Y++ 
Sbjct: 542 KLLSESGEFT--IETEGKAFKLTKDMVSVKRFQKTLHVEEVVPNVIEPSFGIGRIMYTIF 599

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR+  SFP  VAP+KC ++PLS N  F   V EL++ + +  ++ KVDD
Sbjct: 600 EHTFQVREGDEQRTYFSFPATVAPYKCSVLPLSQNQEFMPFVRELSEALTRNGVSHKVDD 659

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKDL 298
           SS SIGRRYAR DE+G  F ITIDF SVN    T TLR+RDS +QIR  +  +  +++DL
Sbjct: 660 SSGSIGRRYARTDEIGVAFGITIDFDSVNKTPHTATLRDRDSMRQIRAEVGELPVIVRDL 719

Query: 299 LEESTTWEKVMETYPTFTQQE 319
              + TW +V   YP F  QE
Sbjct: 720 ASGTLTWAEVESKYPIFEGQE 740



>gi|350595384|ref|XP_003134854.3| PREDICTED: glycyl-tRNA synthetase-like [Sus scrofa]
          Length = 742

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 415 RIYLYLVKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 474

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 475 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 534

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 535 KLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTV 591

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 592 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 651

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 652 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 711

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 712 LANGSITWADVEARYPLFEGQE 733



>gi|402863813|ref|XP_003896193.1| PREDICTED: glycine--tRNA ligase [Papio anubis]
          Length = 738

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 411 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 470

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP        E NK   G   ++++K V +YL            
Sbjct: 471 HARATKVPLVAEKPLKEPKTVSVVQFEPNKGAIGKAYKKDAKLVMEYLAVCDECYITEME 530

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               + G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 531 MLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 587

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 588 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 647

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 648 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 707

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 708 LANGSITWADVEARYPLFEGQE 729



>gi|189536638|ref|XP_692410.3| PREDICTED: glycyl-tRNA synthetase [Danio rerio]
          Length = 764

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 202/321 (62%), Gaps = 4/321 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+  D+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL  
Sbjct: 437 RIYLYLVKVGVAKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLC 496

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  LV  + L EP + +    E NK   G   ++++K   +YL +          
Sbjct: 497 HARATKVPLVAEKPLKEPKVVNVVQFEPNKGAIGKAYKKDAKFAMEYL-AICDECYITEQ 555

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               + NG   +  T+G  +++T + + IKR   T HV E  PNVIEPSFGIGRI+YS+ 
Sbjct: 556 EKLLNENGEFTIE-TEGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIF 614

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R+ DEQR+  SFP  VAP+KC ++PLS N  F   V EL++ + +  ++ KVDD
Sbjct: 615 EHTFRIREGDEQRTYFSFPATVAPYKCSVLPLSQNQEFMPFVRELSEALTRNGVSHKVDD 674

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKDL 298
           SS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  + ++++DL
Sbjct: 675 SSGSIGRRYARTDEIGVAFGITIDFDTVNKNPHTATLRDRDSMRQIRAEVGELPEIIRDL 734

Query: 299 LEESTTWEKVMETYPTFTQQE 319
              + TW +V   YP F  QE
Sbjct: 735 ANGAITWAEVESKYPIFEGQE 755



>gi|440911500|gb|ELR61161.1| Glycyl-tRNA synthetase [Bos grunniens mutus]
          Length = 739

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+ P++LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLVKVGVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP+ ++    E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPISFNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 532 KLLNEKGEFTVE---TEGKTFQLTKDMVNVKRFQKTLHVEEVIPSVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ KVD
Sbjct: 589 FEHTFQVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGISHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S  W  V   YP F  QE
Sbjct: 709 LANGSIMWADVEARYPVFEGQE 730



>gi|449492085|ref|XP_002193565.2| PREDICTED: glycine--tRNA ligase [Taeniopygia guttata]
          Length = 677

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLFLTK+G+ P++LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 350 RIYLFLTKVGVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 409

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  TK  L+  ++L EP   +    E NK   G   ++++K V +YL+           
Sbjct: 410 HARATKVPLIAEKHLKEPRTVNIVQFEANKGAIGKAYKKDAKVVMEYLSMCDECYINEME 469

Query: 121 XXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
               D G  T +   T+G  + IT + +T+KR      V E  PNVIEPSFGIGRI+Y++
Sbjct: 470 QLLNDKGEFTVE---TEGKTFLITKDMVTVKRFXXCVPVEEIIPNVIEPSFGIGRIMYTV 526

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ KVD
Sbjct: 527 FEHTFRIREGDEQRTYFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRTGISHKVD 586

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVN--DRTITLRERDSTKQIRENIDTILQVLKD 297
           D++ SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  I  +  +++D
Sbjct: 587 DAAGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAEISELPGIIRD 646

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L     TW  V   YP F  QE
Sbjct: 647 LANGFLTWADVEAKYPQFEGQE 668



>gi|281208581|gb|EFA82757.1| glycyl-tRNA synthetase [Polysphondylium pallidum PN500]
          Length = 643

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 198/316 (62%), Gaps = 1/316 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           RT LFL  +GIKP+R+RFRQH  NEMAHYA DCWDA+IH SYGW+ECVG ADRS YDL V
Sbjct: 325 RTQLFLHTVGIKPERMRFRQHQSNEMAHYAADCWDAEIHTSYGWVECVGHADRSCYDLKV 384

Query: 61  HSNRTKEKLVVRENLAE-PMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXX 119
           HS +++  LVV E   + P + D   +++NK + G   +  +K   D+L S         
Sbjct: 385 HSEKSQVPLVVFEEFKDGPKMVDTIDVKMNKGLMGKTFKATAKEPMDFLDSLSNDFEAGL 444

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                       V   + NQY IT E +T+ +         Y P+VIEPSFG+GRI+YSL
Sbjct: 445 TFKERLDTDGQAVINVNTNQYTITKEMVTLTKTQKKISGESYQPHVIEPSFGLGRIIYSL 504

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
           IEH YW R+ DEQR VLS P  +AP K  ++PL  N      V  + + +++  I+ KVD
Sbjct: 505 IEHAYWVREGDEQRCVLSLPAIIAPVKASILPLIGNAELAPFVHRINRLLKEAGISCKVD 564

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLL 299
           DS ++IGRRYAR DE+G PF ITIDF ++ D T+TLRERD+TKQ+R  I  + Q LK L 
Sbjct: 565 DSGSAIGRRYARTDEIGIPFGITIDFDTLKDDTVTLRERDTTKQVRIPISDVTQTLKQLC 624

Query: 300 EESTTWEKVMETYPTF 315
           E ++TW+ V+  +P F
Sbjct: 625 ENNSTWQDVVTKFPAF 640



>gi|471379526|ref|XP_004377560.1| PREDICTED: glycine--tRNA ligase [Trichechus manatus latirostris]
          Length = 744

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 200/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 417 RIYLYLTKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 476

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YLT           
Sbjct: 477 HAKATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLTICDECYITEME 536

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T HV E  P+VIEPSFG+GRI+Y++
Sbjct: 537 KLLNEKGEFTIE---TEGRTFQLTKDMVNVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTV 593

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  I+ KVD
Sbjct: 594 FEHTFQVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGISHKVD 653

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  +  +  V+  
Sbjct: 654 DSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVICS 713

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   S TW  V   YP F  QE
Sbjct: 714 LANGSITWADVEARYPLFEGQE 735



>gi|332242726|ref|XP_003270534.1| PREDICTED: glycine--tRNA ligase isoform 1 [Nomascus leucogenys]
          Length = 739

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 532 MLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 709 LANGNITWADVEARYPLFEGQE 730



>gi|156537409|ref|XP_001606827.1| PREDICTED: glycyl-tRNA synthetase-like [Nasonia vitripennis]
          Length = 737

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/320 (47%), Positives = 202/320 (63%), Gaps = 3/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R   FL K+G+ P +LRFRQHM NEMAHYACDCWDA++  SYGW+ECVGCADRSAYDLT 
Sbjct: 416 RIQKFLVKVGVDPKKLRFRQHMGNEMAHYACDCWDAELLTSYGWVECVGCADRSAYDLTQ 475

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           H+  T  KLV  + L +P   D      N+ + G   R+ +K + D L +          
Sbjct: 476 HTKATGVKLVAEKKLPQPKTIDVCEAAPNRGLIGKTFRKEAKVILDALAALEEKDIDALE 535

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +  G  ++  +D   Y+IT + +TIKR   T HV E+ P+VIEPSFGIGRI+YS+ 
Sbjct: 536 KDLNE-KGEYELQTSDA-PYKITKDMITIKRYQKTVHVEEFVPSVIEPSFGIGRIMYSVF 593

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R  DEQR   S PP VAP KC ++PLS+N  FT  V +L++ + ++ ++ KVDD
Sbjct: 594 EHNFKMRDGDEQRRYFSLPPVVAPLKCSVLPLSSNAEFTPFVKKLSQELTRVDVSHKVDD 653

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVND-RTITLRERDSTKQIRENIDTILQVLKDLL 299
           SS SIGRRYAR DE+  PF ITIDF ++ +  + TLRERDS  Q+R N++ +  V++DL 
Sbjct: 654 SSGSIGRRYARTDEIAIPFGITIDFDTLKEPHSATLRERDSMGQVRINLEVLPAVVRDLS 713

Query: 300 EESTTWEKVMETYPTFTQQE 319
               TW  V   YP F QQE
Sbjct: 714 LGKITWSDVEAKYPKFEQQE 733



>gi|198438257|ref|XP_002130910.1| PREDICTED: glycine--tRNA ligase [Ciona intestinalis]
          Length = 728

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 195/320 (60%), Gaps = 3/320 (0%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YLF  K+GI P + RFRQHM NEMAHYACDCWDA+   SYGW+ECVGCADRS YDL  
Sbjct: 407 RIYLFCVKVGIDPFKFRFRQHMQNEMAHYACDCWDAECKTSYGWVECVGCADRSCYDLKC 466

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS   K  L     L EP+  D   L  NK+  G   ++++K V+ +L            
Sbjct: 467 HSQAAKVNLSAERPLPEPVQRDVVSLSCNKQAVGKAFKKDAKKVQAHLEGLSEEEIVNLE 526

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
                 N       +DG ++ +    + +KR   T  V E+ P+VIEPSFG GR+LYS +
Sbjct: 527 TEMT-ANSVYVYTHSDGGKFNVLPGMVAVKRTKKTFQVEEFMPSVIEPSFGFGRLLYSTL 585

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           EH +  R  DEQR+  S P  +AP+KC L+PLSN P F   +  L+  ++KL I+ KVD 
Sbjct: 586 EHNFKIRAADEQRTFFSLPAVIAPYKCSLLPLSNKPDFNPFITSLSLALKKLGISHKVDT 645

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVN--DRTITLRERDSTKQIRENIDTILQVLKDL 298
           SS SIG+RYAR DE+  PF IT+DF +V     T TLRERDS  QIR  ++ I Q++ DL
Sbjct: 646 SSGSIGKRYARTDEIAVPFGITVDFDTVKIEPHTATLRERDSLVQIRATVEEIPQIVYDL 705

Query: 299 LEESTTWEKVMETYPTFTQQ 318
           ++E+TTWE+VM+ Y  F +Q
Sbjct: 706 VQENTTWEEVMKKYSVFEEQ 725



>gi|441651074|ref|XP_004091026.1| PREDICTED: glycine--tRNA ligase isoform 2 [Nomascus leucogenys]
          Length = 689

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 362 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 421

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 422 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 481

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 482 MLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 538

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 539 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 598

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 599 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 658

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 659 LANGNITWADVEARYPLFEGQE 680



>gi|197099206|ref|NP_001127342.1| glycine--tRNA ligase precursor [Pongo abelii]
 gi|71153559|sp|Q5RBL1.1|SYG_PONAB RecName: Full=Glycine--tRNA ligase; AltName: Full=Diadenosine
           tetraphosphate synthetase; Short=AP-4-A synthetase;
           AltName: Full=Glycyl-tRNA synthetase; Short=GlyRS
 gi|55728200|emb|CAH90849.1| hypothetical protein [Pongo abelii]
          Length = 739

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 201/322 (62%), Gaps = 6/322 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+LTK+GI PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 412 RIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 471

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLT-SXXXXXXXXX 119
           H+  TK  LV  + L EP   +    E NK   G   ++++K V +YL            
Sbjct: 472 HARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEME 531

Query: 120 XXXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSL 179
                 G  T +   T+G  +++T + + +KR   T +V E  PNVIEPSFG+GRI+Y++
Sbjct: 532 MLLNEKGEFTIE---TEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTV 588

Query: 180 IEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVD 239
            EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ KVD
Sbjct: 589 FEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD 648

Query: 240 DSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQVLKD 297
           DSS SIGRRYAR DE+G  F +TIDF +VN    T TLR+RDS +QIR  +  +  +++D
Sbjct: 649 DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRD 708

Query: 298 LLEESTTWEKVMETYPTFTQQE 319
           L   + TW  V   YP F  QE
Sbjct: 709 LANGNITWADVEARYPLFEGQE 730



>gi|401842167|gb|EJT44424.1| GRS2-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 613

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 207/308 (67%), Gaps = 4/308 (1%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R + FL KLGI  ++ RFRQH+ NEMAHYA DCWD ++  SYGWIEC+GCADR+A+DLTV
Sbjct: 301 RVHQFLLKLGIDNNKFRFRQHLKNEMAHYATDCWDGELLTSYGWIECIGCADRAAFDLTV 360

Query: 61  HSNRTKEKLVVRENLAEPMIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXXXXX 120
           HS +T + L+V++ L  P    + VL++NKK+FGP+ +  +K +E  L            
Sbjct: 361 HSKKTGKSLMVKQRLNSPKEKIEWVLDVNKKLFGPQFKYRAKKIESVLLRFSQEELRSRH 420

Query: 121 XXXXDGNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRILYSLI 180
               +G   T     DG+  E+    ++I+ +T  +H REY PNVIEPSFG+GRI+Y + 
Sbjct: 421 KELKEGGKFT--CQIDGDIVELDDGLVSIEMRTTLQHTREYIPNVIEPSFGLGRIIYCIF 478

Query: 181 EHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAIKVDD 240
           +H +  R D+  R+  SFP +VAP K L+  +SNN  F  +V E+++ +RK  I  KVDD
Sbjct: 479 DHCFRLRADNNARAFFSFPLQVAPIKVLITTISNNENFPSIVKEISQILRKREIYFKVDD 538

Query: 241 SSNSIGRRYARNDELGTPFAITIDFQSVNDRTITLRERDSTKQIRENIDTILQVLKDLLE 300
           S+ SIG++YARNDELG PF ITIDF+++ND+T+TLRERDSTKQ+R ++D ++ V+  ++ 
Sbjct: 539 SNTSIGKKYARNDELGIPFGITIDFETLNDKTVTLRERDSTKQVRGSVDDVISVIDKMIR 598

Query: 301 EST--TWE 306
             T  TW+
Sbjct: 599 NPTESTWD 606



>gi|444727438|gb|ELW67931.1| Glycyl-tRNA synthetase [Tupaia chinensis]
          Length = 621

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 203/325 (62%), Gaps = 9/325 (2%)

Query: 1   RTYLFLTKLGIKPDRLRFRQHMPNEMAHYACDCWDADIHNSYGWIECVGCADRSAYDLTV 60
           R YL+L K+G+ PD+LRFRQHM NEMAHYACDCWDA+   SYGWIE VGCADRS YDL+ 
Sbjct: 291 RIYLYLVKVGVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSC 350

Query: 61  HSNRTKEKLVVRENLAEP---MIYDKTVLEINKKVFGPKLRQNSKTVEDYLTSXXXXXXX 117
           H+  TK  LV  + L EP   ++  K   E NK   G   ++++K V +YL         
Sbjct: 351 HARATKVPLVAEKPLKEPISFLVTPKVEFEPNKGTIGKAYKKDAKLVLEYLAVCDECYVT 410

Query: 118 XXXXXXXD-GNGTTKVPGTDGNQYEITSEYLTIKRQTFTEHVREYTPNVIEPSFGIGRIL 176
                  + G  T +   T+G  +++T + +++KR   T HV E  PNVIEPSFG+GRI+
Sbjct: 411 EMETLLSEKGEFTIE---TEGKTFQLTKDMVSVKRFQKTLHVEEVVPNVIEPSFGLGRIM 467

Query: 177 YSLIEHVYWTRKDDEQRSVLSFPPRVAPFKCLLVPLSNNPAFTDLVDELAKRIRKLSIAI 236
           Y++ EH +  R+ DEQR+  SFP  VAPFKC ++PLS N  F   V EL++ + +  ++ 
Sbjct: 468 YTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFVPFVKELSEALTRSGVSH 527

Query: 237 KVDDSSNSIGRRYARNDELGTPFAITIDFQSVND--RTITLRERDSTKQIRENIDTILQV 294
           KVDDSS SIGRRYAR DE+G  F ITIDF +VN    T TLR+RDS +QIR  I  +  V
Sbjct: 528 KVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSV 587

Query: 295 LKDLLEESTTWEKVMETYPTFTQQE 319
           + DL   S +W  V   YP F  QE
Sbjct: 588 VCDLANGSISWADVEARYPQFEGQE 612