BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10112_c0_seq1-m.39 complete 64-852(+) 263 (+)
         (262 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|353237413|emb|CCA69386.1| related to RING finger protein Dorf...   168   2e-39   Serendipita indica DSM 11827
gi|472239222|gb|EMR84044.1| putative ring finger protein [Botryo...   164   2e-38   Botrytis cinerea BcDW1
gi|336276135|ref|XP_003352821.1| hypothetical protein SMAC_04935...   164   2e-38   Sordaria macrospora k-hell
gi|347840597|emb|CCD55169.1| hypothetical protein BofuT4_P159900...   163   3e-38   Botrytis cinerea T4
gi|169596360|ref|XP_001791604.1| hypothetical protein SNOG_00938...   161   2e-37   Parastagonospora nodorum SN15
gi|353239290|emb|CCA71207.1| hypothetical protein PIIN_05143 [Pi...   154   2e-35   Serendipita indica DSM 11827
gi|512200864|gb|EPE29696.1| RING/U-box [Glarea lozoyensis ATCC 2...   152   6e-35   Glarea lozoyensis ATCC 20868
gi|452988826|gb|EME88581.1| hypothetical protein MYCFIDRAFT_1597...   146   4e-33   Cercospora fijiensis CIRAD86
gi|85114236|ref|XP_964661.1| hypothetical protein NCU11208 [Neur...   144   2e-32   Neurospora crassa OR74A
gi|402222074|gb|EJU02141.1| hypothetical protein DACRYDRAFT_1070...   144   2e-32   Dacryopinax primogenitus
gi|406859161|gb|EKD12230.1| ring finger protein [Marssonina brun...   144   2e-32   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|336463470|gb|EGO51710.1| hypothetical protein NEUTE1DRAFT_125...   144   3e-32   Neurospora tetrasperma FGSC 2508
gi|347835544|emb|CCD50116.1| hypothetical protein BofuT4_P025150...   142   8e-32   Botrytis cinerea T4
gi|340923824|gb|EGS18727.1| hypothetical protein CTHT_0053350 [C...   142   9e-32   Chaetomium thermophilum var. thermophilum DSM 1495
gi|353237414|emb|CCA69387.1| hypothetical protein PIIN_03287 [Pi...   142   1e-31   Serendipita indica DSM 11827
gi|482813689|gb|EOA90380.1| hypothetical protein SETTUDRAFT_1033...   140   3e-31   Setosphaeria turcica Et28A
gi|472242631|gb|EMR87318.1| putative ring finger protein [Botryo...   139   5e-31   Botrytis cinerea BcDW1
gi|154305743|ref|XP_001553273.1| hypothetical protein BC1G_07686...   139   6e-31   Botrytis cinerea B05.10
gi|353237475|emb|CCA69447.1| related to RING finger protein, put...   138   1e-30   Serendipita indica DSM 11827
gi|156031146|ref|XP_001584898.1| hypothetical protein SS1G_14181...   138   2e-30   Sclerotinia sclerotiorum 1980 UF-70
gi|353239291|emb|CCA71208.1| hypothetical protein PIIN_11690 [Pi...   136   6e-30   Serendipita indica DSM 11827
gi|406866348|gb|EKD19388.1| ring finger protein [Marssonina brun...   134   2e-29   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|452838947|gb|EME40887.1| hypothetical protein DOTSEDRAFT_7444...   133   5e-29   Dothistroma septosporum NZE10
gi|396470291|ref|XP_003838608.1| hypothetical protein LEMA_P1154...   133   5e-29   Leptosphaeria maculans JN3
gi|449296711|gb|EMC92730.1| hypothetical protein BAUCODRAFT_5950...   132   7e-29   Baudoinia panamericana UAMH 10762
gi|402074860|gb|EJT70331.1| hypothetical protein GGTG_11359 [Gae...   132   1e-28   Gaeumannomyces graminis var. tritici R3-111a-1
gi|320586883|gb|EFW99546.1| ring finger protein [Grosmannia clav...   132   1e-28   Grosmannia clavigera kw1407
gi|475674868|gb|EMT71948.1| Putative E3 ubiquitin-protein ligase...   131   2e-28   Fusarium oxysporum f. sp. cubense race 4
gi|494832224|gb|EON68538.1| hypothetical protein W97_07796 [Coni...   131   2e-28   Coniosporium apollinis CBS 100218
gi|302881601|ref|XP_003039711.1| hypothetical protein NECHADRAFT...   130   3e-28   Nectria haematococca mpVI 77-13-4
gi|443917746|gb|ELU38402.1| IBR domain-containing protein [Rhizo...   128   1e-27   Rhizoctonia solani AG-1 IA
gi|449295610|gb|EMC91631.1| hypothetical protein BAUCODRAFT_2994...   125   9e-27   Baudoinia panamericana UAMH 10762
gi|169615298|ref|XP_001801065.1| hypothetical protein SNOG_10806...   125   1e-26   Parastagonospora nodorum SN15
gi|443917698|gb|ELU38358.1| IBR domain-containing protein [Rhizo...   125   1e-26   Rhizoctonia solani AG-1 IA
gi|302913723|ref|XP_003050988.1| hypothetical protein NECHADRAFT...   125   2e-26   Nectria haematococca mpVI 77-13-4
gi|452839201|gb|EME41140.1| hypothetical protein DOTSEDRAFT_5505...   123   4e-26   Dothistroma septosporum NZE10
gi|169596090|ref|XP_001791469.1| hypothetical protein SNOG_00796...   123   4e-26   Parastagonospora nodorum SN15
gi|330947502|ref|XP_003306898.1| hypothetical protein PTT_20198 ...   120   3e-25   Pyrenophora teres f. teres 0-1
gi|472240240|gb|EMR85018.1| putative ring finger protein [Botryo...   120   3e-25   Botrytis cinerea BcDW1
gi|512207691|gb|EPE36508.1| RING/U-box [Glarea lozoyensis ATCC 2...   120   4e-25   Glarea lozoyensis ATCC 20868
gi|347837234|emb|CCD51806.1| hypothetical protein BofuT4_P021120...   120   4e-25   Botrytis cinerea T4
gi|154322535|ref|XP_001560582.1| hypothetical protein BC1G_00610...   120   4e-25   Botrytis cinerea B05.10
gi|449295670|gb|EMC91691.1| hypothetical protein BAUCODRAFT_7968...   119   8e-25   Baudoinia panamericana UAMH 10762
gi|453083496|gb|EMF11542.1| hypothetical protein SEPMUDRAFT_4841...   119   1e-24   Sphaerulina musiva SO2202
gi|212545456|ref|XP_002152882.1| RING finger protein, putative [...   118   1e-24   Talaromyces marneffei ATCC 18224
gi|116180776|ref|XP_001220237.1| hypothetical protein CHGG_01016...   117   3e-24   Chaetomium globosum CBS 148.51
gi|169615296|ref|XP_001801064.1| hypothetical protein SNOG_10805...   116   7e-24   Parastagonospora nodorum SN15
gi|342886266|gb|EGU86150.1| hypothetical protein FOXB_03338 [Fus...   115   9e-24   Fusarium oxysporum Fo5176
gi|340513935|gb|EGR44209.1| predicted protein [Trichoderma reese...   115   9e-24   Trichoderma reesei QM6a
gi|512203368|gb|EPE32192.1| RING/U-box [Glarea lozoyensis ATCC 2...   115   1e-23   Glarea lozoyensis ATCC 20868
gi|296814830|ref|XP_002847752.1| IBR domain-containing protein [...   114   4e-23   Arthroderma otae CBS 113480
gi|330804929|ref|XP_003290441.1| hypothetical protein DICPUDRAFT...   112   9e-23   Dictyostelium purpureum
gi|315053907|ref|XP_003176328.1| ariadne-1 [Arthroderma gypseum ...   112   1e-22   Microsporum gypseum CBS 118893
gi|340518962|gb|EGR49202.1| hypothetical protein TRIREDRAFT_7766...   112   1e-22   Trichoderma reesei QM6a
gi|327308880|ref|XP_003239131.1| RING finger protein [Trichophyt...   111   2e-22   Trichophyton rubrum CBS 118892
gi|302655405|ref|XP_003019491.1| IBR finger domain protein [Tric...   111   2e-22   Trichophyton verrucosum HKI 0517
gi|302504427|ref|XP_003014172.1| IBR finger domain protein [Arth...   111   2e-22   Arthroderma benhamiae CBS 112371
gi|326484433|gb|EGE08443.1| IBR domain-containing protein [Trich...   111   2e-22   Trichophyton equinum CBS 127.97
gi|326469461|gb|EGD93470.1| IBR domain-containing protein [Trich...   111   2e-22   Trichophyton tonsurans CBS 112818
gi|330844607|ref|XP_003294211.1| hypothetical protein DICPUDRAFT...   111   2e-22   Dictyostelium purpureum
gi|358394570|gb|EHK43963.1| hypothetical protein TRIATDRAFT_3563...   110   3e-22   Trichoderma atroviride IMI 206040
gi|429857904|gb|ELA32743.1| ring finger domain-containing protei...   110   4e-22   Colletotrichum gloeosporioides Nara gc5
gi|470426397|ref|XP_004337892.1| IBR domain containing protein [...   110   5e-22   Acanthamoeba castellanii str. Neff
gi|403359855|gb|EJY79585.1| IBR domain containing protein [Oxytr...   109   6e-22   Oxytricha trifallax
gi|358385943|gb|EHK23539.1| hypothetical protein TRIVIDRAFT_7985...   109   6e-22   Trichoderma virens Gv29-8
gi|402218564|gb|EJT98640.1| hypothetical protein DACRYDRAFT_9641...   109   7e-22   Dacryopinax primogenitus
gi|406867586|gb|EKD20624.1| IBR domain-containing protein [Marss...   109   8e-22   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|443917697|gb|ELU38357.1| IBR domain-containing protein [Rhizo...   108   1e-21   Rhizoctonia solani AG-1 IA
gi|66807519|ref|XP_637482.1| ariadne-like ubiquitin ligase [Dict...   108   1e-21   Dictyostelium discoideum AX4
gi|511000424|gb|EPB81964.1| hypothetical protein HMPREF1544_1131...   108   2e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|342873166|gb|EGU75386.1| hypothetical protein FOXB_14091 [Fus...   108   2e-21   Fusarium oxysporum Fo5176
gi|475667535|gb|EMT65324.1| hypothetical protein FOC4_g10011306 ...   107   2e-21   Fusarium oxysporum f. sp. cubense race 4
gi|501754838|emb|CCG81828.1| IBR domain protein [Taphrina deform...   107   2e-21   Taphrina deformans PYCC 5710
gi|170091398|ref|XP_001876921.1| predicted protein [Laccaria bic...   107   2e-21   Laccaria bicolor S238N-H82
gi|511006115|gb|EPB87434.1| ubiquitin-conjugating enzyme E2, oth...   107   3e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|302916589|ref|XP_003052105.1| predicted protein [Nectria haem...   107   3e-21   Nectria haematococca mpVI 77-13-4
gi|400601841|gb|EJP69466.1| RING-5 protein [Beauveria bassiana A...   107   4e-21   Beauveria bassiana ARSEF 2860
gi|403333348|gb|EJY65764.1| IBR domain containing protein [Oxytr...   107   4e-21   Oxytricha trifallax
gi|403363259|gb|EJY81371.1| IBR domain containing protein [Oxytr...   106   7e-21   Oxytricha trifallax
gi|336261932|ref|XP_003345752.1| hypothetical protein SMAC_05909...   105   8e-21   Sordaria macrospora k-hell
gi|302418562|ref|XP_003007112.1| ariadne-1 [Verticillium albo-at...   105   9e-21   Verticillium alfalfae VaMs.102
gi|322694692|gb|EFY86515.1| RING-5 like protein [Metarhizium acr...   105   9e-21   Metarhizium acridum CQMa 102
gi|346322205|gb|EGX91804.1| RING finger protein [Cordyceps milit...   105   9e-21   Cordyceps militaris CM01
gi|110617782|gb|ABG78607.1| RING-5 [Fusarium graminearum]             105   9e-21   Fusarium graminearum
gi|121700086|ref|XP_001268308.1| IBR domain protein [Aspergillus...   105   1e-20   Aspergillus clavatus NRRL 1
gi|408397963|gb|EKJ77100.1| hypothetical protein FPSE_02744 [Fus...   105   1e-20   Fusarium pseudograminearum CS3096
gi|482807844|gb|EOA84777.1| hypothetical protein SETTUDRAFT_1718...   105   1e-20   Setosphaeria turcica Et28A
gi|164424670|ref|XP_959229.2| hypothetical protein NCU06882 [Neu...   105   1e-20   Neurospora crassa OR74A
gi|189191638|ref|XP_001932158.1| ankyrin repeat and IBR domain c...   105   1e-20   Pyrenophora tritici-repentis Pt-1C-BFP
gi|46125333|ref|XP_387220.1| hypothetical protein FG07044.1 [Fus...   105   1e-20   
gi|346976688|gb|EGY20140.1| ariadne-1 [Verticillium dahliae VdLs...   105   2e-20   Verticillium dahliae VdLs.17
gi|500259144|gb|EOO01983.1| putative ibr domain-containing prote...   104   2e-20   Phaeoacremonium minimum UCRPA7
gi|336466941|gb|EGO55105.1| hypothetical protein NEUTE1DRAFT_852...   104   2e-20   Neurospora tetrasperma FGSC 2508
gi|67470299|ref|XP_651119.1| IBR domain containing protein [Enta...   104   2e-20   Entamoeba histolytica HM-1:IMSS
gi|115389878|ref|XP_001212444.1| hypothetical protein ATEG_03266...   104   2e-20   Aspergillus terreus NIH2624
gi|472463683|gb|EMS16621.1| IBR domain containing protein [Entam...   104   2e-20   Entamoeba histolytica HM-3:IMSS
gi|119472659|ref|XP_001258396.1| IBR domain protein [Neosartorya...   104   2e-20   Aspergillus fischeri NRRL 181
gi|340966726|gb|EGS22233.1| hypothetical protein CTHT_0017500 [C...   104   2e-20   Chaetomium thermophilum var. thermophilum DSM 1495
gi|494827998|gb|EON64894.1| hypothetical protein W97_04128 [Coni...   104   3e-20   Coniosporium apollinis CBS 100218
gi|407041618|gb|EKE40854.1| IBR domain containing protein [Entam...   104   3e-20   Entamoeba nuttalli P19
gi|242790269|ref|XP_002481528.1| RING finger protein [Talaromyce...   104   3e-20   Talaromyces stipitatus ATCC 10500
gi|195589272|ref|XP_002084376.1| GD14237 [Drosophila simulans] >...   104   3e-20   
gi|380473790|emb|CCF46118.1| hypothetical protein CH063_14968, p...   103   3e-20   Colletotrichum higginsianum
gi|451853358|gb|EMD66652.1| hypothetical protein COCSADRAFT_3007...   103   4e-20   Bipolaris sorokiniana ND90Pr
gi|255538518|ref|XP_002510324.1| Protein ariadne-1, putative [Ri...   103   4e-20   Ricinus communis
gi|259481769|tpe|CBF75602.1| TPA: RING finger protein (AFU_ortho...   103   5e-20   Aspergillus nidulans FGSC A4
gi|449299861|gb|EMC95874.1| hypothetical protein BAUCODRAFT_5073...   103   5e-20   Baudoinia panamericana UAMH 10762
gi|310796238|gb|EFQ31699.1| IBR domain-containing protein [Glome...   103   5e-20   Colletotrichum graminicola M1.001
gi|406861964|gb|EKD15016.1| IBR domain-containing protein [Marss...   103   5e-20   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|471196425|ref|XP_004255171.1| ariadne RING finger, putative [...   103   6e-20   Entamoeba invadens IP1
gi|358394310|gb|EHK43703.1| hypothetical protein TRIATDRAFT_3577...   102   7e-20   Trichoderma atroviride IMI 206040
gi|453081502|gb|EMF09551.1| hypothetical protein SEPMUDRAFT_9234...   102   7e-20   Sphaerulina musiva SO2202
gi|380479124|emb|CCF43208.1| IBR domain-containing protein [Coll...   102   7e-20   Colletotrichum higginsianum
gi|167381630|ref|XP_001735792.1| ariadne RING finger [Entamoeba ...   102   7e-20   Entamoeba dispar SAW760
gi|357460861|ref|XP_003600712.1| hypothetical protein MTR_3g0654...   102   8e-20   
gi|477527715|gb|ENH79530.1| ring finger [Colletotrichum orbicula...   102   8e-20   Colletotrichum orbiculare MAFF 240422
gi|429852833|gb|ELA27950.1| ring-5 like protein [Colletotrichum ...   102   8e-20   Colletotrichum gloeosporioides Nara gc5
gi|470525854|ref|XP_004356665.1| e3 ubiquitinprotein ligase rbra...   102   8e-20   Acanthamoeba castellanii str. Neff
gi|258568024|ref|XP_002584756.1| conserved hypothetical protein ...   102   9e-20   Uncinocarpus reesii 1704
gi|70992567|ref|XP_751132.1| RING finger protein [Aspergillus fu...   102   1e-19   Aspergillus fumigatus Af293
gi|146162447|ref|XP_001009638.2| IBR domain containing protein [...   102   1e-19   
gi|322708109|gb|EFY99686.1| RING-5 like protein [Metarhizium ani...   102   1e-19   Metarhizium robertsii ARSEF 23
gi|171679387|ref|XP_001904640.1| hypothetical protein [Podospora...   102   1e-19   Podospora anserina S mat+
gi|367048091|ref|XP_003654425.1| hypothetical protein THITE_2117...   102   1e-19   Thielavia terrestris NRRL 8126
gi|471200017|ref|XP_004256870.1| ariadne RING finger, putative [...   102   1e-19   Entamoeba invadens IP1
gi|440465234|gb|ELQ34574.1| IBR domain protein [Magnaporthe oryz...   102   1e-19   Magnaporthe oryzae Y34
gi|384494946|gb|EIE85437.1| hypothetical protein RO3G_10147 [Rhi...   102   1e-19   Rhizopus delemar RA 99-880
gi|389638068|ref|XP_003716667.1| IBR domain-containing protein [...   102   1e-19   Magnaporthe oryzae 70-15
gi|357154274|ref|XP_003576728.1| PREDICTED: probable E3 ubiquiti...   102   1e-19   Brachypodium distachyon [annual false brome]
gi|452981589|gb|EME81349.1| hypothetical protein MYCFIDRAFT_5205...   101   2e-19   Cercospora fijiensis CIRAD86
gi|212534476|ref|XP_002147394.1| RING finger protein [Talaromyce...   101   2e-19   Talaromyces marneffei ATCC 18224
gi|212534478|ref|XP_002147395.1| RING finger protein [Talaromyce...   101   2e-19   Talaromyces marneffei ATCC 18224
gi|281211302|gb|EFA85467.1| ariadne-like ubiquitin ligase [Polys...   101   2e-19   Polysphondylium pallidum PN500
gi|296417176|ref|XP_002838236.1| hypothetical protein [Tuber mel...   101   2e-19   Tuber melanosporum Mel28
gi|145490195|ref|XP_001431098.1| hypothetical protein [Parameciu...   101   2e-19   Paramecium tetraurelia strain d4-2
gi|116203713|ref|XP_001227667.1| conserved hypothetical protein ...   101   2e-19   Chaetomium globosum CBS 148.51
gi|470486393|ref|XP_004344600.1| IBR domain containing protein [...   101   2e-19   Acanthamoeba castellanii str. Neff
gi|470316672|gb|EMR08418.1| hypothetical protein PNEG_03254 [Pne...   100   3e-19   Pneumocystis murina B123
gi|367031716|ref|XP_003665141.1| hypothetical protein MYCTH_2308...   100   3e-19   Myceliophthora thermophila ATCC 42464
gi|119194723|ref|XP_001247965.1| hypothetical protein CIMG_01736...   100   3e-19   Coccidioides immitis RS
gi|303311031|ref|XP_003065527.1| IBR domain containing protein [...   100   3e-19   Coccidioides posadasii C735 delta SOWgp
gi|330927034|ref|XP_003301711.1| hypothetical protein PTT_13285 ...   100   3e-19   Pyrenophora teres f. teres 0-1
gi|320031521|gb|EFW13483.1| RING finger protein [Coccidioides po...   100   3e-19   Coccidioides posadasii str. Silveira
gi|240280594|gb|EER44098.1| RING finger domain-containing protei...   100   3e-19   Histoplasma capsulatum H143
gi|134075454|emb|CAK48015.1| unnamed protein product [Aspergillu...   100   4e-19   Aspergillus niger
gi|320592166|gb|EFX04605.1| ring finger protein [Grosmannia clav...   100   4e-19   Grosmannia clavigera kw1407
gi|225560856|gb|EEH09137.1| RING finger domain-containing protei...   100   4e-19   Histoplasma capsulatum G186AR
gi|350630162|gb|EHA18535.1| hypothetical protein ASPNIDRAFT_2076...   100   4e-19   Aspergillus niger ATCC 1015
gi|255947396|ref|XP_002564465.1| Pc22g04260 [Penicillium chrysog...   100   4e-19   Penicillium rubens Wisconsin 54-1255
gi|145493115|ref|XP_001432554.1| hypothetical protein [Parameciu...   100   4e-19   Paramecium tetraurelia strain d4-2
gi|226293405|gb|EEH48825.1| ariadne-1 [Paracoccidioides brasilie...   100   4e-19   
gi|325089144|gb|EGC42454.1| RING finger protein [Ajellomyces cap...   100   5e-19   Histoplasma capsulatum H88
gi|494831493|gb|EON67948.1| ubiquitin-conjugating enzyme E2, oth...   100   5e-19   Coniosporium apollinis CBS 100218
gi|453084367|gb|EMF12411.1| RING finger protein [Mycosphaerella ...   100   6e-19   Sphaerulina musiva SO2202
gi|317029041|ref|XP_001390993.2| hypothetical protein ANI_1_2120...   100   6e-19   Aspergillus niger CBS 513.88
gi|42569518|ref|NP_180709.3| putative E3 ubiquitin-protein ligas...   100   6e-19   Arabidopsis thaliana [mouse-ear cress]
gi|460366165|ref|XP_004228962.1| PREDICTED: probable E3 ubiquiti...   100   6e-19   Solanum lycopersicum
gi|24662189|ref|NP_648392.1| CG12362, isoform A [Drosophila mela...   100   7e-19   Drosophila melanogaster
gi|15225136|ref|NP_180736.1| putative E3 ubiquitin-protein ligas...    99   7e-19   Arabidopsis thaliana [mouse-ear cress]
gi|195326557|ref|XP_002029992.1| GM25208 [Drosophila sechellia] ...    99   8e-19   Drosophila sechellia
gi|330798908|ref|XP_003287491.1| hypothetical protein DICPUDRAFT...    99   9e-19   Dictyostelium purpureum
gi|357460859|ref|XP_003600711.1| hypothetical protein MTR_3g0653...    99   9e-19   
gi|512186955|gb|EPE02739.1| ibr domain-containing protein [Ophio...    99   9e-19   Ophiostoma piceae UAMH 11346
gi|330923838|ref|XP_003300396.1| hypothetical protein PTT_11634 ...    99   9e-19   Pyrenophora teres f. teres 0-1
gi|154277954|ref|XP_001539806.1| hypothetical protein HCAG_05273...    99   9e-19   Histoplasma capsulatum NAm1
gi|471570741|gb|EMR69764.1| putative ibr domain-containing prote...    99   9e-19   Eutypa lata UCREL1
gi|485922695|gb|EOD48060.1| putative ring finger protein [Neofus...    99   1e-18   Neofusicoccum parvum UCRNP2
gi|167376967|ref|XP_001734234.1| ariadne RING finger [Entamoeba ...    99   1e-18   Entamoeba dispar SAW760
gi|477534185|gb|ENH85747.1| ring finger protein [Colletotrichum ...    99   1e-18   Colletotrichum orbiculare MAFF 240422
gi|460391591|ref|XP_004241404.1| PREDICTED: probable E3 ubiquiti...    99   1e-18   Solanum lycopersicum
gi|470251774|ref|XP_004358984.1| ariadne-like ubiquitin ligase [...    99   1e-18   Dictyostelium fasciculatum
gi|334182329|ref|NP_001184920.1| putative E3 ubiquitin-protein l...    99   1e-18   Arabidopsis thaliana [mouse-ear cress]
gi|358377798|gb|EHK15481.1| hypothetical protein TRIVIDRAFT_8005...    99   1e-18   Trichoderma virens Gv29-8
gi|239608096|gb|EEQ85083.1| IBR domain-containing protein [Ajell...    99   1e-18   Blastomyces dermatitidis ER-3
gi|261203745|ref|XP_002629086.1| IBR domain-containing protein [...    99   1e-18   Blastomyces gilchristii SLH14081
gi|396499624|ref|XP_003845520.1| similar to RING finger domain-c...    99   1e-18   Leptosphaeria maculans JN3
gi|67465696|ref|XP_649010.1| IBR domain containing protein [Enta...    99   1e-18   Entamoeba histolytica HM-1:IMSS
gi|30679494|ref|NP_172080.2| putative E3 ubiquitin-protein ligas...    99   1e-18   Arabidopsis thaliana [mouse-ear cress]
gi|440633916|gb|ELR03835.1| ariadne-1 [Geomyces destructans 2063...    99   1e-18   Pseudogymnoascus destructans 20631-21
gi|29125025|emb|CAD52887.1| ARIADNE-like protein ARI5 [Arabidops...    99   2e-18   Arabidopsis thaliana [mouse-ear cress]
gi|169770169|ref|XP_001819554.1| hypothetical protein AOR_1_6261...    99   2e-18   Aspergillus oryzae RIB40
gi|238487448|ref|XP_002374962.1| RING finger protein [Aspergillu...    98   2e-18   Aspergillus flavus NRRL3357
gi|512197974|gb|EPE26809.1| RING/U-box [Glarea lozoyensis ATCC 2...    98   2e-18   Glarea lozoyensis ATCC 20868
gi|367036058|ref|XP_003667311.1| hypothetical protein MYCTH_1038...    98   2e-18   Myceliophthora thermophila ATCC 42464
gi|164657668|ref|XP_001729960.1| hypothetical protein MGL_2946 [...    98   2e-18   Malassezia globosa CBS 7966
gi|156064957|ref|XP_001598400.1| hypothetical protein SS1G_00488...    98   2e-18   Sclerotinia sclerotiorum 1980 UF-70
gi|407924611|gb|EKG17644.1| Zinc finger RING-type protein [Macro...    97   4e-18   Macrophomina phaseolina MS6
gi|297826593|ref|XP_002881179.1| hypothetical protein ARALYDRAFT...    97   4e-18   Arabidopsis lyrata subsp. lyrata
gi|345562364|gb|EGX45432.1| hypothetical protein AOL_s00169g38 [...    97   5e-18   Arthrobotrys oligospora ATCC 24927
gi|297743763|emb|CBI36646.3| unnamed protein product [Vitis vini...    97   5e-18   Vitis vinifera
gi|297843384|ref|XP_002889573.1| hypothetical protein ARALYDRAFT...    97   5e-18   Arabidopsis lyrata subsp. lyrata
gi|255585685|ref|XP_002533527.1| Protein ariadne-1, putative [Ri...    97   5e-18   
gi|452840435|gb|EME42373.1| hypothetical protein DOTSEDRAFT_7325...    97   5e-18   Dothistroma septosporum NZE10
gi|295664735|ref|XP_002792919.1| ariadne-1 [Paracoccidioides sp....    97   5e-18   
gi|85085463|ref|XP_957515.1| hypothetical protein NCU04438 [Neur...    97   6e-18   
gi|328773966|gb|EGF84003.1| hypothetical protein BATDEDRAFT_9163...    97   6e-18   Batrachochytrium dendrobatidis JAM81
gi|336471198|gb|EGO59359.1| hypothetical protein NEUTE1DRAFT_399...    96   6e-18   Neurospora tetrasperma FGSC 2508
gi|224067302|ref|XP_002302456.1| predicted protein [Populus tric...    96   6e-18   
gi|359478116|ref|XP_003632072.1| PREDICTED: probable E3 ubiquiti...    96   6e-18   Vitis vinifera
gi|402222073|gb|EJU02140.1| hypothetical protein DACRYDRAFT_1159...    96   6e-18   Dacryopinax primogenitus
gi|399168667|emb|CCE30453.1| probable ring-finger protein Ariadn...    96   7e-18   Claviceps purpurea 20.1
gi|71018479|ref|XP_759470.1| hypothetical protein UM03323.1 [Ust...    96   8e-18   
gi|299470137|emb|CBN78166.1| ubiquitin-conjugating enzyme E2-bin...    96   8e-18   Ectocarpus siliculosus
gi|358391353|gb|EHK40757.1| hypothetical protein TRIATDRAFT_2267...    96   9e-18   Trichoderma atroviride IMI 206040
gi|357150016|ref|XP_003575311.1| PREDICTED: probable E3 ubiquiti...    96   9e-18   Brachypodium distachyon [annual false brome]
gi|66824123|ref|XP_645416.1| RING zinc finger-containing protein...    96   9e-18   Dictyostelium discoideum AX4
gi|347827664|emb|CCD43361.1| similar to RING finger domain-conta...    96   9e-18   Botrytis cinerea T4
gi|154294327|ref|XP_001547605.1| hypothetical protein BC1G_13936...    96   1e-17   Botrytis cinerea B05.10
gi|345564001|gb|EGX46983.1| hypothetical protein AOL_s00097g222 ...    96   1e-17   Arthrobotrys oligospora ATCC 24927
gi|443897746|dbj|GAC75085.1| predicted E3 ubiquitin ligase [Pseu...    96   1e-17   Moesziomyces antarcticus T-34
gi|475540461|gb|EMT09603.1| Putative E3 ubiquitin-protein ligase...    96   1e-17   Aegilops tauschii
gi|194868345|ref|XP_001972274.1| GG15432 [Drosophila erecta] >gi...    96   1e-17   Drosophila erecta
gi|501310477|dbj|GAC99237.1| hypothetical protein PHSY_006837 [P...    96   1e-17   Pseudozyma hubeiensis SY62
gi|383864941|ref|XP_003707936.1| PREDICTED: protein ariadne-2-li...    96   1e-17   
gi|378732131|gb|EHY58590.1| ubiquitin-conjugating enzyme E2 [Exo...    96   1e-17   Exophiala dermatitidis NIH/UT8656
gi|156039407|ref|XP_001586811.1| hypothetical protein SS1G_11840...    95   1e-17   Sclerotinia sclerotiorum 1980 UF-70
gi|348664944|gb|EGZ04781.1| hypothetical protein PHYSODRAFT_5357...    95   2e-17   Phytophthora sojae
gi|66808225|ref|XP_637835.1| hypothetical protein DDB_G0286289 [...    95   2e-17   Dictyostelium discoideum AX4
gi|470114049|ref|XP_004293231.1| PREDICTED: probable E3 ubiquiti...    95   2e-17   Fragaria vesca subsp. vesca
gi|470110233|ref|XP_004291390.1| PREDICTED: probable E3 ubiquiti...    95   2e-17   
gi|302916487|ref|XP_003052054.1| hypothetical protein NECHADRAFT...    95   2e-17   Nectria haematococca mpVI 77-13-4
gi|452004789|gb|EMD97245.1| hypothetical protein COCHEDRAFT_1084...    95   2e-17   Bipolaris maydis C5
gi|195493154|ref|XP_002094294.1| GE21740 [Drosophila yakuba] >gi...    95   2e-17   Drosophila yakuba
gi|156055562|ref|XP_001593705.1| hypothetical protein SS1G_05133...    95   2e-17   Sclerotinia sclerotiorum 1980 UF-70
gi|502081662|ref|XP_004486930.1| PREDICTED: probable E3 ubiquiti...    95   2e-17   Cicer arietinum [garbanzo]
gi|470110229|ref|XP_004291388.1| PREDICTED: probable E3 ubiquiti...    95   2e-17   Fragaria vesca subsp. vesca
gi|170587899|ref|XP_001898711.1| Ariadne-2 protein [Brugia malay...    95   2e-17   Brugia malayi [agent of lymphatic filariasis]
gi|358371364|dbj|GAA87972.1| RING finger protein [Aspergillus ka...    95   2e-17   Aspergillus kawachii IFO 4308
gi|512200862|gb|EPE29694.1| RING/U-box [Glarea lozoyensis ATCC 2...    95   2e-17   Glarea lozoyensis ATCC 20868
gi|384245176|gb|EIE18671.1| IBR-domain-containing protein [Cocco...    94   2e-17   Coccomyxa subellipsoidea C-169
gi|19115116|ref|NP_594204.1| RING finger protein [Schizosaccharo...    94   3e-17   Schizosaccharomyces pombe 972h-
gi|326505476|dbj|BAJ95409.1| predicted protein [Hordeum vulgare ...    94   3e-17   Hordeum vulgare subsp. vulgare [barley]
gi|477587212|gb|ENI04294.1| hypothetical protein COCC4DRAFT_1978...    94   3e-17   Bipolaris maydis ATCC 48331
gi|195017392|ref|XP_001984590.1| GH14942 [Drosophila grimshawi] ...    94   3e-17   Drosophila grimshawi
gi|91092242|ref|XP_971366.1| PREDICTED: similar to zinc finger p...    94   3e-17   Tribolium castaneum [rust-red flour beetle]
gi|358342131|dbj|GAA49668.1| ariadne-1 [Clonorchis sinensis]           94   3e-17   Clonorchis sinensis [oriental liver fluke]
gi|195442684|ref|XP_002069079.1| GK24041 [Drosophila willistoni]...    94   3e-17   
gi|392902006|ref|NP_001255868.1| Protein TAG-349, isoform c [Cae...    94   4e-17   Caenorhabditis elegans [roundworm]
gi|388854295|emb|CCF52038.1| probable Ariadne-1 protein [Ustilag...    94   4e-17   Ustilago hordei
gi|145545520|ref|XP_001458444.1| hypothetical protein [Parameciu...    94   4e-17   Paramecium tetraurelia strain d4-2
gi|340518373|gb|EGR48614.1| predicted protein [Trichoderma reese...    94   5e-17   Trichoderma reesei QM6a
gi|115533080|ref|NP_001041060.1| Protein TAG-349, isoform a [Cae...    93   5e-17   Caenorhabditis elegans [roundworm]
gi|356550364|ref|XP_003543557.1| PREDICTED: probable E3 ubiquiti...    93   6e-17   Glycine max [soybeans]
gi|326522708|dbj|BAJ88400.1| predicted protein [Hordeum vulgare ...    93   6e-17   Hordeum vulgare subsp. vulgare [barley]
gi|380028493|ref|XP_003697934.1| PREDICTED: protein ariadne-2-li...    93   7e-17   Apis florea [dwarf honeybee]
gi|195649461|gb|ACG44198.1| ubiquitin-protein ligase/ zinc ion b...    93   7e-17   Zea mays [maize]
gi|110749511|ref|XP_624643.2| PREDICTED: protein ariadne-2-like ...    93   8e-17   Apis mellifera [European honey bee]
gi|356544392|ref|XP_003540636.1| PREDICTED: probable E3 ubiquiti...    93   8e-17   Glycine max [soybeans]
gi|326525965|dbj|BAJ93159.1| predicted protein [Hordeum vulgare ...    93   8e-17   Hordeum vulgare subsp. vulgare [barley]
gi|116205373|ref|XP_001228497.1| hypothetical protein CHGG_10570...    93   8e-17   Chaetomium globosum CBS 148.51
gi|115459148|ref|NP_001053174.1| Os04g0492100 [Oryza sativa Japo...    93   9e-17   
gi|356560194|ref|XP_003548379.1| PREDICTED: probable E3 ubiquiti...    92   9e-17   
gi|298204736|emb|CBI25234.3| unnamed protein product [Vitis vini...    92   9e-17   Vitis vinifera
gi|225443209|ref|XP_002270721.1| PREDICTED: probable E3 ubiquiti...    92   9e-17   
gi|471571484|gb|EMR70255.1| putative ibr domain-containing prote...    92   1e-16   Eutypa lata UCREL1
gi|403346328|gb|EJY72558.1| IBR domain containing protein [Oxytr...    92   1e-16   Oxytricha trifallax
gi|242082011|ref|XP_002445774.1| hypothetical protein SORBIDRAFT...    92   1e-16   Sorghum bicolor [broomcorn]
gi|357454413|ref|XP_003597487.1| hypothetical protein MTR_2g0985...    92   1e-16   Medicago truncatula
gi|308495502|ref|XP_003109939.1| hypothetical protein CRE_06578 ...    92   1e-16   Caenorhabditis remanei
gi|239609073|gb|EEQ86060.1| conserved hypothetical protein [Ajel...    92   1e-16   Blastomyces dermatitidis ER-3
gi|242079373|ref|XP_002444455.1| hypothetical protein SORBIDRAFT...    92   1e-16   Sorghum bicolor [broomcorn]
gi|261188077|ref|XP_002620455.1| conserved hypothetical protein ...    92   1e-16   Blastomyces gilchristii SLH14081
gi|224132684|ref|XP_002327855.1| predicted protein [Populus tric...    92   1e-16   
gi|194750987|ref|XP_001957808.1| GF10593 [Drosophila ananassae] ...    92   1e-16   Drosophila ananassae
gi|46123271|ref|XP_386189.1| hypothetical protein FG06013.1 [Fus...    92   1e-16   
gi|402080670|gb|EJT75815.1| ariadne-1 [Gaeumannomyces graminis v...    92   2e-16   Gaeumannomyces graminis var. tritici R3-111a-1
gi|147816926|emb|CAN64393.1| hypothetical protein VITISV_024826 ...    92   2e-16   Vitis vinifera
gi|330844611|ref|XP_003294213.1| hypothetical protein DICPUDRAFT...    92   2e-16   Dictyostelium purpureum
gi|115454193|ref|NP_001050697.1| Os03g0625800 [Oryza sativa Japo...    92   2e-16   
gi|125544931|gb|EAY91070.1| hypothetical protein OsI_12680 [Oryz...    92   2e-16   Oryza sativa Indica Group [Indian rice]
gi|255547476|ref|XP_002514795.1| Protein ariadne-1, putative [Ri...    92   2e-16   
gi|460409287|ref|XP_004250070.1| PREDICTED: probable E3 ubiquiti...    91   2e-16   Solanum lycopersicum
gi|195378130|ref|XP_002047837.1| GJ13659 [Drosophila virilis] >g...    91   2e-16   
gi|332017491|gb|EGI58212.1| E3 ubiquitin-protein ligase RNF19A [...    91   2e-16   Acromyrmex echinatior
gi|398396332|ref|XP_003851624.1| hypothetical protein MYCGRDRAFT...    91   3e-16   Zymoseptoria tritici IPO323
gi|268537470|ref|XP_002633871.1| Hypothetical protein CBG19920 [...    91   3e-16   Caenorhabditis briggsae
gi|356557318|ref|XP_003546964.1| PREDICTED: probable E3 ubiquiti...    91   3e-16   
gi|512922694|ref|XP_004930179.1| PREDICTED: protein ariadne-2-li...    91   3e-16   Bombyx mori [silk moth]
gi|170051064|ref|XP_001861595.1| ariadne-2 [Culex quinquefasciat...    91   3e-16   Culex quinquefasciatus
gi|482564915|gb|EOA29105.1| hypothetical protein CARUB_v10025372...    91   3e-16   
gi|340708943|ref|XP_003393076.1| PREDICTED: protein ariadne-2-li...    91   4e-16   
gi|118369757|ref|XP_001018081.1| IBR domain containing protein [...    91   4e-16   
gi|38346221|emb|CAE02043.2| OJ990528_30.1 [Oryza sativa Japonica...    91   4e-16   
gi|118394316|ref|XP_001029534.1| IBR domain containing protein [...    91   4e-16   
gi|115476708|ref|NP_001061950.1| Os08g0451800 [Oryza sativa Japo...    91   4e-16   
gi|350419001|ref|XP_003492038.1| PREDICTED: protein ariadne-2-li...    91   4e-16   
gi|218563484|sp|P0C8K8.1|ARI6_ARATH RecName: Full=Putative E3 ub...    91   4e-16   
gi|320593257|gb|EFX05666.1| ring finger protein [Grosmannia clav...    90   5e-16   
gi|218563493|sp|Q9LVW9.2|ARI4_ARATH RecName: Full=Putative E3 ub...    90   5e-16   
gi|449442245|ref|XP_004138892.1| PREDICTED: probable E3 ubiquiti...    90   5e-16   
gi|505754476|gb|EOQ98797.1| hypothetical protein J056_002834 [Wa...    90   6e-16   
gi|170063073|ref|XP_001866946.1| zinc finger protein [Culex quin...    90   6e-16   
gi|308478201|ref|XP_003101312.1| hypothetical protein CRE_13504 ...    90   6e-16   
gi|195129241|ref|XP_002009067.1| GI11465 [Drosophila mojavensis]...    90   6e-16   
gi|302825973|ref|XP_002994548.1| hypothetical protein SELMODRAFT...    90   7e-16   
gi|502144481|ref|XP_004505713.1| PREDICTED: probable E3 ubiquiti...    89   8e-16   
gi|297815032|ref|XP_002875399.1| hypothetical protein ARALYDRAFT...    89   8e-16   
gi|462404351|gb|EMJ09908.1| hypothetical protein PRUPE_ppa003187...    89   8e-16   
gi|281204516|gb|EFA78711.1| ubiquitin-protein ligase [Polysphond...    89   9e-16   
gi|340368900|ref|XP_003382988.1| PREDICTED: e3 ubiquitin-protein...    89   9e-16   
gi|508717786|gb|EOY09683.1| IBR domain-containing protein isofor...    89   9e-16   
gi|482575191|gb|EOA39378.1| hypothetical protein CARUB_v10012456...    89   9e-16   
gi|402593765|gb|EJW87692.1| zinc finger protein [Wuchereria banc...    89   9e-16   
gi|471202355|ref|XP_004258008.1| ariadne RING finger, putative [...    89   1e-15   
gi|357164408|ref|XP_003580043.1| PREDICTED: probable E3 ubiquiti...    89   1e-15   
gi|470140100|ref|XP_004305782.1| PREDICTED: probable E3 ubiquiti...    89   1e-15   
gi|157116029|ref|XP_001658347.1| zinc finger protein [Aedes aegy...    89   1e-15   
gi|301092516|ref|XP_002997113.1| conserved hypothetical protein ...    89   1e-15   
gi|508717785|gb|EOY09682.1| IBR domain-containing protein isofor...    89   1e-15   
gi|147843035|emb|CAN83309.1| hypothetical protein VITISV_023021 ...    89   1e-15   
gi|298205054|emb|CBI38350.3| unnamed protein product [Vitis vini...    89   1e-15   
gi|212721766|ref|NP_001132685.1| uncharacterized protein LOC1001...    89   2e-15   
gi|440475135|gb|ELQ43836.1| ariadne-1 [Magnaporthe oryzae Y34] >...    89   2e-15   
gi|195027449|ref|XP_001986595.1| GH21451 [Drosophila grimshawi] ...    89   2e-15   
gi|157123501|ref|XP_001660175.1| zinc finger protein [Aedes aegy...    89   2e-15   
gi|302812621|ref|XP_002987997.1| hypothetical protein SELMODRAFT...    88   2e-15   
gi|389640961|ref|XP_003718113.1| ariadne-1 [Magnaporthe oryzae 7...    88   2e-15   
gi|502119893|ref|XP_004496771.1| PREDICTED: probable E3 ubiquiti...    88   2e-15   
gi|359495753|ref|XP_002268068.2| PREDICTED: probable E3 ubiquiti...    88   2e-15   
gi|229594447|ref|XP_001023544.3| IBR domain containing protein [...    88   2e-15   
gi|470111366|ref|XP_004291919.1| PREDICTED: probable E3 ubiquiti...    88   2e-15   
gi|198465787|ref|XP_001353771.2| GA11583 [Drosophila pseudoobscu...    88   2e-15   
gi|357473923|ref|XP_003607246.1| hypothetical protein MTR_4g0750...    88   2e-15   
gi|470376247|ref|XP_004333261.1| Znfinger in Ran binding protein...    88   2e-15   
gi|357628228|gb|EHJ77618.1| hypothetical protein KGM_04631 [Dana...    88   2e-15   
gi|470132616|ref|XP_004302175.1| PREDICTED: probable E3 ubiquiti...    88   2e-15   
gi|303284979|ref|XP_003061780.1| predicted protein [Micromonas p...    88   2e-15   
gi|115480643|ref|NP_001063915.1| Os09g0559000 [Oryza sativa Japo...    88   2e-15   
gi|482561393|gb|EOA25584.1| hypothetical protein CARUB_v10018931...    88   3e-15   
gi|118346631|ref|XP_977199.1| IBR domain containing protein [Tet...    88   3e-15   
gi|145490632|ref|XP_001431316.1| hypothetical protein [Parameciu...    87   3e-15   
gi|350404007|ref|XP_003486979.1| PREDICTED: E3 ubiquitin-protein...    87   3e-15   
gi|167524391|ref|XP_001746531.1| hypothetical protein [Monosiga ...    87   3e-15   
gi|482562682|gb|EOA26872.1| hypothetical protein CARUB_v10022964...    87   4e-15   
gi|470263651|ref|XP_004360979.1| ubiquitin-protein ligase [Dicty...    87   4e-15   
gi|168022154|ref|XP_001763605.1| predicted protein [Physcomitrel...    87   4e-15   
gi|502148916|ref|XP_004507320.1| PREDICTED: probable E3 ubiquiti...    87   4e-15   
gi|218201538|gb|EEC83965.1| hypothetical protein OsI_30081 [Oryz...    87   4e-15   
gi|293336083|ref|NP_001169569.1| uncharacterized protein LOC1003...    87   4e-15   
gi|477529900|gb|ENH81642.1| ibr finger domain protein [Colletotr...    87   4e-15   
gi|341881444|gb|EGT37379.1| hypothetical protein CAEBREN_07961 [...    87   4e-15   
gi|341879882|gb|EGT35817.1| hypothetical protein CAEBREN_23659 [...    87   5e-15   
gi|470134774|ref|XP_004303213.1| PREDICTED: putative uncharacter...    87   5e-15   
gi|470266403|ref|XP_004361746.1| hypothetical protein DFA_06033 ...    87   5e-15   
gi|302782319|ref|XP_002972933.1| hypothetical protein SELMODRAFT...    87   6e-15   
gi|195402599|ref|XP_002059892.1| GJ15094 [Drosophila virilis] >g...    87   6e-15   
gi|482683587|ref|XP_004444425.1| GA19075, isoform B [Drosophila ...    87   6e-15   
gi|15225135|ref|NP_180735.1| putative E3 ubiquitin-protein ligas...    87   6e-15   
gi|47085901|ref|NP_998308.1| protein ariadne-2 homolog [Danio re...    87   6e-15   
gi|123487071|ref|XP_001324861.1| IBR domain containing protein [...    86   6e-15   
gi|115477573|ref|NP_001062382.1| Os08g0540300 [Oryza sativa Japo...    86   7e-15   
gi|321262474|ref|XP_003195956.1| ariadne-1 protein-like protein ...    86   7e-15   
gi|413918763|gb|AFW58695.1| putative RING zinc finger domain sup...    86   7e-15   
gi|500253260|gb|EON96989.1| putative ibr domain-containing prote...    86   7e-15   
gi|21428834|gb|AAM50136.1| GH07166p [Drosophila melanogaster]          86   7e-15   
gi|356541617|ref|XP_003539270.1| PREDICTED: uncharacterized prot...    86   7e-15   
gi|312376028|gb|EFR23241.1| hypothetical protein AND_13267 [Anop...    86   8e-15   
gi|508713083|gb|EOY04980.1| IBR domain-containing protein isofor...    86   8e-15   
gi|226506396|ref|NP_001141318.1| LOC100273409 [Zea mays] >gi|194...    86   8e-15   
gi|118387809|ref|XP_001027007.1| IBR domain containing protein [...    86   8e-15   
gi|508722758|gb|EOY14655.1| IBR domain-containing protein, putat...    86   8e-15   
gi|432864606|ref|XP_004070370.1| PREDICTED: E3 ubiquitin-protein...    86   8e-15   
gi|508713081|gb|EOY04978.1| IBR domain-containing protein isofor...    86   8e-15   
gi|508713082|gb|EOY04979.1| IBR domain-containing protein isofor...    86   9e-15   
gi|268568806|ref|XP_002640352.1| C. briggsae CBR-ARI-1 protein [...    86   9e-15   
gi|330844099|ref|XP_003293974.1| hypothetical protein DICPUDRAFT...    86   9e-15   
gi|167533849|ref|XP_001748603.1| hypothetical protein [Monosiga ...    86   9e-15   
gi|66805419|ref|XP_636442.1| hypothetical protein DDB_G0289043 [...    86   9e-15   
gi|326513316|dbj|BAK06898.1| predicted protein [Hordeum vulgare ...    86   1e-14   
gi|308505042|ref|XP_003114704.1| CRE-ARI-1 protein [Caenorhabdit...    86   1e-14   
gi|195346672|ref|XP_002039881.1| GM15896 [Drosophila sechellia] ...    86   1e-14   
gi|58271512|ref|XP_572912.1| hypothetical protein [Cryptococcus ...    86   1e-14   
gi|17137570|ref|NP_477374.1| ariadne 2 [Drosophila melanogaster]...    86   1e-14   
gi|195488626|ref|XP_002092394.1| GE14168 [Drosophila yakuba] >gi...    86   1e-14   
gi|307188142|gb|EFN72974.1| Protein ariadne-2 [Camponotus florid...    86   1e-14   
gi|194882149|ref|XP_001975175.1| GG22175 [Drosophila erecta] >gi...    86   1e-14   
gi|356545498|ref|XP_003541178.1| PREDICTED: probable E3 ubiquiti...    86   1e-14   
gi|217927136|gb|ACK57214.1| CG12362-like protein, partial [Droso...    86   1e-14   
gi|356538909|ref|XP_003537943.1| PREDICTED: probable E3 ubiquiti...    86   1e-14   
gi|413921939|gb|AFW61871.1| putative RING zinc finger domain sup...    86   1e-14   
gi|168033696|ref|XP_001769350.1| predicted protein [Physcomitrel...    86   1e-14   
gi|357148681|ref|XP_003574856.1| PREDICTED: probable E3 ubiquiti...    86   1e-14   
gi|125564686|gb|EAZ10066.1| hypothetical protein OsI_32372 [Oryz...    86   1e-14   
gi|403346134|gb|EJY72451.1| RING finger protein [Oxytricha trifa...    86   1e-14   
gi|312083499|ref|XP_003143887.1| hypothetical protein LOAG_08307...    86   1e-14   
gi|462395169|gb|EMJ00968.1| hypothetical protein PRUPE_ppa003200...    86   1e-14   
gi|118388248|ref|XP_001027223.1| IBR domain containing protein [...    86   1e-14   
gi|341881536|gb|EGT37471.1| hypothetical protein CAEBREN_01143 [...    85   1e-14   
gi|449298003|gb|EMC94020.1| hypothetical protein BAUCODRAFT_3649...    85   2e-14   
gi|457870639|ref|XP_004222240.1| IBR domain protein, partial [Pl...    85   2e-14   
gi|195639914|gb|ACG39425.1| ubiquitin-protein ligase/ zinc ion b...    85   2e-14   
gi|390355310|ref|XP_794311.3| PREDICTED: E3 ubiquitin-protein li...    85   2e-14   
gi|449455425|ref|XP_004145453.1| PREDICTED: uncharacterized prot...    85   2e-14   
gi|195154405|ref|XP_002018112.1| GL17530 [Drosophila persimilis]...    85   2e-14   
gi|72390403|ref|XP_845496.1| hypothetical protein [Trypanosoma b...    85   2e-14   
gi|425768924|gb|EKV07435.1| hypothetical protein PDIG_72960 [Pen...    85   2e-14   
gi|357154581|ref|XP_003576831.1| PREDICTED: probable E3 ubiquiti...    85   2e-14   
gi|3925604|emb|CAA10276.1| Ariadne-2 protein (ARI2) [Homo sapiens]     85   2e-14   
gi|261328899|emb|CBH11877.1| hypothetical protein, conserved [Tr...    85   2e-14   
gi|256080792|ref|XP_002576661.1| ariadne-2 protein homolog (ari-...    85   2e-14   
gi|475536268|gb|EMT08891.1| Putative E3 ubiquitin-protein ligase...    85   2e-14   
gi|145543595|ref|XP_001457483.1| hypothetical protein [Parameciu...    85   2e-14   
gi|392902008|ref|NP_001255869.1| Protein TAG-349, isoform d [Cae...    85   2e-14   
gi|91094237|ref|XP_968250.1| PREDICTED: similar to ariadne ubiqu...    85   2e-14   
gi|426193257|gb|EKV43191.1| hypothetical protein AGABI2DRAFT_195...    85   2e-14   
gi|414586613|tpg|DAA37184.1| TPA: putative RING zinc finger doma...    85   2e-14   
gi|443728566|gb|ELU14866.1| hypothetical protein CAPTEDRAFT_2075...    85   2e-14   
gi|194753211|ref|XP_001958910.1| GF12618 [Drosophila ananassae] ...    85   2e-14   
gi|158295106|ref|XP_316020.4| AGAP005977-PA [Anopheles gambiae s...    85   2e-14   
gi|339246333|ref|XP_003374800.1| protein ariadne-1 [Trichinella ...    84   2e-14   
gi|168044134|ref|XP_001774537.1| predicted protein [Physcomitrel...    84   2e-14   
gi|462418933|gb|EMJ23196.1| hypothetical protein PRUPE_ppa003287...    84   3e-14   
gi|413925059|gb|AFW64991.1| putative RING zinc finger domain sup...    84   3e-14   
gi|256073384|ref|XP_002573011.1| ariadne-1 protein homolog (ari-...    84   3e-14   
gi|502143403|ref|XP_004505329.1| PREDICTED: uncharacterized prot...    84   3e-14   
gi|145360522|ref|NP_180737.3| putative E3 ubiquitin-protein liga...    84   3e-14   
gi|341883605|gb|EGT39540.1| hypothetical protein CAEBREN_23911 [...    84   3e-14   
gi|294461426|gb|ADE76274.1| unknown [Picea sitchensis]                 84   3e-14   
gi|482557906|gb|EOA22098.1| hypothetical protein CARUB_v10002648...    84   3e-14   
gi|195119822|ref|XP_002004428.1| GI19927 [Drosophila mojavensis]...    84   3e-14   
gi|308483122|ref|XP_003103763.1| hypothetical protein CRE_09505 ...    84   3e-14   
gi|223999919|ref|XP_002289632.1| transcription factor [Thalassio...    84   3e-14   
gi|145540245|ref|XP_001455812.1| hypothetical protein [Parameciu...    84   3e-14   
gi|332017848|gb|EGI58508.1| Protein ariadne-2 [Acromyrmex echina...    84   3e-14   
gi|478253016|gb|ENN73396.1| hypothetical protein YQE_09958, part...    84   4e-14   
gi|448087861|ref|XP_004196431.1| Piso0_005894 [Millerozyma farin...    84   4e-14   
gi|66801239|ref|XP_629545.1| hypothetical protein DDB_G0292642 [...    84   4e-14   
gi|443728564|gb|ELU14864.1| hypothetical protein CAPTEDRAFT_1979...    84   4e-14   
gi|485626734|gb|EOD22420.1| hypothetical protein EMIHUDRAFT_4304...    84   4e-14   
gi|297822915|ref|XP_002879340.1| hypothetical protein ARALYDRAFT...    84   4e-14   
gi|221055743|ref|XP_002259010.1| ibr domain protein [Plasmodium ...    84   4e-14   
gi|15232251|ref|NP_189408.1| putative E3 ubiquitin-protein ligas...    84   4e-14   
gi|115479197|ref|NP_001063192.1| Os09g0419600 [Oryza sativa Japo...    84   4e-14   
gi|326501808|dbj|BAK06396.1| predicted protein [Hordeum vulgare ...    84   4e-14   
gi|310796067|gb|EFQ31528.1| IBR domain-containing protein [Glome...    84   4e-14   
gi|242073556|ref|XP_002446714.1| hypothetical protein SORBIDRAFT...    84   4e-14   
gi|281342759|gb|EFB18343.1| hypothetical protein PANDA_010122 [A...    84   4e-14   
gi|301771636|ref|XP_002921239.1| PREDICTED: probable E3 ubiquiti...    84   4e-14   
gi|470115094|ref|XP_004293738.1| PREDICTED: uncharacterized prot...    84   5e-14   
gi|348514904|ref|XP_003444980.1| PREDICTED: E3 ubiquitin-protein...    84   5e-14   
gi|15231185|ref|NP_190144.1| RING/U-box protein with C6HC-type z...    84   5e-14   
gi|255086025|ref|XP_002508979.1| predicted protein [Micromonas s...    84   5e-14   
gi|25144228|ref|NP_491749.2| Protein ARI-1 [Caenorhabditis elega...    84   5e-14   
gi|308475811|ref|XP_003100123.1| hypothetical protein CRE_21332 ...    84   5e-14   
gi|403336855|gb|EJY67624.1| IBR domain containing protein [Oxytr...    84   5e-14   
gi|465955773|gb|EMP26602.1| E3 ubiquitin-protein ligase ARIH2 [C...    83   6e-14   
gi|498931789|ref|XP_004519237.1| PREDICTED: protein ariadne-1-li...    83   6e-14   
gi|67477540|ref|XP_654228.1| zinc finger protein [Entamoeba hist...    83   6e-14   
gi|225458418|ref|XP_002283665.1| PREDICTED: probable E3 ubiquiti...    83   6e-14   
gi|405971891|gb|EKC36694.1| Protein ariadne-2 [Crassostrea gigas]      83   6e-14   
gi|449676932|ref|XP_002158303.2| PREDICTED: E3 ubiquitin-protein...    83   6e-14   
gi|75337346|sp|Q9SKC2.1|ARI11_ARATH RecName: Full=Probable E3 ub...    83   6e-14   
gi|193786001|dbj|BAG50977.1| unnamed protein product [Homo sapiens]    83   6e-14   
gi|322510087|sp|Q54CX4.2|Y5521_DICDI RecName: Full=Uncharacteriz...    83   6e-14   
gi|448083238|ref|XP_004195341.1| Piso0_005894 [Millerozyma farin...    83   6e-14   
gi|255538524|ref|XP_002510327.1| Protein ariadne-1, putative [Ri...    83   7e-14   
gi|302142421|emb|CBI19624.3| unnamed protein product [Vitis vini...    83   7e-14   
gi|341875444|gb|EGT31379.1| hypothetical protein CAEBREN_30373 [...    83   7e-14   
gi|470106686|ref|XP_004289693.1| PREDICTED: probable E3 ubiquiti...    83   7e-14   
gi|470111701|ref|XP_004292083.1| PREDICTED: probable E3 ubiquiti...    83   8e-14   
gi|512874795|ref|XP_004893527.1| PREDICTED: E3 ubiquitin-protein...    83   8e-14   
gi|67970511|dbj|BAE01598.1| unnamed protein product [Macaca fasc...    83   8e-14   
gi|345326930|ref|XP_001508466.2| PREDICTED: E3 ubiquitin-protein...    83   8e-14   
gi|508705343|gb|EOX97239.1| RING/U-box superfamily protein isofo...    83   8e-14   
gi|149727782|ref|XP_001503664.1| PREDICTED: probable E3 ubiquiti...    83   8e-14   
gi|302782323|ref|XP_002972935.1| hypothetical protein SELMODRAFT...    83   9e-14   
gi|326674016|ref|XP_002667427.2| PREDICTED: e3 ubiquitin-protein...    83   9e-14   
gi|170574967|ref|XP_001893040.1| ubiquitin-conjugating enzyme E2...    83   9e-14   
gi|403337484|gb|EJY67960.1| hypothetical protein OXYTRI_11526 [O...    83   9e-14   
gi|402592071|gb|EJW86000.1| hypothetical protein WUBG_03088 [Wuc...    82   9e-14   
gi|410899144|ref|XP_003963057.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|410899146|ref|XP_003963058.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|449470882|ref|XP_002191397.2| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|297820104|ref|XP_002877935.1| zinc finger family protein [Ara...    82   1e-13   
gi|326926356|ref|XP_003209368.1| PREDICTED: protein ariadne-1 ho...    82   1e-13   
gi|460370020|ref|XP_004230853.1| PREDICTED: probable E3 ubiquiti...    82   1e-13   
gi|507620332|ref|XP_004625128.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|344284437|ref|XP_003413974.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|281340433|gb|EFB16017.1| hypothetical protein PANDA_008406 [A...    82   1e-13   
gi|114586741|ref|XP_001159999.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|460370018|ref|XP_004230852.1| PREDICTED: probable E3 ubiquiti...    82   1e-13   
gi|224103473|ref|XP_002313070.1| predicted protein [Populus tric...    82   1e-13   
gi|242038795|ref|XP_002466792.1| hypothetical protein SORBIDRAFT...    82   1e-13   
gi|343961851|dbj|BAK62513.1| protein ariadne-2 homolog [Pan trog...    82   1e-13   
gi|47230084|emb|CAG10498.1| unnamed protein product [Tetraodon n...    82   1e-13   
gi|505836627|ref|XP_004622916.1| PREDICTED: LOW QUALITY PROTEIN:...    82   1e-13   
gi|505828243|ref|XP_004609431.1| PREDICTED: probable E3 ubiquiti...    82   1e-13   
gi|296225154|ref|XP_002758370.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|5453557|ref|NP_006312.1| E3 ubiquitin-protein ligase ARIH2 [H...    82   1e-13   
gi|395501239|ref|XP_003775276.1| PREDICTED: LOW QUALITY PROTEIN:...    82   1e-13   
gi|351705757|gb|EHB08676.1| ariadne-1-like protein, partial [Het...    82   1e-13   
gi|47220486|emb|CAG03266.1| unnamed protein product [Tetraodon n...    82   1e-13   
gi|281207359|gb|EFA81542.1| hypothetical protein PPL_05531 [Poly...    82   1e-13   
gi|148694020|gb|EDL25967.1| ariadne ubiquitin-conjugating enzyme...    82   1e-13   
gi|432116965|gb|ELK37537.1| E3 ubiquitin-protein ligase ARIH1 [M...    82   1e-13   
gi|194206494|ref|XP_001494700.2| PREDICTED: protein ariadne-1 ho...    82   1e-13   
gi|62898832|dbj|BAD97270.1| ariadne homolog 2 variant [Homo sapi...    82   1e-13   
gi|431893698|gb|ELK03519.1| Protein ariadne-1 like protein [Pter...    82   1e-13   
gi|397495542|ref|XP_003818611.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   
gi|507566241|ref|XP_004666769.1| PREDICTED: E3 ubiquitin-protein...    82   1e-13   


>gi|353237413|emb|CCA69386.1| related to RING finger protein Dorfin [Piriformospora indica DSM
           11827]
          Length = 583

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 127/221 (57%), Gaps = 8/221 (3%)

Query: 7   ECGVCCEDYSII--QQISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           EC +C ++  +   +  +S C H   IC  C++ HI  E+++KG    + CP   C + +
Sbjct: 261 ECMICADEPLLFPTKPPTSLCTHEARICLPCLQNHISNEMSTKGAVRAIVCPAPECIMLM 320

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
            Y+D+R  A +  F +YD +L R+A+    +F  C    C +GQ H+ G   PI+TC  C
Sbjct: 321 DYDDLRYWADENTFRKYDRMLTRMALGVEENFVLCTNAACDAGQIHSEGANAPIVTCYVC 380

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQLQTE-DFTANRAYHERHTKQCPNCYMSIEKNDGCDH 182
             K+CF H V WH GL+C +++E+ + +      + Y +R TK CPNC   +EK++GCD 
Sbjct: 381 HHKTCFLHQVAWHEGLSCEEYDEEQRIKMGMATTKEYLKRFTKACPNCKKPLEKSEGCDA 440

Query: 183 MSCR----CGYEFCWLCLGDYENIRTHGNHYHAPTCQYYAP 219
           M C+    CG+ FCWLCL  Y+ I   GNH H  +C+YYAP
Sbjct: 441 MLCKPPAGCGHRFCWLCLAPYDIILRDGNHRHYSSCKYYAP 481



>gi|472239222|gb|EMR84044.1| putative ring finger protein [Botryotinia fuckeliana BcDW1]
          Length = 353

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/222 (40%), Positives = 130/222 (58%), Gaps = 13/222 (5%)

Query: 7   ECGVCCEDYSIIQ---QISSSCGHNDICSV-CIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           EC +C E+ ++     +I++ C H+  C + C+ + I A++ +   D Q+ CP+  CP  
Sbjct: 127 ECSICAEELALANFPNRITTGCAHDSSCCLTCLSQSIGAQIETVQWD-QISCPE--CPEL 183

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           L++E+V+  AS+  F+RYD   L   I   P+F  C    CG+GQ H  GD  PI+TCG+
Sbjct: 184 LSFENVKTFASEGDFDRYDKNSLLSYISNNPNFTNCLGPNCGAGQIHQDGDAQPIMTCGS 243

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHER----HTKQCPNCYMSIEKND 178
           C  K+CF H +PWH+GLTC Q + + Q E  +      +R     TK+CP+C + I KN 
Sbjct: 244 CDFKTCFIHKMPWHTGLTCAQHDAR-QREGASKQEQKSQRLIKKATKKCPSCDVPILKNK 302

Query: 179 GCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYAP 219
           GCDHM+C  C YEFCW+CL DYE I T  N  H   C +Y P
Sbjct: 303 GCDHMTCTHCDYEFCWICLADYELILTTSNAAHDSKCAHYRP 344



>gi|336276135|ref|XP_003352821.1| hypothetical protein SMAC_04935 [Sordaria macrospora k-hell]
 gi|380092939|emb|CCC09176.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 1000

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 85/221 (38%), Positives = 131/221 (59%), Gaps = 16/221 (7%)

Query: 8   CGVCCEDYSI---IQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           C VC ++ ++     +I+S C H   ICS C+ + I +EL +K  D +++CP+  CP  L
Sbjct: 373 CSVCLDNKNLSVMAYEITSGCAHKPTICSACLGQWIASELETKMWD-RIKCPE--CPKPL 429

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQ-EHTTGDRFPIITCGA 122
            + DV+R ASK +F+RYD L  R A+  +P+FRWCK+ KC SGQ +     RF    C A
Sbjct: 430 QFADVKRNASKSIFQRYDELATRAALGNIPNFRWCKSAKCSSGQIDDVRCVRF---KCKA 486

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQ--LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
           C    C  HDVPWHSG TC +++++   + +D  A+ A   + +K+CP+C  ++ K  GC
Sbjct: 487 CKTSHCIKHDVPWHSGETCEEYDKRNVQKKKDERASEAEIIKSSKKCPSCNKAVHKFSGC 546

Query: 181 DHMSCRCGYEFCWLCLGDYENIRTHGNHY--HAPTCQYYAP 219
           +H++C C +E+C++CL  ++    HG  Y  H P C    P
Sbjct: 547 NHITCICSHEWCYICLAPFQR-NEHGFLYCRHKPECTERDP 586



>gi|347840597|emb|CCD55169.1| hypothetical protein BofuT4_P159900.1 [Botryotinia fuckeliana T4]
          Length = 353

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/222 (40%), Positives = 130/222 (58%), Gaps = 13/222 (5%)

Query: 7   ECGVCCEDYSIIQ---QISSSCGHNDICSV-CIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           EC +C E+ ++     +I++ C H+  C + C+ + I A++ +   D Q+ CP+  CP  
Sbjct: 127 ECSICAEELALANFPNRITTGCVHDSSCCLTCLSQSIGAQIETVQWD-QISCPE--CPEL 183

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           L++E+V+  AS+  F+RYD   L   I   P+F  C    CG+GQ H  GD  PI+TCG+
Sbjct: 184 LSFENVKTFASEGDFDRYDKNALLSYISNDPNFTNCLGPNCGAGQIHQDGDAQPIMTCGS 243

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHER----HTKQCPNCYMSIEKND 178
           C  K+CF H +PWH+GLTC Q + + Q E  +      +R     TK+CP+C + I KN 
Sbjct: 244 CDFKTCFIHKMPWHTGLTCAQHDAR-QREGASKQEQKSQRLIKKATKKCPSCDVPILKNK 302

Query: 179 GCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYAP 219
           GCDHM+C  C YEFCW+CL DYE I T  N  H   C +Y P
Sbjct: 303 GCDHMTCTHCDYEFCWICLADYELILTTSNAAHDSKCAHYRP 344



>gi|169596360|ref|XP_001791604.1| hypothetical protein SNOG_00938 [Phaeosphaeria nodorum SN15]
 gi|111071313|gb|EAT92433.1| hypothetical protein SNOG_00938 [Phaeosphaeria nodorum SN15]
          Length = 515

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 124/222 (55%), Gaps = 16/222 (7%)

Query: 10  VCCEDYSIIQQISS--SCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           + C D  +I +  S   C H    C+VC    I  +L   G   + RCP+++C  +L Y 
Sbjct: 297 IVCGDSILINEFPSLAKCEHIPQTCAVCYSTWIARQLEDSGWK-EARCPENKCKTKLEYY 355

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           ++++  + E+F+R+D ++ R AI + P+F WC+   CGSGQ H +G    I TC ACG K
Sbjct: 356 EIQQTITPEVFQRFDDMMARNAIGEDPNFEWCR--NCGSGQIHMSGVEGNIFTCAACGHK 413

Query: 127 SCFTHDVPWHSGLTCTQF-------NEQLQTEDFTANRAYHERHTKQCP--NCYMSIEKN 177
            C  H   WH G TC  +        E+ Q     A+     R +K+CP  NC  +IEKN
Sbjct: 414 MCIVHKNTWHEGETCEDYEYRSSGRKERDQKAQEAASLKAIGRMSKKCPGPNCIYNIEKN 473

Query: 178 DGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           DGCDHM+C RC YEFCW+CL DY  +RT GN  HA  C Y+A
Sbjct: 474 DGCDHMTCSRCSYEFCWVCLCDYNEVRTRGNSAHARNCNYHA 515



>gi|353239290|emb|CCA71207.1| hypothetical protein PIIN_05143 [Piriformospora indica DSM 11827]
          Length = 778

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 128/225 (56%), Gaps = 15/225 (6%)

Query: 7   ECGVCC--EDYSIIQQISS--SCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC VC   ED   I  + +  +C H ++ C  C++R IE  +++      + CP   C  
Sbjct: 74  ECVVCGSGEDEVAIPTMPATDACEHESETCLDCLRRIIETSISTGAFISGIPCPSLGCGQ 133

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            +TY DV++ A  E+F+RYDTLL + ++R    + WC +  C +GQEHT G+   I+TC 
Sbjct: 134 TMTYFDVQKWAEPEIFQRYDTLLFQNSLRSDSTWVWCVSPNCEAGQEHTGGEASNIVTCH 193

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQT----EDFTANRAYHERHTKQCPNCYMSIEKN 177
           ACG+K CF H   WH G++C Q+++QL      E +T      E  TK CPNC   I KN
Sbjct: 194 ACGSKMCFRHQSIWHEGMSCAQWDDQLAIAEHGERWTDEWILTE--TKGCPNCKARILKN 251

Query: 178 DGCDHMSCR----CGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           +GCDHM+C+    CG++FCW CL  ++ I    N  H   C+YYA
Sbjct: 252 EGCDHMTCKKPGGCGHQFCWECLAPWDEIVRIDNSRHYDNCRYYA 296



>gi|512200864|gb|EPE29696.1| RING/U-box [Glarea lozoyensis ATCC 20868]
          Length = 527

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 83/204 (40%), Positives = 117/204 (57%), Gaps = 14/204 (6%)

Query: 22  SSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
           S +C H  ++C+ C+  HI  ++  +   +++ CP    P+   Y+ V+  AS E F+R+
Sbjct: 309 SETCAHEINVCTDCLTAHIGTQI--RESPLRILCPGCSEPV--GYQVVKTYASSEEFDRF 364

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLT 140
           + L L  A +  P F  C    C SGQ H  G+  PI+ C +C  K+CF H +PWHSG T
Sbjct: 365 ERLGLMEAFKDDPSFIMCLGPNCDSGQLHEGGENEPIMECNSCHFKTCFVHKLPWHSGQT 424

Query: 141 CTQFN----EQLQTEDFTANRAYHERHTKQCPN--CYMSIEKNDGCDHMSC-RCGYEFCW 193
           C +++    E+L  E   A     +R TK CPN  C + + K  GCDHM+C RC +EFCW
Sbjct: 425 CEEYDLDRKEKLDQE--AATNELLQRETKTCPNKSCGLHVMKISGCDHMTCHRCRFEFCW 482

Query: 194 LCLGDYENIRTHGNHYHAPTCQYY 217
           LCL  Y+ IR HGNHYH   C+YY
Sbjct: 483 LCLAPYQAIRAHGNHYHEKNCRYY 506



>gi|452988826|gb|EME88581.1| hypothetical protein MYCFIDRAFT_159791 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 219

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 121/208 (58%), Gaps = 16/208 (7%)

Query: 22  SSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
           + SC H+ + C  C++  + +E +SKG +  ++CP+  CP +++YED++RLAS+E FE+Y
Sbjct: 4   TESCEHDSLTCKECMQSWLSSEFDSKGAE-SIKCPE--CPSQVSYEDMQRLASEETFEKY 60

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLT 140
           + +L R A+  LP+F WC A  C SGQ +     F  + C +C  K C TH  PWH G T
Sbjct: 61  EKILTRNALSSLPEFSWCLASGCTSGQLNAENANF--MDCVSCHYKQCLTHKCPWHVGET 118

Query: 141 CTQF----NEQLQTEDFTANRAYHERHTKQCPN-----CYMSIEKNDGCDHMSCR-CGYE 190
           C Q+    + Q   ++  A  A  +  +K CP      C   I+K DGCDHM+CR C +E
Sbjct: 119 CDQYTYRTSGQKSKDEDAATEAMLDTVSKSCPGPKGKACGWRIQKIDGCDHMTCRSCKHE 178

Query: 191 FCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           FCW CL  +  I+  GN  H   C++++
Sbjct: 179 FCWECLASHREIKEVGNTAHEEWCKFHS 206



>gi|85114236|ref|XP_964661.1| hypothetical protein NCU11208 [Neurospora crassa OR74A]
 gi|16945411|emb|CAC10096.2| conserved hypothetical protein [Neurospora crassa]
 gi|28926451|gb|EAA35425.1| predicted protein [Neurospora crassa OR74A]
          Length = 702

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 127/220 (57%), Gaps = 14/220 (6%)

Query: 8   CGVCCEDYSI---IQQISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           C VC +  ++     +I+S C H   IC+ C+ + I +EL +K  D +++CP+  CP  L
Sbjct: 366 CSVCLDSKNLSLMAYKITSGCNHKPTICNACLSQWIASELETKMWD-RIKCPE--CPKSL 422

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
            + DV+R ASK +F RYD L  R A+  +P+FRWCK+ KC SGQ      R     C AC
Sbjct: 423 EFADVQRNASKTVFRRYDELATRAALGNIPNFRWCKSSKCNSGQIDDV--RCVRFKCKAC 480

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQ--LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
               C  HDVPWHSG TC +++++   + +D  A+ A   + +K+CP+C  ++ K  GC+
Sbjct: 481 KNSHCIKHDVPWHSGETCEEYDKRNTQKKKDERASEAEITKSSKKCPSCNKAVHKFSGCN 540

Query: 182 HMSCRCGYEFCWLCLGDYENIRTHGNHY--HAPTCQYYAP 219
           H++C C +E+C++CL  ++    HG  Y  H P C    P
Sbjct: 541 HITCICSHEWCYVCLAPFQR-NEHGFLYCRHKPECTERDP 579



>gi|402222074|gb|EJU02141.1| hypothetical protein DACRYDRAFT_107078 [Dacryopinax sp. DJM-731
           SS1]
          Length = 305

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 117/203 (57%), Gaps = 15/203 (7%)

Query: 2   TETTLECGVCCEDYSIIQ----QISSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPK 56
           TE    C VC ED    +    +++S+C H+ + C  C++++++ ++   G + ++ CP 
Sbjct: 105 TEVIHTCQVCAEDLPTDKYSRYKLASNCQHSSVVCRRCVRQYLKNQIEELG-NTRLLCPV 163

Query: 57  SRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEH--TTGDR 114
             C  E++Y  V+R A   +F+RYD LLLR  +   P+F WCK  KC SGQ H    G  
Sbjct: 164 PECRAEISYHRVKRYARSRVFQRYDALLLRKNLGADPNFIWCKNPKCDSGQVHDGIEGGS 223

Query: 115 FPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDF--TANRAYHERHTKQCPNCYM 172
             IITC  CG+K+C  HD PWH GLTC Q++++   +     A  AY  ++TKQCP C  
Sbjct: 224 V-IITCVKCGSKACSFHDAPWHEGLTCAQYDQRKMDKQGREAAVEAYFSKNTKQCPKCNA 282

Query: 173 SIEKNDGCDHMSCR----CGYEF 191
            IEK  GCDHM+CR    CG++ 
Sbjct: 283 PIEKISGCDHMTCRPPGGCGFQL 305



>gi|406859161|gb|EKD12230.1| ring finger protein [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 352

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 121/222 (54%), Gaps = 13/222 (5%)

Query: 6   LECGVCCEDYSI--IQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           +EC VC E +    +  ++S C H   +C  CI + I+A++     D Q++CP   CP  
Sbjct: 96  VECCVCMELFHSDHLPAVTSVCTHEPKVCPDCIAQSIDAQIPQVAWD-QIQCPV--CPEP 152

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           L +++V++ AS E FE+YD   L    R  P    C    C SGQ H      PI+TC  
Sbjct: 153 LPFDEVKKWASTEAFEQYDKKSLMSVFRNFPSLIMCLGPGCDSGQIHDGEHDQPIMTCNN 212

Query: 123 CGAKSCFTHDVPWHSGLTCTQFN---EQLQTEDFTANRAYHERHTKQC--PNCYMSIEKN 177
           C  K+C+TH +PWHSG TC  +    E+   ++  ++R   E  TK C  P C   IEKN
Sbjct: 213 CQFKTCYTHKMPWHSGQTCAGYEYEREKRMAQEAASDRVIAET-TKVCGNPECGARIEKN 271

Query: 178 DGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
            GCDHM+C+ C Y+FC+LCL  Y+ I   GN  HA  C Y++
Sbjct: 272 GGCDHMTCKVCLYQFCYLCLAPYKRIMAEGNTAHAENCVYHS 313



>gi|336463470|gb|EGO51710.1| hypothetical protein NEUTE1DRAFT_125372 [Neurospora tetrasperma
           FGSC 2508]
 gi|350297313|gb|EGZ78290.1| hypothetical protein NEUTE2DRAFT_80699 [Neurospora tetrasperma FGSC
           2509]
          Length = 702

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 128/221 (57%), Gaps = 16/221 (7%)

Query: 8   CGVCCEDYSI---IQQISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           C VC +  ++     +I+S C H   IC+ C+ + I +EL +K  D +++CP+  CP  L
Sbjct: 366 CSVCLDSKNLSLMAYKITSECNHKPTICNACLSQWIASELETKMWD-RIKCPE--CPKSL 422

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQ-EHTTGDRFPIITCGA 122
            + DV+R ASK +F RYD L  R A+  +P+FRWCK+ KC SGQ +     RF    C A
Sbjct: 423 EFADVQRNASKSVFRRYDELATRAALGNIPNFRWCKSSKCNSGQIDDVRCVRF---KCKA 479

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQ--LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
           C    C  HDVPWHSG TC +++++   + +D  A+ A   + +K+CP C  ++ K  GC
Sbjct: 480 CKNSHCIKHDVPWHSGETCEEYDKRNTQKKKDERASEAEITKSSKKCPLCNKAVHKFSGC 539

Query: 181 DHMSCRCGYEFCWLCLGDYENIRTHGNHY--HAPTCQYYAP 219
           +H++C C +E+C++CL  ++    HG  Y  H P C    P
Sbjct: 540 NHITCICSHEWCYICLAPFQR-NEHGFLYCRHKPECTERDP 579



>gi|347835544|emb|CCD50116.1| hypothetical protein BofuT4_P025150.1 [Botryotinia fuckeliana T4]
          Length = 451

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 130/223 (58%), Gaps = 25/223 (11%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC +C E+ +  +    +I+S+C H+  +CS C+ +HI  ++ ++  + QV CP+  C  
Sbjct: 122 ECRICMENLTPEKFPQTRITSTCAHHPAVCSRCLTKHIHDQVQTRASN-QVSCPE--CQE 178

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           +++  ++++   +         LL ++++ LP+F +C + KC SGQ HT G   P++TC 
Sbjct: 179 KVSDAEIKKNGRR---------LLNMSLQHLPNFTFCLSPKCESGQIHT-GPDHPMMTCT 228

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFN--EQLQTEDFTANRAYHERHTKQCPN--CYMSIEKN 177
            CG K+CF H +PWH  LTC +F+   Q +     A+ A+   HTK CPN  C M I+K 
Sbjct: 229 TCGFKTCFIHKLPWHEDLTCAEFDLFNQARVRQEAASAAWIAEHTKLCPNPKCGMRIQKK 288

Query: 178 DGCDHMSCRCGY---EFCWLCLGDYENIRTHGNHYHAPTCQYY 217
            GCDH++C C Y   EFCW C  D++ I+  GN +H   C+++
Sbjct: 289 TGCDHLTCECDYCLSEFCWCCFADFKMIKKRGNDHHKEDCRWH 331



>gi|340923824|gb|EGS18727.1| hypothetical protein CTHT_0053350 [Chaetomium thermophilum var.
            thermophilum DSM 1495]
          Length = 1731

 Score =  142 bits (358), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 79/240 (32%), Positives = 115/240 (47%), Gaps = 33/240 (13%)

Query: 4    TTLECGVCCE----DYSIIQQISSSCGHNDI-------------CSVCIKRHIEAELNSK 46
            +T  CG C E    D  ++ +I+S+C H +I             C  C++  + A  + +
Sbjct: 1236 STATCGTCLEEKTNDEFLLGKITSTCRHEEIDILDNTIEDRHRICRDCLQGWLRAR-SDR 1294

Query: 47   GGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG 106
             G    RCP + C   L+Y D R+  ++++F+RYD L+LR  + +L +F WC    C SG
Sbjct: 1295 WGSSPPRCPITGCNQVLSYTDARKHMTEDVFQRYDYLVLRTTLGQLDEFVWCLNPDCQSG 1354

Query: 107  QEH-TTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTK 165
            Q H    +  P   CG C  + C TH +PWH G TC +F+ +         R   E   +
Sbjct: 1355 QLHYPEAEWCPEFQCGGCQRRYCLTHRMPWHEGQTCEEFDRRTHGR----RRDDSEAEGR 1410

Query: 166  QCPNCYMSIEKNDGCDHMSCRCGYEFCWLCLGDY------ENIRTHGNHYHAPTCQYYAP 219
             CP C   I K  GCDHM+C CG EFC+ C   Y      +  RT     H P C ++ P
Sbjct: 1411 SCPRCKKRIYKEIGCDHMTCVCGQEFCYQCGALYPPTLPGQIART----THFPNCPHFEP 1466



>gi|353237414|emb|CCA69387.1| hypothetical protein PIIN_03287 [Piriformospora indica DSM 11827]
          Length = 343

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 121/231 (52%), Gaps = 19/231 (8%)

Query: 4   TTLECGVCCEDYSIIQQISSS----CGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSR 58
           T  EC VC E    +   SS     C H  ++C  C+ + +   +  +G    +RCP + 
Sbjct: 89  TRRECTVCRESDLDVAFGSSPPTDRCLHQPEVCMDCLSQTLRTAIMGEGNVKTLRCPSAE 148

Query: 59  CPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPII 118
           C   L Y++V R A     ERY+ LL +  +R+   +  C    CG+ Q H   + FPI+
Sbjct: 149 CKELLEYDEVYRWADLATLERYEELLTQAMLREEAGYVTCIDPACGASQVHGGENIFPIV 208

Query: 119 TCGACGAKSCFTHDVPW--HSGLTCTQFN----EQLQTEDFTANRAYHERHTKQC--PNC 170
           TC  CG +SC+ H VPW  H G  C +++     + Q E+ +  R + +  TK+C  P C
Sbjct: 209 TCWKCGKRSCWKHRVPWEDHEGFNCREWDTKDERRAQAEELS--REWVQEQTKRCPAPGC 266

Query: 171 YMSIEKNDGCDHMSCR----CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
              I+K +GCDHM+CR    CG+EFCW+CL  YE IR  G   H P C+YY
Sbjct: 267 NRPIKKEEGCDHMTCRRPGGCGFEFCWVCLAPYEPIREFGCEKHEPFCRYY 317



>gi|482813689|gb|EOA90380.1| hypothetical protein SETTUDRAFT_103320 [Setosphaeria turcica Et28A]
          Length = 312

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 129/242 (53%), Gaps = 29/242 (11%)

Query: 4   TTLECGVCCEDYSI--IQQISSSCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           +  EC VC     I    Q++S C H  D+C  C    ++ ++ +   +  + CP S C 
Sbjct: 62  SVRECAVCLVSAPIQDFPQLAS-CNHIPDVCHDCFFEWLDQKMATHDTN-SIACPSSDCE 119

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
             + ++DV++ AS E+F R+D L +R  +   P+F +C A  C SGQ H++G   PI  C
Sbjct: 120 ALIIHQDVQKYASPEVFARFDELSMRSLLSTDPEFLYCPAVGCNSGQIHSSGVEGPIFRC 179

Query: 121 GACGAKSCFTHD--VPWHSGLTCTQFNEQLQTEDF----------------TANRAYHER 162
            ACG + C  H   +P+H   +CTQ+NE+++ E                   A+ A  +R
Sbjct: 180 AACGYRICTAHTPMIPFHENESCTQYNERIEIEKLECGTKKERALVRKKQDEASIALLKR 239

Query: 163 HTKQCPNCYMSIEKNDGCDHMSCR---CGYEFCWLCLGDY---ENIRTHGNHYHAPTCQY 216
            T++CP C   IEK  GCDHM+C    CG+EFC++C   Y     IRT GN  HAP+C++
Sbjct: 240 ETRECPGCGSYIEKIHGCDHMTCTRKGCGFEFCYICRAPYAGARGIRTVGNLAHAPSCRH 299

Query: 217 YA 218
           ++
Sbjct: 300 HS 301



>gi|472242631|gb|EMR87318.1| putative ring finger protein [Botryotinia fuckeliana BcDW1]
          Length = 482

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 129/221 (58%), Gaps = 23/221 (10%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC +C E+ +  +    +I+S+C H+  +CS C+ +HI  ++ ++  + QV CP+  C  
Sbjct: 122 ECRICMENLTPEKFPQTRITSTCAHHPAVCSRCLTKHINDQVQTRASN-QVSCPE--CQE 178

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           +++  ++++   +         LL ++++ LP+F +C + KC SGQ HT G   P++TC 
Sbjct: 179 KVSDAEIKKNGRR---------LLNMSLQHLPNFTFCLSPKCESGQIHT-GPDHPLMTCT 228

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFN--EQLQTEDFTANRAYHERHTKQCPN--CYMSIEKN 177
            CG K+CF H +PWH  LTC +F+   Q +     A+ A+   HTK CPN  C M I+K 
Sbjct: 229 TCGFKTCFIHKLPWHEDLTCAEFDLFNQARVRQEAASEAWIAEHTKLCPNPKCGMRIQKK 288

Query: 178 DGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
            GCDH++C  C  EFCW C  D++ I+  GN +H   C+++
Sbjct: 289 TGCDHLTCDYCLSEFCWCCFADFKMIKKRGNDHHKEDCRWH 329



>gi|154305743|ref|XP_001553273.1| hypothetical protein BC1G_07686 [Botryotinia fuckeliana B05.10]
          Length = 528

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 129/221 (58%), Gaps = 23/221 (10%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC +C E+ +  +    +I+S+C H+  +CS C+ +HI  ++ ++  + QV CP+  C  
Sbjct: 122 ECRICMENLTPEKFPQTRITSTCAHHPAVCSRCLTKHINDQVQTRASN-QVSCPE--CQE 178

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           +++  ++++   +         LL ++++ LP+F +C + KC SGQ HT G   P++TC 
Sbjct: 179 KVSDAEIKKNGRR---------LLNMSLQHLPNFTFCLSPKCESGQIHT-GPDHPMMTCT 228

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFN--EQLQTEDFTANRAYHERHTKQCPN--CYMSIEKN 177
            CG K+CF H +PWH  LTC +F+   Q +     A+ A+   HTK CPN  C M I+K 
Sbjct: 229 TCGFKTCFIHKLPWHEDLTCAEFDLFNQARVRQEAASEAWIAEHTKLCPNPKCGMRIQKK 288

Query: 178 DGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
            GCDH++C  C  EFCW C  D++ I+  GN +H   C+++
Sbjct: 289 TGCDHLTCDYCLSEFCWCCFADFKMIKKRGNDHHKEDCRWH 329



>gi|353237475|emb|CCA69447.1| related to RING finger protein, putative-Penicillium marneffei
           [Piriformospora indica DSM 11827]
          Length = 460

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 104/199 (52%), Gaps = 12/199 (6%)

Query: 7   ECGVCCEDYSIIQQI------SSSCGHN--DICSVCIKRHIEAELNSKGGDVQVRCPKSR 58
           EC VC E +     I      ++ C H   DIC  C+   I A +  +G  + V CP S 
Sbjct: 241 ECQVCGESFGTENVIRPTRLPTTKCEHVTVDICKSCLASTIAAHMEDRGVAIPVLCPYSG 300

Query: 59  CPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPD-FRWCKAQKCGSGQEHTTGDRFPI 117
           CP  LT +D++  A+ +++ R+D L LR  +R     F WC+   C SGQ H  G   PI
Sbjct: 301 CPCTLTKDDIKEAATSDVYARWDMLSLREMMRSDQGLFVWCQNPACFSGQLHPEGASQPI 360

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDF---TANRAYHERHTKQCPNCYMSI 174
           +TC  C  ++CF H + +H G TC Q+++    +D     ANRA     T+ CP C+  I
Sbjct: 361 VTCVRCSVQTCFNHCIVYHEGKTCAQYDKSRPLKDVINRAANRATIWWKTRSCPGCFQPI 420

Query: 175 EKNDGCDHMSCRCGYEFCW 193
            KN GC HM CRCGY F W
Sbjct: 421 SKNGGCRHMRCRCGYNFTW 439



>gi|156031146|ref|XP_001584898.1| hypothetical protein SS1G_14181 [Sclerotinia sclerotiorum 1980]
 gi|154700572|gb|EDO00311.1| hypothetical protein SS1G_14181 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 487

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 130/239 (54%), Gaps = 32/239 (13%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC +C E  +  +    +I+S+C H+  +C  C+ +HI  ++ +K  D ++ CP+  CP 
Sbjct: 121 ECRICMETLAPEKFPQRRIASTCAHHPAVCCQCLTKHINIQVQTKASD-KILCPE--CPE 177

Query: 62  ELTYEDVRRLASKELFERYDTLLLRV------------------AIRKLPDFRWCKAQKC 103
           +++  +++  AS E+ ER  TL + V                  +++ LP+F +C    C
Sbjct: 178 KVSDAEIKSYASPEVLERQYTLFISVITILTYKPNRKGRRTFIMSLQHLPNFTFCLNPTC 237

Query: 104 GSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFN--EQLQTEDFTANRAYHE 161
            SGQ H + D+ P++TC  C  K+CF H +PWH  LTC +F+   Q++     A+ A+  
Sbjct: 238 ESGQIHKSADQ-PMMTCTTCNFKTCFIHKLPWHEDLTCAEFDIFNQVRVRQEAASEAWIT 296

Query: 162 RHTKQCPN--CYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
           +H + CPN  C M I+K  GCDH+ C  C +EFCW C  D+  I+  GN  H   CQ++
Sbjct: 297 QHARLCPNPECGMRIQKKTGCDHLVCDYCLFEFCWCCCADFRAIKRQGNDGHKVDCQWH 355



>gi|353239291|emb|CCA71208.1| hypothetical protein PIIN_11690 [Piriformospora indica DSM 11827]
          Length = 1044

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 112/198 (56%), Gaps = 15/198 (7%)

Query: 7   ECGVCC--EDYSIIQQI--SSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC VC   ED   I  +  + +C H  +IC  C+KR IE  +++      + CP   C  
Sbjct: 530 ECIVCGSDEDDVAIPNVPATGACDHPPEICVDCLKRIIETSISTGAFISGIPCPSIGCGQ 589

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            +TY DV++ A  ++F+RYDTLL + ++R    + WC +  C +GQEHT GD   I+TC 
Sbjct: 590 IMTYFDVQKWAETKVFQRYDTLLFQNSLRSDSTWVWCVSPSCEAGQEHTGGDASNIVTCH 649

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQL----QTEDFTANRAYHERHTKQCPNCYMSIEKN 177
           ACG+K CF H   WH G++C Q++EQL      E +T      E  TK CP C   I KN
Sbjct: 650 ACGSKMCFRHQSAWHEGMSCAQWDEQLLIAEHGERWTDEWILTE--TKGCPKCKARILKN 707

Query: 178 DGCDHMSCR----CGYEF 191
           +GCDHM+CR    CG+E 
Sbjct: 708 EGCDHMTCRRPGGCGHEL 725



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 73/150 (48%), Gaps = 20/150 (13%)

Query: 7   ECGVCCED--YSIIQQISSSCGHN-DICSVCIKRHIEAEL---NSKGGDVQVRCPKSRCP 60
           EC VC ++  Y      +S C H  ++CS C+ R I+  +   N  G   Q+RCP   C 
Sbjct: 155 ECLVCRDEPQYFPKDPPTSHCSHAPEVCSACLGRTIQEAVKHGNYNGDGTQIRCPSYNCD 214

Query: 61  IELTYEDVRRLASKELFE---RYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPI 117
             + Y ++R+ A  ++ E   R D L +R           C   KC +GQ HT     PI
Sbjct: 215 QWMGYLEIRQWAPNDVCEKSLRSDALFVR-----------CVNPKCSAGQVHTEKGNNPI 263

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQFNEQ 147
           + C +C    CF H + WH+G TC Q+++Q
Sbjct: 264 VICYSCRKSQCFNHRIEWHAGYTCKQWDKQ 293



>gi|406866348|gb|EKD19388.1| ring finger protein [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 708

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 123/224 (54%), Gaps = 19/224 (8%)

Query: 3   ETTLECGVCCEDYSIIQ----QISSSCGHND---ICSVCIKRHIEAELNSKGGDVQVRCP 55
           +  +EC VC  DY   +    +I+S+C H+    +C  CI+  I+  L ++G    +RCP
Sbjct: 398 DNAIECCVCAGDYGPDKFPESEITSTCEHHSKAMVCLRCIRFSIQTFL-AQGNLHLIRCP 456

Query: 56  KSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRF 115
              CP  L+ +++++  +KE+F RY+ L+        P    C +  CG GQ H +    
Sbjct: 457 L--CPAMLSKDEIKKYGTKEMFSRYEYLVQMAT----PGLVMCLSPSCGMGQVHPSNADN 510

Query: 116 PIITCGACGAKSCFTHDVPWHSGLTCTQFN-EQLQTEDFTANRAYHERHTKQ----CPNC 170
           PI+TC  CG ++C TH +PWH G TC +F+ E+ Q E   A+ A  +  ++Q    CP+C
Sbjct: 511 PIMTCDTCGFRTCVTHKLPWHEGFTCAEFDLEESQIERLEADEATAKLLSQQDSRICPSC 570

Query: 171 YMSIEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTC 214
              + + +GCDH+ CRCG ++C+ C   +ENI   G   HA TC
Sbjct: 571 NQGVTRTEGCDHLQCRCGQQWCFECQAAWENILRLGPTAHARTC 614



>gi|452838947|gb|EME40887.1| hypothetical protein DOTSEDRAFT_74442 [Dothistroma septosporum
           NZE10]
          Length = 233

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 111/200 (55%), Gaps = 10/200 (5%)

Query: 22  SSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
           +S C H    C  C    +++++ S   + ++ C +  C   L   D+++LA+   ++ Y
Sbjct: 25  ASGCTHERQTCRKCWHEWLKSQVASASAN-KISCIQ--CSNILVQSDIQKLATVSTYKAY 81

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLT 140
           +   L+  + + PDFRWC A  C SGQ H  GD   I TC +CG K+C   +V WHS  T
Sbjct: 82  EDASLKSVLSQDPDFRWCFATDCKSGQIHDGGD---IFTCSSCGYKACVHCNVAWHSEET 138

Query: 141 CTQFNEQLQTEDFTANRAYH--ERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCWLCLG 197
           C  +  ++Q ++     +    ++  K CPNC   ++KN GCDHM+C+ C +EFCW+CL 
Sbjct: 139 CETYTGRVQAQNLNEASSARTLQKVAKLCPNCSRKLQKNGGCDHMTCQLCRHEFCWICLV 198

Query: 198 DYENIRTHGNHYHAPTCQYY 217
           DY  IR  GN +H   CQ+Y
Sbjct: 199 DYAGIRREGNSHHKSNCQHY 218



>gi|396470291|ref|XP_003838608.1| hypothetical protein LEMA_P115440.1 [Leptosphaeria maculans JN3]
 gi|312215176|emb|CBX95129.1| hypothetical protein LEMA_P115440.1 [Leptosphaeria maculans JN3]
          Length = 511

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 111/206 (53%), Gaps = 17/206 (8%)

Query: 8   CGVCCEDYSIIQQIS-SSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           C V  E YSI    + S+C H+ + C+ C +R + A+L       + RCP+  C   LTY
Sbjct: 265 CVVDGEAYSITSMPTLSACSHDPNYCAECYQRWLTAQLEDSSWH-EARCPEHGCNAILTY 323

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITCGACG 124
            ++++ AS+E FE YD  L R A+ + PDFRWC+A  C SGQ H  G     I TC ACG
Sbjct: 324 PEIQQHASQESFELYDKFLTRAALNQDPDFRWCRA--CESGQVHDGGGVENNIFTCVACG 381

Query: 125 AKSCFTHDVPWHSGLTCTQFN---EQLQTEDFTANRAYHERHTKQC------PNCYMSIE 175
            K C  H+  WH   TC ++     + Q  D  A          QC      P C  +IE
Sbjct: 382 DKVCILHNT-WHEDETCREYEYRASEQQQRDRNAQEEASLAAIAQCSKKCPGPGCEYNIE 440

Query: 176 KNDGCDHMSC-RCGYEFCWLCLGDYE 200
           KNDGCDHM+C  C Y+FCWLCL DYE
Sbjct: 441 KNDGCDHMTCSNCNYQFCWLCLCDYE 466



>gi|449296711|gb|EMC92730.1| hypothetical protein BAUCODRAFT_59502, partial [Baudoinia
           compniacensis UAMH 10762]
          Length = 200

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (54%), Gaps = 12/196 (6%)

Query: 30  ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAI 89
            C  C++  + +E ++KG D  ++CP+  CP  L Y DV   AS+  F+ YD +    A+
Sbjct: 7   TCKECLESWMASEFDTKGTD-GIKCPE--CPETLEYADVLLAASEATFQAYDRISTLNAL 63

Query: 90  RKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFN---- 145
             L DF WC   KC SGQ +   + F  + C +CG K C  H VPWH+G TC Q++    
Sbjct: 64  SALDDFAWCLGPKCDSGQLNPENNHF--MDCASCGYKQCLKHKVPWHTGETCDQYDYRTS 121

Query: 146 EQLQTEDFTANRAYHERHTKQCP--NCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYENI 202
            Q   ++     A  +  +K+CP  NC   I+K DGCDHM+CR C +EFCW CL     I
Sbjct: 122 GQQARDEEARTEAMLDSVSKRCPGVNCGWRIQKTDGCDHMTCRKCKHEFCWQCLAAQTEI 181

Query: 203 RTHGNHYHAPTCQYYA 218
           R  GN  H   C++++
Sbjct: 182 RRIGNTAHQTWCKFHS 197



>gi|402074860|gb|EJT70331.1| hypothetical protein GGTG_11359 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 603

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 110/207 (53%), Gaps = 18/207 (8%)

Query: 7   ECGVCCEDYSIIQ---QISSSCGHN--DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC VC +  +I     +I+  C H     C  C++R IE+ L     D ++RCP+  CP 
Sbjct: 336 ECAVCGDKKTIADMPLRITERCEHARPGTCKDCLRRWIESSLADTVWD-RLRCPE--CPQ 392

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFP----- 116
            LT+ DVRR AS  +F RYD L LR A+ ++  FRWC A  CGSGQ H +  R P     
Sbjct: 393 LLTHADVRRWASSPVFARYDGLALRAALGEMRHFRWCLA-GCGSGQIHVSRPRSPPSSCK 451

Query: 117 --IITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYH--ERHTKQCPNCYM 172
             +  C  C A+ C  HDVPWH G TC  F+ + +       R      +  K CP C  
Sbjct: 452 PEVFRCHVCHARQCTVHDVPWHRGETCADFDLRARRRLRDDLRTREAVSKMAKACPGCLR 511

Query: 173 SIEKNDGCDHMSCRCGYEFCWLCLGDY 199
            + K+ GC+H++C CG+E+C++C   Y
Sbjct: 512 DVHKHSGCNHITCLCGHEWCYMCFAPY 538



>gi|320586883|gb|EFW99546.1| ring finger protein [Grosmannia clavigera kw1407]
          Length = 682

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 121/224 (54%), Gaps = 31/224 (13%)

Query: 1   MTETTLECGVCCEDYSIIQ---QISSSC----GHND-----ICSVCIKRHIEAELNSKGG 48
           +TET   C +C ED ++ +   +I+++C     H+      +C  C+   I + L     
Sbjct: 413 LTET---CMICLEDKAVTEMPHRITAACLRHANHSQRHTPTLCKPCLAEWIGSSLKGSVW 469

Query: 49  DVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVA-IRKLPDFRWCKAQKCGSGQ 107
           + ++RCP+  CP  L+Y DVR  A+  +FERYDTL  R A + + P+FRWC A  C +GQ
Sbjct: 470 N-RLRCPE--CPARLSYADVRLYATPSVFERYDTLATRAALVSEFPNFRWCLAVGCEAGQ 526

Query: 108 EHTTGDRF----------PIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQT--EDFTA 155
            H    R           P   C AC A  C  H++PWHS  TC Q++ + Q   +D   
Sbjct: 527 IHGPASRSASARSVEEECPKFRCHACRATHCIRHNIPWHSSETCAQYDARTQRRRQDNRK 586

Query: 156 NRAYHERHTKQCPNCYMSIEKNDGCDHMSCRCGYEFCWLCLGDY 199
           + A+ +  +KQCP C  ++ K  GC+H+SC CG+E+C++C   +
Sbjct: 587 SEAFVQETSKQCPGCNKAVFKYSGCNHISCICGHEWCYICFAPF 630



>gi|475674868|gb|EMT71948.1| Putative E3 ubiquitin-protein ligase ARI7 [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 650

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (54%), Gaps = 7/198 (3%)

Query: 19  QQISSSCGHN-DICSVCIKRHIEAELNSKG--GDVQVRCPKSRCPIELTYEDVRRLASKE 75
           +++   C H  D C+ C++ +IEA+L+  G  G   + CP S C   L Y++V+  A +E
Sbjct: 394 RKLEQRCSHTVDFCTECLENYIEAQLDQHGRAGCHLLTCPSSDCGRRLEYDEVKLYARQE 453

Query: 76  LFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPW 135
            F +YD  L   A+  LP FRWC A+ C  GQ H   +    ++C  CG + CF H + W
Sbjct: 454 TFSKYDKYLTLEALSNLPSFRWCLAENCSYGQIHDLIESNH-VSCEECGYEMCFEHQIKW 512

Query: 136 HSGLTCTQFNEQLQTED--FTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFC 192
           H  LTC +F+   +  D  F   R +   +TKQCP+C ++ +K  GC HM+C  C +EFC
Sbjct: 513 HDDLTCGEFDSMEKNGDPRFRETRDWVNANTKQCPSCGVNTQKGPGCFHMTCTLCRHEFC 572

Query: 193 WLCLGDYENIRTHGNHYH 210
           W CL  + +I      Y+
Sbjct: 573 WECLASWSDIMPRPGQYN 590



>gi|494832224|gb|EON68538.1| hypothetical protein W97_07796 [Coniosporium apollinis CBS 100218]
          Length = 236

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 107/196 (54%), Gaps = 12/196 (6%)

Query: 1   MTETTLECGVCCEDYSIIQQISS-SCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSR 58
           +   T  C VC +D  I +  +   C H    CS C +  I +E NSKG   ++ CP+S 
Sbjct: 41  LQAVTRNCVVCGDDTPISELPALLDCNHEPRTCSNCYQNWISSEFNSKGWK-RIACPESG 99

Query: 59  CPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPII 118
           C + L + +++  A+ E F+++DTL  R A+   P+FRWC+   C SGQ H  G   PI 
Sbjct: 100 CSVLLQHVELQAYATSEDFQKFDTLSAREAMNDEPNFRWCRGPSCTSGQIHYGGRSDPIF 159

Query: 119 TCGACGAKSCFTHDVPWHSGLTCTQFN-------EQLQTEDFTANRAYHERHTKQCP--N 169
           TC  CG K C  HD  WH G TC +++       EQ Q     A++   E+ TK+CP   
Sbjct: 160 TCSECGFKVCVVHDGTWHQGETCEEYDYRVSGRKEQDQRSQEQASQRLLEKLTKKCPGEG 219

Query: 170 CYMSIEKNDGCDHMSC 185
           C  +IEKNDGCDHM+C
Sbjct: 220 CNWNIEKNDGCDHMTC 235



>gi|302881601|ref|XP_003039711.1| hypothetical protein NECHADRAFT_85406 [Nectria haematococca mpVI
           77-13-4]
 gi|256720578|gb|EEU33998.1| hypothetical protein NECHADRAFT_85406 [Nectria haematococca mpVI
           77-13-4]
          Length = 848

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 109/207 (52%), Gaps = 19/207 (9%)

Query: 20  QISSSCGHN-DICSVCIKRHIEAELNSKGGDV--QVRCPKSRCPIELTYEDVRRLASKEL 76
           ++   C H+ D C+ C+++H++ +L   G     Q+ CP   C   L YE+VR  A  E 
Sbjct: 612 KLRIGCNHDIDFCTGCLEQHLKTQLEQYGRSRCDQLACPSDGCTRRLEYEEVRLYAEPET 671

Query: 77  FERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRF-PIITCGACGAKSCFTHDVPW 135
           FE YD  L   AI  L +FRWC  Q C +GQ +   D   P I C  C  + C+ H +PW
Sbjct: 672 FELYDRYLHLNAISSLENFRWCLRQGCPNGQLYDDDDETDPHIHCQECAFEMCYKHMIPW 731

Query: 136 HSGLTCTQFN--------EQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC-R 186
           H GLTC +F         +  QT+D+ AN      +TK CP+C  +I+K + C HM+C  
Sbjct: 732 HEGLTCEEFESARDHGDPQYQQTQDWIAN------NTKPCPSCNQNIQKGEACFHMTCSN 785

Query: 187 CGYEFCWLCLGDYENIRTHGNHYHAPT 213
           C +EFCW+CL D+  I      ++  T
Sbjct: 786 CHHEFCWICLADWAQITPRPGEHNPET 812



>gi|443917746|gb|ELU38402.1| IBR domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 486

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 119/229 (51%), Gaps = 24/229 (10%)

Query: 6   LECGVCCE--DYSIIQQISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           L C VC E  + S+  + ++SC H   IC  C+ + +   +   GG  +V CP   C  E
Sbjct: 148 LTCSVCLETMEPSVWIRPAASCAHEPRICEPCLVQLVVHAIQV-GGLTEVLCPDVGCRRE 206

Query: 63  LTYEDV-------RRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRF 115
           + YEDV       R L  ++  +  +T  LR+    +P+               T+    
Sbjct: 207 MDYEDVILCIQNDRPLLDRDSEKHGETSELRM----VPESDVLTGADPRQRGYATSAS-- 260

Query: 116 PIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPN--CYM 172
           P++ C  C A++CFTH V WH GLTC Q++ Q +  ++  AN  Y   HTK+CPN  C  
Sbjct: 261 PLVICRYCDARTCFTHQVLWHKGLTCRQYSIQAKRRQEIHANEEYIGAHTKRCPNPTCGR 320

Query: 173 SIEKNDGCDHMSCR----CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
            IEK  GCDHM+CR    CG+EFCW CL DY  IR  GNH H P C++Y
Sbjct: 321 PIEKAQGCDHMTCRKPGGCGHEFCWDCLADYGPIRLQGNHRHKPGCRHY 369



>gi|449295610|gb|EMC91631.1| hypothetical protein BAUCODRAFT_299438 [Baudoinia compniacensis
           UAMH 10762]
          Length = 235

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 111/210 (52%), Gaps = 18/210 (8%)

Query: 20  QISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFE 78
           +I+  C H  + C  C  + +  +L +K  D Q+ C  ++CP +L   D+R LA   ++ 
Sbjct: 20  KINEECQHERETCRRCWYQWLALQLETKQWD-QITC--AQCPTKLGQADIRALAKPAVYT 76

Query: 79  RYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSG 138
           +Y    +R  +     FRWC   +C SGQ H  GD   I TC +CG K+C   + PWH G
Sbjct: 77  KYLEAEIRGTMAAEESFRWCLNPECKSGQAHFDGD---IFTCASCGHKACVGCNAPWHEG 133

Query: 139 LTCTQFNEQLQ---------TEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CG 188
            TC  + +++           E+  + +A  ER  K CP C   +EKN GCDHM+C+ C 
Sbjct: 134 ETCEAYQDRINEGERKRRQVVEEQDSAKAV-ERVAKLCPACGRKLEKNGGCDHMTCQICR 192

Query: 189 YEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           +EFCW CL  Y  I T GN  H  +C+Y++
Sbjct: 193 HEFCWSCLAHYSPILTIGNSAHEESCRYHS 222



>gi|169615298|ref|XP_001801065.1| hypothetical protein SNOG_10806 [Phaeosphaeria nodorum SN15]
 gi|111061080|gb|EAT82200.1| hypothetical protein SNOG_10806 [Phaeosphaeria nodorum SN15]
          Length = 328

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 116/240 (48%), Gaps = 32/240 (13%)

Query: 7   ECGVCCEDYSIIQQISSSCG---HNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           +C +C + + I Q + S CG     ++C  C    +  E++S   D ++ CP S C   +
Sbjct: 75  DCSICADTFKI-QDLVSLCGCSHEPEVCQECFLGWLTQEMDSTAWD-RIACPSSVCEKMI 132

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
           ++EDVR  A  ++F R+D L +R  +     FR+C +  C SGQ H +G    I  C AC
Sbjct: 133 SHEDVRANAPADIFNRFDELSMRSFLSADAQFRYCLSPSCNSGQVHNSGAEGYIFRCVAC 192

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQL------------QTEDFTANRAYHERHTKQ----- 166
           G ++C  HD  +H G TC QF+E++            Q E+    R   ++   Q     
Sbjct: 193 GFRACTIHDAAFHEGETCGQFDERIKREEERQAEEDRQAEEERVARELRKQQEAQSEEEV 252

Query: 167 ------CPNCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYE---NIRTHGNHYHAPTCQY 216
                 CP C   I+K  GCDHM+CR C +EFC++C   Y     I   GN  H   C+Y
Sbjct: 253 KRCAMVCPGCQTPIQKISGCDHMTCRKCRFEFCYICRAPYNGPGGIHRIGNSAHVAGCRY 312



>gi|443917698|gb|ELU38358.1| IBR domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 488

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 104/203 (51%), Gaps = 27/203 (13%)

Query: 8   CGVCCEDYSIIQQISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           C VC E   +    +S+C H+  +C  C++RHIE  +  +G    V CP   C   L+YE
Sbjct: 250 CMVCFEPKPLTTIGTSNCAHDSRVCEECLERHIEISVCDRGF-TNVTCPLLSCNEILSYE 308

Query: 67  DV-------RRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
           D+         L+      RY+ LLLR A+  +P+F WCK  +C  GQ H          
Sbjct: 309 DILGGVKDENVLSRWSYLVRYERLLLRRALDAMPNFVWCKNPQCSFGQFHDGS------- 361

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQL----QTEDFTANRAYHERHTKQCPNCYMSIE 175
             +CG +SC+ HD PWH GLTC+Q++ ++    Q     AN  Y  +H K CP C   IE
Sbjct: 362 --SCGHESCYVHDTPWHQGLTCSQYDSKMKRSAQAGKIRANENYISKHAKACPTCGRIIE 419

Query: 176 KNDGCDHMSCR----CGYEFCWL 194
           K  GCDHM+C     CG+E  W+
Sbjct: 420 KGYGCDHMTCMGPMGCGHEL-WV 441



>gi|302913723|ref|XP_003050988.1| hypothetical protein NECHADRAFT_80796 [Nectria haematococca mpVI
           77-13-4]
 gi|256731926|gb|EEU45275.1| hypothetical protein NECHADRAFT_80796 [Nectria haematococca mpVI
           77-13-4]
          Length = 642

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 116/228 (50%), Gaps = 18/228 (7%)

Query: 3   ETTLECGVCCEDYSIIQQ------ISSSCGHN---DICSVCIKRHIEAELNSKGGDV--Q 51
           E + EC +C E Y+ +Q           C  +   D+C +C+   I+++L S+G      
Sbjct: 377 EKSRECTICVETYTNVQDSFPFPPALRECSEHHDMDVCVLCLCHSIKSQLESRGTAAVSD 436

Query: 52  VRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEH-T 110
           ++CP   C    T+  V+ LA  + F  YD   L  ++   P+FR C   +C +GQ +  
Sbjct: 437 LKCPNLSCDHIYTHTQVQLLADPDTFVLYDQYCLNASLAMEPNFRRCLRGRCTNGQIYEN 496

Query: 111 TGDRFPI---ITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQC 167
            G  +P    I C ACG   CF H+ PWH  LTC +++ Q +  D      +  + TK C
Sbjct: 497 LGPDYPSRNRIVCKACGFVMCFKHNRPWHQDLTCDEYDLQRKDSD-KETETWLAKRTKPC 555

Query: 168 PNCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTC 214
           PNC + IEK  GC HM+CR C YEFCW CL D+  I + G+  H P C
Sbjct: 556 PNCNIPIEKGLGCFHMTCRACRYEFCWECLADW-GIASSGHAGHRPDC 602



>gi|452839201|gb|EME41140.1| hypothetical protein DOTSEDRAFT_55051 [Dothistroma septosporum
           NZE10]
          Length = 659

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 120/224 (53%), Gaps = 18/224 (8%)

Query: 10  VCCEDYS-----IIQQISSSCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           VCC D        ++  ++ C H +  C  C+   + +EL++KG +  ++CP+  CP  L
Sbjct: 418 VCCGDEKHVLDFPVKPATNVCQHVSTTCIDCMHSWLSSELDTKGCE-DLKCPE--CPGIL 474

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFP--IITCG 121
            Y+ +  L+++    +Y+ LLLR  +  LP+F WC +  C SGQ +T    +     + G
Sbjct: 475 AYDSIHLLSNRSTSTKYEQLLLRNTLSSLPEFAWCLSPTCESGQLNTQNGNYMECDTSLG 534

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQTED----FTANRAYHERHTKQCP--NCYMSIE 175
            CG K C  H VPWH+G TC Q+  ++          A  A  +  +K CP  NC   I+
Sbjct: 535 GCGYKQCLLHKVPWHAGETCPQYEHRVSGRKAAEEEAATNAMLDEVSKICPGKNCGWRIQ 594

Query: 176 KNDGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           K+ GCDHM+CR C ++FCW CL  ++ I+  GN  H   C++++
Sbjct: 595 KSTGCDHMTCRKCKWQFCWECLASHKEIKREGNTAHERWCKFHS 638



>gi|169596090|ref|XP_001791469.1| hypothetical protein SNOG_00796 [Phaeosphaeria nodorum SN15]
 gi|111071171|gb|EAT92291.1| hypothetical protein SNOG_00796 [Phaeosphaeria nodorum SN15]
          Length = 427

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 117/233 (50%), Gaps = 23/233 (9%)

Query: 3   ETTLECGVCCEDYSIIQ----QISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKS 57
           ++T EC VC E   + Q      +  C H+ D C+ C++  IE+E  SK  + +V CP  
Sbjct: 139 KSTKECNVCTETRPLFQFPERPPTEDCQHSIDTCTHCLQTWIESEFKSKMWN-EVNCPT- 196

Query: 58  RCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPI 117
            C   L + DV   A + +F RY  L  +    K+P++RWC A+ C SGQ H   D+   
Sbjct: 197 -CRARLQFNDVMGFAPRNVFVRYSKLHTKAIYEKIPNWRWCVARGCKSGQIH--DDKDSR 253

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQF----NEQLQTEDFTANRAYHERHTKQCPNCYMS 173
             C  C    C  H V WH+  TC ++    N  ++ ++  A+ A   R TK CP C  S
Sbjct: 254 FRCKKCKRSHCTVHLVRWHTKETCREYEYRTNTGIRQQEELASYALIARTTKVCPGCTRS 313

Query: 174 IEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHY------HAPTCQYYAP 219
           IEK+ GCDHM+C  C  EFCW+CL  Y  +RT           H+  C +Y P
Sbjct: 314 IEKSYGCDHMTCSECRTEFCWVCLASY--VRTSNTQAPTVGIEHSTDCIHYMP 364



>gi|330947502|ref|XP_003306898.1| hypothetical protein PTT_20198 [Pyrenophora teres f. teres 0-1]
 gi|311315324|gb|EFQ84995.1| hypothetical protein PTT_20198 [Pyrenophora teres f. teres 0-1]
          Length = 614

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 103/190 (54%), Gaps = 14/190 (7%)

Query: 8   CGVCCEDYSIIQQIS-SSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           C VC E   I+   S ++C H  + C  C    I A+L   G   +V CP + C ++L+Y
Sbjct: 409 CVVCDESVQIVDLPSLANCDHQPETCIDCYSGWIAAQLQDSGW-REVACPGNGCKVKLSY 467

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           ++++  AS E F++YDT + R A    P+FRWC+A  C SGQ H +G    I TC ACG 
Sbjct: 468 QEIQAYASPETFQQYDTFIARAAFSDDPNFRWCRA--CDSGQIHLSGVEGNIFTCVACGH 525

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHE-------RHTKQC--PNCYMSIEK 176
           K C  H+  WH G TC +F  +         RA  E       + TK+C  P C  +IEK
Sbjct: 526 KVCIVHENTWHEGETCEEFEYRSSGRKEQDQRAQEEASLEAIGKLTKKCPGPGCTWNIEK 585

Query: 177 NDGCDHMSCR 186
           NDGCDHM+C+
Sbjct: 586 NDGCDHMTCK 595



>gi|472240240|gb|EMR85018.1| putative ring finger protein [Botryotinia fuckeliana BcDW1]
          Length = 583

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 115/221 (52%), Gaps = 20/221 (9%)

Query: 5   TLECGVCCEDYSIIQQISS---SCGHND--ICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
            +EC +C ED  ++  +SS    C H D  IC  C+   I  +++  G    ++CP   C
Sbjct: 280 NVECVICAEDVPMVDTLSSITGDCQHPDTFICKECLDLSITTDIDY-GLLNGIKCP--LC 336

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
              LT +DV + AS ++ +RY  + LR    +   F  C   KCG GQ H   +  P++ 
Sbjct: 337 TAVLTDKDVHQKASLKVLDRY--MYLREKASRPDTFIMCLGPKCGGGQIHEGTE--PLMI 392

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFN------EQLQTEDFTANRAYHERHTKQCPNCYMS 173
           C  C  K+C  H +PWH GL+C  F+      E+L+ E+ TA      + ++ CP C   
Sbjct: 393 CDHCQFKTCVKHKLPWHEGLSCDDFDVDDSQIERLEQEEATAK--LLAKDSRICPQCKEC 450

Query: 174 IEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTC 214
           + +++GCDHM CRCG  +C+LC  D+ENI   G+  H   C
Sbjct: 451 VVRSEGCDHMECRCGKSWCYLCGADWENIIRLGDSAHGRNC 491



>gi|512207691|gb|EPE36508.1| RING/U-box [Glarea lozoyensis ATCC 20868]
          Length = 468

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 101/190 (53%), Gaps = 15/190 (7%)

Query: 22  SSSCGH--NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFER 79
           SSSC H   + C+ C+   I+  L ++  +  +RCP   C   + YE ++  AS E F  
Sbjct: 230 SSSCHHCIAECCTSCLTFSIDNSLQTRYWN-DIRCPS--CDEHIGYEGMKEFASPEAFME 286

Query: 80  YDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTT----GDRFPI-ITCGACGAKSCFTHDVP 134
           YD   L   +  +P+FR+C +  C  GQ H       D  P  I C  C   SC  H+VP
Sbjct: 287 YDKRALTHYLSSVPNFRYCTSPTCNFGQIHVATKLGSDTLPPRIACSMCSVISCSRHNVP 346

Query: 135 WHSGLTCTQFNEQLQTEDFTANRAYHE---RHTKQCP--NCYMSIEKNDGCDHMSCRCGY 189
           WH G TC +F+ +L  ++   ++   +   R TK CP  NC + I+KN GC HM+C CG+
Sbjct: 347 WHEGETCEEFDARLAIQNKEQDKGSKKEVKRITKACPKKNCGLRIDKNGGCQHMTCLCGH 406

Query: 190 EFCWLCLGDY 199
           EFCW CL DY
Sbjct: 407 EFCWDCLKDY 416



>gi|347837234|emb|CCD51806.1| hypothetical protein BofuT4_P021120.1 [Botryotinia fuckeliana T4]
          Length = 576

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 115/221 (52%), Gaps = 20/221 (9%)

Query: 5   TLECGVCCEDYSIIQQISS---SCGHND--ICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
            +EC +C ED  ++  +SS    C H D  IC  C+   I  +++  G    ++CP   C
Sbjct: 273 NVECVICAEDVPMVDTLSSITGDCQHPDTFICKECLDLSITTDIDY-GLLNGIKCP--LC 329

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
              LT +DV + AS ++ +RY  + LR    +   F  C   KCG GQ H   +  P++ 
Sbjct: 330 TAVLTDKDVHQKASLKVLDRY--MYLREKASRPDTFIMCLGPKCGGGQIHEGTE--PLMI 385

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFN------EQLQTEDFTANRAYHERHTKQCPNCYMS 173
           C  C  K+C  H +PWH GL+C  F+      E+L+ E+ TA      + ++ CP C   
Sbjct: 386 CDHCQFKTCVKHKLPWHEGLSCDDFDVDDSQIERLEQEEATAK--LLAKDSRICPQCKEC 443

Query: 174 IEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTC 214
           + +++GCDHM CRCG  +C+LC  D+ENI   G+  H   C
Sbjct: 444 VVRSEGCDHMECRCGKSWCYLCGADWENIIRLGDSAHGRNC 484



>gi|154322535|ref|XP_001560582.1| hypothetical protein BC1G_00610 [Botryotinia fuckeliana B05.10]
          Length = 604

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 115/221 (52%), Gaps = 20/221 (9%)

Query: 5   TLECGVCCEDYSIIQQISS---SCGHND--ICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
            +EC +C ED  ++  +SS    C H D  IC  C+   I  +++  G    ++CP   C
Sbjct: 303 NVECVICAEDVPMVDTLSSITGDCQHPDTFICKECLDLSITTDIDY-GLLNGIKCP--LC 359

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
              LT +DV + AS ++ +RY  + LR    +   F  C   KCG GQ H   +  P++ 
Sbjct: 360 TAVLTDKDVHQKASLKVLDRY--MYLREKASRPDTFIMCLGPKCGGGQIHEGTE--PLMI 415

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFN------EQLQTEDFTANRAYHERHTKQCPNCYMS 173
           C  C  K+C  H +PWH GL+C  F+      E+L+ E+ TA      + ++ CP C   
Sbjct: 416 CDHCQFKTCVKHKLPWHEGLSCDDFDVDDSQIERLEQEEATAK--LLAKDSRICPQCKEC 473

Query: 174 IEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTC 214
           + +++GCDHM CRCG  +C+LC  D+ENI   G+  H   C
Sbjct: 474 VVRSEGCDHMECRCGKSWCYLCGADWENIIRLGDSAHGRNC 514



>gi|449295670|gb|EMC91691.1| hypothetical protein BAUCODRAFT_79681, partial [Baudoinia
           compniacensis UAMH 10762]
          Length = 207

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 106/198 (53%), Gaps = 15/198 (7%)

Query: 30  ICSVCIKRHIEAELNSKG-GDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVA 88
           IC  C +  +E ++ ++  G++      ++C   L  ++++ LA+  ++ +Y    +R  
Sbjct: 9   ICGPCWQSWLEVQVATQHVGNIYC----AQCDSRLGRDEIQDLAADVVYGQYVDAEVRAM 64

Query: 89  IRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQL 148
           +   PDF WC++  C  GQ HT  D   I  CG+CG K C   DV WH+G TC   + ++
Sbjct: 65  LTSNPDFVWCQSGNCTHGQLHTGDD---IFRCGSCGYKHCMLCDVVWHAGETCGDHHAKI 121

Query: 149 QTEDFTANRA------YHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYEN 201
             +     RA      + + + KQCP C   I+K+ GCDHM+CR C ++FCW+CL  Y N
Sbjct: 122 VHQKQHRQRAEISSESWIKTYAKQCPWCRRKIQKDGGCDHMTCRVCRHQFCWVCLASYNN 181

Query: 202 IRTHGNHYHAPTCQYYAP 219
           +   GN  H  +C YY P
Sbjct: 182 VLRLGNQKHKKSCIYYRP 199



>gi|453083496|gb|EMF11542.1| hypothetical protein SEPMUDRAFT_48412 [Mycosphaerella populorum
           SO2202]
          Length = 369

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 114/242 (47%), Gaps = 35/242 (14%)

Query: 10  VCCEDYSIIQQISS-----SCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           +CC D    Q   S     SC H+   C+ C+     ++L++KG      CP+  CP  L
Sbjct: 117 ICCGDSHPPQNFPSKPATASCSHDSQTCTECMHTWFASQLDAKGATEDFTCPQ--CPSVL 174

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQ---------------E 108
           T+ +++   S E F  Y+ LL R A+ +LP+F WC    C SGQ                
Sbjct: 175 THSELQLYTSPETFSHYEKLLTRNALSQLPEFAWCLDPNCSSGQLNFNNNNNNNLAAAAT 234

Query: 109 HTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHT--- 164
                  P + C ACG + C  H   WH   TC Q++ +++   D       +ER T   
Sbjct: 235 AAAAAPAPYMNCVACGYQQCVHHKCAWHHNETCAQYDLRMKARRDDDEENKKNERKTEEM 294

Query: 165 -----KQCP--NCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQY 216
                K+CP   C   I+K DGCDHM C+ C +EFCW CL +++ I+  GN  H   C++
Sbjct: 295 LDSVSKKCPGAGCGWRIQKVDGCDHMRCKQCKHEFCWECLANHQEIKKIGNTAHQTWCKF 354

Query: 217 YA 218
           ++
Sbjct: 355 HS 356



>gi|212545456|ref|XP_002152882.1| RING finger protein, putative [Talaromyces marneffei ATCC 18224]
 gi|210065851|gb|EEA19945.1| RING finger protein, putative [Talaromyces marneffei ATCC 18224]
          Length = 455

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (58%), Gaps = 10/156 (6%)

Query: 2   TETTLECGVCCEDYSIIQQ----ISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPK 56
           T+    C +C ED+S        IS +C H   +C++CI + I+++L ++  D Q+RCP+
Sbjct: 140 TDRLTSCNICVEDFSNTVTRPAWISIACAHEPSVCNICISKSIKSDLETRIWD-QIRCPE 198

Query: 57  SRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFP 116
             C   L Y+D++RLA  E FERY+ L  R A+    +F WC  Q+C  GQ H  G   P
Sbjct: 199 --CQTLLIYDDIKRLADPETFERYERLSFRSAVGSDENFIWC--QQCDFGQLHEKGASEP 254

Query: 117 IITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTED 152
           I+ C  CG +SC+ H  PWHSGLTC +++E LQ  D
Sbjct: 255 IVRCLNCGFRSCYLHAGPWHSGLTCDEYDEMLQNPD 290



>gi|116180776|ref|XP_001220237.1| hypothetical protein CHGG_01016 [Chaetomium globosum CBS 148.51]
 gi|88185313|gb|EAQ92781.1| hypothetical protein CHGG_01016 [Chaetomium globosum CBS 148.51]
          Length = 825

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 118/220 (53%), Gaps = 12/220 (5%)

Query: 2   TETTLECGVCCED---YSIIQQISSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKS 57
           TETT++C +C ED     +  Q +  C H    C  C+   + + +     D +++CP  
Sbjct: 495 TETTVQCSICIEDKPRAEMPAQNTPRCTHQPTTCKDCLGEWLRSSIERGAWD-RLQCPD- 552

Query: 58  RCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPI 117
            CP  L ++DV+  AS+  F RYDTL+ R A+ K P F +C +  CGSGQ +   +  P 
Sbjct: 553 -CPEALDWQDVKWHASEGTFNRYDTLVTRAALTKDPAFHFCLSPACGSGQMYE--ENCPR 609

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFT--ANRAYHERHTKQCPNCYMSIE 175
             C +C A SC  H++PWH   TC +++++ Q       A++      +K CP C   + 
Sbjct: 610 FECVSCQASSCLHHNLPWHWDETCQEYDKRNQDRRAAEKASQKAVRGSSKPCPGCKRDVH 669

Query: 176 KNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNH-YHAPTC 214
           K  GC+H++C C +E+C++C   ++ ++T   +  HAP C
Sbjct: 670 KFAGCNHITCICRHEWCYICTQPWQRLQTGAPYCRHAPGC 709



>gi|169615296|ref|XP_001801064.1| hypothetical protein SNOG_10805 [Phaeosphaeria nodorum SN15]
 gi|111061079|gb|EAT82199.1| hypothetical protein SNOG_10805 [Phaeosphaeria nodorum SN15]
          Length = 428

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 107/225 (47%), Gaps = 17/225 (7%)

Query: 8   CGVCCEDYSI--IQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           C  C ED+      Q+       +I ++C  R I   +          CP   C   LT 
Sbjct: 167 CEACLEDFPTEEFPQLDGCQRGPNIHNLCFARWIAVRVGETTHHRNTTCPCG-CGTVLTR 225

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           E+V + A     + YD LL +    +L  FR C    C SGQ H + D   I  C  CG 
Sbjct: 226 ENVEQYAEGNTLQGYDDLLAQELAEEL-GFRRCIGPDCESGQIHDSEDGN-IFICHECGH 283

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQTEDFT------ANRAYHERHTKQCPN--CYMSIEKN 177
           + C THD+P+H G TC  ++ +L  E         A++ Y ++HTK CP   C    +K 
Sbjct: 284 RHCSTHDIPFHDGETCEDYDNRLHREAMPPTAEEIADQEYVDKHTKNCPGPKCGKRGDKV 343

Query: 178 DGCDHMSC-RCGYEFCWLCLGDY---ENIRTHGNHYHAPTCQYYA 218
            GCDHM+C +C +E+CW CL  Y   E IR  GN  HAP C YY+
Sbjct: 344 SGCDHMTCEQCQFEYCWRCLAPYAGPEGIRLRGNAAHAPNCPYYS 388



>gi|342886266|gb|EGU86150.1| hypothetical protein FOXB_03338 [Fusarium oxysporum Fo5176]
          Length = 658

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 97/178 (54%), Gaps = 6/178 (3%)

Query: 20  QISSSCGHN-DICSVCIKRHIEAELNSKG--GDVQVRCPKSRCPIELTYEDVRRLASKEL 76
           ++   C H  D C+ C++ +IEA+L+  G  G   + CP S C   L Y++V+  A +E 
Sbjct: 459 KLEQRCSHTVDFCTECLENYIEAQLDQHGRAGCHLLTCPSSDCGRRLEYDEVKLYARQET 518

Query: 77  FERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWH 136
           F +YD  L   A+  LP FRWC A+ C  GQ H   +    ++C  CG + CF H + WH
Sbjct: 519 FSKYDKYLTLEALSNLPSFRWCLAENCSYGQIHDLIESNH-VSCEECGCEMCFEHQMKWH 577

Query: 137 SGLTCTQFNEQLQTED--FTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCRCGYEFC 192
           + LTC +F+   +  D  F   R +   +TKQCP+C ++ +K  GC HM+C  G   C
Sbjct: 578 NDLTCEEFDSMEENGDPRFHETRDWVNANTKQCPSCGVNTQKGPGCFHMTCYWGAYTC 635



>gi|340513935|gb|EGR44209.1| predicted protein [Trichoderma reesei QM6a]
          Length = 199

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 104/201 (51%), Gaps = 34/201 (16%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC VC E  S  Q     I+  C H    C  CI R IE EL+SK  + +V CP   C  
Sbjct: 4   ECSVCAEVKSTEQFPASPITQECTHAPTTCRPCITRAIETELSSKPWE-KVGCPD--CGA 60

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            L Y DV++ A  E  E+YD L++   +++ PDF WC +  CGSGQ H +G+  PI+ C 
Sbjct: 61  TLGYHDVQKYADLETREKYDKLMILHTLQQDPDFIWCSS-GCGSGQLHDSGESEPIVKCT 119

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTA-----NRAY-------HERH------ 163
           +CG  +CF H VPWH+G+TC +F+  L   D  A     NRA        H+R       
Sbjct: 120 SCGHLTCFQHKVPWHAGVTCEEFD--LTRSDSAASLPQGNRAVELAEARRHKRDNDASEE 177

Query: 164 -----TKQCPNCYMSIEKNDG 179
                TK CP+C   IEKN G
Sbjct: 178 TIRSTTKACPSCKSQIEKNGG 198



>gi|512203368|gb|EPE32192.1| RING/U-box [Glarea lozoyensis ATCC 20868]
          Length = 718

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 120/229 (52%), Gaps = 22/229 (9%)

Query: 2   TETTLECGVCCE-----DYSIIQQISSSCGHN--DICSVCIKRHIEAELNSKGGDVQVRC 54
           +   +EC +C E      +    +I+++C  +    C  CI+  I++ L+ +G   ++ C
Sbjct: 391 SNNEIECAICAETLPPDSFPPSSKITANCEDHPYKACISCIQHSIQSTLD-EGSIHRLIC 449

Query: 55  PKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR 114
               C   L+ ++V + A+K    RY  L+L  +    PD   C +  C SGQ+H    +
Sbjct: 450 --LFCHHRLSADEVEKYATKSALTRYKYLMLLDS----PDIIMCLSPTCKSGQKHVD-KQ 502

Query: 115 FPIITCGACGAKSCFTHDVPWHSGLTCTQFN------EQLQTEDFTANRAYHERHTKQCP 168
            P + C  C   +C  H +PWH  +TC +F+      E+L+  + TA     E+ ++ CP
Sbjct: 503 NPKMVCNTCSFATCVLHKLPWHDNVTCAEFDTSEEQIERLEEAEATAKLLAKEQ-SQICP 561

Query: 169 NCYMSIEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
            C+  + +++GCDHM CRCG E+C+LCL  +EN+   G   H PTCQY+
Sbjct: 562 ECHQGVFRSEGCDHMMCRCGNEWCFLCLASWENVMRLGEEAHHPTCQYH 610



>gi|296814830|ref|XP_002847752.1| IBR domain-containing protein [Arthroderma otae CBS 113480]
 gi|238840777|gb|EEQ30439.1| IBR domain-containing protein [Arthroderma otae CBS 113480]
          Length = 523

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED S +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 148 CEICCEDGSDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIVDSKS 206

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L S+ + +RY TLL+R  +  +PD +WC A  C        +E       P + C A
Sbjct: 207 LDLLVSEAIRDRYRTLLIRTYVDDMPDLKWCPAPNCEFAVRCGVKERDLYRVVPTVHC-A 265

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 266 CSFAFCFGCDVGDHQPCPCVLVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 325

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 326 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 352



>gi|330804929|ref|XP_003290441.1| hypothetical protein DICPUDRAFT_92487 [Dictyostelium purpureum]
 gi|325079413|gb|EGC33014.1| hypothetical protein DICPUDRAFT_92487 [Dictyostelium purpureum]
          Length = 519

 Score =  112 bits (280), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 112/219 (51%), Gaps = 12/219 (5%)

Query: 2   TETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
            +TT+ C +C +DY+  +  + SC H   C  C K ++E  +      +   CP  +C +
Sbjct: 132 AKTTVSCLICLDDYAPDKVFALSCNHK-YCLGCWKNYLEINVGEGPECIYTTCPAPKCKV 190

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            +  +  + + S E++ERY++ +L+  +   P  +WC A  C         +R   + C 
Sbjct: 191 VVHQDAFKAIISPEIYERYNSFILKSYVDDNPQVKWCPAPGCIYSIRCDRKERKEAVLC- 249

Query: 122 ACGAKSCFT---HDVPWHSGLTCTQFNEQLQ-TEDFTANRAYHERHTKQCPNCYMSIEKN 177
            CG + CF    +D+  H    C+Q ++ LQ   D + N  +   +TK+CP C   IEKN
Sbjct: 250 KCGFQYCFNCNDYDIGDHMPCPCSQVDKWLQKASDESENVTWMLANTKKCPECRSPIEKN 309

Query: 178 DGCDHMSCR-----CGYEFCWLCLGDY-ENIRTHGNHYH 210
            GC HM+CR     CGYEFCWLC G + E+  T G +Y+
Sbjct: 310 GGCMHMTCRKNAGGCGYEFCWLCRGPWSEHGSTTGGYYN 348



>gi|315053907|ref|XP_003176328.1| ariadne-1 [Arthroderma gypseum CBS 118893]
 gi|311338174|gb|EFQ97376.1| ariadne-1 [Arthroderma gypseum CBS 118893]
          Length = 511

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 108/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCG-----SGQEHTTGDRFPIITCGA 122
           +  L  +++ +RY TLL+R  +  +P+ +WC A  C      + +E       P + C A
Sbjct: 195 LDLLVGEDVRDRYRTLLIRTYVDDMPNLKWCPAPNCEFAIRCAVKERDLDRVVPTVNC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CAFAFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|340518962|gb|EGR49202.1| hypothetical protein TRIREDRAFT_77667 [Trichoderma reesei QM6a]
          Length = 533

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 142 CDICCEDEEGLQTFAMKCGHR-YCVDCYRHYLTQKIQDEGESARIQCPSDGCGRILDARS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + EL +RY  LL R  +     F+WC A  C +    G +    DR  P + C  
Sbjct: 201 LDLLVTPELTDRYHELLNRTYVEDKDTFKWCPAPDCPNAIECGVKKKDLDRIVPTVEC-L 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C      L+   D +    +   HTK+CP C  +IEKN GC+
Sbjct: 260 CGYRFCFGCPNPDHQPAPCDLVKRWLKKCADDSETANWISAHTKECPKCSSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 346



>gi|327308880|ref|XP_003239131.1| RING finger protein [Trichophyton rubrum CBS 118892]
 gi|326459387|gb|EGD84840.1| RING finger protein [Trichophyton rubrum CBS 118892]
          Length = 517

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDR-FPIITCGA 122
           +  L  +++ ERY TLL+R  +  +P+ +WC A  C      G +    DR  P + C A
Sbjct: 195 LDLLVGEDVRERYRTLLIRTYVDDMPNLKWCPAPNCEFAVRCGVKQRDLDRVVPTVHC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 254 CSFTFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCQSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|302655405|ref|XP_003019491.1| IBR finger domain protein [Trichophyton verrucosum HKI 0517]
 gi|291183219|gb|EFE38846.1| IBR finger domain protein [Trichophyton verrucosum HKI 0517]
          Length = 522

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L  +++ +RY TLL+R  +  +P+ +WC A  C      G +    DR  P + C A
Sbjct: 195 LDLLVGEDVRDRYRTLLIRTYVDDMPNLKWCPAPNCEFAVRCGVKERDLDRIVPTVHC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CSFAFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|302504427|ref|XP_003014172.1| IBR finger domain protein [Arthroderma benhamiae CBS 112371]
 gi|291177740|gb|EFE33532.1| IBR finger domain protein [Arthroderma benhamiae CBS 112371]
          Length = 517

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L  +++ +RY TLL+R  +  +P+ +WC A  C      G +    DR  P + C A
Sbjct: 195 LDLLVGEDVRDRYRTLLIRTYVDDMPNLKWCPAPNCEFAVRCGVKERDLDRIVPTVHC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CSFAFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|326484433|gb|EGE08443.1| IBR domain-containing protein [Trichophyton equinum CBS 127.97]
          Length = 517

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDR-FPIITCGA 122
           +  L  +++ +RY TLL+R  +  +P+ +WC A  C      G +    DR  P + C A
Sbjct: 195 LDLLVGEDVRDRYRTLLIRTYVDDMPNLKWCPAPNCEFAVRCGVKERDLDRVVPTVHC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CSFAFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|326469461|gb|EGD93470.1| IBR domain-containing protein [Trichophyton tonsurans CBS 112818]
          Length = 517

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C   ++  ++  +G   ++ CP+ +C   +  + 
Sbjct: 136 CDICCEDGPDLQTYAMRCGHR-FCVDCYSHYLGQKIKEEGEAARIECPQDQCHRIIDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDR-FPIITCGA 122
           +  L  +++ +RY TLL+R  +  +P+ +WC A  C      G +    DR  P + C A
Sbjct: 195 LDLLVGEDVRDRYRTLLIRTYVDDMPNLKWCPAPNCEFAVRCGVKERDLDRVVPTVHC-A 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF  DV  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CSFAFCFGCDVGNHQPCPCALVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+CLG +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCLGPWSE---HGTSWY 340



>gi|330844607|ref|XP_003294211.1| hypothetical protein DICPUDRAFT_43095 [Dictyostelium purpureum]
 gi|325075361|gb|EGC29258.1| hypothetical protein DICPUDRAFT_43095 [Dictyostelium purpureum]
          Length = 257

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 115/221 (52%), Gaps = 17/221 (7%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           T +C +C +++ I +  +     +  C+ C+++H   ++ + GG   +RCP   C   ++
Sbjct: 47  TYQCFICFDEHPIEKIYTLDECFHRFCNGCLEQHFSTQIFN-GGVKNIRCPDPDCGRLVS 105

Query: 65  YEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITCG-- 121
           Y +V+         +Y+  LL++++ + P+FR C    C +      GD   P+I C   
Sbjct: 106 YHEVKHNVDTSTLSKYEEFLLQISLSEDPNFRTCPRSNCNTA---LIGDPDAPMIVCPKE 162

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHE---RHTKQCPNCYMSIEKND 178
           +C    CF     WHS +TC Q+ ++ + E+  A R + E    +TK CP C   IEKN 
Sbjct: 163 SCKFAYCFNCKDAWHSDITCEQY-KRWKEENDQAERKFQEWSRANTKPCPKCNSKIEKNG 221

Query: 179 GCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           GC+HM+C RC +EFCWLCL  Y     +  HY +  C+ ++
Sbjct: 222 GCNHMTCKRCSHEFCWLCLEIY-----NKQHYSSSKCKQFS 257



>gi|358394570|gb|EHK43963.1| hypothetical protein TRIATDRAFT_35637 [Trichoderma atroviride IMI
           206040]
          Length = 530

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP   C   L    
Sbjct: 143 CDICCEDEDGLQTFAMKCGHR-YCVNCYRQYLTQKIQDEGESARIQCPSDGCGRILDSRS 201

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + EL  RY  LL R  +     F+WC A  C +    G +    D+  P + C  
Sbjct: 202 LDLLVTPELTVRYSELLNRTYVEDKDTFKWCPAPDCPNAIECGVKKKDLDKIVPTVEC-L 260

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C      L+   D +    +   HTK+CP C  +IEKN GC+
Sbjct: 261 CGNRFCFGCANPDHQPAPCDLVKRWLKKCADDSETANWISAHTKECPKCSSTIEKNGGCN 320

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 321 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 347



>gi|429857904|gb|ELA32743.1| ring finger domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 659

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (58%), Gaps = 11/163 (6%)

Query: 7   ECGVCCE-----DYSIIQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           EC +C E     D+ I+  ++S C H  + C  C++  I ++LNSK    ++RCP+ R  
Sbjct: 381 ECPICAEIREASDFPILS-VTSMCTHPPEACLECLQMSIRSDLNSKLW-TEIRCPECREL 438

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
           +E  Y D+++ A +E F RY+ L LR A+ +  +F WC A  CGSGQ H TG   PI++C
Sbjct: 439 LE--YVDIQKYADEETFARYEALALRAAMAEAENFIWCTA-NCGSGQLHDTGTEQPIVSC 495

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERH 163
             CG +SCFTH+V WH  LTC +++  L+  +   +R   ER 
Sbjct: 496 LHCGQRSCFTHNVTWHENLTCEEYDSLLRDPENFRSRIEMERE 538



>gi|470426397|ref|XP_004337892.1| IBR domain containing protein [Acanthamoeba castellanii str. Neff]
 gi|440794724|gb|ELR15879.1| IBR domain containing protein [Acanthamoeba castellanii str. Neff]
          Length = 609

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 103/213 (48%), Gaps = 11/213 (5%)

Query: 1   MTETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           + E    C +CC DY I +  +    ++  C  C+ R +  ++  +G    ++CP   C 
Sbjct: 393 IDEKEYSCPICCTDYPIEEMYTLDKCYHRFCFECLGRFVLVKVQ-EGQTQNMKCPDPDCK 451

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
             +T  +VR +  +E + +Y+   L  A+  +PD RWC    C +       +   + + 
Sbjct: 452 EFMTPAEVRHVVDEETYSKYEEFTLASALNAMPDIRWCPKPDCKNAMIGGEENLMMVCSN 511

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHE---RHTKQCPNCYMSIEKN 177
             C    C+     WH+  TC Q+ +Q + E+  A+  Y E    + K CPNC   IEKN
Sbjct: 512 SECRFSFCYKCKEEWHADATCEQY-QQWRRENSEADAKYDEWVKANAKMCPNCQAPIEKN 570

Query: 178 DGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHY 209
            GC+HM+C+ C YEFCWLC   Y     + NH+
Sbjct: 571 GGCNHMTCKNCKYEFCWLCNAQY-----NKNHF 598



>gi|403359855|gb|EJY79585.1| IBR domain containing protein [Oxytricha trifallax]
          Length = 1539

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 103/213 (48%), Gaps = 15/213 (7%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQV-RCPKSRCPIELTYE 66
           C +C  +Y+        C H   C  C+  ++E   N   G V+V +C  ++C  E T E
Sbjct: 264 CEICYMNYNESDLYGIKCNHR-YCKNCLYDYLE--YNISNGQVRVIKCADAQCKEEFTKE 320

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           DV +  SKE++++Y      + +   P+ +WC    C +   + +  +   +TC  CG +
Sbjct: 321 DVEKFGSKEIYDKYLKFKENIDVNLNPNLKWCPKPNCNN---YISKGKKRKVTC-KCGLE 376

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
            CF   + WH  + C    E +  E F+   A +  +   CP C + +EK  GC+HM+CR
Sbjct: 377 ICFDCGIEWHGKIKC---KEVMDKEFFSW--AANNGNISNCPKCKVRLEKISGCNHMTCR 431

Query: 187 -CGYEFCWLCLGDYENIRTHG-NHYHAPTCQYY 217
            CGY +CWLC   Y +   +  N +  P  QY+
Sbjct: 432 QCGYSWCWLCGKKYTDFHYNPINVFGCPGQQYF 464



>gi|358385943|gb|EHK23539.1| hypothetical protein TRIVIDRAFT_79851 [Trichoderma virens Gv29-8]
          Length = 526

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 139 CDICCEDEEGLQTFAMKCGHR-YCVDCYRHYLTQKIQDEGESARIQCPSDGCGRILDSRS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + EL +RY  LL R  +     F+WC A  C +  E     +      P + C  
Sbjct: 198 LDLLVTPELTDRYHELLNRTYVEDKDTFKWCPAPDCPNAIECGVKKKDLEKIVPTVEC-L 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C      L+   D +    +   HTK+CP C  +IEKN GC+
Sbjct: 257 CGYRFCFGCPNPDHQPAPCDLVKRWLKKCADDSETANWISAHTKECPKCSSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 343



>gi|402218564|gb|EJT98640.1| hypothetical protein DACRYDRAFT_96413 [Dacryopinax sp. DJM-731 SS1]
          Length = 248

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 99/226 (43%), Gaps = 58/226 (25%)

Query: 50  VQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG--- 106
           ++VRCP + C   L +EDV+R A K +FERYD  LL   +    +F WC   KCGSG   
Sbjct: 8   MEVRCPITSCGNVLEFEDVKRCAEKSVFERYDKFLLNRHLATEEEFVWCHDPKCGSGYFI 67

Query: 107 ----------------------------------------QEHTTGDRFPIITCGACGAK 126
                                                      T+  + P+I C  C + 
Sbjct: 68  PSSRSSPSPSTTTSPSSIITISISAPASTPPTSIASPKSSPPSTSPTQCPLIHCPTCQSP 127

Query: 127 SCFTHDVPWHSGLTCTQFNEQL-----------QTEDFTANRAYHERHTKQCPNCYMSIE 175
           +C  H  PWHS +TC Q++ Q            Q    T    + +R TK CP C + IE
Sbjct: 128 TCAHHLRPWHSNMTCAQYDRQQLGLGPLGVLGKQWRQGTKTGWWIKRKTKPCPGCGIKIE 187

Query: 176 KNDGCDHMSCR----CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
           +++GCDH++C     CGY FCW C  +Y  I   GNH H   C+++
Sbjct: 188 RSEGCDHITCYPPAGCGYHFCWRCSANYTLIFQVGNHAHKRFCRHW 233



>gi|406867586|gb|EKD20624.1| IBR domain-containing protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 386

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 89/155 (57%), Gaps = 10/155 (6%)

Query: 8   CGVCCEDYSIIQQ----ISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           C VC ED+S   Q    I+ +C H   ICS C+  +IE+ELNSK  + ++ CP+S C   
Sbjct: 107 CDVCFEDFSSETQPPEWITRACVHKPTICSRCLAAYIESELNSKIAE-RIYCPESNCGAV 165

Query: 63  LTYEDVRRLAS-KELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           L + D++RLA+  E F RYDT LLR A+    +  WC  Q C SGQ H  G   PI+ C 
Sbjct: 166 LDHGDIKRLAADAETFARYDTRLLRRALGADRNAVWC--QNCASGQIHEGGSTQPIVRCS 223

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTA 155
            C  +SCF H VPWH  LTC +++   L  E F A
Sbjct: 224 NCHFRSCFRHGVPWHDRLTCEEYDAMLLNPEGFQA 258



>gi|443917697|gb|ELU38357.1| IBR domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 383

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 92/177 (51%), Gaps = 9/177 (5%)

Query: 8   CGVCCEDYSIIQ----QISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           C VC E  S ++      ++SC H   +C  C+++HI   ++ K   V +RCP   C   
Sbjct: 193 CVVCFEQGSDVRFAARSPTASCHHGATVCVSCLEQHILIAIH-KSRSVGIRCPHDGCGKM 251

Query: 63  LTYEDVR-RLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           L Y+DV   +    +   Y+ LL+R  +     F WCK   C SGQ H  G   PI+TC 
Sbjct: 252 LEYQDVYCSVRDWSMLAYYEQLLIRREMGNTEQFVWCKNPICTSGQVHKPGPNQPIVTCN 311

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQ--TEDFTANRAYHERHTKQCPNCYMSIEK 176
            C  KSC+ HD PWH GL+C  F+ +L+   E   A RAY  ++TK CP C   +EK
Sbjct: 312 TCHQKSCYVHDRPWHEGLSCEDFDIKLRRYEEQDRATRAYLAKNTKSCPKCKRKVEK 368



>gi|66807519|ref|XP_637482.1| ariadne-like ubiquitin ligase [Dictyostelium discoideum AX4]
 gi|75008207|sp|Q6T486.1|RBRA_DICDI RecName: Full=Probable E3 ubiquitin-protein ligase rbrA; AltName:
           Full=Ariadne-like ubiquitin ligase
 gi|38073484|gb|AAR10851.1| ariadne-like ubiquitin ligase RbrA [Dictyostelium discoideum]
 gi|60465908|gb|EAL63978.1| ariadne-like ubiquitin ligase [Dictyostelium discoideum AX4]
          Length = 520

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 109/216 (50%), Gaps = 12/216 (5%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
            + C +C EDY   Q  +  C H   C  C K ++E +++     +   CP  +C + + 
Sbjct: 136 NVSCLICLEDYPPTQTFALICNHR-YCLPCYKNYLEIKVSEGPECIYTPCPAPKCKVIVH 194

Query: 65  YEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACG 124
            +  +++ S E+FER++  +L+  +   P  +WC A  C         +R   + C  CG
Sbjct: 195 QDAFKQIVSPEVFERFNNFILKSYVDDNPQVKWCPAPGCIYSIRCDRKERKEAVNC-KCG 253

Query: 125 AKSCFT---HDVPWHSGLTCTQFNEQLQ-TEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
            + CF    +++  H    C+Q ++ LQ   D + N  +   +TK+CP C   IEKN GC
Sbjct: 254 FQYCFNCNDYEIGDHMPCPCSQVDKWLQKASDESENVTWMLANTKKCPECRSPIEKNGGC 313

Query: 181 DHMSCR-----CGYEFCWLCLGDY-ENIRTHGNHYH 210
            HM+CR     CG+EFCWLC G + E+  T G +Y+
Sbjct: 314 MHMTCRKNAGGCGFEFCWLCRGPWTEHGSTTGGYYN 349



>gi|511000424|gb|EPB81964.1| hypothetical protein HMPREF1544_11317 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 471

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 104/203 (51%), Gaps = 10/203 (4%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           + EC +CC +   ++ IS +CGH   C  C   ++  ++  +G    ++CP+  C   + 
Sbjct: 96  SFECEICCNNEPGLETISLACGHL-FCVDCYTYYLSDKIK-QGDATNIQCPQEGCNAAVD 153

Query: 65  YEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIIT 119
              ++ +   +++ RY +LL +V ++  P+ +WC A  C    E     ++     P +T
Sbjct: 154 EATLKMVLDDDMYSRYQSLLDKVYVQDNPNLKWCTAPDCSYAIECDISKNSLSTIVPTVT 213

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQL-QTEDFTANRAYHERHTKQCPNCYMSIEKND 178
           C  CG   CF  D   H    C+   +   + E+ +A   +   HTK CP C   IEKN 
Sbjct: 214 C-ECGHVMCFGCDHEDHQPANCSMVKDWWRKKEEDSATATWISSHTKDCPKCQSPIEKNG 272

Query: 179 GCDHMSCR-CGYEFCWLCLGDYE 200
           GC+HM C+ C +EFCW+CLGD++
Sbjct: 273 GCNHMWCKQCKHEFCWVCLGDWK 295



>gi|342873166|gb|EGU75386.1| hypothetical protein FOXB_14091 [Fusarium oxysporum Fo5176]
          Length = 499

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 141 CDICCEDEEGLESFAMKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPSDGCGRILDSAS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L +  L +RY  LL R  +    +F+WC A  C +  E        G   P + C  
Sbjct: 200 LDVLVTPALADRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLGKIVPTVEC-R 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGYRFCFGCPNPDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 345



>gi|475667535|gb|EMT65324.1| hypothetical protein FOC4_g10011306 [Fusarium oxysporum f. sp.
           cubense race 4]
 gi|477512173|gb|ENH64734.1| hypothetical protein FOC1_g10014010 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 519

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 139 CDICCEDEEGLESFAMKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPSDGCGRILDSAS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L +  L +RY  LL R  +    +F+WC A  C +  E        G   P + C  
Sbjct: 198 LDVLVTPALADRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLGKIVPTVEC-R 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CGYRFCFGCPNPDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 343



>gi|501754838|emb|CCG81828.1| IBR domain protein [Taphrina deformans PYCC 5710]
          Length = 501

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 106/211 (50%), Gaps = 13/211 (6%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC +CCED   ++  +  CGH   C  C  R ++ ++  +G    ++CP  +C + L   
Sbjct: 119 ECPICCED-GTLETFALPCGHR-YCRDCYGRFMDEKIVEEGEVRNLKCPGDKCKLALGES 176

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCG 121
            VR L   ++++RY  LL R  +    + +WC +  C +  E  T  R      P +TC 
Sbjct: 177 VVRLLVEDDVYQRYLRLLDRAYVDDHDNVKWCPSPNCENAVECGTSARQLTQIIPSVTCA 236

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
           A G   CF   +  H    C      L+  ED +    +   +TK+CP C  +IEKN GC
Sbjct: 237 A-GHSFCFGCSLDEHQPCICPIVKTWLKKCEDDSETSNWISANTKECPKCVSTIEKNGGC 295

Query: 181 DHMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           +HM+CR C YEFCW+C+G + +   HG  ++
Sbjct: 296 NHMTCRKCKYEFCWVCMGVWSD---HGQSWY 323



>gi|170091398|ref|XP_001876921.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648414|gb|EDR12657.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1228

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 89/165 (53%), Gaps = 26/165 (15%)

Query: 7   ECGVCCED----YSIIQ-QISSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           EC +CC D    Y   +   ++ C H  I C  C+ +HIEA+L S+   +++ CP   CP
Sbjct: 364 ECPICCSDDIPEYEYPRFPPTNRCQHEPIACRQCLAQHIEAQLFSQAMVLEINCPSHPCP 423

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTG-------- 112
            +L Y+++++ A+ + F+RY+++ LR  + +  +FRWC   KC  GQ H  G        
Sbjct: 424 EKLGYDEIKQWAAADCFKRYNSIALRQHLSEDINFRWCLNAKCDHGQTHRLGGLYQSISF 483

Query: 113 ------------DRFPIITCGACGAKSCFTHDVPWHSGLTCTQFN 145
                       D +PI+ C  C  KSCFTH +PWH GLTC QF+
Sbjct: 484 LEDILTQALRNVDEYPIVQCTWCYKKSCFTHQLPWHEGLTCAQFD 528



>gi|511006115|gb|EPB87434.1| ubiquitin-conjugating enzyme E2, other [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 513

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 105/217 (48%), Gaps = 14/217 (6%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   ++ IS SCGH   C  C   ++  ++  +G   +++CP+S C + +  + 
Sbjct: 136 CDICCDDSPDMETISVSCGHR-FCRTCYTHYVVQKIREEGESRRIQCPQSDCAVIVDEKT 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           V  L   +   +Y  LL R  +      RWC A  C    E      +     P + C  
Sbjct: 195 VELLVDHDTNLKYRELLNRTFVDDNDFLRWCPAPDCEYAVECSVPSTSLTSIVPTVEC-K 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C    + LQ  ED +    +   HTK+CP C+ +IEKN GC+
Sbjct: 254 CSCRFCFGCGLDDHQPCICVLVKKWLQKCEDDSETANWISAHTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
           HM+CR C YEFCW+C+G +     HG  ++  TC  Y
Sbjct: 314 HMTCRKCRYEFCWVCMGPWSE---HGTSWY--TCNRY 345



>gi|302916589|ref|XP_003052105.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733044|gb|EEU46392.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 499

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 111 CDICCEDEDGLESFAMKCGHR-YCVDCYRHYLTQKIKEEGEAARIQCPSDGCGRILDSAS 169

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L ++EL  RY  LL R  +    +F+WC A  C +    G +    D+  P + C  
Sbjct: 170 LDVLVTQELSGRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLDKIVPTVEC-R 228

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 229 CGYRFCFGCPNPDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 288

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 289 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 315



>gi|400601841|gb|EJP69466.1| RING-5 protein [Beauveria bassiana ARSEF 2860]
          Length = 710

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   +++CP   C   L    
Sbjct: 320 CDICCEDEEGLETFAMKCGHR-YCVDCYRQYLTQKIRDEGEAARIQCPSDGCGRILDSRS 378

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + EL  RY  LL R  +     F+WC A  C +  E     +      P + C +
Sbjct: 379 LDLLVTSELTGRYHELLNRTYVEDKNIFKWCPAPDCPNAVECNIKKNDLNKVVPTVEC-S 437

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 438 CGFRFCFGCPNPDHQPAPCDLVKKWLKKCADDSETANWINANTKECPKCQSTIEKNGGCN 497

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 498 HMTCRKCRYEFCWMCMGLWSE---HGTSWY 524



>gi|403333348|gb|EJY65764.1| IBR domain containing protein [Oxytricha trifallax]
          Length = 1495

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 14/196 (7%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQV-RCPKSRCPIELTYE 66
           C +C  +Y+        C H   C  C+  ++E   N   G V+V +C  ++C  E T E
Sbjct: 273 CEICYMNYNESDLYGIKCNHR-YCKNCLYDYLE--YNISNGQVRVIKCADAQCKEEFTKE 329

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           DV +  SKE++++Y      + +   P+ +WC    C +   + +  +   +TC  CG +
Sbjct: 330 DVEKFGSKEIYDKYLKFKENIDVNLNPNLKWCPKPNCNN---YISKGKKRKVTC-KCGLE 385

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
            CF   + WH  + C    E +  E F+   A +  +   CP C + +EK  GC+HM+CR
Sbjct: 386 ICFDCGIEWHGKIKC---KEVMDKEFFSW--AANNGNISNCPKCKVRLEKISGCNHMTCR 440

Query: 187 -CGYEFCWLCLGDYEN 201
            CGY +CWLC   Y +
Sbjct: 441 QCGYSWCWLCGKKYTD 456



>gi|403363259|gb|EJY81371.1| IBR domain containing protein [Oxytricha trifallax]
          Length = 632

 Score =  106 bits (264), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 99/192 (51%), Gaps = 10/192 (5%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           T  C +C  D S+ Q    +CGH   C  C K +IE  +N+ G   Q++CP + C +E  
Sbjct: 299 TFNCRICYMDVSMQQIKYLNCGHY-FCEECFKAYIEYMINN-GHAYQIKCPDADCQVEFL 356

Query: 65  YEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACG 124
            + ++ + S+ +FE+Y  L L + + K  + ++C    C +  E    +    + C  C 
Sbjct: 357 AQLMKEILSENMFEKYKRLQLNIEVSKSRNKKFCPIPSCENVIEVKQSNT-KKVQCQKCK 415

Query: 125 AKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
              CF   + WH G+TC +  E+L  + + AN   H     +CP+C   +EKN+GC HM+
Sbjct: 416 NDICFKCQIKWHEGITCAKAQEKL-YKGWAANYGAH-----KCPSCQAPVEKNEGCPHMN 469

Query: 185 C-RCGYEFCWLC 195
           C  CGY +CW C
Sbjct: 470 CSMCGYRWCWGC 481



>gi|336261932|ref|XP_003345752.1| hypothetical protein SMAC_05909 [Sordaria macrospora k-hell]
 gi|380090088|emb|CCC12171.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 608

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   +++CP   C + +    
Sbjct: 213 CDICCEDGPGLESFAIKCGHR-FCVDCYRQYLSQKIREEGEAARIQCPADGCNLIIDARS 271

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + EL ERY  LL+R  +      +WC +  C +  E            P ++C  
Sbjct: 272 LDLLVTPELTERYHELLMRTYVEDKETLKWCPSPDCANAVECGVKKKDLAKVVPTVSC-L 330

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF      H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 331 CGHRFCFGCIYTDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 390

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 391 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 417



>gi|302418562|ref|XP_003007112.1| ariadne-1 [Verticillium albo-atrum VaMs.102]
 gi|261354714|gb|EEY17142.1| ariadne-1 [Verticillium albo-atrum VaMs.102]
          Length = 430

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (48%), Gaps = 9/203 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + ++  +  CGH   C  C + ++  ++  +G   +++CP  RC   L  + 
Sbjct: 128 CDICCEDDADLETFAMKCGHR-YCVACYRHYLNQKIREEGEAARIQCPADRCGRILDSKS 186

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + EL  RY  LL R  +      +WC A  C +  E            P + C A
Sbjct: 187 LDILVTPELSGRYKELLNRTYVEDKDALKWCPAPDCVNAVECGVKKKDLDKVVPTVAC-A 245

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C+     L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 246 CGHRFCFGCILTDHQPAPCSLVKLWLKKCADDSETANWISANTKECPRCNSTIEKNGGCN 305

Query: 182 HMSCR-CGYEFCWLCLGDYENIR 203
           HM+CR C +EFCW+C+G +   R
Sbjct: 306 HMTCRKCKHEFCWMCMGLWSGTR 328



>gi|322694692|gb|EFY86515.1| RING-5 like protein [Metarhizium acridum CQMa 102]
          Length = 527

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP   C   L    
Sbjct: 141 CDICCEDEDGLQTFAMKCGHR-YCVDCYRQYLTQKIKGEGEAARIQCPAEGCGRILDSRS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + EL  RY  LL R  +     F+WC A  C +    G +    D+  P + C  
Sbjct: 200 LDLLVTPELTGRYRELLNRTYVEDKDIFKWCPAPDCPNVVECGIKKKDLDKIVPSVEC-L 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGYRFCFGCPNPDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCSSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 345



>gi|346322205|gb|EGX91804.1| RING finger protein [Cordyceps militaris CM01]
          Length = 876

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C +R++  ++  +G   +++CP   C   L    
Sbjct: 394 CDICCEDEEGLETFAMKCGHR-YCVHCYRRYLTQKIRDEGEAARIQCPSDGCGRSLDSRS 452

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + +L  RY  LL R  +     F+WC A  C +  E            P + C +
Sbjct: 453 LDLLVTSDLTGRYHELLNRTYVEDKDIFKWCPAPDCPNAVECGIKKKDLDKVVPTVEC-S 511

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 512 CGFRFCFGCPNPDHQPAPCDLVRKWLKKCADDSETANWINANTKECPKCQSTIEKNGGCN 571

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 572 HMTCRKCRYEFCWMCMGLWSE---HGTSWY 598



>gi|110617782|gb|ABG78607.1| RING-5 [Fusarium graminearum]
          Length = 529

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 141 CDICCEDDDGLESFAMKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPSDGCGRILDSAS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L +  L  RY  LL R  +    +F+WC A  C +  E        G   P + C  
Sbjct: 200 LDVLVTPALAGRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLGRIVPTVEC-R 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGFRFCFGCPNPDHQPAPCDLVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 345



>gi|121700086|ref|XP_001268308.1| IBR domain protein [Aspergillus clavatus NRRL 1]
 gi|119396450|gb|EAW06882.1| IBR domain protein [Aspergillus clavatus NRRL 1]
          Length = 533

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLAQKIRGEGEAARIECPGEGCHMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L ERY TLL+R  +    + +WC A  C        ++       P + C A
Sbjct: 196 LGLLVTDDLKERYSTLLMRTYVDDKENLKWCPAPNCEYAVNCHVKQRDLNRIVPTVQC-A 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    CT     LQ  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CRHFFCFGCTLNDHQPAPCTLVKMWLQKCEDDSETANWISANTKECPRCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|408397963|gb|EKJ77100.1| hypothetical protein FPSE_02744 [Fusarium pseudograminearum CS3096]
          Length = 717

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 329 CDICCEDDDGLESFAMKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPSDGCGRILDSAS 387

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L +  L  RY  LL R  +    +F+WC A  C +  E        G   P + C  
Sbjct: 388 LDVLVTPALAGRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLGRIVPTVEC-R 446

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 447 CGFRFCFGCPNPDHQPAPCDLVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 506

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 507 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 533



>gi|482807844|gb|EOA84777.1| hypothetical protein SETTUDRAFT_171825 [Setosphaeria turcica Et28A]
          Length = 558

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   +   +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + 
Sbjct: 183 CDICCDDNPNMDTFAMKCGHR-FCLTCYRQYLGTKIQDEGEAARIRCPGEGCTRIVDSKS 241

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY TLL R  +    + +WC A  C    E     +      P + C  
Sbjct: 242 LDLLVTADLHERYHTLLTRTYVDDKENLKWCPAPDCKYAIECPVKSKELTRIVPTVHCN- 300

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG   CF   +  H    C    + ++  ED +    +   +TK+CPNC  +IEKN GC+
Sbjct: 301 CGHAFCFGCTLNNHQPAPCALVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCN 360

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 361 HMTCRKCRNEFCWMCMGKWSE---HGTSWY 387



>gi|164424670|ref|XP_959229.2| hypothetical protein NCU06882 [Neurospora crassa OR74A]
 gi|157070612|gb|EAA29993.2| hypothetical protein NCU06882 [Neurospora crassa OR74A]
          Length = 537

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   +++CP   C + +    
Sbjct: 140 CDICCEDGDGLESFAIKCGHR-YCVDCYRQYLSQKIREEGEAARIQCPADGCNLIIDARS 198

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + EL ERY  LL+R  +      +WC +  C +  E     +      P ++C  
Sbjct: 199 LDILVTPELTERYHELLMRTYVEDKETLKWCPSPDCANAVECGVKKKDLTKVVPTVSC-L 257

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF      H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 258 CGHRFCFGCIYTDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 317

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 318 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 344



>gi|189191638|ref|XP_001932158.1| ankyrin repeat and IBR domain containing protein 1 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187973764|gb|EDU41263.1| ankyrin repeat and IBR domain containing protein 1 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 562

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   +Q  +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + 
Sbjct: 187 CDICCDDDINMQTFAMKCGHR-FCLDCYRQYLGTKIQDEGEAARIRCPGEGCTRIVDSKS 245

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L ++EL +RY TLL R  +    + +WC A  C    E     +      P + C  
Sbjct: 246 LDLLVTEELHDRYHTLLTRTYVDDKENLKWCPAPDCKYAVECGVKSKDLSRIVPTVHC-E 304

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG   CF   +  H    C+   + ++  ED +    +   +TK+CPNC  +IEKN GC+
Sbjct: 305 CGHDFCFGCTLNNHQPAPCSLVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCN 364

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 365 HMTCRKCRNEFCWMCMGKWSE---HGTSWY 391



>gi|46125333|ref|XP_387220.1| hypothetical protein FG07044.1 [Fusarium graminearum PH-1]
          Length = 670

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   L    
Sbjct: 282 CDICCEDDDGLESFAMKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPSDGCGRILDSAS 340

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L +  L  RY  LL R  +    +F+WC A  C +  E        G   P + C  
Sbjct: 341 LDVLVTPALAGRYQELLNRTYVEDKDNFKWCPAPDCPNALECGVKKKDLGRIVPTVEC-R 399

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF    P H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 400 CGFRFCFGCPNPDHQPAPCDLVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 459

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 460 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 486



>gi|346976688|gb|EGY20140.1| ariadne-1 [Verticillium dahliae VdLs.17]
          Length = 518

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + ++  +  CGH   C  C + ++  ++  +G   +++CP  RC   L  + 
Sbjct: 128 CDICCEDDASLETFAMKCGHR-YCVACYRHYLNQKIREEGEAARIQCPADRCGRILDSKS 186

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + EL  RY  LL R  +      +WC A  C +  E            P + C A
Sbjct: 187 LDILVTPELSGRYKELLNRTYVEDKDALKWCPAPDCVNAVECGVKKKDLDKVVPTVAC-A 245

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C+     L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 246 CGHRFCFGCILTDHQPAPCSLVKLWLKKCADDSETANWISANTKECPRCNSTIEKNGGCN 305

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 306 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 332



>gi|500259144|gb|EOO01983.1| putative ibr domain-containing protein [Togninia minima UCRPA7]
          Length = 527

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   CP  +    
Sbjct: 139 CDICCEDEEGLQSFAMKCGHR-YCVNCYRHYLTQKIREEGEAARIQCPSDGCPRIIDARS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE----HTTGDR-FPIITCGA 122
           +  L +  L ERY  LL R  +      +WC A  C +  E        DR  P + C A
Sbjct: 198 LDLLVTPALAERYHQLLNRTYVEDKDTLKWCPAPDCENAVECAVKKKDLDRVVPTVAC-A 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CGHRFCFGCILNDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 343



>gi|336466941|gb|EGO55105.1| hypothetical protein NEUTE1DRAFT_85203 [Neurospora tetrasperma FGSC
           2508]
 gi|350288450|gb|EGZ69686.1| hypothetical protein NEUTE2DRAFT_116384 [Neurospora tetrasperma
           FGSC 2509]
          Length = 537

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   +++CP   C + +    
Sbjct: 140 CDICCEDGDGLESFAIKCGHR-YCVDCYRQYLSQKIREEGEAARIQCPADGCNLIIDARS 198

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + EL ERY  LL+R  +      +WC +  C +  E     +      P ++C  
Sbjct: 199 LDILVTPELTERYHELLMRTYVEDKDTLKWCPSPDCANAIECGVKKKDLTKVVPTVSC-L 257

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF      H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 258 CGHRFCFGCIYTDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 317

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 318 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 344



>gi|67470299|ref|XP_651119.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS]
 gi|56467808|gb|EAL45732.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS]
 gi|449702080|gb|EMD42784.1| IBR domain containing protein [Entamoeba histolytica KU27]
 gi|459661000|gb|EMH76249.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS-B]
 gi|480520905|gb|ENY60652.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS-A]
          Length = 268

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 117/226 (51%), Gaps = 28/226 (12%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C  D  I       CGH   C  C   HI  ++ S  G V+VRCPKS C  ++T+E+
Sbjct: 56  CDICYSDIQIKDMYIFDCGHK-FCLDCCYEHIHEKIFS--GIVKVRCPKSMCCHDITFEE 112

Query: 68  VRRLASK------ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITC 120
           + ++  +      EL ERY+   ++  ++K  + R+C   +CG+G     GD   P I C
Sbjct: 113 IYQIIRRHQPIDQELIERYERFSVQEYLKKENNCRYCP--RCGTG---VIGDPNTPEIEC 167

Query: 121 GACGAKSCFTHDVP-----WHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPNCYMS 173
                K             WH GLTC+Q+ E  ++  E      ++ +++T++CP C  +
Sbjct: 168 QNEECKKKKIKFCFNCKEIWHEGLTCSQYQEWKRMNCEADKRFLSWAQKNTRKCPKCNAT 227

Query: 174 IEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           IEKN GC+HM+C  CGY+FCWLC+ +Y +     +H+    C+ Y+
Sbjct: 228 IEKNRGCNHMTCANCGYQFCWLCMQEYTS-----SHFKNGKCKQYS 268



>gi|115389878|ref|XP_001212444.1| hypothetical protein ATEG_03266 [Aspergillus terreus NIH2624]
 gi|114194840|gb|EAU36540.1| hypothetical protein ATEG_03266 [Aspergillus terreus NIH2624]
          Length = 528

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   ++ CP   C + +  + 
Sbjct: 136 CDICCEDGDDLETYAMRCGHR-FCVDCYRQYLAQKIRGEGEAARIECPGEGCHMIVDSKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY+TLL R  +  + + +WC A  C    +     R      P + C  
Sbjct: 195 LSLLVTNDLKDRYNTLLTRTYVDDMENLKWCPAPNCEYAVDCPVKQRDLRRIVPTVQC-V 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    CT     L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 CRHFFCFGCTLNDHQPAPCTLVKMWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 314 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 340



>gi|472463683|gb|EMS16621.1| IBR domain containing protein [Entamoeba histolytica HM-3:IMSS]
          Length = 262

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 117/226 (51%), Gaps = 28/226 (12%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C  D  I       CGH   C  C   HI  ++ S  G V+VRCPKS C  ++T+E+
Sbjct: 50  CDICYSDIQIKDMYIFDCGHK-FCLDCCYEHIHEKIFS--GIVKVRCPKSMCCHDITFEE 106

Query: 68  VRRLASK------ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITC 120
           + ++  +      EL ERY+   ++  ++K  + R+C   +CG+G     GD   P I C
Sbjct: 107 IYQIIRRHQPIDQELIERYERFSVQEYLKKENNCRYCP--RCGTG---VIGDPNTPEIEC 161

Query: 121 GACGAKSCFTHDVP-----WHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPNCYMS 173
                K             WH GLTC+Q+ E  ++  E      ++ +++T++CP C  +
Sbjct: 162 QNEECKKKKIKFCFNCKEIWHEGLTCSQYQEWKRMNCEADKRFLSWAQKNTRKCPKCNAT 221

Query: 174 IEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           IEKN GC+HM+C  CGY+FCWLC+ +Y +     +H+    C+ Y+
Sbjct: 222 IEKNRGCNHMTCANCGYQFCWLCMQEYTS-----SHFKNGKCKQYS 262



>gi|119472659|ref|XP_001258396.1| IBR domain protein [Neosartorya fischeri NRRL 181]
 gi|119406548|gb|EAW16499.1| IBR domain protein [Neosartorya fischeri NRRL 181]
          Length = 511

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLAQKIREEGEAARIECPGDGCHMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY TLL+R  +    + +WC A  C    +     R      P + C A
Sbjct: 196 LSLLVADDLKERYQTLLMRTYVDDKENLKWCPAPNCEYAVDCPVKQRDLNRIVPTVQC-A 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    CT     L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CKHFFCFGCTLNDHLPSPCTLVKMWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|340966726|gb|EGS22233.1| hypothetical protein CTHT_0017500 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 631

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + ++  +  CGH   C  C ++++  ++  +G   +++CP   C + +    
Sbjct: 244 CDICCEDEAGMETFALKCGHR-YCVACYRQYLAQKIRVEGEAARIQCPTEGCNLIIDARS 302

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY  LL R  +      +WC A  C +  E     +      P + C  
Sbjct: 303 LDILVTPDLTERYHELLYRTYVEDKETLKWCPAPDCPNTIECAVKKKDLHKIVPTVQC-L 361

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 362 CGHRFCFGCALNDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 421

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 422 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 448



>gi|494827998|gb|EON64894.1| hypothetical protein W97_04128 [Coniosporium apollinis CBS 100218]
          Length = 586

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 102/198 (51%), Gaps = 22/198 (11%)

Query: 5   TLECGVCCEDYSII----QQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
           T  C VC +    +    +  +++C H    C  C+ + I +E+++KG + ++ CP+  C
Sbjct: 350 TRSCMVCTDSLPPLDFPARPPTATCSHAVSACQSCLAQWISSEMDAKGWE-RIGCPE--C 406

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHT-TGDRFPII 118
              L Y+D+RR AS E FE+YD       +   P FRWC A  C SGQ H   G  F   
Sbjct: 407 HERLGYDDIRRGASAEDFEKYDHFAALSVLATDPRFRWCVAPGCSSGQIHDEQGGNF--F 464

Query: 119 TCGACGAKSCFTHDVPWHSGLTC---------TQFNEQLQTEDFTANRAYHERHTKQCP- 168
            C  CG + C  H + WH G +C          Q  ++ +  D  A++A  ++ TK+CP 
Sbjct: 465 KCAGCGYEHCVRHGIKWHEGESCFLYDYRTSGLQDRDRHRAADEAASQALMQQITKKCPG 524

Query: 169 -NCYMSIEKNDGCDHMSC 185
            NC   IEKN+GCDHM+C
Sbjct: 525 VNCGWRIEKNEGCDHMTC 542



>gi|407041618|gb|EKE40854.1| IBR domain containing protein [Entamoeba nuttalli P19]
          Length = 268

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 117/226 (51%), Gaps = 28/226 (12%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C  D  I       CGH   C  C   HI  ++ +  G V+VRCPKS C  ++T+E+
Sbjct: 56  CDICYSDIQIQDMYIFDCGHK-FCLDCCYEHIHEKIFN--GIVKVRCPKSMCCHDITFEE 112

Query: 68  VRRLASK------ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITC 120
           + ++  +      EL ERY+   ++  ++K  + R+C   +CG+G     GD   P I C
Sbjct: 113 IYQIIRRHQPIDQELIERYERFSIQEYLKKEKNCRYCP--RCGTG---VIGDPNTPEIEC 167

Query: 121 GACGAKSCFTHDVP-----WHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPNCYMS 173
                K             WH GLTC+Q+ E  ++  E      ++ +++T++CP C  +
Sbjct: 168 QNEECKKKKIKFCFNCKEIWHEGLTCSQYQEWKRMNCEADKRFLSWAQKNTRKCPKCNAT 227

Query: 174 IEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           IEKN GC+HM+C  CGY+FCWLC+ +Y +     +H+    C+ Y+
Sbjct: 228 IEKNRGCNHMTCANCGYQFCWLCMQEYTS-----SHFKNGKCKQYS 268



>gi|242790269|ref|XP_002481528.1| RING finger protein [Talaromyces stipitatus ATCC 10500]
 gi|218718116|gb|EED17536.1| RING finger protein [Talaromyces stipitatus ATCC 10500]
          Length = 512

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP+  C   +  + 
Sbjct: 138 CSICCEDGDDLETYAMRCGHR-FCVDCFRHYLSQKIKEEGEAARIQCPQDNCHRIVDSKS 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + EL +RY TLL R  +    + +WC A  C    E     R      P + C A
Sbjct: 197 LNLLVTDELKDRYKTLLTRTYVDDKDNLKWCPAPNCEFAVECGVKARDLNKIVPTVHC-A 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+     L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CKHSFCFGCGLNDHQPPPCSLVKMWLKKCEDDSETANWISANTKECPKCLSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 342



>gi|195589272|ref|XP_002084376.1| GD14237 [Drosophila simulans]
 gi|194196385|gb|EDX09961.1| GD14237 [Drosophila simulans]
          Length = 341

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 106/215 (49%), Gaps = 15/215 (6%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C    S  + I   CGHN  C+ C K+++  +  S+G    ++CP + C I + Y  
Sbjct: 136 CGICF--CSCDELIGLGCGHN-FCAACWKQYLANKTCSEGLANTIKCPATNCEILVDYIS 192

Query: 68  VRRLAS-KELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
             +LA   E+ ERY  L+    +      RWC A  C    +    +  P      CG +
Sbjct: 193 FLKLADDPEVVERYQQLITNTFVECNTLMRWCPAPNCSHAVKAVCAE--PRAVLCKCGHE 250

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQ--TEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
            CF     WH   +C+     ++   ED +    +  ++TK+CP C ++IEK+ GC+HM 
Sbjct: 251 FCFACGENWHEPASCSSLKTWVKKCLED-SETSNWIAQNTKECPKCNVTIEKDGGCNHMV 309

Query: 185 CR---CGYEFCWLCLGDYENIRTHGNHYHAPTCQY 216
           C+   C Y+FCW+CLG +E    HG  ++ P  QY
Sbjct: 310 CKNPSCRYDFCWVCLGSWE---PHGVPFYTPYNQY 341



>gi|380473790|emb|CCF46118.1| hypothetical protein CH063_14968, partial [Colletotrichum
           higginsianum]
          Length = 422

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 89/153 (58%), Gaps = 10/153 (6%)

Query: 7   ECGVCCEDYSI----IQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC +C E        +  ++ +C H  + C  C++  I ++LNSK    ++RCP+ R P+
Sbjct: 247 ECPICAETRDPASFPVLSVTPTCTHPPEACLDCLQTSIRSDLNSKLW-TEIRCPECREPL 305

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           E  Y D+++ A +E F RY+ L LR A+ +   F WC A  CGSGQ H  G   P++TC 
Sbjct: 306 E--YVDIQKYADEETFARYEALALRAAMAEADTFIWCTA-NCGSGQLHDMGGDRPLVTCL 362

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQ-TEDF 153
            CG +SCFTH + WH  L+C +++  L+  E+F
Sbjct: 363 HCGQRSCFTHGIAWHENLSCDEYDALLRDPENF 395



>gi|451853358|gb|EMD66652.1| hypothetical protein COCSADRAFT_300717 [Bipolaris sorokiniana
           ND90Pr]
          Length = 513

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   +   +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + 
Sbjct: 138 CDICCDDDPNMDTFAMKCGHR-FCLDCYRQYLATKIQDEGEAARIRCPGEGCTRIVDSKS 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY TLL R  +    + +WC A  C    E     +      P + C  
Sbjct: 197 LDLLVTADLHERYHTLLTRTYVDDKENLKWCPAPDCKYAIECPVKSKELTRVVPTVHCD- 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG   CF   +  H    C    + ++  ED +    +   +TK+CPNC  +IEKN GC+
Sbjct: 256 CGHAFCFGCTLNNHQPAPCALVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCRNEFCWMCMGKWSE---HGTSWY 342



>gi|255538518|ref|XP_002510324.1| Protein ariadne-1, putative [Ricinus communis]
 gi|223551025|gb|EEF52511.1| Protein ariadne-1, putative [Ricinus communis]
          Length = 560

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 103/200 (51%), Gaps = 5/200 (2%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKG-GDVQVRCPKSRCPIEL 63
            ++CG+C E +   +  S++CGH+  C  C   +I   +N+ G G + +RCP+  C + +
Sbjct: 142 VVDCGICFESFPFEKTSSAACGHH-YCIDCWSCYISTSINNDGLGCLMLRCPEPSCRVAV 200

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
            ++ +  L S++   +Y    +R  I++    +WC  + C +  E   GD    +TC  C
Sbjct: 201 GHDMIDLLVSRDDRNKYARCFVRSYIQENRKMKWCPGRDCDNAIEFLDGDGSFDVTCD-C 259

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQL-QTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDH 182
               C+  D   H  + C    + + + +  + N  Y   + K CPNC   IEKN+GC H
Sbjct: 260 FTSFCWNCDEESHRPVDCDTVKKWISKNQSESENINYILTYCKPCPNCRRPIEKNEGCMH 319

Query: 183 MSCR-CGYEFCWLCLGDYEN 201
           M+CR CG+ FCWLCL  Y N
Sbjct: 320 MTCRVCGHSFCWLCLASYNN 339



>gi|259481769|tpe|CBF75602.1| TPA: RING finger protein (AFU_orthologue; AFUA_6G12540)
           [Aspergillus nidulans FGSC A4]
          Length = 511

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP + C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLAQKIREEGEAARIQCPGNDCHMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY TLL R  +    + +WC A  C    +     R      P + CG 
Sbjct: 196 LSLLVTDDLKDRYQTLLTRTYVDDKENLKWCPAPNCEYAVDCHVKQRELHRIVPTVQCG- 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      LQ  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CKHYFCFGCTLNDHQPSPCRLVKMWLQKCEDDSETANWISANTKECPKCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|449299861|gb|EMC95874.1| hypothetical protein BAUCODRAFT_507371 [Baudoinia compniacensis
           UAMH 10762]
          Length = 517

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  + +CGH   C  C ++++  ++  +G   +++CP   C   +  + 
Sbjct: 142 CDICCEDTPGLESFAMNCGHR-FCVDCYRQYLVQKIKGEGEAARIKCPGDGCNKIIDAKS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   EL ERY+ LL+R  +    + +WC A  C    E     R      P + C  
Sbjct: 201 LDLLVPTELTERYNELLMRTYVDDKENLKWCPAPNCVYAVECGVKKRDLNKIVPSVHCD- 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C    + L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 260 CKHAFCFGCTLADHQPCPCVLVKKWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKNEFCWMCMGVWSE---HGTSWY 346



>gi|310796238|gb|EFQ31699.1| IBR domain-containing protein [Glomerella graminicola M1.001]
          Length = 531

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  S  CGH   C  C + ++  ++  +G   +++CP   C   +  + 
Sbjct: 142 CDICCEDEDGLQTFSLKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPAEGCGRIIDSKS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + +L  RY+ LL R  +      +WC A  C +    G +    DR  P + CG 
Sbjct: 201 LDLLVASDLNSRYNELLNRTYVEDRDTLKWCPAPDCPNAIECGIKKKDLDRIVPTVACG- 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 260 CGHRFCFGCILNDHQPAPCELVRRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 346



>gi|406861964|gb|EKD15016.1| IBR domain-containing protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 604

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + +Q  +  CGH   C  C  +++  ++  +G   +++CP+  C   L  + 
Sbjct: 228 CDICCEDEAGLQSFAMKCGHR-YCVTCYNQYLTQKIKEEGEAARIQCPQDGCKRILDSKS 286

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + +L +RY  LL R  +      +WC A  C +  E        G   P + C  
Sbjct: 287 LDLLVTVDLNDRYLELLTRTYVEDKEQLKWCPAPDCVNAIECGIKKKDLGKVVPTVACD- 345

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 346 CKHRFCFGCGLSDHQPAPCDLVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 405

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 406 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 432



>gi|471196425|ref|XP_004255171.1| ariadne RING finger, putative [Entamoeba invadens IP1]
 gi|440295487|gb|ELP88400.1| ariadne RING finger, putative [Entamoeba invadens IP1]
          Length = 251

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 103/211 (48%), Gaps = 19/211 (9%)

Query: 6   LECGVC-CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           LECG+C  E        +  CGH+  C  C+  H+  ++N    +  ++CP+  C  E+ 
Sbjct: 43  LECGICFSESDQSFFYTNPFCGHS-FCIPCLSDHVRTKIND--ANTIIKCPQGGCTSEIP 99

Query: 65  YEDVRRLA---SKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS---GQEHTTGDRFPII 118
           Y D+          L ++YD  L R+++    +  +C   KCG+   G+  TT     ++
Sbjct: 100 YNDLVDFGLVTDPALLQKYDATLTRLSLDNDTNTVYCI--KCGTAMIGEPSTT-----MV 152

Query: 119 TCGACGAKSCFTHDVPWHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPNCYMSIEK 176
            C  C    C      WH+  TC ++ +  +   +  TA   Y   H K CPNC+  IEK
Sbjct: 153 RCVKCDYCFCCRCKEQWHADSTCEKYQQWKKDNAKGSTAFEEYIRNHAKLCPNCHQPIEK 212

Query: 177 NDGCDHMSCRCGYEFCWLCLGDYENIRTHGN 207
           N GC+HM+C+CGY+FCWLC+  Y +     N
Sbjct: 213 NGGCNHMTCKCGYQFCWLCMQKYTSTHFLSN 243



>gi|358394310|gb|EHK43703.1| hypothetical protein TRIATDRAFT_35778 [Trichoderma atroviride IMI
           206040]
          Length = 183

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 10/165 (6%)

Query: 21  ISSSCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFER 79
           I+  C H    C  C+++ + +EL  K  +  ++CP+  C   L Y+++++ A  +  ++
Sbjct: 22  ITKECTHFPTACLRCLRKMLRSELERKQWE-DIKCPE--CGAVLQYQEIQKFADDDTKKK 78

Query: 80  YDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGL 139
            DTL+++ A +  P+F WC +  CG GQ H  G   PI+ C +C   +CF H  PWH GL
Sbjct: 79  LDTLIIQRATQDDPNFLWCSSD-CGFGQLHEGGSDEPIMRCNSCSNLTCFQHKKPWHKGL 137

Query: 140 TCTQFNEQ-----LQTEDFTANRAYHERHTKQCPNCYMSIEKNDG 179
           TC QF+EQ        ++  A+    ++ TK CPNC + I+KN G
Sbjct: 138 TCEQFDEQEAASARHKKEDAASTETIKQVTKPCPNCKVHIQKNGG 182



>gi|453081502|gb|EMF09551.1| hypothetical protein SEPMUDRAFT_92347 [Mycosphaerella populorum
           SO2202]
          Length = 246

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 99/199 (49%), Gaps = 13/199 (6%)

Query: 28  NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRV 87
            ++C  C + +++ ++ +   D +++C  + C + L   D+R L  +  +++Y       
Sbjct: 28  GEVCFACWEIYLQMQIEATSTD-KIKC--AECNVLLAEADIRHLVGRTTYDKYTDKASLE 84

Query: 88  AIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQ 147
            +++ P FR C +  C  G  HTT     I  C  C  + C   +V  H G TC  +  +
Sbjct: 85  FMKQDPLFRVCPSATCSYGYIHTTAADGNIFRCQLCQCRYCILCEVVMHEGETCGDYQLR 144

Query: 148 LQTEDF------TANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYE 200
           ++ +        TA+R Y + H+K+CP C + I+KN GCDHM+C  C +EFCW+CL  Y 
Sbjct: 145 VRKQPGAHKKHETASRKYLKAHSKKCPKCTIHIQKNHGCDHMTCNLCHHEFCWVCLATYN 204

Query: 201 ---NIRTHGNHYHAPTCQY 216
               I   GN  H   C Y
Sbjct: 205 GPRGIHRRGNEAHRKGCHY 223



>gi|380479124|emb|CCF43208.1| IBR domain-containing protein [Colletotrichum higginsianum]
          Length = 531

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  S  CGH   C  C + ++  ++  +G   +++CP   C   +  + 
Sbjct: 142 CDICCEDEDGLQTFSLKCGHR-YCVDCYRHYLTQKIREEGEAARIQCPAEGCGRIIDSKS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + +L  RY+ LL R  +      +WC A  C +    G +    DR  P + CG 
Sbjct: 201 LDLLVASDLNSRYNELLNRTYVEDKDILKWCPAPDCPNAVECGIKKKDLDRIVPTVACG- 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 260 CGHRFCFGCILNDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 346



>gi|167381630|ref|XP_001735792.1| ariadne RING finger [Entamoeba dispar SAW760]
 gi|165902076|gb|EDR27997.1| ariadne RING finger, putative [Entamoeba dispar SAW760]
          Length = 268

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 115/226 (50%), Gaps = 28/226 (12%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C  D  I       CGH   C  C   HI  ++ +  G V +RCPKS C   +T+E+
Sbjct: 56  CDICYSDIKIQDIYIFDCGHK-FCIDCCYEHIHEKIFN--GVVNIRCPKSNCCHIITFEE 112

Query: 68  VRRLASK------ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGD-RFPIITC 120
           V ++  +      EL ERY+   ++  ++K  + R+C   +CG+G     GD   P I C
Sbjct: 113 VYQIIRRHQPIDQELIERYERYSIQEYLKKENNCRYCP--QCGTG---VIGDPNIPEIEC 167

Query: 121 GACGAKSCFTHDVP-----WHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPNCYMS 173
                K             WHSGLTC+Q+ E  ++  E      ++ +++T++CP C  +
Sbjct: 168 QNEECKKKKIKFCFNCKEIWHSGLTCSQYQEWKRMNCEADKRFLSWAQKNTRKCPKCNAT 227

Query: 174 IEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           IEKN GC+HM+C  CGY+FCWLC+ +Y       +H+    C+ Y+
Sbjct: 228 IEKNRGCNHMTCVNCGYQFCWLCMQEYT-----SSHFKNGKCKQYS 268



>gi|357460861|ref|XP_003600712.1| hypothetical protein MTR_3g065410 [Medicago truncatula]
 gi|355489760|gb|AES70963.1| hypothetical protein MTR_3g065410 [Medicago truncatula]
          Length = 606

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 95/199 (47%), Gaps = 5/199 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y + +  ++SCGH   C  C + +I   +N   G + +RCP   C   +  
Sbjct: 157 LTCGICFEAYRLSKIHTASCGH-PYCFSCWRGYIGTSINDGPGCLMLRCPDPACGAAVDQ 215

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+YD  L+R  I      +WC A  C        G     ++C  C  
Sbjct: 216 DTINLLASAEDKEKYDRYLVRSYIENNKKTKWCPAPGCEHAVNFDAGGENYDVSC-LCSY 274

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   +TK CP C   IEKN+GC HM+
Sbjct: 275 SFCWNCTEDAHRPVDCDTVSKWILKNSAESENTTWILAYTKPCPKCKRPIEKNNGCMHMT 334

Query: 185 CR--CGYEFCWLCLGDYEN 201
           C   C +EFCWLCLG + N
Sbjct: 335 CTQPCRFEFCWLCLGSWSN 353



>gi|477527715|gb|ENH79530.1| ring finger [Colletotrichum orbiculare MAFF 240422]
          Length = 549

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 86/150 (57%), Gaps = 9/150 (6%)

Query: 5   TLECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
           T EC +C E     +     ++ SC H   +C  C++  I  + NSK    ++RCP+ R 
Sbjct: 258 TRECPICAETREAFEFPKLSVTLSCSHPPGVCLECLRTSIRCDFNSKLW-TEIRCPECRE 316

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
            +E  Y D+++ A +  F RY++L LR A+ +  +F WC A  CGSGQ H TG   PI+T
Sbjct: 317 VLE--YADIQKYADEATFARYESLALRAAMAEAENFIWCPAN-CGSGQLHDTGADQPIVT 373

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQLQ 149
           C  C  +SCFTH+V WH  LTC +++  L+
Sbjct: 374 CLTCSQRSCFTHNVVWHERLTCKEYDALLR 403



>gi|429852833|gb|ELA27950.1| ring-5 like protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 553

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  S  CGH   C  C + ++  ++  +G   +++CP   C   +  + 
Sbjct: 164 CDICCEDEEGLQTFSLKCGHR-YCVDCYRHYLNQKIREEGEAARIQCPAEGCGRIIDSKS 222

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE----HTTGDRF-PIITCGA 122
           +  L + EL  RY  LL R  +      +WC A  C +  E        DR  P + C A
Sbjct: 223 LDLLVTPELGSRYHELLNRTYVEDKDSLKWCPAPDCPNAVECPIKKKDLDRIVPTVAC-A 281

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 282 CGHRFCFGCILNDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 341

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 342 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 368



>gi|470525854|ref|XP_004356665.1| e3 ubiquitinprotein ligase rbra, putative [Acanthamoeba castellanii
           str. Neff]
 gi|440803882|gb|ELR24765.1| e3 ubiquitinprotein ligase rbra, putative [Acanthamoeba castellanii
           str. Neff]
          Length = 513

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 11/213 (5%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC VC +DY      +  CGH   CS C K ++E ++      +  +C   +C   +  E
Sbjct: 128 ECLVCMDDYKNSDSFALPCGHR-YCSTCWKNYLEVKIADGPECITTKCMAPKCGSVVHEE 186

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
            V+++   + F  Y   LLR  +   P  +WC A  C +       +R   + CG CG +
Sbjct: 187 AVKKIVDAKEFALYSKYLLRSFVDDNPKVKWCPAPHCSNCVRCERQNRQEAVACG-CGFR 245

Query: 127 SCFT---HDVPWHSGLTCTQFNE-QLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDH 182
            CF     ++  H    C   +  Q +  D + N  +   +TK+CP C   IEKN GC H
Sbjct: 246 FCFKCCDFEIGDHMPADCETVDLWQQKAADESENVTWMIANTKKCPQCRSPIEKNGGCMH 305

Query: 183 MSCR-----CGYEFCWLCLGDYENIRTHGNHYH 210
           M+CR     CG+EFCWLC G + +  +H   Y+
Sbjct: 306 MTCRKNAGGCGFEFCWLCRGPWSDHGSHTGGYY 338



>gi|258568024|ref|XP_002584756.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237906202|gb|EEP80603.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 518

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP+ +C   +  + 
Sbjct: 141 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLAQKIKEEGEAARIQCPQDQCQQIVDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L +K+L ERY  LL R  +    D +WC A  C          R      P + C +
Sbjct: 200 LELLVTKDLKERYHILLTRTYVDDKTDLKWCPAPNCEYAVNCAVKTRELDRIVPTVRC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C    + ++  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 259 CTHAFCFGCTLNDHQPTPCAIVKKWVKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 345



>gi|70992567|ref|XP_751132.1| RING finger protein [Aspergillus fumigatus Af293]
 gi|66848765|gb|EAL89094.1| RING finger protein [Aspergillus fumigatus Af293]
 gi|159124703|gb|EDP49821.1| RING finger protein [Aspergillus fumigatus A1163]
          Length = 532

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLAQKIREEGEAARIECPGDGCHMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY TLL+R  +    + +WC A  C    +     R      P + C A
Sbjct: 196 LSLLVADDLKERYQTLLMRTYVDDKENLKWCPAPNCEYAVDCPVKQRDLNRIVPTVQC-A 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CKHFFCFGCTLNDHLPSPCKLVKMWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|146162447|ref|XP_001009638.2| IBR domain containing protein [Tetrahymena thermophila]
 gi|146146385|gb|EAR89393.2| IBR domain containing protein [Tetrahymena thermophila SB210]
          Length = 515

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 97/200 (48%), Gaps = 13/200 (6%)

Query: 3   ETTLECGVCCEDYSIIQQISS-SCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           +  LEC +CC++Y+I ++    +C H   CS C+K++I  ++N     + + CP+  C  
Sbjct: 205 QQVLECAICCQEYTISKKRPLLNCDH-QFCSDCLKQYILNKINC-CQVLHILCPQEGCDQ 262

Query: 62  ELTYEDVRRLASKEL-FERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
           E   + +  + + +   ERY     R  ++  PD RWC    C +  +    D  P + C
Sbjct: 263 EYNEKQIGEILNDDYQKERYIKFKQRQQLQLDPDIRWCIRPGCNNAIKGQKND--PKLKC 320

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
             C    C+     WH G TC Q  +Q        N+       K CP C   I+KNDGC
Sbjct: 321 SECNMMICYFCTNQWHEGQTCEQAIDQ------EYNQMAKNFKVKYCPQCKTKIQKNDGC 374

Query: 181 DHMSC-RCGYEFCWLCLGDY 199
           +HM+C RC YEFCWLC   Y
Sbjct: 375 NHMTCTRCNYEFCWLCTKQY 394



>gi|322708109|gb|EFY99686.1| RING-5 like protein [Metarhizium anisopliae ARSEF 23]
          Length = 549

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP   C   L    
Sbjct: 141 CDICCEDEDGLQTFAMKCGHR-YCVDCYRQYLTQKIKGEGEAARIQCPADGCGRILDSRS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDRF-PIITCGA 122
           +  L + EL  RY  LL R  +     F+WC A  C +    G +    D+  P + C  
Sbjct: 200 LDLLVTPELTGRYRELLNRTYVEDKDIFKWCPAPDCPNVVECGIKRKDLDKIVPSVEC-L 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF      H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGYRFCFGCPNADHQPAPCELVKRWLKKCADDSETANWISANTKECPKCSSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 345



>gi|171679387|ref|XP_001904640.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939319|emb|CAP64547.1| unnamed protein product [Podospora anserina S mat+]
          Length = 528

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C I +    
Sbjct: 139 CDICCEDEEGLQSFALKCGHR-FCVDCYRHYLGQKIREEGEAARIQCPAEGCNIIIDARS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + EL ERY  LL R  +      +WC A  C +  E     +      P + C +
Sbjct: 198 LDLLVTAELTERYHKLLNRTYVEDKETLKWCPAPDCQNAIECGIKKKDLTRIVPTVAC-S 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CSHRFCFGCILNDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 343



>gi|367048091|ref|XP_003654425.1| hypothetical protein THITE_2117452 [Thielavia terrestris NRRL 8126]
 gi|347001688|gb|AEO68089.1| hypothetical protein THITE_2117452 [Thielavia terrestris NRRL 8126]
          Length = 528

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C + +    
Sbjct: 139 CDICCEDEPGLQTFALKCGHR-YCVDCYRHYLSQKILGEGEAARIQCPAEGCNLIIDARS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE----HTTGDR-FPIITCGA 122
           +  L +++L ERY  LL R  +      +WC A  C +  E        DR  P ++C  
Sbjct: 198 LDLLVTQDLTERYHELLHRTYVEDKETLKWCPAPDCENAIECAVKKKDLDRVVPTVSC-L 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CGHRFCFGCALNDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 343



>gi|471200017|ref|XP_004256870.1| ariadne RING finger, putative [Entamoeba invadens IP1]
 gi|440297405|gb|ELP90099.1| ariadne RING finger, putative [Entamoeba invadens IP1]
 gi|511092807|dbj|BAN42163.1| ariadne RING finger, putative [Entamoeba invadens]
          Length = 269

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 112/230 (48%), Gaps = 22/230 (9%)

Query: 1   MTETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           + +    C +C ED          C H+  C  C   HI  ++ +  G   +RCP S C 
Sbjct: 50  LQDKVYTCDICYEDVPASSVYIFDCDHH-FCLGCAYDHIHTQIFN--GVTDIRCPFSGCG 106

Query: 61  IELTYEDVRRLA------SKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS---GQEHTT 111
             +++E++ ++        K+L +RY+  L+   ++  P+ R+C   KCG+   G  +T 
Sbjct: 107 HVISFEEIYQIIRNHEPYDKDLADRYERFLVNDYMKHEPNCRYCP--KCGNAILGDPNTP 164

Query: 112 GDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNE--QLQTEDFTANRAYHERHTKQCPN 169
                   C     + CF     WH GLTC Q+ E  ++  E      ++ +++T++CP 
Sbjct: 165 EIFCRSEECKKVNFRFCFNCKEAWHEGLTCAQYQEWKRMNCEADKRFLSWAQKNTRKCPK 224

Query: 170 CYMSIEKNDGCDHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYYA 218
           C  +IEKN GC+HM+C  CGY+FCWLC+  Y       NH+    C+ Y+
Sbjct: 225 CSATIEKNRGCNHMTCANCGYQFCWLCMAPYT-----SNHFRNGKCKQYS 269



>gi|440465234|gb|ELQ34574.1| IBR domain protein [Magnaporthe oryzae Y34]
          Length = 783

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 9/157 (5%)

Query: 5   TLECGVCCEDYS----IIQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
           T EC VC E++       + ++S+C H  + C  C+K  I +++N+K    ++ CP+  C
Sbjct: 108 TRECAVCTEEFPDSNFPTKAVTSACSHAINTCKTCLKTSIRSDMNNKFWH-RISCPE--C 164

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
              L  EDV R A  E  E+Y  L      +  P FRWC A  CG+GQEH+ G   P++ 
Sbjct: 165 GASLMQEDVERHAEPETIEKYRKLKENADRQASPSFRWCAA-GCGAGQEHSGGPNQPMMI 223

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTAN 156
           C  C AKSCF H+  WH G TC Q+++  + ++  A+
Sbjct: 224 CQQCNAKSCFNHESRWHEGFTCRQWDKVTEPDESVAS 260



>gi|384494946|gb|EIE85437.1| hypothetical protein RO3G_10147 [Rhizopus delemar RA 99-880]
          Length = 509

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 102/211 (48%), Gaps = 12/211 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   +  +  SC H   C  C  +++  ++  +G   +++CP+S C + +  + 
Sbjct: 130 CDICCDDSGEMDTVCISCEHR-FCKNCYTQYLYQKIREEGESRRIQCPESECTLIVDEKT 188

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           V  L  K  F +Y  LL R  +      +WC A  C    E      +     P + C  
Sbjct: 189 VELLVDKVTFAKYRELLNRTFVDDNDFLKWCPAPDCEYAVECNIPSTSLTSVVPTVECN- 247

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C   N+ L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 248 CSHRFCFGCTLNDHQPCICALVNKWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 307

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYHA 211
           HM+CR C YEFCW+C+G +     HG  ++ 
Sbjct: 308 HMTCRKCKYEFCWVCMGPWSE---HGTSWYT 335



>gi|389638068|ref|XP_003716667.1| IBR domain-containing protein [Magnaporthe oryzae 70-15]
 gi|351642486|gb|EHA50348.1| IBR domain-containing protein [Magnaporthe oryzae 70-15]
 gi|440487628|gb|ELQ67406.1| IBR domain protein [Magnaporthe oryzae P131]
          Length = 783

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 9/157 (5%)

Query: 5   TLECGVCCEDYS----IIQQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
           T EC VC E++       + ++S+C H  + C  C+K  I +++N+K    ++ CP+  C
Sbjct: 108 TRECAVCTEEFPDSNFPTKAVTSACSHAINTCKTCLKTSIRSDMNNKFWH-RISCPE--C 164

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
              L  EDV R A  E  E+Y  L      +  P FRWC A  CG+GQEH+ G   P++ 
Sbjct: 165 GASLMQEDVERHAEPETIEKYRKLKENADRQASPSFRWCAA-GCGAGQEHSGGPNQPMMI 223

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTAN 156
           C  C AKSCF H+  WH G TC Q+++  + ++  A+
Sbjct: 224 CQQCNAKSCFNHESRWHEGFTCRQWDKVTEPDESVAS 260



>gi|357154274|ref|XP_003576728.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like
           [Brachypodium distachyon]
          Length = 560

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 101/209 (48%), Gaps = 8/209 (3%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E YS     S+SC H   C+ C + +I A +N   G + +RCP+  C   +  
Sbjct: 134 LTCGICFEGYSTSALSSASCVHF-YCNECWEGYISASINDGPGCLALRCPEPSCSAMVLE 192

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           E + RLA  E   +Y   +LR  I      +WC A  C    E   GD    ++C  C  
Sbjct: 193 ETINRLAKDEDKVKYKKFVLRSYIEDNKKMKWCPAPDCTRAVEF-LGDLNYDVSC-MCKF 250

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  ++C   ++  L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 251 NFCWNCTEETHRPVSCETVSKWILKNSSESENMNWIIANSKPCPKCKRPIEKNQGCMHMT 310

Query: 185 CR--CGYEFCWLCLGDYE--NIRTHGNHY 209
           C   C ++FCWLCLG +    IRT G +Y
Sbjct: 311 CTPPCKFQFCWLCLGAWSEHGIRTGGGYY 339



>gi|452981589|gb|EME81349.1| hypothetical protein MYCFIDRAFT_52051 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 519

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 9/197 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + ++  +  CGH   C  C ++++  ++  +G   +++CP   C   +  + 
Sbjct: 144 CDICCEDEAGLESFAMRCGHR-FCVNCYRQYLAQKIREEGEAARIKCPGDGCNNIVDAKS 202

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A +C    E     R      P + C  
Sbjct: 203 LDLLVTADLTDRYHELLMRTYVDDKDNLKWCPAPECIYAVECGVKQRDLKRIVPTVHCD- 261

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +P H    C+   + L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 262 CKHSFCFGCTLPDHQPCPCSLVKKWLKKCEDDSETANWISANTKECPKCSSTIEKNGGCN 321

Query: 182 HMSCR-CGYEFCWLCLG 197
           HM+CR C  EFCW+C+G
Sbjct: 322 HMTCRKCRNEFCWICMG 338



>gi|212534476|ref|XP_002147394.1| RING finger protein [Talaromyces marneffei ATCC 18224]
 gi|210069793|gb|EEA23883.1| RING finger protein [Talaromyces marneffei ATCC 18224]
          Length = 512

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP+  C   +  + 
Sbjct: 138 CEICCEDGDDLQTYAMRCGHR-FCVDCFRHYLSQKIKEEGEAARIQCPQDHCHRIVDSKS 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L +RY TLL R  +    + +WC A  C        +        P + C A
Sbjct: 197 LNLLVTDDLKDRYKTLLTRTYVDDKDNLKWCPAPNCEFAIDCGVKARDLNKIVPTVHC-A 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+     L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CKHSFCFGCGLNDHQPPPCSLVKMWLKKCEDDSETANWISANTKECPKCLSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 342



>gi|212534478|ref|XP_002147395.1| RING finger protein [Talaromyces marneffei ATCC 18224]
 gi|210069794|gb|EEA23884.1| RING finger protein [Talaromyces marneffei ATCC 18224]
          Length = 531

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 9/197 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP+  C   +  + 
Sbjct: 138 CEICCEDGDDLQTYAMRCGHR-FCVDCFRHYLSQKIKEEGEAARIQCPQDHCHRIVDSKS 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L +RY TLL R  +    + +WC A  C        +        P + C A
Sbjct: 197 LNLLVTDDLKDRYKTLLTRTYVDDKDNLKWCPAPNCEFAIDCGVKARDLNKIVPTVHC-A 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+     L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CKHSFCFGCGLNDHQPPPCSLVKMWLKKCEDDSETANWISANTKECPKCLSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLG 197
           HM+CR C +EFCW+C+G
Sbjct: 316 HMTCRKCKHEFCWMCMG 332



>gi|281211302|gb|EFA85467.1| ariadne-like ubiquitin ligase [Polysphondylium pallidum PN500]
          Length = 564

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 99/205 (48%), Gaps = 11/205 (5%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
             C +C ED+   Q  + SC H   C  C K ++E ++      +   CP  +C +++  
Sbjct: 180 FSCLICLEDFPPSQTFALSCDHR-YCLACWKLYLECKIGEGPECIYSTCPAPKCKVKVHE 238

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           +  ++L     +E+Y   +L+  +   P  +WC A  C         +R   +TC  CG 
Sbjct: 239 DAFKKLIESVAYEKYSNFILKSYVDDNPQVKWCPAPGCVYSVRCDRKERKEAVTC-KCGF 297

Query: 126 KSCFT---HDVPWHSGLTCTQFNEQLQ-TEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           + CF     ++  H    C+Q ++ LQ   D + N  +   +TK+CP C   IEKN GC 
Sbjct: 298 QYCFNCNDSEIGDHMPCPCSQVDKWLQKASDESENVTWMLANTKKCPECRSPIEKNGGCM 357

Query: 182 HMSCR-----CGYEFCWLCLGDYEN 201
           HM+CR     CG+EFCWLC G + +
Sbjct: 358 HMTCRKNAGGCGFEFCWLCRGPWSD 382



>gi|296417176|ref|XP_002838236.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634160|emb|CAZ82427.1| unnamed protein product [Tuber melanosporum]
          Length = 507

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 105/215 (48%), Gaps = 18/215 (8%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
             C +CC+D   ++  +  CGH   C+ C +++IE+++  +G   ++ CP   C   +  
Sbjct: 129 FSCEICCDDERGLETYAMKCGHR-YCADCYRQYIESKIKDEGEASRIECPSEGCSRIVGS 187

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCG--------SGQEHTTGDRFPI 117
           + +  L   E+  RY  LL R  +   P+ RWC A  C           Q H+     P 
Sbjct: 188 KTIDLLVPSEINHRYRELLNRTYVDDKPNLRWCPAPNCEYVVDCAIRPTQLHSI---VPT 244

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEK 176
           + C +C  + CF      H    C    + L+  ED +    +   +TK+CP C  +IEK
Sbjct: 245 VQC-SCSHQFCFGCGYADHLPCPCLLVKKWLKKCEDDSETANWISANTKECPKCVSTIEK 303

Query: 177 NDGCDHMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           N GC+HM+CR C +EFCW+C+G ++    HG  ++
Sbjct: 304 NGGCNHMTCRKCKHEFCWVCMGPWQE---HGTSWY 335



>gi|145490195|ref|XP_001431098.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124398201|emb|CAK63700.1| unnamed protein product [Paramecium tetraurelia]
          Length = 442

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 24  SCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTL 83
           SC H + C  CI  H++  +  +G  + + CP+  C  + +   ++ L S  L+E+Y   
Sbjct: 153 SCSH-EFCKSCIVAHLKENI-IRGNVLVIMCPQLSCSEQFSNPQIKDLVSHNLYEKYQRF 210

Query: 84  LLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQ 143
             R  I K  + RWC    C   + +  G+   ++TC +CG + CF     +H G++C Q
Sbjct: 211 HRRQLISKDKNVRWCPRIDC---ENYVIGNGNNLLTC-SCGQQICFKCGSQYHQGMSCEQ 266

Query: 144 FNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC-RCGYEFCWLCLGDY 199
                   DF    A  +     CPNC + IEK  GC+HM+C +C YEFCW+C G Y
Sbjct: 267 ------AMDFQYLEARKQLEVNDCPNCSVPIEKKGGCNHMTCFKCEYEFCWVCRGKY 317



>gi|116203713|ref|XP_001227667.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88175868|gb|EAQ83336.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 531

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C I +    
Sbjct: 142 CDICCEDEPGLESFALKCGHR-YCVDCYRHYLSQKIQGEGEAARIQCPSEGCTIIIDARS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + EL ERY  LL R  +      +WC A  C +  E            P ++C  
Sbjct: 201 LDLLVTPELTERYHELLHRTYVEDKETLKWCPAPDCQNAVECGVKKKDLDKVVPTVSC-L 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 260 CSHRFCFGCILNDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 346



>gi|470486393|ref|XP_004344600.1| IBR domain containing protein [Acanthamoeba castellanii str. Neff]
 gi|440799814|gb|ELR20857.1| IBR domain containing protein [Acanthamoeba castellanii str. Neff]
          Length = 536

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 92/178 (51%), Gaps = 10/178 (5%)

Query: 31  CSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIR 90
           C  C++ + +  +N  G  +++ CP   C   +  +D++ + + + F RY    L  ++R
Sbjct: 297 CKACLRGNYDVLIND-GKVLKLTCPNPTCAAAVEEDDLKNILTNKQFVRYQQFYLLASLR 355

Query: 91  KLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQT 150
             P  RWC    C +    +  D    + C +C  + C+  ++ WH G+TC +   Q Q 
Sbjct: 356 NDPTVRWCPKIGCETAAHGSEEDCH--MKCSSCSTEFCWKCNLEWHEGITCERARRQAQK 413

Query: 151 EDFTANRA------YHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCWLCLGDYEN 201
                 RA      Y ++  + CP C   I+KNDGC+HM+C+ C Y+FCW+C+G++++
Sbjct: 414 GKKKMTRAERKAERYIKKKARPCPKCKTPIQKNDGCNHMTCQGCRYQFCWICMGEFQS 471



>gi|470316672|gb|EMR08418.1| hypothetical protein PNEG_03254 [Pneumocystis murina B123]
          Length = 435

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 100/211 (47%), Gaps = 14/211 (6%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   ++ CP  +C   +T   
Sbjct: 58  CEICCEDEKSLQTYALQCGHR-YCKHCYEHYLTQKIKEEGESCRIYCPGEKCNYIVTERA 116

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQ------KCGSGQEHTTGDRFPIITCG 121
           +  L S E+  RY  LL R  +      R+C A       KC   Q   T    P + C 
Sbjct: 117 IELLVSPEISRRYTALLDRTYVNDNEHLRYCPAPNCEYTIKCRIEQRQLTSI-VPTVVC- 174

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
            CG + CF   +  H    C      L+  ED +    +   +TK+CP C  +IEKN GC
Sbjct: 175 LCGQRFCFGCGLSDHQPCICILVKMWLKKCEDDSETANWISANTKECPKCNATIEKNGGC 234

Query: 181 DHMSC-RCGYEFCWLCLGDYENIRTHGNHYH 210
           +HM C +C YEFCW+C+G +     HG +++
Sbjct: 235 NHMICKKCKYEFCWVCIGPWSE---HGTNWY 262



>gi|367031716|ref|XP_003665141.1| hypothetical protein MYCTH_2308537 [Myceliophthora thermophila ATCC
           42464]
 gi|347012412|gb|AEO59896.1| hypothetical protein MYCTH_2308537 [Myceliophthora thermophila ATCC
           42464]
          Length = 528

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C + +    
Sbjct: 139 CDICCEDEPGLQTFALKCGHR-YCVDCYRHYLSQKIRGEGEAARIQCPSEGCNVIIDARS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +  E     +      P ++C  
Sbjct: 198 LDILVTPDLMARYHELLHRTYVEDKETLKWCPAPDCENAIECAVKKKDLDKVVPTVSC-L 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CGHRFCFGCILNDHQPAPCELVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 343



>gi|119194723|ref|XP_001247965.1| hypothetical protein CIMG_01736 [Coccidioides immitis RS]
 gi|392862795|gb|EAS36536.2| IBR domain-containing protein [Coccidioides immitis RS]
          Length = 518

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP+ +C   +  + 
Sbjct: 141 CDICCEDGEDLQTFAMRCGHR-FCVDCYRHYLVQKIKEEGEAARIQCPQDQCQQIVDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   ++ ERY  LL R  +    + +WC A  C    + +   R      P + C +
Sbjct: 200 LELLVPDDIKERYHILLTRTYVDDKANLKWCPAPNCEFAVDCSVKTRGLDRIVPTVRC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 259 CAHMFCFGCTLNDHQPAPCAIVKMWLKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 345



>gi|303311031|ref|XP_003065527.1| IBR domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105189|gb|EER23382.1| IBR domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 518

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP+ +C   +  + 
Sbjct: 141 CDICCEDGEDLQTFAMRCGHR-FCVDCYRHYLVQKIKEEGEAARIQCPQDQCQQIVDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   ++ ERY  LL R  +    + +WC A  C    + +   R      P + C +
Sbjct: 200 LELLVPDDIKERYHILLTRTYVDDKANLKWCPAPNCEFAVDCSVKTRELDRIVPTVRC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 259 CAHMFCFGCTLNDHQPAPCAIVKMWLKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 345



>gi|330927034|ref|XP_003301711.1| hypothetical protein PTT_13285 [Pyrenophora teres f. teres 0-1]
 gi|311323345|gb|EFQ90195.1| hypothetical protein PTT_13285 [Pyrenophora teres f. teres 0-1]
          Length = 564

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 103/206 (50%), Gaps = 23/206 (11%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D + +Q  +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + 
Sbjct: 208 CDICCDDDNNMQTFAMKCGHR-FCLDCYRQYLGTKIQDEGEAARIRCPGEGCTRIVDSKS 266

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           +  L ++EL +RY TLL R  +    + +WC A  C    E              CG KS
Sbjct: 267 LDLLVTEELHDRYHTLLTRTYVDDKENLKWCPAPDCKYAVE--------------CGVKS 312

Query: 128 C-FTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
                 VP  +   C+   + ++  ED +    +   +TK+CPNC  +IEKN GC+HM+C
Sbjct: 313 KELARIVP--TPAPCSLVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCNHMTC 370

Query: 186 R-CGYEFCWLCLGDYENIRTHGNHYH 210
           R C  EFCW+C+G +     HG  ++
Sbjct: 371 RKCRNEFCWMCMGKWSE---HGTSWY 393



>gi|320031521|gb|EFW13483.1| RING finger protein [Coccidioides posadasii str. Silveira]
          Length = 518

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP+ +C   +  + 
Sbjct: 141 CDICCEDGEDLQTFAMRCGHR-FCVDCYRHYLVQKIKEEGEAARIQCPQDQCQQIVDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   ++ ERY  LL R  +    + +WC A  C    + +   R      P + C +
Sbjct: 200 LELLVPDDIKERYHILLTRTYVDDKANLKWCPAPNCEFAVDCSVKTRELDRIVPTVRC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  +D +    +   +TK+CP C+ +IEKN GC+
Sbjct: 259 CAHMFCFGCTLNDHQPAPCAIVKMWLKKCKDDSETANWISANTKECPKCHSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 345



>gi|240280594|gb|EER44098.1| RING finger domain-containing protein [Ajellomyces capsulatus H143]
          Length = 596

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   +++CP+S C   +  + 
Sbjct: 220 CDICCEDGPDMETYSMRCGHR-FCVECYRHYLGQKIGEEGETARIQCPRSNCHRIVDSKT 278

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C +
Sbjct: 279 LDLLVTDDLRDRYHLLLMRTYVDDKENLKWCPAPNCEFAIDCPVKRRELNRIVPTVQC-S 337

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 338 CNHSFCFGCTLNDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCASTIEKNGGCN 397

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 398 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 424



>gi|134075454|emb|CAK48015.1| unnamed protein product [Aspergillus niger]
          Length = 504

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 130 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLRQKIREEGEAARIECPSDSCNMIVDSKS 188

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY+ LL R  +    + +WC A  C    +     R      P + C  
Sbjct: 189 LGLLVTNDLKERYNALLTRTYVDDKDNLKWCPAPNCEYAVDCPVKQRDLRRIVPTVQCD- 247

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 248 CRHYFCFGCTLNDHQPAPCLLVRMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 307

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 308 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 334



>gi|320592166|gb|EFX04605.1| ring finger protein [Grosmannia clavigera kw1407]
          Length = 538

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C ++++  ++  +G   +++CP   C   +  + 
Sbjct: 143 CDICCEDGRGLKSFAMKCGHR-FCVNCYRQYLTQKIREEGEAARIQCPSDGCGRIIDAKS 201

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG----QEHTTGDRF-PIITCGA 122
           +  L + EL +RY  LL R  +      +WC A  C +      +    DR  P + C  
Sbjct: 202 LDVLVTPELTDRYHELLNRTYVEDKDSLKWCPAPDCQNAVDCHAKKKDLDRMVPTVEC-H 260

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 261 CGYRFCFGCSLTDHQPAPCRLVKQWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 320

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 321 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 347



>gi|225560856|gb|EEH09137.1| RING finger domain-containing protein [Ajellomyces capsulatus
           G186AR]
          Length = 514

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   +++CP+S C   +  + 
Sbjct: 138 CDICCEDGPDMETYSMRCGHR-FCVECYRHYLGQKIGEEGEAARIQCPQSNCHRIVDSKT 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C +
Sbjct: 197 LDLLVTDDLRDRYHLLLMRTYVDDKENLKWCPAPNCEFAIDCPVKRRELNRIVPTVQC-S 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CNHSFCFGCTLNDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCASTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 342



>gi|350630162|gb|EHA18535.1| hypothetical protein ASPNIDRAFT_207667 [Aspergillus niger ATCC
           1015]
          Length = 511

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLRQKIREEGEAARIECPSDSCNMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY+ LL R  +    + +WC A  C    +     R      P + C  
Sbjct: 196 LGLLVTNDLKERYNALLTRTYVDDKDNLKWCPAPNCEYAVDCPVKQRDLRRIVPTVQCD- 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CRHYFCFGCTLNDHQPAPCLLVRMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|255947396|ref|XP_002564465.1| Pc22g04260 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591482|emb|CAP97714.1| Pc22g04260 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 602

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP   C   + Y+ 
Sbjct: 136 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLGQKIKEEGEAARIQCPGDGCNRIVDYKS 194

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L +KEL  RY  LL R  +    + +WC A  C    +    +R      P + C  
Sbjct: 195 LDLLVTKELQGRYRELLTRTYVDDKENLKWCPAPNCQYAIDCGVKNRDLRRIVPTVRC-F 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C      LQ  ED +    +   +TK+C  C  +IEKN GC+
Sbjct: 254 CKHEFCFGCSLNDHQPAPCKLVKMWLQKCEDDSETANWISANTKECTKCNSTIEKNGGCN 313

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 314 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 340



>gi|145493115|ref|XP_001432554.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124399666|emb|CAK65157.1| unnamed protein product [Paramecium tetraurelia]
          Length = 445

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 96/196 (48%), Gaps = 12/196 (6%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC +C  D    Q I+     +D CS C+ +H+   +  KG  + + CP++ C +    E
Sbjct: 138 ECQICYVDKPKEQFIAPLNCKHDFCSDCLSQHLTQNI-LKGNVLSITCPQTSCTVAFNDE 196

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
            ++ L  ++++E+Y     R  I +  + RWC    C   + +  G+   ++TC  CG  
Sbjct: 197 QIKGLVQEKIYEKYKRFYNRQVISQNKNVRWCPKPDC---ENYVIGNGNDLLTC-ICGQS 252

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC- 185
            CF     +H G+ C      +Q  D    +A  +     CP+C   I+K  GC+HM+C 
Sbjct: 253 ICFQCGNQYHKGMNC------IQAMDAQYLQARKDNLIFDCPSCKAPIQKKGGCNHMTCY 306

Query: 186 RCGYEFCWLCLGDYEN 201
           +C Y+FCWLC G Y +
Sbjct: 307 KCKYQFCWLCRGKYSS 322



>gi|226293405|gb|EEH48825.1| ariadne-1 [Paracoccidioides brasiliensis Pb18]
          Length = 602

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 106/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP+++C   +  + 
Sbjct: 226 CDICCEDRKGLESYAMRCGHR-FCVDCYRHYLGQKIREEGEAARIQCPQNKCHRIVDSKT 284

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L +++L ERY  LL+R  +    + +WC A  C        ++       P + C  
Sbjct: 285 LDLLVTEDLQERYHRLLIRTYVDDKYNLKWCPAPNCEFAIDCGVKKRDLNRVVPTVHC-R 343

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   HTK+CP C  +IEKN GC+
Sbjct: 344 CSHSFCFGCTLNDHQPPPCSLVKKWLKKCKDDSETANWISAHTKECPKCSSTIEKNGGCN 403

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 404 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 430



>gi|325089144|gb|EGC42454.1| RING finger protein [Ajellomyces capsulatus H88]
          Length = 578

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   +++CP+S C   +  + 
Sbjct: 202 CDICCEDGPDMETYSMRCGHR-FCVECYRHYLGQKIGEEGETARIQCPQSNCHRIVDSKT 260

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C +
Sbjct: 261 LDLLVTDDLRDRYHLLLMRTYVDDKENLKWCPAPNCEFAIDCPVKRRELNRIVPTVQC-S 319

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 320 CNHSFCFGCTLNDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCASTIEKNGGCN 379

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 380 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 406



>gi|494831493|gb|EON67948.1| ubiquitin-conjugating enzyme E2, other [Coniosporium apollinis CBS
           100218]
          Length = 516

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCE+   ++  +  C H   C  C K+++  ++  +G   +++CP   C   +  + 
Sbjct: 141 CDICCEEGPDMETFAMKCEHR-FCVDCYKQYLCGKIKEEGEAARIKCPGDGCNRIVDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY  LL R  +    + +WC A  C    E     R      P + C +
Sbjct: 200 LDLLVTTDLKERYQELLTRTYVDDRENLKWCPAPNCIYAVECPVKKRDLSKIVPTVHC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +P H    C    + L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 259 CKHSFCFGCSLPDHQPAPCALVKKWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCRHEFCWMCMGVWSE---HGTSWY 345



>gi|453084367|gb|EMF12411.1| RING finger protein [Mycosphaerella populorum SO2202]
          Length = 522

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP   C   +  + 
Sbjct: 148 CEICCEDEPGLQSFAMKCGHR-YCVDCYRQYLGQKIRDEGEAARIKCPGDGCNNVVDTKS 206

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   EL +RY  LL+R  +    + +WC A +C    E +   R      P +TC  
Sbjct: 207 LELLVPSELKDRYHELLMRTYVDDKENLKWCPAPECIYAIECSVKKRDLNRIVPTVTCEG 266

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
                CF   +  H    C    + L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 267 -KHNFCFGCTLADHQPCPCKLVKQWLKKCEDDSETANWINANTKECPKCNSTIEKNGGCN 325

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 326 HMTCRKCRNEFCWMCMGVWSE---HGTSWY 352



>gi|317029041|ref|XP_001390993.2| hypothetical protein ANI_1_212054 [Aspergillus niger CBS 513.88]
          Length = 605

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 231 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLRQKIREEGEAARIECPSDSCNMIVDSKS 289

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY+ LL R  +    + +WC A  C    +     R      P + C  
Sbjct: 290 LGLLVTNDLKERYNALLTRTYVDDKDNLKWCPAPNCEYAVDCPVKQRDLRRIVPTVQCD- 348

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 349 CRHYFCFGCTLNDHQPAPCLLVRMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 408

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 409 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 435



>gi|42569518|ref|NP_180709.3| putative E3 ubiquitin-protein ligase ARI7 [Arabidopsis thaliana]
 gi|75328048|sp|Q84RR0.1|ARI7_ARATH RecName: Full=Probable E3 ubiquitin-protein ligase ARI7; AltName:
           Full=ARIADNE-like protein ARI7; AltName: Full=Protein
           ariadne homolog 7
 gi|29125028|emb|CAD52889.1| ARIADNE-like protein ARI7 [Arabidopsis thaliana]
 gi|330253462|gb|AEC08556.1| putative E3 ubiquitin-protein ligase ARI7 [Arabidopsis thaliana]
          Length = 562

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 97/200 (48%), Gaps = 5/200 (2%)

Query: 3   ETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           ++ L CG+C + Y   +  S SCGH   C+ C   +I   +N   G + +RCP   C   
Sbjct: 132 DSELTCGICFDSYPPEKIASVSCGH-PFCTTCWTGYISTTINDGPGCLMLRCPDPSCLAA 190

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           + ++ V +LAS++  E+Y+   LR  I      +WC A  C    +   G     ++C  
Sbjct: 191 VGHDMVDKLASEDEKEKYNRYFLRSYIEDNRKMKWCPAPGCDFAIDFVAGSGNYDVSC-L 249

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    C+      H  + C+  ++  L+    + N  +   ++K CP C   IEKN GC 
Sbjct: 250 CSFSFCWNCTEEAHRPVDCSTVSKWILKNSAESENMNWILANSKPCPRCKRPIEKNQGCM 309

Query: 182 HMSCR--CGYEFCWLCLGDY 199
           HM+C   C YEFCWLCLG +
Sbjct: 310 HMTCTPPCKYEFCWLCLGAW 329



>gi|460366165|ref|XP_004228962.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Solanum
           lycopersicum]
          Length = 857

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 104/217 (47%), Gaps = 12/217 (5%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           + CG+C EDYS    ++S+CGH   C  C K +I   +    G + +RC +  C + ++ 
Sbjct: 127 VTCGICFEDYSSDGILASACGH-PFCVECWKGYISNSITDGPGCLNLRCAEPSCKVAVSQ 185

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + + RLAS +  +RY   L R  + +    +WC A  C    E   G     + C  C  
Sbjct: 186 DMIDRLASDDDKKRYYGFLFRSYVEENRKIKWCPAPGCNFAVEFDIGSDNCEVIC-VCSN 244

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQTEDF-TANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C++     HS + C    + ++  +  + N  +   +TK CP C   IEKN+GC  M+
Sbjct: 245 YFCWSCTEEAHSPVDCDMVVKWMEKNNAESENTNWILAYTKACPKCKRPIEKNEGCMRMT 304

Query: 185 CR--CGYEFCWLCLGDYENIRTHGNHYHAPTCQYYAP 219
           CR  C Y+FCWLCL  +     HG +    +C  Y P
Sbjct: 305 CRDPCKYQFCWLCLNSWS---VHGYN----SCNKYMP 334



>gi|24662189|ref|NP_648392.1| CG12362, isoform A [Drosophila melanogaster]
 gi|24662193|ref|NP_729606.1| CG12362, isoform B [Drosophila melanogaster]
 gi|7294826|gb|AAF50159.1| CG12362, isoform A [Drosophila melanogaster]
 gi|23093708|gb|AAN11912.1| CG12362, isoform B [Drosophila melanogaster]
 gi|28317285|gb|AAO39642.1| AT17761p [Drosophila melanogaster]
          Length = 511

 Score = 99.8 bits (247), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 107/213 (50%), Gaps = 21/213 (9%)

Query: 8   CGVC---CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           CG+C   C++      I   CGHN  C+ C K+++  +  S+G    ++CP + C I + 
Sbjct: 140 CGICFCSCDEL-----IGLGCGHN-FCAACWKQYLANKTCSEGLANTIKCPAANCEILVD 193

Query: 65  YEDVRRLAS-KELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
           Y    +LA   E+ ERY  L+    +      RWC A  C    +    +  P      C
Sbjct: 194 YISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVCAE--PRAVLCKC 251

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQLQT--EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           G + CF     WH   +C+   + ++   ED +    +  ++TK+CP C ++IEK+ GC+
Sbjct: 252 GHEFCFACGENWHEPASCSSLKKWVKKCLED-SETSNWIAQNTKECPKCNVTIEKDGGCN 310

Query: 182 HMSCR---CGYEFCWLCLGDYENIRTHGNHYHA 211
           HM C+   C Y+FCW+CLG +E    HG+ +++
Sbjct: 311 HMVCKNPSCRYDFCWVCLGSWE---PHGSSWYS 340



>gi|15225136|ref|NP_180736.1| putative E3 ubiquitin-protein ligase ARI9 [Arabidopsis thaliana]
 gi|75337347|sp|Q9SKC3.1|ARI9_ARATH RecName: Full=Probable E3 ubiquitin-protein ligase ARI9; AltName:
           Full=ARIADNE-like protein ARI9; AltName: Full=Protein
           ariadne homolog 9
 gi|4887759|gb|AAD32295.1| putative ARI-like RING zinc finger protein [Arabidopsis thaliana]
 gi|29125032|emb|CAD52891.1| ARIADNE-like protein ARI9 [Arabidopsis thaliana]
 gi|91806301|gb|ABE65878.1| zinc finger family protein [Arabidopsis thaliana]
 gi|330253488|gb|AEC08582.1| putative E3 ubiquitin-protein ligase ARI9 [Arabidopsis thaliana]
          Length = 543

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 98/200 (49%), Gaps = 4/200 (2%)

Query: 3   ETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           +  ++CG+C E Y+  +    SCGH   C  C   +I  ++    G ++V+CP+  C   
Sbjct: 123 KVNIQCGICFESYTREEIARVSCGH-PYCKTCWAGYITTKIEDGPGCLRVKCPEPSCSAA 181

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           +  + +  +   ++ E+Y   +LR  +      +WC +  CG   E    +         
Sbjct: 182 VGKDMIEDVTETKVNEKYSRYILRSYVEDGKKIKWCPSPGCGYAVEFGGSESSSYDVSCL 241

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQL-QTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + C+      HS + C   ++ + + +D + N+ +   ++K CP C   IEKNDGC+
Sbjct: 242 CSYRFCWNCSEDAHSPVDCDTVSKWIFKNQDESENKNWMLANSKPCPECKRPIEKNDGCN 301

Query: 182 HMSCR--CGYEFCWLCLGDY 199
           HM+C   CG+EFCW+CL  Y
Sbjct: 302 HMTCSAPCGHEFCWICLKAY 321



>gi|195326557|ref|XP_002029992.1| GM25208 [Drosophila sechellia]
 gi|194118935|gb|EDW40978.1| GM25208 [Drosophila sechellia]
          Length = 507

 Score = 99.4 bits (246), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 17/211 (8%)

Query: 8   CGVC-CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           CG+C C   S  + I   CGHN  C+ C K+++  +  S+G    ++CP + C I + Y 
Sbjct: 136 CGICFC---SCDELIGLGCGHN-FCAACWKQYLANKTCSEGLANTIKCPATNCEILVDYI 191

Query: 67  DVRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
              +LA   E+ ERY  L+    +      RWC A  C    +    +  P      CG 
Sbjct: 192 SFLKLADDPEVVERYQQLITNTFVECNTLMRWCPAPNCSHAVKAVCAE--PRAVLCKCGH 249

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQT--EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHM 183
           + CF     WH   +C+     ++   ED +    +  ++TK+CP C ++IEK+ GC+HM
Sbjct: 250 EFCFACGENWHEPASCSSLKTWVKKCLED-SETSNWIAQNTKECPKCNVTIEKDGGCNHM 308

Query: 184 SCR---CGYEFCWLCLGDYENIRTHGNHYHA 211
            C+   C Y+FCW+CLG +E    HG+ +++
Sbjct: 309 VCKNPSCRYDFCWVCLGSWE---PHGSSWYS 336



>gi|330798908|ref|XP_003287491.1| hypothetical protein DICPUDRAFT_151593 [Dictyostelium purpureum]
 gi|325082510|gb|EGC35990.1| hypothetical protein DICPUDRAFT_151593 [Dictyostelium purpureum]
          Length = 731

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 102/219 (46%), Gaps = 12/219 (5%)

Query: 2   TETTLECGVCCEDYSIIQQIS--SSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRC 59
           +  T EC +C  D    +++   S CGH   C+ C+  +++  + S+   + + CP  +C
Sbjct: 458 SSMTTECAICFLDEIEEEKLFLISQCGH-IYCTECLSEYLKTNILSRK--IFIPCPFPKC 514

Query: 60  PIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIIT 119
                Y  ++ L     F +Y+     + + K P+++WC  + C +       +     +
Sbjct: 515 TSWFQYGQIKYLVDDHTFNKYEEFTFSIFLMKTPNYKWCPNKNCENAVYGEVDNPRTRCS 574

Query: 120 CGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHE----RHTKQCPNCYMSIE 175
              C    CF  +  WH   TC Q+ +  + E+   +  Y +      TK+CP C   IE
Sbjct: 575 NKECNFDFCFNCEAEWHHNSTCEQY-QIWRLENTMVDTTYGKWTKTNDTKKCPKCKSVIE 633

Query: 176 KNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTC 214
           KN GC+H++C CGY FCWLC G Y N   H N+ +   C
Sbjct: 634 KNAGCNHITCHCGYNFCWLCGGKYSN--NHFNNLNVFGC 670



>gi|357460859|ref|XP_003600711.1| hypothetical protein MTR_3g065380 [Medicago truncatula]
 gi|355489759|gb|AES70962.1| hypothetical protein MTR_3g065380 [Medicago truncatula]
          Length = 611

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 98/208 (47%), Gaps = 5/208 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y   +  ++SCGH   CS C   +I   +N   G + +RCP   C   +  
Sbjct: 133 LTCGICFEAYRPSKIHTASCGH-PYCSSCWGGYIGTSINDGLGCLMLRCPDPACAAAVDQ 191

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +   AS E  ++Y+  L+R  I      +WC A  C        GD    ++C  C  
Sbjct: 192 DMIDAFASAEDKKKYERYLVRSYIEVNKKTKWCPAPGCEHAVNFDAGDENYDVSC-LCSY 250

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   +TK CP C  SIEKN GC HM+
Sbjct: 251 SFCWNCTEDAHRPVDCDTVSKWILKNSAESENTNWILAYTKPCPKCKRSIEKNRGCMHMT 310

Query: 185 CR--CGYEFCWLCLGDYENIRTHGNHYH 210
           C   C ++FCWLCLGD+ + R   N + 
Sbjct: 311 CSAPCRFQFCWLCLGDWSDHRGACNRFQ 338



>gi|512186955|gb|EPE02739.1| ibr domain-containing protein [Ophiostoma piceae UAMH 11346]
          Length = 540

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP + C   +    
Sbjct: 145 CDICCEDDDELQTFALKCGHR-YCVDCYRQYLTQKIREEGEAARIQCPTADCGRIIDAIS 203

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE----HTTGDRF-PIITCGA 122
           +  L + EL  RY  LL R  +      +WC A  C +  +        DR  P + C  
Sbjct: 204 LSVLVTPELSGRYHELLNRTYVEDRESLKWCPAPNCENAVDCRVKKKDLDRVVPTVEC-L 262

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 263 CGYRFCFGCTLKDHLPAPCRLVKLWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 322

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 323 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 349



>gi|330923838|ref|XP_003300396.1| hypothetical protein PTT_11634 [Pyrenophora teres f. teres 0-1]
 gi|311325486|gb|EFQ91511.1| hypothetical protein PTT_11634 [Pyrenophora teres f. teres 0-1]
          Length = 330

 Score = 99.0 bits (245), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 95/191 (49%), Gaps = 11/191 (5%)

Query: 3   ETTLECGVCCEDYSIIQQIS-SSCGH-NDICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           + T EC  C + + +      +SC H    C  C    +  ++N  G    + C    C 
Sbjct: 134 DVTQECAGCGDSFRMRDLTRLASCEHVPQYCGQCFLEGLSVQIND-GNPENILCLSHACS 192

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
             +TYED+R LAS E+FE+Y+ +L   A    P+F+ C  Q C SGQ H + +  PI TC
Sbjct: 193 TRITYEDIRALASSEMFEQYENILALRATNADPNFQRCLGQGCDSGQIHDSTN-GPIFTC 251

Query: 121 GACGAKSCFTHD--VPWHSGLTCTQF---NEQLQTEDFTANRAYHERHTKQCPNCYMSIE 175
             C  + C  HD  VP H G +C Q+   N++ + E  +   A   +    CP+C   I+
Sbjct: 252 FQCRYRMCTAHDPPVPLHQGESCAQYTLRNDKREQEKLSLAEAA--KIAVACPDCGTKIQ 309

Query: 176 KNDGCDHMSCR 186
           K  GCDHM+C+
Sbjct: 310 KTGGCDHMTCK 320



>gi|154277954|ref|XP_001539806.1| hypothetical protein HCAG_05273 [Ajellomyces capsulatus NAm1]
 gi|150413391|gb|EDN08774.1| hypothetical protein HCAG_05273 [Ajellomyces capsulatus NAm1]
          Length = 807

 Score = 99.0 bits (245), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 105/210 (50%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   +++CP+S C   +  + 
Sbjct: 431 CDICCEDGPDMETYSMRCGHR-FCVECYRHYLGQKIGEEGEAARIQCPQSNCHRIVDSKT 489

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C +
Sbjct: 490 LDLLVTDDLRDRYHLLLMRTYVDDKENLKWCPAPNCEFAIDCPVKRRELNRIVPTVQC-S 548

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 549 CNHSFCFGCTLNDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCASTIEKNGGCN 608

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 609 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 635



>gi|471570741|gb|EMR69764.1| putative ibr domain-containing protein [Eutypa lata UCREL1]
          Length = 534

 Score = 99.0 bits (245), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C ++++  ++  +G   +++CP   C   +    
Sbjct: 141 CDICCEDEDDLQTFAMKCGHR-YCVDCYRQYLTQKIREEGEAARIQCPSDGCHRIIDSRS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           ++ L + +L  RY  LL R  +      +WC A  C +  E     +      P + C +
Sbjct: 200 LKLLLTADLTGRYHELLNRTYVEDKDTLKWCPAPDCENAVECAVKKKDLDKVVPTVAC-S 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGHRFCFGCILNDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCRHEFCWMCMGLWSE---HGTSWY 345



>gi|485922695|gb|EOD48060.1| putative ring finger protein [Neofusicoccum parvum UCRNP2]
          Length = 516

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C ED   +   +  CGH   C  C K+++  ++  +G   +++CP S C   +  + 
Sbjct: 140 CDICAEDDPDLDTYAMKCGHK-FCVPCWKQYLYTKIKDEGEAARIKCPGSDCNRIVDSKS 198

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L +RY  LL R  +    + +WC A  C        ++       P + C  
Sbjct: 199 LELLVAADLKDRYHVLLTRTYVDDKENLKWCPAPNCEFAVDCPIKQKDLARIVPTVVCD- 257

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C    + L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 258 CKHHFCFGCSLNDHQPAPCALVKKWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 317

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 318 HMTCRKCRHEFCWMCMGVWSE---HGTSWY 344



>gi|167376967|ref|XP_001734234.1| ariadne RING finger [Entamoeba dispar SAW760]
 gi|165904399|gb|EDR29624.1| ariadne RING finger, putative [Entamoeba dispar SAW760]
          Length = 252

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 108/223 (48%), Gaps = 21/223 (9%)

Query: 3   ETTLECGVCCEDYSIIQQ----ISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSR 58
           +  + C +C   Y+ + Q     +  CGH+  C  CI  H + ++    G   + CP+  
Sbjct: 41  DDVINCSIC---YADVDQSFFYTNPKCGHS-FCLSCISEHAKEKIKQASG--PILCPEEN 94

Query: 59  CPIELTYEDVRR---LASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRF 115
           C  E++Y D+     ++  +L E+Y++ L R+ +   P+  +C   KCG+      G   
Sbjct: 95  CNKEISYNDLISYGIISDPDLLEKYNSTLTRIRLDNDPNTLYC--IKCGTPMIGEPG--I 150

Query: 116 PIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDF--TANRAYHERHTKQCPNCYMS 173
            ++ C  C    C      WH+  TC Q+    +       A + Y +++TK CP C+  
Sbjct: 151 TMVRCVKCNYCFCCKCKEQWHADCTCEQYQRWKKENSMGDDAFKVYIKKNTKLCPQCHKP 210

Query: 174 IEKNDGCDHMSCRCGYEFCWLCLGDYENIRTHGNHYHAPTCQY 216
           IEKN GC+ M+C+CGY+FCWLC+  Y   +TH  +      QY
Sbjct: 211 IEKNGGCNCMTCKCGYQFCWLCMQPY--TKTHWKNNKTGCTQY 251



>gi|477534185|gb|ENH85747.1| ring finger protein [Colletotrichum orbiculare MAFF 240422]
          Length = 516

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C + ++  ++  +G   +++CP   C   +  + 
Sbjct: 141 CDICCEDEDGLQTFALKCGHR-YCVDCYRHYLNQKIREEGEAARIQCPAEGCGRVIDSKS 199

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +      ++       P + CG 
Sbjct: 200 LDLLVTPQLALRYHELLNRTYVEDKDSLKWCPAPDCPNAVDCAVKKKDLDKIVPTVACG- 258

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 259 CGHRFCFGCILNDHQPAPCELVKMWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 318

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 319 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 345



>gi|460391591|ref|XP_004241404.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Solanum
           lycopersicum]
          Length = 550

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 95/197 (48%), Gaps = 5/197 (2%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C +++     IS  CGH   C+ C K +I   +N   G + +RCP   C + +  + 
Sbjct: 135 CGICFDNFLPADIISLGCGH-PFCTSCWKAYITTSINDGPGCLTLRCPDPSCDVAIGQDM 193

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           +  L S E  E+Y   LLR  I      +WC A  C S  E+  G     +TC +C    
Sbjct: 194 IDTLTSGEDKEKYYRYLLRSYIEDNRKTKWCPAPGCDSAIEYDLGSGSYDVTC-SCSFSF 252

Query: 128 CFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
           C+      H  + C   ++  L+    + N  +   ++K CP C   IEKN GC HM+C 
Sbjct: 253 CWNCTEEAHRPVDCDTVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHMTCT 312

Query: 187 --CGYEFCWLCLGDYEN 201
             C +EFCWLCLG + +
Sbjct: 313 PPCKFEFCWLCLGAWSD 329



>gi|470251774|ref|XP_004358984.1| ariadne-like ubiquitin ligase [Dictyostelium fasciculatum]
 gi|328872767|gb|EGG21134.1| ariadne-like ubiquitin ligase [Dictyostelium fasciculatum]
          Length = 529

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 11/209 (5%)

Query: 2   TETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           T     C +C ++    Q  + SC H   C  C K ++E ++      +   CP  +C +
Sbjct: 139 TMQKFSCLICLDELPPSQTFALSCDHR-YCLPCWKGYLECKIGEGPECILATCPAPKCKV 197

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            +  E V++L     +E+Y   +L+  +   P  +WC A  C         +R   +TC 
Sbjct: 198 RVHEEAVKKLVETPTYEKYANFILKSFVDDNPQVKWCPAPGCIYSVRCDRKERKEAVTC- 256

Query: 122 ACGAKSCFT---HDVPWHSGLTCTQFNEQLQ-TEDFTANRAYHERHTKQCPNCYMSIEKN 177
            CG + CF     ++  H    C+Q +  LQ   D + N  +   +TK+CP C   IEKN
Sbjct: 257 KCGFQYCFNCNDFEIGDHMPCPCSQVDRWLQKASDESENVTWMLANTKKCPECRSPIEKN 316

Query: 178 DGCDHMSCR-----CGYEFCWLCLGDYEN 201
            GC HM+CR     CG+EFCWLC G + +
Sbjct: 317 GGCMHMTCRKNAGGCGFEFCWLCRGAWSD 345



>gi|334182329|ref|NP_001184920.1| putative E3 ubiquitin-protein ligase ARI5 [Arabidopsis thaliana]
 gi|332189792|gb|AEE27913.1| putative E3 ubiquitin-protein ligase ARI5 [Arabidopsis thaliana]
          Length = 594

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 5/195 (2%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C + Y++ + +S SCGH   C+ C   +I   +N   G + ++CP   CP  +  + 
Sbjct: 174 CGICFDSYTLEEIVSVSCGH-PFCATCWTGYISTTINDGPGCLMLKCPDPSCPAAIGRDM 232

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           + +LASKE  E+Y    LR  +    + +WC A  C    +   G     ++C  C    
Sbjct: 233 IDKLASKEDKEKYYRYFLRSYVEVNREMKWCPAPGCEHAIDFAGGTESYDVSC-LCSHSF 291

Query: 128 CFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
           C+      H  + C    +  L+    + N  +   ++K CP C   IEKN GC HM+C 
Sbjct: 292 CWNCTEEAHRPVDCDTVGKWILKNSAESENMNWILANSKPCPKCKRPIEKNHGCMHMTCT 351

Query: 187 --CGYEFCWLCLGDY 199
             C +EFCWLCL  +
Sbjct: 352 PPCKFEFCWLCLNAW 366



>gi|358377798|gb|EHK15481.1| hypothetical protein TRIVIDRAFT_80053 [Trichoderma virens Gv29-8]
          Length = 696

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 5/132 (3%)

Query: 22  SSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
           ++SC H    C  C++R I ++L SK     +RCP+  C   L Y D++R A  E F+RY
Sbjct: 402 TASCTHAPTACLECLERSIRSDLTSKIW-TDIRCPE--CRELLDYTDIQRYADGETFKRY 458

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLT 140
           +TL LR A+ +  +F WC +  CGSGQ H +G   PI+ C  C  +SCF H+V WH GLT
Sbjct: 459 ETLALRAAMAEAENFFWCTS-GCGSGQIHESGQEQPIVICLHCTHRSCFHHNVAWHQGLT 517

Query: 141 CTQFNEQLQTED 152
           C ++++ L   D
Sbjct: 518 CDEYDQLLADPD 529



>gi|239608096|gb|EEQ85083.1| IBR domain-containing protein [Ajellomyces dermatitidis ER-3]
 gi|327349281|gb|EGE78138.1| RING finger domain-containing protein [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 514

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   ++ CP+S C   +  + 
Sbjct: 138 CDICCEDGPGMETYSMRCGHR-FCVECYRHYLGQKIGEEGEAARIECPQSNCHRIVDSKT 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C  
Sbjct: 197 LDLLVTDDLQDRYHLLLMRTYVDDKENLKWCPAPNCEYAIDCPVKKRQLNRIVPTVHC-R 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CSHSFCFGCTLDDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCSSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 342



>gi|261203745|ref|XP_002629086.1| IBR domain-containing protein [Ajellomyces dermatitidis SLH14081]
 gi|239586871|gb|EEQ69514.1| IBR domain-containing protein [Ajellomyces dermatitidis SLH14081]
          Length = 514

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 103/210 (49%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  S  CGH   C  C + ++  ++  +G   ++ CP+S C   +  + 
Sbjct: 138 CDICCEDGPGMETYSMRCGHR-FCVECYRHYLGQKIGEEGEAARIECPQSNCHRIVDSKT 196

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L +RY  LL+R  +    + +WC A  C    +     R      P + C  
Sbjct: 197 LDLLVTDDLQDRYHLLLMRTYVDDKENLKWCPAPNCEYAIDCPVKKRQLNRIVPTVHC-R 255

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  +D +    +   +TK+CP C  +IEKN GC+
Sbjct: 256 CSHSFCFGCTLDDHQPPPCSLVKKWLKKCKDDSETANWISANTKECPKCSSTIEKNGGCN 315

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 316 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 342



>gi|396499624|ref|XP_003845520.1| similar to RING finger domain-containing protein [Leptosphaeria
           maculans JN3]
 gi|312222101|emb|CBY02041.1| similar to RING finger domain-containing protein [Leptosphaeria
           maculans JN3]
          Length = 559

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 99/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC+D   +   +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + 
Sbjct: 184 CDICCDDTPNMDTFAMKCGHR-FCVDCYRQYLGTKIQDEGEAARIRCPGEGCTRIVDSKS 242

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + +L +RY  LL R  +    + +WC A  C    E            P + C  
Sbjct: 243 LDLLVTADLQDRYHVLLTRTYVDDKENLKWCPAPDCKYAVECPIKTKDLTKVVPTVHC-E 301

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG   CF   +  H    C+     L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 302 CGHDFCFGCTLNNHQPAPCSLVKRWLKKCEDDSETANWISANTKECPKCNSTIEKNGGCN 361

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C  EFCW+C+G +     HG  ++
Sbjct: 362 HMTCRKCRNEFCWMCMGVWSE---HGTSWY 388



>gi|67465696|ref|XP_649010.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS]
 gi|56465356|gb|EAL43630.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS]
 gi|449710541|gb|EMD49597.1| IBR domain containing protein [Entamoeba histolytica KU27]
 gi|459660487|gb|EMH75861.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS-B]
 gi|472461840|gb|EMS15158.1| IBR domain containing protein [Entamoeba histolytica HM-3:IMSS]
 gi|480527049|gb|ENY65521.1| IBR domain containing protein [Entamoeba histolytica HM-1:IMSS-A]
          Length = 252

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (51%), Gaps = 12/180 (6%)

Query: 25  CGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRR---LASKELFERYD 81
           CGH+  C  C+  +   ++    G   + CP+  C  E++Y D+     ++  EL E+Y+
Sbjct: 64  CGHS-FCLSCVSEYANEKIKQANG--PILCPEKDCNEEISYNDLINYGIISDPELLEQYN 120

Query: 82  TLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTC 141
           + L R+ I   PD  +C   KCG+      G    ++ C  C    C   +  WH+  TC
Sbjct: 121 STLTRIRIDNDPDTLYCI--KCGTPMIGEPG--ITMVRCVKCDYCFCCKCNEQWHADCTC 176

Query: 142 TQFNEQLQTEDF--TANRAYHERHTKQCPNCYMSIEKNDGCDHMSCRCGYEFCWLCLGDY 199
            Q+    +       A + Y +++TK CP C+  IEKN GC+H++CRCG++FCWLC+  Y
Sbjct: 177 EQYQRWKRENGMGDDAFQVYVKKNTKLCPQCHSPIEKNGGCNHITCRCGFQFCWLCMQPY 236



>gi|30679494|ref|NP_172080.2| putative E3 ubiquitin-protein ligase ARI5 [Arabidopsis thaliana]
 gi|75329794|sp|Q8L829.1|ARI5_ARATH RecName: Full=Probable E3 ubiquitin-protein ligase ARI5; AltName:
           Full=ARIADNE-like protein ARI5; AltName: Full=Protein
           ariadne homolog 5
 gi|21539577|gb|AAM53341.1| unknown protein [Arabidopsis thaliana]
 gi|23197712|gb|AAN15383.1| unknown protein [Arabidopsis thaliana]
 gi|332189791|gb|AEE27912.1| putative E3 ubiquitin-protein ligase ARI5 [Arabidopsis thaliana]
          Length = 552

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 5/195 (2%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C + Y++ + +S SCGH   C+ C   +I   +N   G + ++CP   CP  +  + 
Sbjct: 132 CGICFDSYTLEEIVSVSCGH-PFCATCWTGYISTTINDGPGCLMLKCPDPSCPAAIGRDM 190

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           + +LASKE  E+Y    LR  +    + +WC A  C    +   G     ++C  C    
Sbjct: 191 IDKLASKEDKEKYYRYFLRSYVEVNREMKWCPAPGCEHAIDFAGGTESYDVSC-LCSHSF 249

Query: 128 CFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
           C+      H  + C    +  L+    + N  +   ++K CP C   IEKN GC HM+C 
Sbjct: 250 CWNCTEEAHRPVDCDTVGKWILKNSAESENMNWILANSKPCPKCKRPIEKNHGCMHMTCT 309

Query: 187 --CGYEFCWLCLGDY 199
             C +EFCWLCL  +
Sbjct: 310 PPCKFEFCWLCLNAW 324



>gi|440633916|gb|ELR03835.1| ariadne-1 [Geomyces destructans 20631-21]
          Length = 517

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + +   +  CGH   C  C ++++  ++  +G    ++CP+  C   +  + 
Sbjct: 137 CDICCEDEAGLLTFAMKCGHR-YCVDCYRQYLSQKIKEEGEAAHIQCPQDGCKRIMDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSG-----QEHTTGDRFPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +      Q+       P + C  
Sbjct: 196 MDLLVASDLNNRYHELLTRTYVEDKNALKWCPAPDCVNAVECKIQKRDLDKVVPTVACD- 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 255 CGYRFCFGCILIDHQPAPCELVKHWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|29125025|emb|CAD52887.1| ARIADNE-like protein ARI5 [Arabidopsis thaliana]
          Length = 551

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 5/195 (2%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C + Y++ + +S SCGH   C+ C   +I   +N   G + ++CP   CP  +  + 
Sbjct: 130 CGICFDSYTLEEIVSVSCGH-PFCATCWTGYISTTINDGPGCLMLKCPDPSCPAAIGRDM 188

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           + +LASKE  E+Y    LR  +    + +WC A  C    +   G     ++C  C    
Sbjct: 189 IDKLASKEDKEKYYRYFLRSYVEVNREMKWCPAPGCEHAIDFAGGTESYDVSC-LCSHSF 247

Query: 128 CFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
           C+      H  + C    +  L+    + N  +   ++K CP C   IEKN GC HM+C 
Sbjct: 248 CWNCTEEAHRPVDCDTVGKWILKNSAESENMNWILANSKPCPKCKRPIEKNHGCMHMTCT 307

Query: 187 --CGYEFCWLCLGDY 199
             C +EFCWLCL  +
Sbjct: 308 PPCKFEFCWLCLNAW 322



>gi|169770169|ref|XP_001819554.1| hypothetical protein AOR_1_626154 [Aspergillus oryzae RIB40]
 gi|83767413|dbj|BAE57552.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391867404|gb|EIT76650.1| putative E3 ubiquitin ligase [Aspergillus oryzae 3.042]
          Length = 511

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDNLETYAMRCGHR-FCVDCYRHYLAQKIRGEGEAARIECPGDGCNMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L +  L +RY TLL R  +    + +WC A  C    + +   R      P + C  
Sbjct: 196 LSLLVTPALKDRYYTLLQRTYVDDKENLKWCPAPNCEYAVDCSVKQRDLRRIVPTVQCN- 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 255 CKHHFCFGCTLNDHQPAPCQLVKMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|238487448|ref|XP_002374962.1| RING finger protein [Aspergillus flavus NRRL3357]
 gi|220699841|gb|EED56180.1| RING finger protein [Aspergillus flavus NRRL3357]
          Length = 620

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 246 CDICCEDGDNLETYAMRCGHR-FCVDCYRHYLAQKIRGEGEAARIECPGDGCNMIVDSKS 304

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L +  L +RY TLL R  +    + +WC A  C    + +   R      P + C  
Sbjct: 305 LSLLVTPALKDRYYTLLQRTYVDDKENLKWCPAPNCEYAVDCSVKQRDLRRIVPTVQCN- 363

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C      L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 364 CKHHFCFGCTLNDHQPAPCQLVKMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 423

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 424 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 450



>gi|512197974|gb|EPE26809.1| RING/U-box [Glarea lozoyensis ATCC 20868]
          Length = 515

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C  +++  ++  +G   +++CP   C   +  + 
Sbjct: 139 CDICCEDEPGLKSFAMKCGHR-FCVTCYNQYLAQKIKEEGEAARIQCPAEGCKRIIDAKS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGS----GQEHTTGDR-FPIITCGA 122
           +  L + +L +RY  LL R  +      +WC A  C +    G +    DR  P + C  
Sbjct: 198 LDLLVTADLQQRYHELLTRTYVEDKEHLKWCPAPDCQNAIECGIKKKDLDRVVPTVVCD- 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    C      L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 257 CKHRFCFGCILSDHQPAPCELVKRWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 343



>gi|367036058|ref|XP_003667311.1| hypothetical protein MYCTH_103867 [Myceliophthora thermophila ATCC
           42464]
 gi|347014584|gb|AEO62066.1| hypothetical protein MYCTH_103867 [Myceliophthora thermophila ATCC
           42464]
          Length = 526

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 82/147 (55%), Gaps = 9/147 (6%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHND-ICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           EC VC +   + +     I+ +C H    C  C+   I  +LN++  + +++CP+ R  +
Sbjct: 239 ECIVCTDTKPVSEFPTVGITKACNHEPATCLACVATSIRTDLNTRLWN-EIKCPECRETL 297

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           E  Y+DV+R A +E  ERY TL  R A+   P+F WC A  CG GQ H  G+  PI+TC 
Sbjct: 298 E--YDDVQRFADEETKERYQTLSFRSAVSSSPNFLWCTA-GCGYGQIHEGGESSPIVTCR 354

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQL 148
            C  +SCF H V WH  LTC +++  L
Sbjct: 355 LCSHRSCFHHKVAWHENLTCDEYDSLL 381



>gi|164657668|ref|XP_001729960.1| hypothetical protein MGL_2946 [Malassezia globosa CBS 7966]
 gi|159103854|gb|EDP42746.1| hypothetical protein MGL_2946 [Malassezia globosa CBS 7966]
          Length = 534

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 101/211 (47%), Gaps = 13/211 (6%)

Query: 8   CGVCCEDYS-IIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           C +  EDY   I   S  CGH   C+ C   + E ++  +G   +++C K +C + +  +
Sbjct: 157 CFMSAEDYGGRIMTTSLPCGHR-YCTACYTHYAEQKVREEGESRRIQCMKDKCNLIVDED 215

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCG 121
            + ++ S  L  RY  LL R  +   P  RWC A  C    E     +      P + C 
Sbjct: 216 TMSKILSPTLMHRYRILLDRAYVDDHPHLRWCPAPDCEMAVECPVTRKQLHFVVPSVRCD 275

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
            CG   CF   +  H  + C      L+  ED +    + + +TK+CP+C  +IEKN GC
Sbjct: 276 -CGHWFCFGCGLAAHQPVICAIVRLWLKKCEDDSETSNWIQANTKECPHCNSTIEKNGGC 334

Query: 181 DHMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           +HM+CR C YEFCW+C G +     HG  ++
Sbjct: 335 NHMTCRKCKYEFCWICSGPWSE---HGTSWY 362



>gi|156064957|ref|XP_001598400.1| hypothetical protein SS1G_00488 [Sclerotinia sclerotiorum 1980]
 gi|154691348|gb|EDN91086.1| hypothetical protein SS1G_00488 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 584

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 112/241 (46%), Gaps = 43/241 (17%)

Query: 6   LECGVCCEDYSIIQQ-----ISSSCGHND---ICSVCIKRHIEAELNSKGGDVQVRCPKS 57
           +EC +C E  ++++      I+ +C H +    C  C+   I   +   G    ++CP  
Sbjct: 265 VECAICAE--TVLKSETWYSITDTCEHPNEDRTCKACLNASISTAVEY-GFLNGIKCP-- 319

Query: 58  RCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPI 117
            CP  LT+ D+ + AS ++ ERY    LR    +   F  C A  CG GQ H   +  P+
Sbjct: 320 LCPAVLTFRDISQKASIDVLERYS--YLREKASRPDTFTMCLAPNCGGGQIHEGPE--PL 375

Query: 118 ITCGACGAKSCFTHDVPWHSGLTCTQFN------EQLQTEDFTANRAYHERHTKQCPNCY 171
           + C  C  K+C  H +PWH G +C +F+      E+L+ E+ TA      + ++ CP C 
Sbjct: 376 MICNHCRFKTCVKHKLPWHEGQSCDEFDIDDSQIERLEQEEATAK--LLAKDSRICPKCQ 433

Query: 172 MSIEKNDGCDHMSC------------------RCGYEFCWLCLGDYENIRTHGNHYHAPT 213
             + +++GCDHM C                  RCG  +C+LC  ++ENI   G   H   
Sbjct: 434 ECVVRSEGCDHMQCVYKCISSYKFNIDDYFLGRCGKSWCYLCGVNWENIIRLGRTAHGRN 493

Query: 214 C 214
           C
Sbjct: 494 C 494



>gi|407924611|gb|EKG17644.1| Zinc finger RING-type protein [Macrophomina phaseolina MS6]
          Length = 516

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 102/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C +D   +   +  CGH   C  C K+++  ++  +G   +++CP S C   +  + 
Sbjct: 140 CDICADDDPELDTYAMKCGHK-FCVPCWKQYLYTKIKDEGEAARIKCPGSDCNRIVDSKS 198

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L +++L +RY  LL R  +    + +WC A  C    +     +      P + C  
Sbjct: 199 LELLVAEDLKDRYHVLLTRTYVDDKENLKWCPAPNCEFAVDCPVKQKDLLRIVPTVICD- 257

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C    + L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 258 CKHHFCFGCSLNDHQPAPCALVKKWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCN 317

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 318 HMTCRKCRHEFCWMCMGVWSE---HGTSWY 344



>gi|297826593|ref|XP_002881179.1| hypothetical protein ARALYDRAFT_902186 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327018|gb|EFH57438.1| hypothetical protein ARALYDRAFT_902186 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 561

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (48%), Gaps = 6/200 (3%)

Query: 3   ETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIE 62
           ++ L CG+C + Y   +  S SCGH   C+ C   +I   +N   G + +RCP   C   
Sbjct: 132 DSELTCGICFDSYPPEKIPSVSCGH-PFCTTCWTGYITTTINDGPGCLMLRCPDPSCLAA 190

Query: 63  LTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGA 122
           + ++ V +LAS+E  E+Y+   LR  I      +WC A  C    +   G     ++C  
Sbjct: 191 VGHDMVDKLASEEK-EKYNRYFLRSYIEDNRKMKWCPAPGCDYAIDFVAGSGSYDVSC-L 248

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    C+      H  + C+  ++  L+    + N  +   ++K CP C   IEKN GC 
Sbjct: 249 CSFSFCWNCTEEAHRPVDCSTVSKWILKNSAESENMNWILANSKPCPRCKRPIEKNQGCM 308

Query: 182 HMSCR--CGYEFCWLCLGDY 199
           HM+C   C YEFCWLCLG +
Sbjct: 309 HMTCTPPCKYEFCWLCLGAW 328



>gi|345562364|gb|EGX45432.1| hypothetical protein AOL_s00169g38 [Arthrobotrys oligospora ATCC
           24927]
          Length = 463

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 105/227 (46%), Gaps = 21/227 (9%)

Query: 5   TLECGVCCED----YSIIQQISSSCGHNDI--CSVCIKRHIEAEL-NSKGGDVQVRCPKS 57
           T EC +C  +    Y    +I+  C H +   C  C+K  I++ + N+  GD+  +CP+ 
Sbjct: 162 TFECAICLSEVDRRYQPKGKIAPGCKHAESSCCLECLKSMIDSAVRNAMWGDL--KCPEL 219

Query: 58  RCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQK--CGSGQEHTTGDRF 115
            C   L    V+R AS+  + +++   L  A+    +FRWC  +   CG GQ H   D  
Sbjct: 220 DCQAGLDSAAVKRYASEAAYAKWEKFQLMKALEGDEEFRWCPGENFTCGHGQLHPERDSQ 279

Query: 116 PIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCP--NCYMS 173
           P I C  C    C+T  V WH G TC ++   L T   + + A   + TK+CP   C + 
Sbjct: 280 PRIICSECDTHHCYTCRVIWHRGETCAEYQANLAT---SQSEALILKTTKRCPARGCGIP 336

Query: 174 IEKNDGCDHMSCR--CGYEFCWLCLGDYENIRTHGNHY---HAPTCQ 215
           IEK + C  +S R  CG  FCW C     N   H       H  TC+
Sbjct: 337 IEKREACLEVSHRGGCGTNFCWDCKAIVGNDIPHSERVANRHFSTCK 383



>gi|297743763|emb|CBI36646.3| unnamed protein product [Vitis vinifera]
          Length = 516

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 92/199 (46%), Gaps = 5/199 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y      S++CGH   CS C + +I   +N   G + +RCP   C   +  
Sbjct: 84  LTCGICFETYPRDMIQSAACGH-PFCSTCWEGYISTSINDGPGCLMLRCPDPSCRAAVGQ 142

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+Y   LLR  I      +WC A  C    E   G     + C  C  
Sbjct: 143 DMINLLASDEDNEKYSRYLLRSYIEDNRKTKWCPAPGCEYAVEFVAGSGSYDVAC-QCSY 201

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C+   +  L+    + N  +   ++K CP C   IEKN GC H++
Sbjct: 202 GFCWNCTEEAHRPVDCSTVAKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHIT 261

Query: 185 CR--CGYEFCWLCLGDYEN 201
           C   C +EFCWLCLG + +
Sbjct: 262 CTPPCKFEFCWLCLGAWSD 280



>gi|297843384|ref|XP_002889573.1| hypothetical protein ARALYDRAFT_470601 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297335415|gb|EFH65832.1| hypothetical protein ARALYDRAFT_470601 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 557

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 92/197 (46%), Gaps = 5/197 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y +   +S+SCGH   C+ C   +I   +N   G + ++CP   CP  +  
Sbjct: 135 LTCGICFESYPLEDIVSASCGHP-FCNTCWTGYISTTINDGPGCLMLKCPDPSCPAAIGR 193

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + + +LA KE  E+Y    LR  +      +WC A  C    +   G     ++C  C  
Sbjct: 194 DMIDKLACKEDKEKYYRYFLRSYVEDNRKMKWCPAPGCEHAIDFAAGTESYDVSC-LCSH 252

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C    +  L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 253 SFCWNCTEEAHRPVDCDTVGKWILKNSAESENMNWILANSKPCPRCKRPIEKNHGCMHMT 312

Query: 185 CR--CGYEFCWLCLGDY 199
           C   C +EFCWLCL  +
Sbjct: 313 CTPPCKHEFCWLCLNAW 329



>gi|255585685|ref|XP_002533527.1| Protein ariadne-1, putative [Ricinus communis]
 gi|223526609|gb|EEF28857.1| Protein ariadne-1, putative [Ricinus communis]
          Length = 478

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 92/199 (46%), Gaps = 5/199 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CGVC E +S  +  S++CGH   C  C   +I   +N   G + +RCP   C   +  
Sbjct: 65  LTCGVCFESFSRDKITSAACGH-PFCMACWSGYISTTINDGPGCLMLRCPVPSCQAAVGQ 123

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+Y   LLR  I      +WC A  C    +   G     ++C  C  
Sbjct: 124 DMINLLASDEDKEKYSRYLLRSYIEDNRKTKWCPAPGCEYAVDFAAGGGSFDVSC-LCSY 182

Query: 126 KSCFTHDVPWHSGLTC-TQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C T     L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 183 SFCWNCTEEAHRPVDCGTVAKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHMT 242

Query: 185 CR--CGYEFCWLCLGDYEN 201
           C   C +EFCWLCLG + +
Sbjct: 243 CTPPCKFEFCWLCLGAWSD 261



>gi|452840435|gb|EME42373.1| hypothetical protein DOTSEDRAFT_73259 [Dothistroma septosporum
           NZE10]
          Length = 520

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 9/197 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +   +  CGH   C  C + ++  ++  +G   +++CP   C   +  + 
Sbjct: 145 CNICCEDEPGLPGFAMKCGHR-FCVNCYRHYLTQKIREEGEAARIKCPGDGCSKVVDAKS 203

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L   +L +RY  LL+R  +    + +WC A +C    E     R      P + C  
Sbjct: 204 LELLIPSDLSDRYHELLMRTYVDDKDNLKWCPAPECVYAVECGVKKRDLNKVVPTVHC-E 262

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C    CF   +  H    C+   + L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 263 CKHSFCFGCTLADHQPCPCSLVKKWLKKCEDDSETANWISANTKECPKCNSTIEKNGGCN 322

Query: 182 HMSCR-CGYEFCWLCLG 197
           HM+CR C  EFCW+C+G
Sbjct: 323 HMTCRKCRNEFCWMCMG 339



>gi|295664735|ref|XP_002792919.1| ariadne-1 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226278440|gb|EEH34006.1| ariadne-1 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 610

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 103/205 (50%), Gaps = 21/205 (10%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   +++CP+++C   +  + 
Sbjct: 253 CDICCEDRKGLESYAMRCGHR-FCVDCYRHYLGQKIREEGEAARIQCPQNKCHRIVDSKT 311

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKS 127
           +  L +++L ERY  LL+R  +    + +WC A  C              I CG    K 
Sbjct: 312 LDLLVTEDLQERYHRLLIRTYVDDKYNLKWCPAPNCEFA-----------IDCGV--KKR 358

Query: 128 CFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR 186
                VP  +   C+   + L+  +D +    +   HTK+CP C  +IEKN GC+HM+CR
Sbjct: 359 DLNRVVP--TPPPCSLVKKWLKKCKDDSETANWISAHTKECPKCSSTIEKNGGCNHMTCR 416

Query: 187 -CGYEFCWLCLGDYENIRTHGNHYH 210
            C +EFCW+C+G +     HG  ++
Sbjct: 417 KCKHEFCWMCMGLWSE---HGTSWY 438



>gi|85085463|ref|XP_957515.1| hypothetical protein NCU04438 [Neurospora crassa OR74A]
 gi|28918607|gb|EAA28279.1| predicted protein [Neurospora crassa OR74A]
 gi|40882182|emb|CAF06008.1| related to RING finger protein Dorfin [Neurospora crassa]
          Length = 247

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 93/196 (47%), Gaps = 22/196 (11%)

Query: 6   LECGVCCEDYSIIQ----QISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           +EC VC E    +     ++S+ C H   +C  C++  I A+L +K     + CP+  C 
Sbjct: 30  IECVVCTETKDFLHFPLSKLSTDCQHAMRVCVECVRLSITADLKNKPWQ-DINCPE--CN 86

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
             L  + V R AS E   +Y+  L +  +     FRWC    CGSG  H  G   PI+ C
Sbjct: 87  NRLDADVVLRYASPEKRAKYEDFLTKNMLESQEGFRWCTEPSCGSGHIHEGGYSQPIMKC 146

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERH-------------TKQC 167
              G  SC+ H VPWH G+TC +F+   +  D  A + +  +              +K C
Sbjct: 147 PN-GHLSCYVHKVPWHKGMTCDEFDIVKKNPDSPAYKQHLRQQEENQQSEKIIALTSKPC 205

Query: 168 PNCYMSIEKNDGCDHM 183
           P+C  +IEKN GC HM
Sbjct: 206 PSCGRNIEKNGGCAHM 221



>gi|328773966|gb|EGF84003.1| hypothetical protein BATDEDRAFT_9163 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 500

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 104/213 (48%), Gaps = 12/213 (5%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
            EC +CC + + +  ++ SC H+  C  C + ++  ++  +G   ++RCP S C I +  
Sbjct: 124 FECDICCNNDTGLMTLALSC-HHRFCVDCYRHYLTLKIAEEGESRRIRCPASGCCIIVDE 182

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITC 120
           + V  +    ++++Y  LL+R  +      +WC A  C    E         +  P +TC
Sbjct: 183 KVVESVVIPAIYQKYQDLLMRTYVDDNIYLKWCPAPNCEYAVECKVHQDQLKELVPAVTC 242

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDG 179
             CG   CF   +P H    C      ++  ED +    +   +TK+C  C  +IEK  G
Sbjct: 243 -RCGHTFCFGCSLPNHQPCICYIVKFWIKKCEDDSETANWISANTKECIKCSTTIEKAGG 301

Query: 180 CDHMSCR-CGYEFCWLCLGDYENIRTHGNHYHA 211
           C+HM+CR C +EFCW+C+G +     HG  +++
Sbjct: 302 CNHMTCRKCKHEFCWVCMGPWSE---HGTSWYS 331



>gi|336471198|gb|EGO59359.1| hypothetical protein NEUTE1DRAFT_39917 [Neurospora tetrasperma FGSC
           2508]
 gi|350292284|gb|EGZ73479.1| hypothetical protein NEUTE2DRAFT_137819 [Neurospora tetrasperma
           FGSC 2509]
          Length = 247

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 93/196 (47%), Gaps = 22/196 (11%)

Query: 6   LECGVCCEDYSIIQ----QISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSRCP 60
           +EC VC E    +     ++S+ C H   +C  C++  I A+L +K     + CP+  C 
Sbjct: 30  IECVVCTETKDFLHFPLSKLSTDCQHAMRVCVECVRLSITADLKNKHWQ-DINCPE--CN 86

Query: 61  IELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITC 120
             L  + V R AS E   +Y+  L +  +     FRWC    CGSG  H  G   PI+ C
Sbjct: 87  NRLDADVVLRYASPETRAKYEDFLTKHMLESQEGFRWCTEPSCGSGHIHEGGYSQPIMKC 146

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERH-------------TKQC 167
              G  SC+ H VPWH G+TC +F+   +  D  A + +  +              +K C
Sbjct: 147 PN-GHLSCYVHKVPWHKGMTCDEFDIVKKNPDSPAYKQHLRQQEENKQSEKIIALTSKPC 205

Query: 168 PNCYMSIEKNDGCDHM 183
           P+C  +IEKN GC HM
Sbjct: 206 PSCGRNIEKNGGCAHM 221



>gi|224067302|ref|XP_002302456.1| predicted protein [Populus trichocarpa]
 gi|222844182|gb|EEE81729.1| predicted protein [Populus trichocarpa]
          Length = 506

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 94/196 (47%), Gaps = 5/196 (2%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKG-GDVQVRCPKSRCPIELTYE 66
           CG+C E ++  + I + CGH   C +C   +I   +N+ G G + +RCP+  C   +  +
Sbjct: 101 CGICFESHTSDRIIYADCGHL-YCEICWSIYISTSINNDGAGCLMLRCPEPSCHAAIGQD 159

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
            +  L S+E  ++Y   LLR  +      +WC    C    E +  D    +TC  C   
Sbjct: 160 MIDSLTSEEDRKKYSDFLLRSYVEDNRTTKWCPGPACEYAIEFSGADGIFDVTCH-CFTS 218

Query: 127 SCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            C+      H  + C       L+    + N  Y   + K CPNC   IEKN GC HM+C
Sbjct: 219 FCWNCKEECHRPMDCDTVKRWILKNSSESENVNYILAYCKPCPNCKRPIEKNHGCMHMTC 278

Query: 186 R-CGYEFCWLCLGDYE 200
           R C YEFCWLCLG ++
Sbjct: 279 RVCRYEFCWLCLGPWK 294



>gi|359478116|ref|XP_003632072.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Vitis
           vinifera]
 gi|147800085|emb|CAN64272.1| hypothetical protein VITISV_008933 [Vitis vinifera]
          Length = 587

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 92/199 (46%), Gaps = 5/199 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y      S++CGH   CS C + +I   +N   G + +RCP   C   +  
Sbjct: 133 LTCGICFETYPRDMIQSAACGH-PFCSTCWEGYISTSINDGPGCLMLRCPDPSCRAAVGQ 191

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+Y   LLR  I      +WC A  C    E   G     + C  C  
Sbjct: 192 DMINLLASDEDNEKYSRYLLRSYIEDNRKTKWCPAPGCEYAVEFVAGSGSYDVAC-QCSY 250

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C+   +  L+    + N  +   ++K CP C   IEKN GC H++
Sbjct: 251 GFCWNCTEEAHRPVDCSTVAKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHIT 310

Query: 185 CR--CGYEFCWLCLGDYEN 201
           C   C +EFCWLCLG + +
Sbjct: 311 CTPPCKFEFCWLCLGAWSD 329



>gi|402222073|gb|EJU02140.1| hypothetical protein DACRYDRAFT_115913 [Dacryopinax sp. DJM-731
           SS1]
          Length = 172

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 25/161 (15%)

Query: 35  IKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPD 94
           ++ H++  L S+ G +   CP   C  + ++ED++R AS+E F RYD LLLR A+   P 
Sbjct: 1   MRHHVDVRL-SELGTIAPLCPS--CRHDFSHEDIQRTASEEAFARYDRLLLRKAVGNQPG 57

Query: 95  FRWCKAQKCGSGQEHTTGDRFP-----------------IITCGACGAKSCFTHDVPWHS 137
           F WCK   C  GQ H   D  P                 ++ C ACG KSCF HDV WH 
Sbjct: 58  FVWCKNPSCEGGQFHIIPD-MPKRLGLVGWMQEPCLDADLVVCFACGTKSCFRHDVLWHE 116

Query: 138 GLTCTQFNEQLQTEDF----TANRAYHERHTKQCPNCYMSI 174
           G +C ++ +   T+ F    +  RA  E+ T+ CP C   +
Sbjct: 117 GRSCQEYEQSKGTKPFAKMQSRTRATIEKTTRACPKCKTPV 157



>gi|399168667|emb|CCE30453.1| probable ring-finger protein Ariadne-1 [Claviceps purpurea 20.1]
          Length = 529

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 98/210 (46%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +   +  CGH   C  C   ++  ++  +G   +++CP   C        
Sbjct: 142 CDICCEDEEDLPTFAMKCGHR-YCVGCHAHYLTQKIKQEGEAAKIQCPSDGCGRIYDSRS 200

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           V  L   E+ +RY  LL R  +     F+WC A  C +  E +   +      P + C +
Sbjct: 201 VDLLVGPEMVDRYHELLNRNYVEGKEHFKWCPAPDCPNVVECSVKKKELDKVVPAVEC-S 259

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG + CF      H    C    + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 260 CGYRFCFGCPHSDHQPAPCELVKKWLRKCADDSETANWISANTKECPKCGSTIEKNGGCN 319

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C YEFCW+C+G +     HG  ++
Sbjct: 320 HMTCRKCKYEFCWMCMGLWSE---HGTSWY 346



>gi|71018479|ref|XP_759470.1| hypothetical protein UM03323.1 [Ustilago maydis 521]
 gi|46099077|gb|EAK84310.1| hypothetical protein UM03323.1 [Ustilago maydis 521]
          Length = 524

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 104/212 (49%), Gaps = 14/212 (6%)

Query: 8   CGVCCEDY--SIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           C +C +D     ++ ++ +CGH   C  C ++++E ++ S+G   +V+C + +C + +  
Sbjct: 146 CFMCSDDMPNGKMETLALACGHR-YCRDCYQQYLEQKIKSEGESRRVQCMREKCNLVVDE 204

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-HTTGDRF----PIITC 120
             V  +    +FERY  LL R  +      RWC A  C    E H +        P + C
Sbjct: 205 GTVGLVVEPTVFERYKILLNRTYVDDSNILRWCPAPNCELAVECHVSSKMLNKVVPSVAC 264

Query: 121 GACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDG 179
             CG   CF      H+   C      L+  ED +    +   +TK+CP C  +IEKN G
Sbjct: 265 D-CGHPFCFGCGNAAHAPAICPIAKMWLKKCEDDSETANWISANTKECPKCTSTIEKNGG 323

Query: 180 CDHMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           C+HM+CR C YE+CW+C G +     HGN ++
Sbjct: 324 CNHMTCRKCKYEWCWICAGPWSE---HGNSWY 352



>gi|299470137|emb|CBN78166.1| ubiquitin-conjugating enzyme E2-binding protein 1 [Ectocarpus
           siliculosus]
          Length = 518

 Score = 95.9 bits (237), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 100/209 (47%), Gaps = 10/209 (4%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           LEC +CCE+++  +  + +C H   C  C   ++ A++      V   CP+ +CP   + 
Sbjct: 153 LECRICCEEFTAKEAYALACKHF-FCRGCWAAYLGAKVQEGPTSVYTTCPEHKCPQIASE 211

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
                  S E  +RY    L   +      R+C  + CG   +      +P      CG+
Sbjct: 212 STFSEFLSAEDLKRYQAFSLTSFVDINKMLRFCPGKDCGMVVKAPLS--YPRSVRCNCGS 269

Query: 126 KSCFTHDVPWHSGLTCTQ---FNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDH 182
             CF      H   +C +   + E+ Q E  TAN  +   +TKQCP C   IEKN GC+H
Sbjct: 270 VFCFRCGEEAHDPASCEELAMWKEKCQNESETAN--WILANTKQCPKCKTRIEKNQGCNH 327

Query: 183 MSCR-CGYEFCWLCLGDY-ENIRTHGNHY 209
           MSCR C  EFCW+C+GD+ E+  + G +Y
Sbjct: 328 MSCRQCKAEFCWICMGDWSEHGSSSGGYY 356



>gi|358391353|gb|EHK40757.1| hypothetical protein TRIATDRAFT_226760 [Trichoderma atroviride IMI
           206040]
          Length = 565

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 81/144 (56%), Gaps = 14/144 (9%)

Query: 19  QQISSSCGHND-----ICS-----VCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDV 68
           Q+I S   +ND     IC+     +   R I ++L  K     +RCP+ R  +E  Y D+
Sbjct: 268 QRIPSDRENNDDRDCLICADTKEEILFPRSIRSDLTGKIW-TDIRCPECRQLLE--YTDI 324

Query: 69  RRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSC 128
           +R A +E F+RY+TL LR A+ +  +F WC +  CGSGQ H TG   PI+ C  C  +SC
Sbjct: 325 QRYADEETFKRYETLALRAAMAEAENFFWCTS-GCGSGQIHDTGHDHPIVICLHCSHRSC 383

Query: 129 FTHDVPWHSGLTCTQFNEQLQTED 152
           F H+V WH GLTC ++ + L   D
Sbjct: 384 FRHNVAWHQGLTCEEYEQLLADPD 407



>gi|357150016|ref|XP_003575311.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like
           [Brachypodium distachyon]
          Length = 586

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 100/219 (45%), Gaps = 11/219 (5%)

Query: 2   TETTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
            E  L CG+C E        ++SCGH   C VC + +I   +N   G + +RCP   C  
Sbjct: 125 NERELTCGICFESCPRESMSAASCGH-PFCGVCWRGYISTAINDGPGCLMLRCPDPSCSA 183

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
            +  + +  LAS E   +YD  L R  I      +WC A  C    E   G     ++CG
Sbjct: 184 AVGQDMIDLLASDEDKGKYDRYLCRSYIEDNRKTKWCPAPGCEYAVEFVVGGGSYDVSCG 243

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
            C    C+      H  + C+  ++  L+    + N  +   ++K CP C   IEKN GC
Sbjct: 244 -CSYGFCWNCTEEAHRPVDCSTVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGC 302

Query: 181 DHMSCR--CGYEFCWLCLGDYEN--IRTHG----NHYHA 211
            H++C   C +EFCWLCLG + +   RT G    N Y A
Sbjct: 303 MHITCTPPCKFEFCWLCLGPWSDHGERTGGFYACNRYEA 341



>gi|66824123|ref|XP_645416.1| RING zinc finger-containing protein [Dictyostelium discoideum AX4]
 gi|60473559|gb|EAL71502.1| RING zinc finger-containing protein [Dictyostelium discoideum AX4]
          Length = 875

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 96/193 (49%), Gaps = 14/193 (7%)

Query: 23  SSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDT 82
           S CGH   C+ C+ ++++  +  +     + CP+ +C   L Y  ++ L  ++ F +Y+ 
Sbjct: 622 SQCGHT-YCTECLTQYLKTNILERK--THIACPELKCTSWLQYGQIKYLVDEQTFTKYEE 678

Query: 83  LLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCT 142
                 + K P+++WC    CG+       +     +  +C    CF  +V WH   TC 
Sbjct: 679 FTFSTFLMKSPNYKWCPNNNCGNAVYGEIDNPRTRCSNKSCNFDFCFNCEVEWHQS-TCE 737

Query: 143 QFNEQLQTEDFTANRAYHE----RHTKQCPNCYMSIEKNDGCDHMSCRCGYEFCWLCLGD 198
           Q+ +  + E+   + A+++       K CP C  +IE+  GC H++C CGY+FCWLC G 
Sbjct: 738 QY-QIWKLENTMVDSAFNQWTKTTDLKPCPKCKSNIERIAGCAHVTCHCGYQFCWLCGGK 796

Query: 199 YENIRTHGNHYHA 211
           Y N     NH++A
Sbjct: 797 YSN-----NHFNA 804



>gi|347827664|emb|CCD43361.1| similar to RING finger domain-containing protein [Botryotinia
           fuckeliana T4]
 gi|472244097|gb|EMR88726.1| putative ibr domain-containing protein [Botryotinia fuckeliana
           BcDW1]
          Length = 516

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 9/197 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C  +++  ++  +G   +++CP   C   +    
Sbjct: 140 CDICCEDEPGLQSFAMKCGHR-YCVNCYNQYLIQKIKEEGEAARIQCPHDGCRRIMDSHS 198

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +  E            P + C  
Sbjct: 199 LDLLVAADLKSRYHELLTRTYVEDKEFLKWCPAPDCQNAIECGIKKKDLDKVVPTVVCD- 257

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    CT   + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 258 CKHRFCFGCILADHQPAPCTLVKKWLKKCADDSETANWISANTKECPECNSTIEKNGGCN 317

Query: 182 HMSCR-CGYEFCWLCLG 197
           HM+CR C +EFCW+C+G
Sbjct: 318 HMTCRKCKHEFCWMCMG 334



>gi|154294327|ref|XP_001547605.1| hypothetical protein BC1G_13936 [Botryotinia fuckeliana B05.10]
          Length = 617

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 98/210 (46%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   +Q  +  CGH   C  C  +++  ++  +G   +++CP   C   +    
Sbjct: 241 CDICCEDEPGLQSFAMKCGHR-YCVNCYNQYLIQKIKEEGEAARIQCPHDGCRRIMDSHS 299

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-----HTTGDRFPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +  E            P + C  
Sbjct: 300 LDLLVAADLKSRYHELLTRTYVEDKEFLKWCPAPDCQNAIECGIKKKDLDKVVPTVVCD- 358

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    CT   + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 359 CKHRFCFGCILADHQPAPCTLVKKWLKKCADDSETANWISANTKECPECNSTIEKNGGCN 418

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 419 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 445



>gi|345564001|gb|EGX46983.1| hypothetical protein AOL_s00097g222 [Arthrobotrys oligospora ATCC
            24927]
          Length = 1390

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 100/210 (47%), Gaps = 12/210 (5%)

Query: 8    CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
            C +CCED + +   S  C H   C+ C + ++  ++  +G  ++++CP   C + +  + 
Sbjct: 1016 CDICCEDENGLPTFSLRCNHR-YCADCYRHYLSQKIKEEGEAIRIQCPSDGCKVLVDPKS 1074

Query: 68   VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCG-----SGQEHTTGDRFPIITCGA 122
            +  LA   +  RY  LL R  +    + RWC A  C         +    +  P + C  
Sbjct: 1075 IVMLAGVGVLSRYYELLNRTYVEDRENLRWCPAPNCEYVVDCPVSQKQLQEIVPTVLCD- 1133

Query: 123  CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
            CG   CF      H    C    + L+  ED +    +   +TK+CP C  +IEKN GC+
Sbjct: 1134 CGHHFCFGCGSNDHQPCPCGLVKKWLKKCEDDSETANWISANTKECPKCQSTIEKNGGCN 1193

Query: 182  HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
            HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 1194 HMTCRKCKHEFCWVCMGPWNE---HGTSWY 1220



>gi|443897746|dbj|GAC75085.1| predicted E3 ubiquitin ligase [Pseudozyma antarctica T-34]
          Length = 527

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 99/200 (49%), Gaps = 12/200 (6%)

Query: 18  IQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELF 77
           ++ ++ +CGH   C  C + ++E ++ ++G   +V+C + +C + +    V  +   E+F
Sbjct: 161 METLALACGHR-YCRDCYQHYLEQKIRAEGESRRVQCMREKCNLVIDERTVGLVVVPEVF 219

Query: 78  ERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-HTTGDRF----PIITCGACGAKSCFTHD 132
           ERY  LL R  +      RWC A  C    E H +        P + C  CG   CF   
Sbjct: 220 ERYKILLNRTYVDDSNVLRWCPAPNCELAVECHVSNKMLNKVVPSVRCD-CGHAFCFGCG 278

Query: 133 VPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYE 190
              H+   C      L+  ED +    +   +TK+CP C  +IEKN GC+HM+CR C YE
Sbjct: 279 NAAHAPAICPIAKLWLKKCEDDSETANWISANTKECPKCNSTIEKNGGCNHMTCRKCKYE 338

Query: 191 FCWLCLGDYENIRTHGNHYH 210
           +CW+C G +     HGN ++
Sbjct: 339 WCWICAGPWSE---HGNSWY 355



>gi|475540461|gb|EMT09603.1| Putative E3 ubiquitin-protein ligase ARI7 [Aegilops tauschii]
          Length = 491

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 99/218 (45%), Gaps = 17/218 (7%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L C +C +++   Q  S+ CGH   C VC + +I A +      + +RCP   C   +  
Sbjct: 122 LTCDLCFDNHPPGQMKSAGCGHL-YCRVCWRGYIRAAVEDGARCLSLRCPDPSCSAAVLR 180

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFP---IITCGA 122
           + V  +A +E  +RY    LR  + +    RWC A  CG   E+  G+       + C  
Sbjct: 181 DLVDDVADEEDKQRYAGFALRSYVEESKTMRWCPAPGCGLAMEYLGGESLSEQLDVVCD- 239

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNE-QLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CG   C       H  + C    E   +    + +  +   +TK CP C   IEKN GC+
Sbjct: 240 CGHGFCIVCAEESHRPVPCRTVREWAAKNSSESESTNWVMANTKLCPKCRRPIEKNTGCN 299

Query: 182 HMSCR--CGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
           HM+CR  C ++FCW+CL DY     HG H    TC  Y
Sbjct: 300 HMTCRDPCRHQFCWICLADY-----HGGH----TCNRY 328



>gi|194868345|ref|XP_001972274.1| GG15432 [Drosophila erecta]
 gi|190654057|gb|EDV51300.1| GG15432 [Drosophila erecta]
          Length = 511

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 98/193 (50%), Gaps = 13/193 (6%)

Query: 25  CGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASK-ELFERYDTL 83
           CGH+  C+ C K+++  +  S+G    ++CP S C I + Y    +LA   E+ ERY  L
Sbjct: 155 CGHS-FCAACWKQYLANKTCSEGLANTIKCPASNCEILVDYVSFLKLADDPEVVERYQQL 213

Query: 84  LLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQ 143
           +    +      RWC A  C    +    +  P      CG + CF     WH   +C+ 
Sbjct: 214 ITNTFVECNMLMRWCPAPNCSHAVKAVCAE--PRAVHCKCGHEFCFACGENWHEPASCSS 271

Query: 144 FNEQLQT--EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR---CGYEFCWLCLGD 198
               ++   ED +    +  ++TK+CP C ++IEK+ GC+HM C+   C Y+FCW+CLG 
Sbjct: 272 LKTWVKKCLED-SETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330

Query: 199 YENIRTHGNHYHA 211
           +E    HG+ +++
Sbjct: 331 WE---PHGSSWYS 340



>gi|501310477|dbj|GAC99237.1| hypothetical protein PHSY_006837 [Pseudozyma hubeiensis SY62]
          Length = 859

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 100/200 (50%), Gaps = 12/200 (6%)

Query: 18  IQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELF 77
           ++ ++ +CGH   C  C ++++E ++ S+G   +V+C + +C + +    V  +   ++F
Sbjct: 493 METLALACGHR-YCRDCYQQYLEQKIKSEGESRRVQCMREKCNLVIDEGTVGLVVEPKVF 551

Query: 78  ERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-HTTGDRF----PIITCGACGAKSCFTHD 132
           ERY  LL R  +      RWC A  C    E H +        P + C  CG   CF   
Sbjct: 552 ERYKILLNRTYVDDSSILRWCPAPNCELAVECHVSNKELSKVVPSVACD-CGHAFCFGCG 610

Query: 133 VPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYE 190
              H+   C      L+  ED +    +   +TK+CP C  +IEKN GC+HM+CR C YE
Sbjct: 611 NAAHAPAICPVAKLWLKKCEDDSETANWISANTKECPKCTSTIEKNGGCNHMTCRKCKYE 670

Query: 191 FCWLCLGDYENIRTHGNHYH 210
           +CW+C G +     HGN ++
Sbjct: 671 WCWICAGPWTE---HGNSWY 687



>gi|383864941|ref|XP_003707936.1| PREDICTED: protein ariadne-2-like [Megachile rotundata]
          Length = 488

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 97/206 (47%), Gaps = 9/206 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C VC   Y   +  + +CGH+  C  C   H E ++ ++G    + C    C +    + 
Sbjct: 134 CSVCVTIYPADKFSTLTCGHS-FCKDCWCMHFEVQI-TQGISTGISCMAQDCNVLAPEDF 191

Query: 68  VRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           V  L +K  + ERY        ++  P  R+C    C     H+   R   + C +C + 
Sbjct: 192 VLSLLTKPNMRERYQQFAFCDYVKSHPQLRFCPGPNCQMVM-HSKEQRAKRVMCSSCKSI 250

Query: 127 SCFTHDVPWHSGLTCTQFNEQL-QTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            CF     +H+   C    + L +  D +    Y   HTK CP C++ IEKN GC+HM C
Sbjct: 251 FCFRCGTDYHAPTDCNTIKKWLIKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC 310

Query: 186 -RCGYEFCWLCLGDYENIRTHGNHYH 210
             C Y+FCW+CLGD+   RTHG+ Y+
Sbjct: 311 YNCKYDFCWICLGDW---RTHGSEYY 333



>gi|378732131|gb|EHY58590.1| ubiquitin-conjugating enzyme E2 [Exophiala dermatitidis NIH/UT8656]
          Length = 513

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 101/210 (48%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C ED   ++  +  CGH   C  C   ++  ++  +G   ++ CP   C   +  + 
Sbjct: 139 CEICYEDDPTMETYAMKCGHR-YCVSCYSHYLTQKVKEEGEAARIECPFDGCHRIVDSKS 197

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           ++ L  K + +RY+ LL R  +    + +WC A +C    E +   R      P + C A
Sbjct: 198 LKLLVDKSVQDRYEVLLTRTYVDDKENLKWCPAPECEYAVECSVKKRDLNRIVPTVRC-A 256

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
                CF   +  H    C    + L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 257 NDHSFCFGCTLADHRPAPCGLVKKWLKKCEDDSETSNWISANTKECPRCHSTIEKNGGCN 316

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 317 HMTCRKCKHEFCWMCMGPWSE---HGTSWY 343



>gi|156039407|ref|XP_001586811.1| hypothetical protein SS1G_11840 [Sclerotinia sclerotiorum 1980]
 gi|154697577|gb|EDN97315.1| hypothetical protein SS1G_11840 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 513

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 99/210 (47%), Gaps = 12/210 (5%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED + +   +  CGH   C  C  +++  ++  +G   +++CP   C   +    
Sbjct: 137 CDICCEDEAGLLSFAMKCGHR-YCVNCYNQYLSQKIKEEGEAARIQCPHDGCRRIMDSHS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L  RY  LL R  +      +WC A  C +  E     +      P + C  
Sbjct: 196 LDLLVAADLKSRYHELLTRTYVEDKEFLKWCPAPDCQNAIECAIKKKDLDKVVPTVAC-E 254

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           C  + CF   +  H    CT   + L+   D +    +   +TK+CP C  +IEKN GC+
Sbjct: 255 CKHRFCFGCILADHQPAPCTLVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCN 314

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 315 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 341



>gi|348664944|gb|EGZ04781.1| hypothetical protein PHYSODRAFT_535714 [Phytophthora sojae]
 gi|348678351|gb|EGZ18168.1| hypothetical protein PHYSODRAFT_360629 [Phytophthora sojae]
          Length = 534

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 100/201 (49%), Gaps = 10/201 (4%)

Query: 4   TTLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIEL 63
           T ++C +CC++Y+  +     CGH   C  C K ++  ++      +   CP   C   +
Sbjct: 166 TKVDCNICCDEYAANEIFGMGCGHL-YCLNCWKPYLSLKIQEGPICITTTCPAHGCKEVV 224

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
           + E  +++ S E + +Y   LLR  +      +WC +  C      T+      +TC  C
Sbjct: 225 SDEIFKQIVSPEDYRKYARFLLRSFVDINKGVKWCPSAGCSKAI--TSAGGLLSVTC-TC 281

Query: 124 GAKSCFTHDVPWHSGLTCTQ---FNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
           G   C       HS +TC Q   + E+ + E  TAN  +   +TK+CP C + IEKN GC
Sbjct: 282 GCVFCLRCGEEAHSPVTCEQLASWQEKCRNESETAN--WILANTKKCPKCSVRIEKNQGC 339

Query: 181 DHMSCR-CGYEFCWLCLGDYE 200
           +HM+CR C YEFCW+C+  ++
Sbjct: 340 NHMTCRSCNYEFCWICMEGWD 360



>gi|66808225|ref|XP_637835.1| hypothetical protein DDB_G0286289 [Dictyostelium discoideum AX4]
 gi|60466258|gb|EAL64320.1| hypothetical protein DDB_G0286289 [Dictyostelium discoideum AX4]
          Length = 611

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 106/206 (51%), Gaps = 14/206 (6%)

Query: 8   CGVC-CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQ-VRCPKSRCPIELTY 65
           C +C  +D  I Q  +    H+  C  C+ +H ++++    GD + ++CP ++C   + Y
Sbjct: 402 CEICFSDDLKIDQMYTLDDCHHRFCKECLSQHFKSKIF--DGDCKSIQCPDTKCRRLVNY 459

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG--AC 123
           ++++    K    +Y+  LL+  + + P+ R+C    C +       D   +I C   +C
Sbjct: 460 QEIKHNVDKITMAKYEDFLLKTTLEEDPNSRFCPRPNCNNAM-IGDSDTVTMIICTNESC 518

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHE---RHTKQCPNCYMSIEKNDGC 180
               CF     WH  +TC Q++E  +    T+N+ + E    +TK CP C   IEK+ GC
Sbjct: 519 RYTFCFNCKSEWHKDMTCKQWSE-FKVLKETSNQRFEEWARENTKPCPKCKSKIEKDGGC 577

Query: 181 DHMSCR-CGYEFCWLCLGDYENIRTH 205
           +HM+C+ C ++FCWLCL  Y   +TH
Sbjct: 578 NHMTCKLCKHQFCWLCLDVY--TKTH 601



>gi|470114049|ref|XP_004293231.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Fragaria
           vesca subsp. vesca]
          Length = 617

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 18/207 (8%)

Query: 8   CGVCCEDY------SIIQQISSSCGHNDICSVCIKRHIEAELNSKGGD-VQVRCPKSRCP 60
           CG+C ++Y      S+   +++SCGH   C  C+  +I   +N +G   + +RCP+ +C 
Sbjct: 131 CGICFDEYDYSSTGSVSSILTASCGH-PYCRDCLAGYISTSINDRGPACLMLRCPEPKCS 189

Query: 61  IELTYEDVRRL------ASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHT-TGD 113
             +  + ++ +        K+L+++Y   LLR  +      +WC A  C         G+
Sbjct: 190 AAIGPDLIQNVLLMSEKKEKDLYDKYKRYLLRSYVENHKKIKWCPAPNCEYAIHFDGVGE 249

Query: 114 RFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQL-QTEDFTANRAYHERHTKQCPNCYM 172
                   AC  K C+      H  + C    + L + +D + N  +   +TK CP C  
Sbjct: 250 MVSYDVSCACSRKYCWNCTEESHRPVDCKTVKKWLLKNQDDSQNGKWIMVNTKPCPKCNR 309

Query: 173 SIEKNDGCDHMSCR--CGYEFCWLCLG 197
           SIEKN GC+HM+CR  C YEFCW CLG
Sbjct: 310 SIEKNLGCNHMTCRAPCRYEFCWYCLG 336



>gi|470110233|ref|XP_004291390.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI5-like isoform 3
           [Fragaria vesca subsp. vesca]
          Length = 493

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 98/210 (46%), Gaps = 18/210 (8%)

Query: 5   TLECGVCCEDY--SIIQQ-----ISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKS 57
           ++ CG+C EDY  S  Q      IS++CGH   C  C   +I   +N   G + +RCP+ 
Sbjct: 123 SVNCGICFEDYDCSYDQSADGAIISAACGH-PFCKDCWTGYISTSINDGPGCLMLRCPEP 181

Query: 58  RCPIELTYEDVRRLASKE---LFERYDTLLLRVAIRKLPDFRWCKAQKCGSG----QEHT 110
            C   + ++ +R +   +     ERY   LLR  + K    +WC A  C        E  
Sbjct: 182 SCSAAVDWDLIRNVLKNQHDHEIERYKRYLLRSYVEKHKQMKWCPAPDCQYAIKVFDEDL 241

Query: 111 TGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPN 169
           TG+         C    C+      HS + C    +  L+ +D + N  +   +TK CP 
Sbjct: 242 TGNGNCYDVSCICSNSFCWNCVEEVHSPVGCDTVGKWILKNKDDSQNAQWIVVNTKPCPK 301

Query: 170 CYMSIEKNDGCDHMSCR--CGYEFCWLCLG 197
           C   IEKN+GC+HM C   CG+ FCWLCLG
Sbjct: 302 CKTPIEKNNGCNHMRCSLPCGHHFCWLCLG 331



>gi|302916487|ref|XP_003052054.1| hypothetical protein NECHADRAFT_59963 [Nectria haematococca mpVI
           77-13-4]
 gi|256732993|gb|EEU46341.1| hypothetical protein NECHADRAFT_59963 [Nectria haematococca mpVI
           77-13-4]
          Length = 508

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 77/119 (64%), Gaps = 5/119 (4%)

Query: 39  IEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWC 98
           IE++L+SK    ++RCP+  C   L Y D++R A+ + F RY+TL LR A+ +  +F WC
Sbjct: 255 IESDLSSKLW-TEIRCPE--CRELLEYADIQRYANNQTFTRYETLALRAAMSEAENFIWC 311

Query: 99  KAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQL-QTEDFTAN 156
            +  CGSGQ H +G   PI+TC  CG +SCF H+V WH  L+C ++++ L   E+F +N
Sbjct: 312 TS-GCGSGQIHDSGSEQPIVTCLHCGHRSCFHHNVAWHQTLSCDEYDQLLADPENFRSN 369



>gi|452004789|gb|EMD97245.1| hypothetical protein COCHEDRAFT_1084405 [Bipolaris maydis C5]
          Length = 489

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 12/197 (6%)

Query: 21  ISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
            +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + +  L + +L ERY
Sbjct: 119 FAMKCGHR-FCLDCYRQYLATKIQDEGEAARIRCPGEGCTRIVDSKSLDLLVTADLHERY 177

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGACGAKSCFTHDVPW 135
            TLL R  +    + +WC A  C    E     +      P + C  CG   CF   +  
Sbjct: 178 HTLLTRTYVDDKENLKWCPAPDCKYAIECPVKSKELTRVVPTVHCD-CGHAFCFGCTLNN 236

Query: 136 HSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCW 193
           H    C    + ++  ED +    +   +TK+CPNC  +IEKN GC+HM+CR C  EFCW
Sbjct: 237 HQPAPCALVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCNHMTCRKCRNEFCW 296

Query: 194 LCLGDYENIRTHGNHYH 210
           +C+G +     HG  ++
Sbjct: 297 MCMGKWSE---HGTSWY 310



>gi|195493154|ref|XP_002094294.1| GE21740 [Drosophila yakuba]
 gi|194180395|gb|EDW94006.1| GE21740 [Drosophila yakuba]
          Length = 511

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 98/193 (50%), Gaps = 13/193 (6%)

Query: 25  CGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASK-ELFERYDTL 83
           CGH+  C+ C K+++  +  S+G    ++CP + C I + Y    +LA   E+ ERY  L
Sbjct: 155 CGHS-FCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYVSFLKLADDPEVVERYQQL 213

Query: 84  LLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQ 143
           +    +      RWC A  C    +    +  P      CG + CF     WH   +C+ 
Sbjct: 214 ITNTFVECNMLMRWCPAPNCSHAVKAVCAE--PRAVQCKCGHEFCFACGENWHEPASCSS 271

Query: 144 FNEQLQT--EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR---CGYEFCWLCLGD 198
               ++   ED +    +  ++TK+CP C ++IEK+ GC+HM C+   C Y+FCW+CLG 
Sbjct: 272 LKTWVKKCLED-SETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330

Query: 199 YENIRTHGNHYHA 211
           +E    HG+ +++
Sbjct: 331 WE---PHGSSWYS 340



>gi|156055562|ref|XP_001593705.1| hypothetical protein SS1G_05133 [Sclerotinia sclerotiorum 1980]
 gi|154702917|gb|EDO02656.1| hypothetical protein SS1G_05133 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 132

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 77  FERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWH 136
              YD  +L   IR  P+F  C   +CG GQ H   D  PI+TCGACG K+CFTH +PWH
Sbjct: 19  LPEYDRNVLLSCIRGDPNFTNCLGPECGGGQIHEDSDDQPIMTCGACGFKTCFTHKMPWH 78

Query: 137 SGLTCTQFN----EQLQTEDFTANRAYHERHTKQCPNCYMSI 174
           +GLTC Q+N    E+LQ E+  A+    E+ TKQCP C + +
Sbjct: 79  TGLTCNQYNTRERERLQQEE--ASLQLMEKATKQCPQCQVDL 118



>gi|502081662|ref|XP_004486930.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like isoform
           X1 [Cicer arietinum]
          Length = 590

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 98/215 (45%), Gaps = 11/215 (5%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y   +  ++SCGH   C  C   +I   +N   G + +RCP   C   +  
Sbjct: 137 LTCGICFEAYPPSRIQTASCGH-PYCFSCWGGYIGTSINDGPGCLMLRCPDPSCDAAVDQ 195

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+YD  LLR  I      +WC A  C        G     ++C  C  
Sbjct: 196 DMINLLASDEDREKYDRYLLRSYIEDNKKTKWCPAPGCEYAVNFDAGSGNYDVSC-LCSY 254

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 255 SFCWNCTEEAHRPVDCGTVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHMT 314

Query: 185 CR--CGYEFCWLCLGDYEN--IRTHG----NHYHA 211
           C   C +EFCWLCLG + +   RT G    N Y A
Sbjct: 315 CTPPCKFEFCWLCLGTWSDHGERTGGFYACNRYEA 349



>gi|470110229|ref|XP_004291388.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI5-like isoform 1
           [Fragaria vesca subsp. vesca]
 gi|470110231|ref|XP_004291389.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI5-like isoform 2
           [Fragaria vesca subsp. vesca]
          Length = 521

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 98/210 (46%), Gaps = 18/210 (8%)

Query: 5   TLECGVCCEDY--SIIQQ-----ISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKS 57
           ++ CG+C EDY  S  Q      IS++CGH   C  C   +I   +N   G + +RCP+ 
Sbjct: 123 SVNCGICFEDYDCSYDQSADGAIISAACGH-PFCKDCWTGYISTSINDGPGCLMLRCPEP 181

Query: 58  RCPIELTYEDVRRLASKE---LFERYDTLLLRVAIRKLPDFRWCKAQKCGSG----QEHT 110
            C   + ++ +R +   +     ERY   LLR  + K    +WC A  C        E  
Sbjct: 182 SCSAAVDWDLIRNVLKNQHDHEIERYKRYLLRSYVEKHKQMKWCPAPDCQYAIKVFDEDL 241

Query: 111 TGDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPN 169
           TG+         C    C+      HS + C    +  L+ +D + N  +   +TK CP 
Sbjct: 242 TGNGNCYDVSCICSNSFCWNCVEEVHSPVGCDTVGKWILKNKDDSQNAQWIVVNTKPCPK 301

Query: 170 CYMSIEKNDGCDHMSCR--CGYEFCWLCLG 197
           C   IEKN+GC+HM C   CG+ FCWLCLG
Sbjct: 302 CKTPIEKNNGCNHMRCSLPCGHHFCWLCLG 331



>gi|170587899|ref|XP_001898711.1| Ariadne-2 protein [Brugia malayi]
 gi|158592924|gb|EDP31519.1| Ariadne-2 protein, putative [Brugia malayi]
          Length = 477

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (50%), Gaps = 10/190 (5%)

Query: 25  CGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASK--ELFERYDT 82
           CGH+  CS C   +IE +L   G  + + C  S C +    + V R+ S+  E+ ++Y+ 
Sbjct: 140 CGHS-FCSACWMEYIETQL-CNGLSITIGCMASGCTLLCLEDFVLRILSERTEIRDKYER 197

Query: 83  LLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAKSCFTHDVPWHSGLTCT 142
           L+ +  +   P  R+C    C    +     +   +TC +C    CF     +H+  +C 
Sbjct: 198 LIFKDCVESHPQLRFCPGIDCHVVIK-AQCQKAKKVTCTSCRISFCFQCGCDYHAPTSCE 256

Query: 143 QFNEQL-QTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC-RCGYEFCWLCLGDYE 200
              + L +  D +    Y   HTK CPNC+  IEKN GC+HM C +C Y FCW+C GD++
Sbjct: 257 TIRKWLTKCADDSETANYISAHTKDCPNCHSCIEKNGGCNHMQCAKCKYHFCWMCFGDWK 316

Query: 201 NIRTHGNHYH 210
           N   HG+ Y+
Sbjct: 317 N---HGSEYY 323



>gi|358371364|dbj|GAA87972.1| RING finger protein [Aspergillus kawachii IFO 4308]
          Length = 495

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 98/210 (46%), Gaps = 28/210 (13%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CCED   ++  +  CGH   C  C + ++  ++  +G   ++ CP   C + +  + 
Sbjct: 137 CDICCEDGDDLETYAMRCGHR-FCVDCYRHYLRQKIREEGEAARIECPSDSCNMIVDSKS 195

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGA 122
           +  L + +L ERY  LL R  +    + +WC A  C    +     R      P + C  
Sbjct: 196 LGLLVTNDLKERYHALLTRTYVDDKDNLKWCPAPNCEYAVDCPIKQRDLRRVVPTVQC-- 253

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
                    D P      CT     L+  ED +    +   +TK+CP C+ +IEKN GC+
Sbjct: 254 ---------DSP------CTLVKMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCN 298

Query: 182 HMSCR-CGYEFCWLCLGDYENIRTHGNHYH 210
           HM+CR C +EFCW+C+G +     HG  ++
Sbjct: 299 HMTCRKCKHEFCWMCMGLWSE---HGTSWY 325



>gi|512200862|gb|EPE29694.1| RING/U-box [Glarea lozoyensis ATCC 20868]
          Length = 377

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 9/147 (6%)

Query: 4   TTLECGVCCEDYSII----QQISSSCGHN-DICSVCIKRHIEAELNSKGGDVQVRCPKSR 58
            T  C VC ED  +      ++++SC H  D+C +C+  HI+ ++  K    +V CP   
Sbjct: 191 VTKHCVVCLEDCDVDTFPEDKLTNSCSHEIDVCIMCVSTHIDTQV--KDNPTRVACPT-- 246

Query: 59  CPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPII 118
           C   L +E VR  AS E FERYD   L  + +  P F  C    C SGQ H+ G   PI+
Sbjct: 247 CLETLGFEAVRLYASAEAFERYDHHTLLQSFKDDPLFTMCLGPNCSSGQFHSGGYEEPIM 306

Query: 119 TCGACGAKSCFTHDVPWHSGLTCTQFN 145
           TC  C  K+CF H +PWH   TC +F+
Sbjct: 307 TCTTCHFKTCFVHRLPWHPEQTCAEFD 333



>gi|384245176|gb|EIE18671.1| IBR-domain-containing protein [Coccomyxa subellipsoidea C-169]
          Length = 499

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 90/199 (45%), Gaps = 12/199 (6%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +C +++ +    ++ C H   C  C + +I   + S    + +RCP   CP  +    
Sbjct: 102 CRICFDEFDLKHMRAARCKHF-FCKPCWRGYISTAIGSGPSVLSLRCPLPDCPAAVPAAV 160

Query: 68  VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRF-----PIITCGA 122
           V+ + S+    RYDT  +R  +       WC +  C    EH    R      P+    +
Sbjct: 161 VKEVVSESDARRYDTYAMRSFVEDNAQLTWCPSPGC----EHAVESRVEVGTEPMDIACS 216

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           CGA  CF      H  + C    +  L+    + N  +   HTKQCP C   IEKN GC 
Sbjct: 217 CGATFCFQCKEEAHRPVDCETVGKWILKNSAESENLNWILAHTKQCPKCKRPIEKNQGCM 276

Query: 182 HMSC-RCGYEFCWLCLGDY 199
           HM+C +C +EFCWLC G +
Sbjct: 277 HMTCSQCRFEFCWLCQGSW 295



>gi|19115116|ref|NP_594204.1| RING finger protein [Schizosaccharomyces pombe 972h-]
 gi|74698267|sp|Q9P3U4.1|YKX2_SCHPO RecName: Full=Uncharacterized RING finger protein C328.02
 gi|8894853|emb|CAB95997.1| ubiquitin-protein ligase involved in sporulation
           [Schizosaccharomyces pombe]
          Length = 504

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 18/218 (8%)

Query: 9   GVC--CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           G C  C D   +   S+ C H + C  C ++++++ ++   G+  ++CP+  C   ++ +
Sbjct: 129 GTCEICYDEGCLPFFSAECDH-EFCLACYRQYLDSRISE--GESVIQCPEESCTQIVSIQ 185

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-HTT----GDRFPIITCG 121
            + ++  ++  +RY  LL R  +      RWC A  C    E H T        P +TC 
Sbjct: 186 SITKVLDEKSLDRYHRLLDRSFVDDNDHLRWCPAPDCEFAIECHVTQASLSSVVPTVTCN 245

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGC 180
            CG + CF      H    C      LQ  +D +    +   +TK+CP C  +IEKN GC
Sbjct: 246 -CGKQFCFGCGHDNHQPTICPLVKIWLQKCQDDSETANWIHANTKECPKCSTTIEKNGGC 304

Query: 181 DHMSC-RCGYEFCWLCLGDYENIRTHGNHYHAPTCQYY 217
           +HM+C +C YEFCW+CLG +     HGN+++  TC  Y
Sbjct: 305 NHMTCKKCKYEFCWVCLGPWTE---HGNNWY--TCNRY 337



>gi|326505476|dbj|BAJ95409.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 490

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 97/209 (46%), Gaps = 8/209 (3%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E YS     S+ C H   C  C + +I A +N   G + +RCP+  C   +  
Sbjct: 67  LTCGICFEGYSTSALSSAGCVH-LYCHECWEGYISASINDGPGCLSLRCPEPSCTAMVLE 125

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           E + R A  E   +Y   L    I      +WC A  C    E   GD    ++C  C  
Sbjct: 126 ETINRFAKAEEKVKYKQFLSCSYIEDNRKIKWCPAPDCTRALEF-LGDENYDVSC-MCKF 183

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  ++C   ++  L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 184 SFCWNCTEETHRPVSCETVSKWILKNSAESENVNWIIANSKPCPKCKRPIEKNHGCMHMT 243

Query: 185 CR--CGYEFCWLCLGDYE--NIRTHGNHY 209
           CR  C ++FCWLCLGD+     RT G +Y
Sbjct: 244 CRPPCKFQFCWLCLGDWSEHGSRTTGGNY 272



>gi|477587212|gb|ENI04294.1| hypothetical protein COCC4DRAFT_197830 [Bipolaris maydis ATCC
           48331]
          Length = 513

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 12/197 (6%)

Query: 21  ISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELFERY 80
            +  CGH   C  C ++++  ++  +G   ++RCP   C   +  + +  L + +L ERY
Sbjct: 151 FAMKCGHR-FCLDCYRQYLATKIQDEGEAARIRCPGEGCTRIVDSKSLDLLVTADLHERY 209

Query: 81  DTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDR-----FPIITCGACGAKSCFTHDVPW 135
            TLL R  +    + +WC A  C    E     +      P + C  CG   CF   +  
Sbjct: 210 HTLLTRTYVDDKENLKWCPAPDCKYAIECPVKSKELTRVVPTVHCD-CGHAFCFGCTLNN 268

Query: 136 HSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYEFCW 193
           H    C    + ++  ED +    +   +TK+CPNC  +IEKN GC+HM+CR C  EFCW
Sbjct: 269 HQPAPCALVKKWVKKCEDDSETANWISANTKECPNCNSTIEKNGGCNHMTCRKCRNEFCW 328

Query: 194 LCLGDYENIRTHGNHYH 210
           +C+G +     HG  ++
Sbjct: 329 MCMGKWSE---HGTSWY 342



>gi|195017392|ref|XP_001984590.1| GH14942 [Drosophila grimshawi]
 gi|193898072|gb|EDV96938.1| GH14942 [Drosophila grimshawi]
          Length = 510

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 105/213 (49%), Gaps = 21/213 (9%)

Query: 8   CGVC---CEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELT 64
           CG+C   C+D   +      CGH   CS C K+++  +  S+G    + CP S C I + 
Sbjct: 143 CGICYCPCDDMKGL-----DCGHT-FCSACWKQYLANKTCSEGLAHSITCPASDCDILVD 196

Query: 65  YEDVRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
                +LA   E+  RY  L+    +   P  RWC A  C +  + +  +    + C  C
Sbjct: 197 DVSFVKLADNMEVIARYQQLITNTFVECNPLMRWCSAPSCTNAIKASYCES-RAVRC-TC 254

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQLQ--TEDFTANRAYHERHTKQCPNCYMSIEKNDGCD 181
           G + CF     WH  ++C      L+   ED +    +  +HTK+CP C  +IEK+ GC+
Sbjct: 255 GHEFCFGCGENWHEPVSCAFLKRWLKKNAED-SETSNWIAQHTKECPKCNATIEKDGGCN 313

Query: 182 HMSCR---CGYEFCWLCLGDYENIRTHGNHYHA 211
           HM C+   C Y+FCW+CLG +E    HG+ +++
Sbjct: 314 HMVCKNVHCLYDFCWVCLGSWE---PHGSSWYS 343



>gi|91092242|ref|XP_971366.1| PREDICTED: similar to zinc finger protein [Tribolium castaneum]
 gi|270014427|gb|EFA10875.1| hypothetical protein TcasGA2_TC001697 [Tribolium castaneum]
          Length = 487

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 99/209 (47%), Gaps = 11/209 (5%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           + C VC       +  S SC H   C  C   H E ++N +G    + C    C + L  
Sbjct: 131 ITCPVCVVVQPAEKFFSLSCSHM-FCKDCWVTHFEVQIN-QGISTAISCMARDCVV-LAP 187

Query: 66  ED--VRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGAC 123
           ED  ++ L+   + E+Y     +  ++  P+ R+C    C     H+T  R    TC  C
Sbjct: 188 EDFVLKHLSRPSMREKYQQFTFQDYVKSHPELRFCPGPNCPIVV-HSTEIRAKRATCSNC 246

Query: 124 GAKSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDH 182
               CF   + +H+   C+   + L    D +    Y   HTK CP C++ IEKN GC+H
Sbjct: 247 KTAFCFQCGMDYHAPTECSIIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNH 306

Query: 183 MSC-RCGYEFCWLCLGDYENIRTHGNHYH 210
           M C  C ++FCW+CLGD+   ++HG+ Y+
Sbjct: 307 MQCYNCKHDFCWMCLGDW---KSHGSEYY 332



>gi|358342131|dbj|GAA49668.1| ariadne-1 [Clonorchis sinensis]
          Length = 723

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 94/208 (45%), Gaps = 9/208 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C +CC ++   Q    +C H   C  C +R++E ++  +    ++ CP   C + +  E 
Sbjct: 350 CDICCMNFPHDQMQGLACRHY-FCLACWQRYLEWKIMEESQGDRIYCPSYGCNVLIEDES 408

Query: 68  V-RRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           V R + +  +  R+  L+    +       WC    CG        +    I C  C   
Sbjct: 409 VFRVITNPNVRRRFQKLISNSFVMHNRSLTWCPGADCGYAARCLGPEEPRQINCTNCSES 468

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQ-TEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            CF    PWH  + C Q    L+   D +    +   +TK+CP C+ +IEK+ GC+HM C
Sbjct: 469 FCFACSQPWHDPVRCDQLKNWLKRVSDDSGTSNWIVANTKECPKCHATIEKSGGCNHMIC 528

Query: 186 R---CGYEFCWLCLGDYENIRTHGNHYH 210
           R   C +EFCWLCL  +E    HG  ++
Sbjct: 529 RNVDCKFEFCWLCLDRWE---PHGAGWY 553



>gi|195442684|ref|XP_002069079.1| GK24041 [Drosophila willistoni]
 gi|194165164|gb|EDW80065.1| GK24041 [Drosophila willistoni]
          Length = 517

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 106/209 (50%), Gaps = 13/209 (6%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           CG+C   Y   Q    +CGH   C+ C K+++  +  S+G    + CP+S C I + Y  
Sbjct: 142 CGICFCPYR--QLTGLACGHC-FCTGCWKQYLANKTCSEGLAHSISCPESDCDILVDYVS 198

Query: 68  VRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
             +LA   ++ ERY  L+    +      RWC A  C    +    +   ++    CG +
Sbjct: 199 FLQLADDVKVVERYQQLITNTFVECNVLMRWCPAPNCSHAIKVNYAEARGVLC--KCGHQ 256

Query: 127 SCFTHDVPWHSGLTCTQFNE-QLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            CF     WH   +C+   + Q + ++ +    +  +HTK+CP C ++IEK+ GC+HM C
Sbjct: 257 FCFECGENWHEPASCSWLKKWQRKCQEDSETSNWLAQHTKECPKCNVTIEKDGGCNHMVC 316

Query: 186 R---CGYEFCWLCLGDYENIRTHGNHYHA 211
           +   C Y+FCW+CLG +E    HG+ +++
Sbjct: 317 KNPTCRYDFCWVCLGSWE---PHGSSWYS 342



>gi|392902006|ref|NP_001255868.1| Protein TAG-349, isoform c [Caenorhabditis elegans]
 gi|290457494|emb|CBK19515.1| Protein TAG-349, isoform c [Caenorhabditis elegans]
          Length = 436

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 92/200 (46%), Gaps = 12/200 (6%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC VCC   S+ +    +C H   C  C K ++  ++    G  ++ C    C + +  E
Sbjct: 75  ECDVCC---SMTRLSGLACAHR-ACDECWKAYLTEKI-VDVGQSEIECMMMDCKLLIEDE 129

Query: 67  DVRR-LASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
            V   +    +   Y  L++   +      +WC    CG   +    DR P +    CG 
Sbjct: 130 KVMSYITDPFVIAAYRKLIISSYVETNSQLKWCPGAGCGKAVKGEPSDREPAVC--TCGE 187

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
           + CF     WH  L+C       +   D +    +   +TK CP C ++IEKN GC+HMS
Sbjct: 188 RFCFACAQDWHDPLSCRHMKMWRKKCSDDSETLNWINANTKPCPKCSVTIEKNGGCNHMS 247

Query: 185 CR---CGYEFCWLCLGDYEN 201
           C+   C YEFCWLCLGD++N
Sbjct: 248 CKSSSCRYEFCWLCLGDWKN 267



>gi|388854295|emb|CCF52038.1| probable Ariadne-1 protein [Ustilago hordei]
          Length = 525

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 97/200 (48%), Gaps = 12/200 (6%)

Query: 18  IQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYEDVRRLASKELF 77
           ++ ++ +CGH   C  C  +++  ++  +G   +V+C + +C + +    V  +   E+F
Sbjct: 159 METLALACGHR-FCRDCYGQYLGQKIREEGESRRVQCMREKCNLVVDERTVGLVVRPEVF 217

Query: 78  ERYDTLLLRVAIRKLPDFRWCKAQKCGSGQE-HTTGDRF----PIITCGACGAKSCFTHD 132
           ERY  LL R  +      RWC A  C    E H +        P + C  CG   CF   
Sbjct: 218 ERYKILLNRTYVDDSAILRWCPAPNCELAVECHVSNKSLNKIVPSVACD-CGHAFCFGCG 276

Query: 133 VPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSCR-CGYE 190
              H+   C      L+  ED +    +   +TK+CP C  +IEKN GC+HM+CR C YE
Sbjct: 277 NAAHAPAICPVAKLWLKKCEDDSETANWISANTKECPKCTSTIEKNGGCNHMTCRKCKYE 336

Query: 191 FCWLCLGDYENIRTHGNHYH 210
           +CW+C G +     HGN ++
Sbjct: 337 WCWICAGPWSE---HGNSWY 353



>gi|145545520|ref|XP_001458444.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124426264|emb|CAK91047.1| unnamed protein product [Paramecium tetraurelia]
          Length = 442

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 90/197 (45%), Gaps = 15/197 (7%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC +C   + ++ Q    C H + C  CI   ++  +  +G  + + CP S C  +    
Sbjct: 138 ECQICL-SFRLVHQFLP-CQH-EFCRSCISELLKENI-VRGNVLVILCPHSACTEQFADL 193

Query: 67  DVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
            ++ L S  L+E+Y     R  I K  + RWC    C   + +  G    ++TC  CG +
Sbjct: 194 QIKELVSHTLYEKYQRFYARQLISKNKNVRWCPRIDC---ENYVIGKGMNLLTC-TCGQQ 249

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC- 185
            CF     +H  ++C       Q  D    +   E     CPNC   IEK  GC+HM C 
Sbjct: 250 ICFKCGNQYHQDMSCE------QAMDAQYLQVRKELQVYDCPNCQAPIEKKGGCNHMKCY 303

Query: 186 RCGYEFCWLCLGDYENI 202
           +C YEFCW+C G Y +I
Sbjct: 304 KCKYEFCWICRGKYSSI 320



>gi|340518373|gb|EGR48614.1| predicted protein [Trichoderma reesei QM6a]
          Length = 713

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 52  VRCPKSRCPIELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTT 111
           +RCP+  C   L Y D++R A +E F RY+TL LR A+ +  +F WC +  CGSGQ H +
Sbjct: 361 IRCPE--CRGLLDYTDIQRYADEETFRRYETLALRAAMAEAENFFWCTS-GCGSGQIHES 417

Query: 112 GDRFPIITCGACGAKSCFTHDVPWHSGLTCTQFNEQLQTED 152
           G   PI+ C  C  +SCF H+V WH GLTC ++++ L   D
Sbjct: 418 GHELPIVICLHCSHRSCFRHNVAWHQGLTCDEYDQLLANPD 458



>gi|115533080|ref|NP_001041060.1| Protein TAG-349, isoform a [Caenorhabditis elegans]
 gi|6782303|emb|CAB70234.1| Protein TAG-349, isoform a [Caenorhabditis elegans]
          Length = 485

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 92/200 (46%), Gaps = 12/200 (6%)

Query: 7   ECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYE 66
           EC VCC   S+ +    +C H   C  C K ++  ++    G  ++ C    C + +  E
Sbjct: 124 ECDVCC---SMTRLSGLACAHR-ACDECWKAYLTEKI-VDVGQSEIECMMMDCKLLIEDE 178

Query: 67  DVRR-LASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
            V   +    +   Y  L++   +      +WC    CG   +    DR P +    CG 
Sbjct: 179 KVMSYITDPFVIAAYRKLIISSYVETNSQLKWCPGAGCGKAVKGEPSDREPAVC--TCGE 236

Query: 126 KSCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
           + CF     WH  L+C       +   D +    +   +TK CP C ++IEKN GC+HMS
Sbjct: 237 RFCFACAQDWHDPLSCRHMKMWRKKCSDDSETLNWINANTKPCPKCSVTIEKNGGCNHMS 296

Query: 185 CR---CGYEFCWLCLGDYEN 201
           C+   C YEFCWLCLGD++N
Sbjct: 297 CKSSSCRYEFCWLCLGDWKN 316



>gi|356550364|ref|XP_003543557.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine
           max]
          Length = 589

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 92/199 (46%), Gaps = 5/199 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E Y   +  S++CGH   C  C   +I   +N   G + +RCP   C   +  
Sbjct: 137 LTCGICFEMYPRARVESAACGH-PYCYSCWAGYIGTSINDGPGCLVLRCPDPSCGAAVGQ 195

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LAS E  E+YD  LLR  I      +WC A  C        G     ++C  C  
Sbjct: 196 DMINLLASDEDKEKYDRYLLRSYIEDNKKTKWCPAPGCEYAVTFDAGSGNYDVSC-LCSY 254

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   ++K CP C   IEKN GC HM+
Sbjct: 255 SFCWNCTEEAHRPVDCGTVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHMT 314

Query: 185 CR--CGYEFCWLCLGDYEN 201
           C   C +EFCWLCLG + +
Sbjct: 315 CTPPCKFEFCWLCLGAWSD 333



>gi|326522708|dbj|BAJ88400.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326527705|dbj|BAK08127.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 589

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 92/197 (46%), Gaps = 5/197 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E+       +++CGH   CSVC + +I   +N   G + +RCP   C   +  
Sbjct: 132 LACGICFENCPHASMSAAACGH-PFCSVCWRGYISTAINDGPGCLMLRCPDPSCAAAVGQ 190

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LA++E  E+Y   L R  I      +WC A  C    E   G     + C  C  
Sbjct: 191 DMINSLANEEDKEKYGRYLRRSYIEDNRKTKWCPAPGCEYAVEFVVGSGSYDVNCN-CSY 249

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   ++K CP C   IEKN GC H++
Sbjct: 250 GFCWNCTEEAHRPVDCATVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHIT 309

Query: 185 CR--CGYEFCWLCLGDY 199
           C   C +EFCWLCLG +
Sbjct: 310 CTPPCKFEFCWLCLGSW 326



>gi|380028493|ref|XP_003697934.1| PREDICTED: protein ariadne-2-like [Apis florea]
          Length = 488

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 95/207 (45%), Gaps = 9/207 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C VC   YS  +  + +CGH+  C  C   H E ++ ++G    + C    C +    + 
Sbjct: 134 CSVCVAIYSAEKFSTLTCGHS-FCKDCWCMHFEVQI-TQGISTGISCMAQDCNVLAPEDF 191

Query: 68  VRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           V  L +K  + ERY        ++  P  R+C    C      +   R   + C +C   
Sbjct: 192 VLSLLTKPNMRERYQQFAFCDYVKSHPQLRFCPGPNCQMIM-RSKEQRAKRVMCSSCKTV 250

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            CF   + +H+   C    + L    D +    Y   HTK CP C++ IEKN GC+HM C
Sbjct: 251 FCFRCGIDYHAPTDCNTMKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC 310

Query: 186 -RCGYEFCWLCLGDYENIRTHGNHYHA 211
             C Y+FCW+CLGD+   + HG+ Y+ 
Sbjct: 311 YNCKYDFCWMCLGDW---KAHGSEYYV 334



>gi|195649461|gb|ACG44198.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 gi|413921940|gb|AFW61872.1| putative RING zinc finger domain superfamily protein [Zea mays]
          Length = 220

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 94/208 (45%), Gaps = 20/208 (9%)

Query: 8   CGVCCEDY--SIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           C +C E    S   +  ++C H   C  C+  H+ A+L   GG   VRCP + C   L  
Sbjct: 13  CSICMEPMAPSAAHRGGAACTHA-FCGACLSGHVRAKLECGGGGAVVRCPDASCAATLDP 71

Query: 66  EDVRRLASKELFERY-----DTLLLRVAIRKLPDFRWCKAQKCGS--GQEHTTGDRFPII 118
           E  R     E+FER+     ++L L  A R    F  C         G+E  T       
Sbjct: 72  ELCRGALPSEVFERWCAKLCESLFLG-ARRTYCPFPDCSEMMVADDDGEECVTQSE---- 126

Query: 119 TCGACGAKSCFTHDVPWHSGLTCTQFNE----QLQTEDFTANRAYHERHTKQCPNCYMSI 174
            C  C    C    VPWH+GLTC +       + + ED    +A  E   K+CP C   +
Sbjct: 127 -CHGCRRLFCARCAVPWHAGLTCEEIARLGEGEREREDLLLVKAAREGSWKRCPRCRFYV 185

Query: 175 EKNDGCDHMSCRCGYEFCWLCLGDYENI 202
           EK+ GC H++CRCGYEFC+ C   ++ I
Sbjct: 186 EKSSGCLHITCRCGYEFCYGCGQQWQLI 213



>gi|110749511|ref|XP_624643.2| PREDICTED: protein ariadne-2-like [Apis mellifera]
          Length = 488

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 95/207 (45%), Gaps = 9/207 (4%)

Query: 8   CGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTYED 67
           C VC   YS  +  + +CGH+  C  C   H E ++ ++G    + C    C +    + 
Sbjct: 134 CSVCVAIYSAEKFSTLTCGHS-FCKDCWCMHFEVQI-TQGISTGISCMAQDCNVLAPEDF 191

Query: 68  VRRLASK-ELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGAK 126
           V  L +K  + ERY        ++  P  R+C    C      +   R   + C +C   
Sbjct: 192 VLSLLTKPNMRERYQQFAFCDYVKSHPQLRFCPGPNCQMIM-RSKEQRAKRVMCSSCKTV 250

Query: 127 SCFTHDVPWHSGLTCTQFNEQLQT-EDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMSC 185
            CF   + +H+   C    + L    D +    Y   HTK CP C++ IEKN GC+HM C
Sbjct: 251 FCFRCGIDYHAPTDCNTMKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC 310

Query: 186 -RCGYEFCWLCLGDYENIRTHGNHYHA 211
             C Y+FCW+CLGD+   + HG+ Y+ 
Sbjct: 311 YNCKYDFCWMCLGDW---KAHGSEYYV 334



>gi|356544392|ref|XP_003540636.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine
           max]
          Length = 522

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 93/201 (46%), Gaps = 5/201 (2%)

Query: 5   TLECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGD-VQVRCPKSRCPIEL 63
           TL C +C +     +  S+SC H   C  C K++++  +N      +++RCPK  C   +
Sbjct: 110 TLTCEICLDVVLCDKVRSASCDHL-YCIDCWKKYVDTSINDGPNKCLKLRCPKPFCDAAV 168

Query: 64  TYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTT-GDRFPIITCGA 122
             + +R LAS+    +YD  L R  +      +WC A  CG    +   G R        
Sbjct: 169 GGDMIRELASESQRNKYDQFLFRSYVENNKKVKWCPAPDCGYAVSYEADGVRSNSDVTCL 228

Query: 123 CGAKSCFTHDVPWHSGLTCTQFNEQLQTEDF--TANRAYHERHTKQCPNCYMSIEKNDGC 180
           C    C++     HS + C      +   D+  + N A+   +TK CP C   IEK DG 
Sbjct: 229 CYHSFCWSCGEEAHSPVDCEIAKHWIMKNDYESSENSAWILANTKPCPKCKKPIEKIDGY 288

Query: 181 DHMSCRCGYEFCWLCLGDYEN 201
            HM C CG++FCWLCL  + N
Sbjct: 289 VHMECMCGFQFCWLCLRKWSN 309



>gi|326525965|dbj|BAJ93159.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 589

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 92/197 (46%), Gaps = 5/197 (2%)

Query: 6   LECGVCCEDYSIIQQISSSCGHNDICSVCIKRHIEAELNSKGGDVQVRCPKSRCPIELTY 65
           L CG+C E+       +++CGH   CSVC + +I   +N   G + +RCP   C   +  
Sbjct: 132 LACGICFENCPHASMSAAACGH-PFCSVCWRGYISTAINDGPGCLMLRCPDPSCAAAVGQ 190

Query: 66  EDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCGACGA 125
           + +  LA++E  E+Y   L R  I      +WC A  C    E   G     + C  C  
Sbjct: 191 DMINSLANEEDKEKYGRYLRRSYIEDNRKTKWCPAPGCEYAVEFVVGSGSYDVNCN-CSC 249

Query: 126 KSCFTHDVPWHSGLTCTQFNEQ-LQTEDFTANRAYHERHTKQCPNCYMSIEKNDGCDHMS 184
             C+      H  + C   ++  L+    + N  +   ++K CP C   IEKN GC H++
Sbjct: 250 GFCWNCTEEAHRPVDCATVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHIT 309

Query: 185 CR--CGYEFCWLCLGDY 199
           C   C +EFCWLCLG +
Sbjct: 310 CTPPCKFEFCWLCLGSW 326



>gi|116205373|ref|XP_001228497.1| hypothetical protein CHGG_10570 [Chaetomium globosum CBS 148.51]
 gi|88176698|gb|EAQ84166.1| hypothetical protein CHGG_10570 [Chaetomium globosum CBS 148.51]
          Length = 623

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 9/147 (6%)

Query: 7   ECGVCCEDYSIIQ----QISSSCGHNDI-CSVCIKRHIEAELNSKGGDVQVRCPKSRCPI 61
           +C +C +   + +     I+ +C H    C VC+   I  +L+S+  + +++CP+ R  +
Sbjct: 323 DCIICTDTKPVSEFPTAAITKTCTHEPTACLVCVATSIRTDLSSRLWN-EIKCPECRELL 381

Query: 62  ELTYEDVRRLASKELFERYDTLLLRVAIRKLPDFRWCKAQKCGSGQEHTTGDRFPIITCG 121
           E  Y+DV+R A  E  ERY TL  R AI   P+F WC +  CG GQ H  G   PI+TC 
Sbjct: 382 E--YDDVQRFADDETKERYQTLSFRSAISSSPNFIWCTS-GCGYGQVHEGGASSPIVTCR 438

Query: 122 ACGAKSCFTHDVPWHSGLTCTQFNEQL 148
            C  +SCF H V WH  LTC +++  L
Sbjct: 439 LCEYRSCFHHKVAWHENLTCDEYDTLL 465