BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10113_c0_seq1-m.40 5prime_partial 3-1691(+) 563 (+)
         (562 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384501255|gb|EIE91746.1| hypothetical protein RO3G_16457 [Rhi...   741   0.0     Rhizopus delemar RA 99-880
gi|511004580|gb|EPB85946.1| asparaginyl-tRNA synthetase [Mucor c...   736   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|501750602|emb|CCG84773.1| protein of unknown function [Taphri...   688   0.0     Taphrina deformans PYCC 5710
gi|328773412|gb|EGF83449.1| hypothetical protein BATDEDRAFT_9285...   652   0.0     Batrachochytrium dendrobatidis JAM81
gi|443897111|dbj|GAC74453.1| asparaginyl-trna synthetase [Pseudo...   628   e-177   Moesziomyces antarcticus T-34
gi|501307050|dbj|GAC96038.1| hypothetical protein PHSY_003617 [P...   626   e-177   Pseudozyma hubeiensis SY62
gi|71020717|ref|XP_760589.1| hypothetical protein UM04442.1 [Ust...   625   e-176   
gi|388855369|emb|CCF51033.1| probable DED81-asparaginyl-tRNA-syn...   625   e-176   Ustilago hordei
gi|402216878|gb|EJT96961.1| asparaginyl-tRNA synthetase [Dacryop...   625   e-176   Dacryopinax primogenitus
gi|343425723|emb|CBQ69257.1| probable DED81-asparaginyl-tRNA-syn...   624   e-176   Sporisorium reilianum SRZ2
gi|443726020|gb|ELU13362.1| hypothetical protein CAPTEDRAFT_1484...   623   e-176   Capitella teleta
gi|307178011|gb|EFN66872.1| Asparaginyl-tRNA synthetase, cytopla...   619   e-175   Camponotus floridanus
gi|348505116|ref|XP_003440107.1| PREDICTED: asparaginyl-tRNA syn...   617   e-174   Oreochromis niloticus
gi|471894609|emb|CCO31472.1| asparaginyl-tRNA synthetase [Rhizoc...   617   e-174   Rhizoctonia solani AG-1 IB
gi|449514835|ref|XP_004174228.1| PREDICTED: LOW QUALITY PROTEIN:...   617   e-174   
gi|471388322|ref|XP_004379317.1| PREDICTED: asparagine--tRNA lig...   615   e-173   Trichechus manatus latirostris
gi|498925995|ref|XP_004538584.1| PREDICTED: asparagine--tRNA lig...   614   e-173   Maylandia zebra
gi|449282950|gb|EMC89675.1| Asparaginyl-tRNA synthetase, cytopla...   614   e-173   Columba livia [carrier pigeon]
gi|148231213|ref|NP_001086948.1| asparaginyl-tRNA synthetase [Xe...   613   e-173   Xenopus laevis [clawed frog]
gi|443698706|gb|ELT98564.1| hypothetical protein CAPTEDRAFT_1307...   612   e-172   Capitella teleta
gi|512809930|ref|XP_002934488.2| PREDICTED: asparagine--tRNA lig...   612   e-172   Xenopus tropicalis [western clawed frog]
gi|392884348|gb|AFM91006.1| asparaginyl-tRNA synthetase, cytopla...   612   e-172   Callorhinchus milii [Australian ghost shark]
gi|344268976|ref|XP_003406332.1| PREDICTED: asparaginyl-tRNA syn...   611   e-172   Loxodonta africana [African bush elephant]
gi|507951721|ref|XP_004683991.1| PREDICTED: asparagine--tRNA lig...   611   e-172   Condylura cristata
gi|194759334|ref|XP_001961904.1| GF15206 [Drosophila ananassae] ...   610   e-172   Drosophila ananassae
gi|194879712|ref|XP_001974286.1| GG21647 [Drosophila erecta] >gi...   610   e-172   Drosophila erecta
gi|327277896|ref|XP_003223699.1| PREDICTED: asparaginyl-tRNA syn...   610   e-172   Anolis carolinensis [Carolina anole]
gi|19111917|ref|NP_595125.1| cytoplasmic asparagine-tRNA ligase ...   610   e-172   Schizosaccharomyces pombe 972h-
gi|465999409|ref|XP_004268091.1| PREDICTED: asparagine--tRNA lig...   610   e-172   Orcinus orca [Orca]
gi|340727529|ref|XP_003402094.1| PREDICTED: asparaginyl-tRNA syn...   610   e-172   Bombus terrestris [large earth bumblebee]
gi|405953092|gb|EKC20816.1| Asparaginyl-tRNA synthetase, cytopla...   609   e-172   Crassostrea gigas
gi|332376021|gb|AEE63151.1| unknown [Dendroctonus ponderosae] >g...   609   e-172   Dendroctonus ponderosae
gi|71897197|ref|NP_001026571.1| asparaginyl-tRNA synthetase, cyt...   608   e-171   Gallus gallus [bantam]
gi|395511543|ref|XP_003760018.1| PREDICTED: asparagine--tRNA lig...   608   e-171   Sarcophilus harrisii
gi|470598025|ref|XP_004311639.1| PREDICTED: asparagine--tRNA lig...   608   e-171   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|66511652|ref|XP_623490.1| PREDICTED: asparaginyl-tRNA synthet...   608   e-171   Apis mellifera [European honey bee]
gi|19921528|ref|NP_609948.1| Asparaginyl-tRNA synthetase, isofor...   608   e-171   Drosophila melanogaster
gi|164657151|ref|XP_001729702.1| hypothetical protein MGL_3246 [...   608   e-171   Malassezia globosa CBS 7966
gi|488520842|ref|XP_004452348.1| PREDICTED: asparagine--tRNA lig...   608   e-171   
gi|395830741|ref|XP_003788477.1| PREDICTED: asparagine--tRNA lig...   608   e-171   Otolemur garnettii
gi|472586898|gb|EMS24397.1| asparaginyl-trna synthetase [Rhodosp...   608   e-171   Rhodotorula toruloides NP11
gi|488520840|ref|XP_004452347.1| PREDICTED: asparagine--tRNA lig...   608   e-171   Dasypus novemcinctus
gi|392882636|gb|AFM90150.1| asparaginyl-tRNA synthetase, cytopla...   608   e-171   Callorhinchus milii [Australian ghost shark]
gi|195484386|ref|XP_002090672.1| GE12667 [Drosophila yakuba] >gi...   608   e-171   Drosophila yakuba
gi|195345035|ref|XP_002039081.1| GM17026 [Drosophila sechellia] ...   608   e-171   Drosophila sechellia
gi|195580101|ref|XP_002079894.1| GD21774 [Drosophila simulans] >...   607   e-171   Drosophila simulans
gi|505773863|ref|XP_004601765.1| PREDICTED: asparagine--tRNA lig...   607   e-171   Sorex araneus [Eurasian shrew]
gi|387914232|gb|AFK10725.1| asparaginyl-tRNA synthetase-like pro...   607   e-171   Callorhinchus milii [Australian ghost shark]
gi|392882842|gb|AFM90253.1| asparaginyl-tRNA synthetase, cytopla...   607   e-171   Callorhinchus milii [Australian ghost shark]
gi|444732531|gb|ELW72821.1| Asparaginyl-tRNA synthetase, cytopla...   606   e-171   Tupaia chinensis
gi|350422932|ref|XP_003493333.1| PREDICTED: asparaginyl-tRNA syn...   606   e-171   
gi|432101403|gb|ELK29585.1| Asparaginyl-tRNA synthetase, cytopla...   606   e-171   Myotis davidii
gi|50284857|ref|XP_444856.1| hypothetical protein [Candida glabr...   605   e-171   Candida glabrata CBS 138
gi|504133962|ref|XP_004579528.1| PREDICTED: asparagine--tRNA lig...   605   e-170   Ochotona princeps [southern American pika]
gi|149721122|ref|XP_001488269.1| PREDICTED: asparaginyl-tRNA syn...   605   e-170   Equus caballus [domestic horse]
gi|91091536|ref|XP_970641.1| PREDICTED: similar to Asparaginyl-t...   605   e-170   Tribolium castaneum [rust-red flour beetle]
gi|504133964|ref|XP_004579529.1| PREDICTED: asparagine--tRNA lig...   605   e-170   Ochotona princeps [southern American pika]
gi|380017127|ref|XP_003692514.1| PREDICTED: LOW QUALITY PROTEIN:...   605   e-170   
gi|114052923|ref|NP_001040037.1| asparagine--tRNA ligase, cytopl...   605   e-170   Bos taurus [bovine]
gi|402903191|ref|XP_003914461.1| PREDICTED: asparagine--tRNA lig...   605   e-170   Papio anubis [Doguera baboon]
gi|507647239|ref|XP_004703067.1| PREDICTED: asparagine--tRNA lig...   604   e-170   Echinops telfairi [lesser hedgehog tenrec]
gi|478496585|ref|XP_004422631.1| PREDICTED: asparagine--tRNA lig...   604   e-170   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|432889274|ref|XP_004075195.1| PREDICTED: asparagine--tRNA lig...   604   e-170   Oryzias latipes [Japanese rice fish]
gi|507541655|ref|XP_004654825.1| PREDICTED: asparagine--tRNA lig...   603   e-170   Jaculus jaculus
gi|507541657|ref|XP_004654826.1| PREDICTED: asparagine--tRNA lig...   603   e-170   Jaculus jaculus
gi|296473717|tpg|DAA15832.1| TPA: asparaginyl-tRNA synthetase [B...   603   e-170   Bos taurus [bovine]
gi|4758762|ref|NP_004530.1| asparagine--tRNA ligase, cytoplasmic...   603   e-170   Homo sapiens [man]
gi|403268030|ref|XP_003926092.1| PREDICTED: asparagine--tRNA lig...   603   e-170   Saimiri boliviensis boliviensis
gi|119583453|gb|EAW63049.1| asparaginyl-tRNA synthetase, isoform...   603   e-170   Homo sapiens [man]
gi|345569198|gb|EGX52066.1| hypothetical protein AOL_s00043g456 ...   603   e-170   Arthrobotrys oligospora ATCC 24927
gi|73945455|ref|XP_849060.1| PREDICTED: asparaginyl-tRNA synthet...   603   e-170   
gi|511842261|ref|XP_004745606.1| PREDICTED: asparagine--tRNA lig...   602   e-170   Mustela putorius furo [black ferret]
gi|465796322|emb|CCV00613.1| unnamed protein product [Malassezia...   602   e-170   Malassezia sympodialis ATCC 42132
gi|426386062|ref|XP_004059513.1| PREDICTED: asparagine--tRNA lig...   602   e-170   Gorilla gorilla gorilla [lowland gorilla]
gi|511842259|ref|XP_004745605.1| PREDICTED: asparagine--tRNA lig...   602   e-170   Mustela putorius furo [black ferret]
gi|449542287|gb|EMD33267.1| hypothetical protein CERSUDRAFT_8757...   602   e-170   Gelatoporia subvermispora B
gi|498940568|ref|XP_004521427.1| PREDICTED: asparagine--tRNA lig...   602   e-170   Ceratitis capitata
gi|292625063|ref|XP_696748.3| PREDICTED: asparaginyl-tRNA synthe...   602   e-169   
gi|350539187|ref|NP_001233302.1| asparaginyl-tRNA synthetase, cy...   602   e-169   Pan troglodytes
gi|62897229|dbj|BAD96555.1| asparaginyl-tRNA synthetase variant ...   602   e-169   Homo sapiens [man]
gi|75075861|sp|Q4R4Z1.1|SYNC_MACFA RecName: Full=Asparagine--tRN...   602   e-169   Macaca fascicularis [crab eating macaque]
gi|426253872|ref|XP_004020615.1| PREDICTED: asparagine--tRNA lig...   601   e-169   Ovis aries [domestic sheep]
gi|410977772|ref|XP_003995274.1| PREDICTED: asparagine--tRNA lig...   601   e-169   Felis catus [cat]
gi|242006633|ref|XP_002424153.1| asparaginyl-tRNA synthetase, cy...   601   e-169   Pediculus humanus corporis [human body lice]
gi|332230291|ref|XP_003264323.1| PREDICTED: asparagine--tRNA lig...   601   e-169   Nomascus leucogenys [White-cheeked Gibbon]
gi|126321623|ref|XP_001366376.1| PREDICTED: asparaginyl-tRNA syn...   600   e-169   
gi|350578507|ref|XP_003121503.3| PREDICTED: asparaginyl-tRNA syn...   600   e-169   Sus scrofa [pigs]
gi|301769781|ref|XP_002920308.1| PREDICTED: asparaginyl-tRNA syn...   600   e-169   Ailuropoda melanoleuca
gi|281337495|gb|EFB13079.1| hypothetical protein PANDA_009023 [A...   600   e-169   Ailuropoda melanoleuca
gi|470318357|gb|EMR10025.1| hypothetical protein PNEG_01779 [Pne...   600   e-169   Pneumocystis murina B123
gi|440892048|gb|ELR45417.1| Asparaginyl-tRNA synthetase, cytopla...   600   e-169   Bos mutus
gi|156547524|ref|XP_001606841.1| PREDICTED: asparaginyl-tRNA syn...   600   e-169   
gi|390474009|ref|XP_002757320.2| PREDICTED: asparagine--tRNA lig...   600   e-169   Callithrix jacchus [common marmoset]
gi|410730863|ref|XP_003980252.1| hypothetical protein NDAI_0G059...   599   e-169   Naumovozyma dairenensis CBS 421
gi|348576868|ref|XP_003474207.1| PREDICTED: asparaginyl-tRNA syn...   599   e-169   Cavia porcellus [guinea pig]
gi|213512082|ref|NP_001133698.1| syncoilin [Salmo salar] >gi|209...   599   e-169   Salmo salar
gi|225581052|gb|ACN94629.1| GA10495 [Drosophila miranda]              599   e-169   Drosophila miranda
gi|348576874|ref|XP_003474210.1| PREDICTED: asparaginyl-tRNA syn...   599   e-169   Cavia porcellus [guinea pig]
gi|297716158|ref|XP_002834410.1| PREDICTED: asparagine--tRNA lig...   598   e-168   
gi|347968958|ref|XP_311928.3| AGAP002969-PA [Anopheles gambiae s...   598   e-168   Anopheles gambiae str. PEST
gi|345305699|ref|XP_001510627.2| PREDICTED: asparaginyl-tRNA syn...   598   e-168   Ornithorhynchus anatinus [duck-billed platypus]
gi|431906955|gb|ELK11074.1| Asparaginyl-tRNA synthetase, cytopla...   598   e-168   Pteropus alecto
gi|126002159|ref|XP_001352279.1| GA10495 [Drosophila pseudoobscu...   598   e-168   Drosophila pseudoobscura pseudoobscura
gi|219276601|ref|NP_001136422.1| asparagine--tRNA ligase, cytopl...   598   e-168   Mus musculus [mouse]
gi|219275596|ref|NP_081626.2| asparagine--tRNA ligase, cytoplasm...   598   e-168   Mus musculus [mouse]
gi|26346633|dbj|BAC36965.1| unnamed protein product [Mus musculus]    597   e-168   Mus musculus [mouse]
gi|195050025|ref|XP_001992811.1| GH13480 [Drosophila grimshawi] ...   597   e-168   Drosophila grimshawi
gi|355755054|gb|EHH58921.1| hypothetical protein EGM_08890, part...   597   e-168   Macaca fascicularis [crab eating macaque]
gi|512993647|ref|XP_004858452.1| PREDICTED: asparagine--tRNA lig...   597   e-168   Heterocephalus glaber [naked mole rat]
gi|355701966|gb|EHH29319.1| hypothetical protein EGK_09713, part...   597   e-168   Macaca mulatta [rhesus macaque]
gi|512993649|ref|XP_004858453.1| PREDICTED: asparagine--tRNA lig...   597   e-168   Heterocephalus glaber [naked mole rat]
gi|383855496|ref|XP_003703246.1| PREDICTED: asparagine--tRNA lig...   597   e-168   Megachile rotundata
gi|74196771|dbj|BAE43117.1| unnamed protein product [Mus musculus]    597   e-168   Mus musculus [mouse]
gi|302308063|ref|NP_984841.2| AEL020Wp [Ashbya gossypii ATCC 108...   597   e-168   Eremothecium gossypii ATCC 10895
gi|170059943|ref|XP_001865582.1| aspartyl-tRNA synthetase [Culex...   596   e-168   Culex quinquefasciatus
gi|198431081|ref|XP_002128269.1| PREDICTED: asparagine--tRNA lig...   596   e-168   Ciona intestinalis [sea vase]
gi|323337256|gb|EGA78509.1| Ded81p [Saccharomyces cerevisiae Vin...   595   e-168   Saccharomyces cerevisiae Vin13
gi|6321807|ref|NP_011883.1| asparagine--tRNA ligase DED81 [Sacch...   595   e-167   Saccharomyces cerevisiae S288c
gi|213405907|ref|XP_002173725.1| cytoplasmic asparagine-tRNA lig...   595   e-167   Schizosaccharomyces japonicus yFS275
gi|109122288|ref|XP_001085923.1| PREDICTED: asparaginyl-tRNA syn...   595   e-167   
gi|31127138|gb|AAH52849.1| Asparaginyl-tRNA synthetase [Mus musc...   595   e-167   Mus musculus [mouse]
gi|358057054|dbj|GAA96961.1| hypothetical protein E5Q_03635 [Mix...   594   e-167   Mixia osmundae IAM 14324
gi|401625480|gb|EJS43488.1| ded81p [Saccharomyces arboricola H-6]     594   e-167   Saccharomyces arboricola H-6
gi|195438242|ref|XP_002067046.1| GK24233 [Drosophila willistoni]...   593   e-167   Drosophila willistoni
gi|366988149|ref|XP_003673841.1| hypothetical protein NCAS_0A090...   593   e-167   Naumovozyma castellii CBS 4309
gi|195398059|ref|XP_002057642.1| GJ17991 [Drosophila virilis] >g...   593   e-167   Drosophila virilis
gi|321476711|gb|EFX87671.1| hypothetical protein DAPPUDRAFT_3065...   593   e-167   Daphnia pulex
gi|291231216|ref|XP_002735562.1| PREDICTED: asparaginyl-tRNA syn...   593   e-167   Saccoglossus kowalevskii
gi|219275589|ref|NP_001020806.2| asparaginyl-tRNA synthetase, cy...   593   e-167   Rattus norvegicus [brown rat]
gi|195161006|ref|XP_002021361.1| GL25284 [Drosophila persimilis]...   592   e-167   Drosophila persimilis
gi|254565875|ref|XP_002490048.1| Cytosolic asparaginyl-tRNA synt...   592   e-166   Komagataella phaffii GS115
gi|148677755|gb|EDL09702.1| asparaginyl-tRNA synthetase, isoform...   592   e-166   Mus musculus [mouse]
gi|472391938|ref|XP_004415254.1| PREDICTED: asparagine--tRNA lig...   592   e-166   Odobenus rosmarus divergens
gi|351704024|gb|EHB06943.1| Asparaginyl-tRNA synthetase, cytopla...   591   e-166   Heterocephalus glaber [naked mole rat]
gi|512993651|ref|XP_004858454.1| PREDICTED: asparagine--tRNA lig...   590   e-166   Heterocephalus glaber [naked mole rat]
gi|332022079|gb|EGI62404.1| Asparaginyl-tRNA synthetase, cytopla...   590   e-166   Acromyrmex echinatior
gi|512865432|ref|XP_004890930.1| PREDICTED: asparagine--tRNA lig...   590   e-166   
gi|195115232|ref|XP_002002168.1| GI17232 [Drosophila mojavensis]...   589   e-166   Drosophila mojavensis
gi|395328274|gb|EJF60667.1| asparaginyl-tRNA synthetase [Dichomi...   589   e-166   Dichomitus squalens LYAD-421 SS1
gi|193666902|ref|XP_001951757.1| PREDICTED: asparaginyl-tRNA syn...   588   e-165   Acyrthosiphon pisum
gi|307202947|gb|EFN82167.1| Asparaginyl-tRNA synthetase, cytopla...   588   e-165   Harpegnathos saltator
gi|340380675|ref|XP_003388847.1| PREDICTED: asparaginyl-tRNA syn...   587   e-165   Amphimedon queenslandica
gi|409044157|gb|EKM53639.1| hypothetical protein PHACADRAFT_2601...   587   e-165   Phanerochaete carnosa HHB-10118-sp
gi|149064469|gb|EDM14672.1| rCG46601, isoform CRA_a [Rattus norv...   587   e-165   Rattus norvegicus [brown rat]
gi|312373072|gb|EFR20897.1| hypothetical protein AND_18332 [Anop...   587   e-165   
gi|470323313|ref|XP_004349464.1| Nars-like protein [Capsaspora o...   587   e-165   Capsaspora owczarzaki ATCC 30864
gi|512909262|ref|XP_004926878.1| PREDICTED: asparagine--tRNA lig...   587   e-165   Bombyx mori [silk moth]
gi|410074169|ref|XP_003954667.1| hypothetical protein KAFR_0A009...   586   e-165   Kazachstania africana CBS 2517
gi|50302869|ref|XP_451372.1| hypothetical protein [Kluyveromyces...   585   e-165   Kluyveromyces lactis NRRL Y-1140
gi|392560859|gb|EIW54041.1| asparaginyl-tRNA synthetase [Tramete...   585   e-164   Trametes versicolor FP-101664 SS1
gi|336372331|gb|EGO00670.1| hypothetical protein SERLA73DRAFT_17...   585   e-164   Serpula lacrymans var. lacrymans S7.3
gi|195427261|ref|XP_002061695.1| GK17133 [Drosophila willistoni]...   585   e-164   Drosophila willistoni
gi|444321494|ref|XP_004181403.1| hypothetical protein TBLA_0F034...   585   e-164   Tetrapisispora blattae CBS 6284
gi|169846462|ref|XP_001829946.1| asparaginyl-tRNA synthetase [Co...   583   e-164   Coprinopsis cinerea okayama7#130
gi|348576870|ref|XP_003474208.1| PREDICTED: asparaginyl-tRNA syn...   583   e-164   
gi|357631715|gb|EHJ79184.1| hypothetical protein KGM_15441 [Dana...   583   e-164   Danaus plexippus [American monarch]
gi|348576876|ref|XP_003474211.1| PREDICTED: asparaginyl-tRNA syn...   583   e-164   
gi|403217448|emb|CCK71942.1| hypothetical protein KNAG_0I01550 [...   582   e-163   Kazachstania naganishii CBS 8797
gi|354474573|ref|XP_003499505.1| PREDICTED: asparaginyl-tRNA syn...   582   e-163   
gi|365760410|gb|EHN02133.1| Ded81p [Saccharomyces cerevisiae x S...   582   e-163   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|313232355|emb|CBY09464.1| unnamed protein product [Oikopleura...   582   e-163   Oikopleura dioica
gi|393227604|gb|EJD35275.1| asparaginyl-tRNA synthetase [Auricul...   581   e-163   Auricularia subglabra TFB-10046 SS5
gi|296424997|ref|XP_002842030.1| hypothetical protein [Tuber mel...   580   e-163   Tuber melanosporum Mel28
gi|196013129|ref|XP_002116426.1| hypothetical protein TRIADDRAFT...   580   e-163   Trichoplax adhaerens
gi|328861275|gb|EGG10379.1| hypothetical protein MELLADRAFT_5182...   580   e-163   Melampsora larici-populina 98AG31
gi|426197830|gb|EKV47757.1| hypothetical protein AGABI2DRAFT_185...   579   e-163   Agaricus bisporus var. bisporus H97
gi|513032346|gb|AGO12338.1| AaceriAEL020Wp [Saccharomycetaceae s...   579   e-163   Saccharomycetaceae sp. 'Ashbya aceri'
gi|409080912|gb|EKM81272.1| hypothetical protein AGABI1DRAFT_112...   579   e-162   Agaricus bisporus var. burnettii JB137-S8
gi|255720298|ref|XP_002556429.1| KLTH0H13024p [Lachancea thermot...   579   e-162   Lachancea thermotolerans CBS 6340
gi|393222658|gb|EJD08142.1| asparaginyl-tRNA synthetase [Fomitip...   579   e-162   Fomitiporia mediterranea MF3/22
gi|115400689|ref|XP_001215933.1| asparaginyl-tRNA synthetase [As...   578   e-162   Aspergillus terreus NIH2624
gi|170115146|ref|XP_001888768.1| predicted protein [Laccaria bic...   578   e-162   Laccaria bicolor S238N-H82
gi|157113775|ref|XP_001652096.1| aspartyl-tRNA synthetase [Aedes...   577   e-162   Aedes aegypti
gi|389739353|gb|EIM80546.1| asparaginyl-tRNA synthetase [Stereum...   576   e-162   Stereum hirsutum FP-91666 SS1
gi|363750097|ref|XP_003645266.1| hypothetical protein Ecym_2750 ...   576   e-162   Eremothecium cymbalariae DBVPG#7215
gi|366997995|ref|XP_003683734.1| hypothetical protein TPHA_0A021...   575   e-161   Tetrapisispora phaffii CBS 4417
gi|219275592|ref|NP_001136421.1| asparaginyl-tRNA synthetase, cy...   575   e-161   Rattus norvegicus [brown rat]
gi|367013032|ref|XP_003681016.1| hypothetical protein TDEL_0D022...   574   e-161   Torulaspora delbrueckii
gi|37361912|gb|AAQ91069.1| LRRGT00113 [Rattus norvegicus]             574   e-161   Rattus norvegicus [brown rat]
gi|50552310|ref|XP_503565.1| YALI0E05005p [Yarrowia lipolytica] ...   574   e-161   Yarrowia lipolytica CLIB122
gi|70989689|ref|XP_749694.1| cytoplasmic asparaginyl-tRNA synthe...   573   e-161   Aspergillus fumigatus Af293
gi|430812049|emb|CCJ30504.1| unnamed protein product, partial [P...   573   e-161   Pneumocystis jirovecii
gi|390597250|gb|EIN06650.1| asparaginyl-tRNA synthetase [Punctul...   573   e-161   Punctularia strigosozonata HHB-11173 SS5
gi|354548631|emb|CCE45368.1| hypothetical protein CPAR2_703810 [...   573   e-161   Candida parapsilosis
gi|344299547|gb|EGW29900.1| Asparaginyl-tRNA synthetase, cytopla...   573   e-161   Spathaspora passalidarum NRRL Y-27907
gi|448536807|ref|XP_003871199.1| Ded81 tRNA-Asn synthetase [Cand...   572   e-161   Candida orthopsilosis Co 90-125
gi|156849133|ref|XP_001647447.1| hypothetical protein Kpol_1018p...   571   e-160   Vanderwaltozyma polyspora DSM 70294
gi|505756698|gb|EOR00839.1| putative asparagine--tRNA ligase, cy...   570   e-160   Wallemia ichthyophaga EXF-994
gi|302681115|ref|XP_003030239.1| hypothetical protein SCHCODRAFT...   569   e-160   Schizophyllum commune H4-8
gi|401885561|gb|EJT49668.1| asparagine-tRNA ligase [Trichosporon...   569   e-160   Trichosporon asahii var. asahii CBS 2479
gi|392591231|gb|EIW80559.1| asparaginyl-tRNA synthetase [Conioph...   568   e-159   Coniophora puteana RWD-64-598 SS2
gi|119480319|ref|XP_001260188.1| cytoplasmic asparaginyl-tRNA sy...   568   e-159   Aspergillus fischeri NRRL 181
gi|190348970|gb|EDK41531.2| asparaginyl-tRNA synthetase [Meyeroz...   568   e-159   Meyerozyma guilliermondii ATCC 6260
gi|146413276|ref|XP_001482609.1| asparaginyl-tRNA synthetase [Me...   568   e-159   Meyerozyma guilliermondii ATCC 6260
gi|388582380|gb|EIM22685.1| asparaginyl-tRNA synthetase [Wallemi...   567   e-159   Wallemia mellicola CBS 633.66
gi|195164590|ref|XP_002023129.1| GL21125 [Drosophila persimilis]...   567   e-159   Drosophila persimilis
gi|320583691|gb|EFW97904.1| Cytosolic asparaginyl-tRNA synthetas...   566   e-159   
gi|403416295|emb|CCM02995.1| predicted protein [Fibroporia radic...   566   e-159   Fibroporia radiculosa
gi|238883499|gb|EEQ47137.1| asparaginyl-tRNA synthetase [Candida...   566   e-159   Candida albicans WO-1
gi|68487991|ref|XP_712154.1| hypothetical protein CaO19.6702 [Ca...   564   e-158   Candida albicans SC5314
gi|354474575|ref|XP_003499506.1| PREDICTED: asparaginyl-tRNA syn...   564   e-158   
gi|169769410|ref|XP_001819175.1| asparaginyl-tRNA synthetase, cy...   564   e-158   Aspergillus oryzae RIB40
gi|254584945|ref|XP_002498040.1| ZYRO0G00726p [Zygosaccharomyces...   563   e-158   Zygosaccharomyces rouxii CBS 732
gi|50419493|ref|XP_458273.1| DEHA2C13684p [Debaryomyces hansenii...   563   e-158   Debaryomyces hansenii CBS767
gi|406606064|emb|CCH42537.1| asparaginyl-tRNA synthetase [Wicker...   562   e-157   Wickerhamomyces ciferrii
gi|308463696|ref|XP_003094120.1| CRE-NARS-1 protein [Caenorhabdi...   561   e-157   Caenorhabditis remanei
gi|149235760|ref|XP_001523758.1| asparaginyl-tRNA synthetase [Lo...   561   e-157   Lodderomyces elongisporus NRRL YB-4239
gi|241957629|ref|XP_002421534.1| asparagine--tRNA ligase, putati...   560   e-157   Candida dubliniensis CD36
gi|260947816|ref|XP_002618205.1| asparaginyl-tRNA synthetase [Cl...   560   e-157   Clavispora lusitaniae ATCC 42720
gi|268562070|ref|XP_002646595.1| C. briggsae CBR-NRS-1 protein [...   560   e-157   Caenorhabditis briggsae
gi|344231684|gb|EGV63566.1| Asparaginyl-tRNA synthetase, cytopla...   559   e-157   Candida tenuis ATCC 10573
gi|255731872|ref|XP_002550860.1| asparaginyl-tRNA synthetase [Ca...   558   e-156   Candida tropicalis MYA-3404
gi|459369066|gb|EMG47574.1| Asparaginyl-tRNA synthetase [Candida...   557   e-156   Candida maltosa Xu316
gi|212532907|ref|XP_002146610.1| cytoplasmic asparaginyl-tRNA sy...   557   e-156   Talaromyces marneffei ATCC 18224
gi|67900984|ref|XP_680748.1| hypothetical protein AN7479.2 [Aspe...   557   e-156   Aspergillus nidulans FGSC A4
gi|121715316|ref|XP_001275267.1| cytoplasmic asparaginyl-tRNA sy...   556   e-156   Aspergillus clavatus NRRL 1
gi|339244857|ref|XP_003378354.1| asparaginyl-tRNA synthetase, cy...   556   e-156   Trichinella spiralis
gi|47208664|emb|CAF88671.1| unnamed protein product [Tetraodon n...   556   e-156   Tetraodon nigroviridis
gi|71984122|ref|NP_001021405.1| Protein NARS-1, isoform a [Caeno...   556   e-156   Caenorhabditis elegans [roundworm]
gi|331220633|ref|XP_003322992.1| asparaginyl-tRNA synthetase [Pu...   556   e-156   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|258574089|ref|XP_002541226.1| asparaginyl-tRNA synthetase [Un...   555   e-155   Uncinocarpus reesii 1704
gi|255948264|ref|XP_002564899.1| Pc22g08870 [Penicillium chrysog...   555   e-155   Penicillium rubens Wisconsin 54-1255
gi|150866122|ref|XP_001385612.2| Asparaginyl-tRNA synthetase, cy...   554   e-155   Scheffersomyces stipitis CBS 6054
gi|303312585|ref|XP_003066304.1| asparaginyl-tRNA synthetase, pu...   554   e-155   Coccidioides posadasii C735 delta SOWgp
gi|242776859|ref|XP_002478916.1| cytoplasmic asparaginyl-tRNA sy...   553   e-155   Talaromyces stipitatus ATCC 10500
gi|119192776|ref|XP_001246994.1| asparaginyl-tRNA synthetase, cy...   553   e-155   Coccidioides immitis RS
gi|297702663|ref|XP_002828292.1| PREDICTED: asparagine--tRNA lig...   551   e-154   
gi|358367628|dbj|GAA84246.1| asparaginyl-tRNA synthetase [Asperg...   551   e-154   Aspergillus kawachii IFO 4308
gi|295669995|ref|XP_002795545.1| asparaginyl-tRNA synthetase [Pa...   550   e-154   
gi|145234338|ref|XP_001400540.1| asparaginyl-tRNA synthetase, cy...   550   e-154   Aspergillus niger CBS 513.88
gi|225684263|gb|EEH22547.1| asparaginyl-tRNA synthetase [Paracoc...   550   e-154   Paracoccidioides brasiliensis Pb03
gi|391336358|ref|XP_003742548.1| PREDICTED: asparagine--tRNA lig...   550   e-154   Metaseiulus occidentalis
gi|453084554|gb|EMF12598.1| asparaginyl-tRNA synthetase [Mycosph...   550   e-154   Sphaerulina musiva SO2202
gi|242212694|ref|XP_002472179.1| predicted protein [Postia place...   550   e-154   Postia placenta Mad-698-R
gi|341882902|gb|EGT38837.1| CBN-NARS-1 protein [Caenorhabditis b...   549   e-154   Caenorhabditis brenneri
gi|353238960|emb|CCA70889.1| probable DED81-asparaginyl-tRNA-syn...   548   e-153   Serendipita indica DSM 11827
gi|170587862|ref|XP_001898693.1| Asparaginyl-tRNA synthetase, cy...   542   e-151   Brugia malayi [agent of lymphatic filariasis]
gi|296815388|ref|XP_002848031.1| asparaginyl-tRNA synthetase [Ar...   541   e-151   Arthroderma otae CBS 113480
gi|358393770|gb|EHK43171.1| hypothetical protein TRIATDRAFT_3010...   541   e-151   Trichoderma atroviride IMI 206040
gi|390336041|ref|XP_003724269.1| PREDICTED: asparagine--tRNA lig...   540   e-151   
gi|326474010|gb|EGD98019.1| asparaginyl-tRNA synthetase [Trichop...   540   e-151   Trichophyton tonsurans CBS 112818
gi|398396612|ref|XP_003851764.1| asparagine--tRNA ligase [Zymose...   539   e-151   Zymoseptoria tritici IPO323
gi|407929625|gb|EKG22437.1| Aspartyl/Asparaginyl-tRNA synthetase...   539   e-151   Macrophomina phaseolina MS6
gi|321258873|ref|XP_003194157.1| asparagine-tRNA ligase [Cryptoc...   539   e-151   Cryptococcus gattii WM276
gi|327299364|ref|XP_003234375.1| asparaginyl-tRNA synthetase [Tr...   539   e-150   Trichophyton rubrum CBS 118892
gi|340521438|gb|EGR51672.1| hypothetical protein TRIREDRAFT_1200...   538   e-150   Trichoderma reesei QM6a
gi|452981270|gb|EME81030.1| hypothetical protein MYCFIDRAFT_2726...   537   e-150   Cercospora fijiensis CIRAD86
gi|315113190|pdb|2XGT|A Chain A, Asparaginyl-Trna Synthetase Fro...   537   e-150   Brugia malayi [agent of lymphatic filariasis]
gi|402589182|gb|EJW83114.1| asparaginyl-tRNA synthetase [Wuchere...   537   e-150   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|315113222|pdb|2XTI|A Chain A, Asparaginyl-Trna Synthetase Fro...   536   e-150   Brugia malayi [agent of lymphatic filariasis]
gi|315052496|ref|XP_003175622.1| asparaginyl-tRNA synthetase [Ar...   536   e-150   Microsporum gypseum CBS 118893
gi|392578556|gb|EIW71684.1| hypothetical protein TREMEDRAFT_7123...   536   e-150   Tremella mesenterica DSM 1558
gi|68534368|gb|AAH99099.1| Asparaginyl-tRNA synthetase [Rattus n...   535   e-149   Rattus norvegicus [brown rat]
gi|358384722|gb|EHK22319.1| hypothetical protein TRIVIDRAFT_8413...   535   e-149   Trichoderma virens Gv29-8
gi|378733655|gb|EHY60114.1| asparaginyl-tRNA synthetase [Exophia...   534   e-149   Exophiala dermatitidis NIH/UT8656
gi|325094255|gb|EGC47565.1| asparaginyl-tRNA synthetase [Ajellom...   533   e-149   Histoplasma capsulatum H88
gi|507616656|ref|XP_004623792.1| PREDICTED: asparagine--tRNA lig...   533   e-149   Octodon degus
gi|449299573|gb|EMC95586.1| hypothetical protein BAUCODRAFT_7123...   532   e-148   Baudoinia panamericana UAMH 10762
gi|261187497|ref|XP_002620171.1| asparaginyl-tRNA synthetase [Aj...   532   e-148   Blastomyces gilchristii SLH14081
gi|226293889|gb|EEH49309.1| asparaginyl-tRNA synthetase [Paracoc...   531   e-148   
gi|225558470|gb|EEH06754.1| asparaginyl-tRNA synthetase [Ajellom...   531   e-148   Histoplasma capsulatum G186AR
gi|154286286|ref|XP_001543938.1| asparaginyl-tRNA synthetase [Aj...   530   e-148   Histoplasma capsulatum NAm1
gi|452840686|gb|EME42624.1| hypothetical protein DOTSEDRAFT_4612...   529   e-148   Dothistroma septosporum NZE10
gi|58267156|ref|XP_570734.1| asparagine-tRNA ligase [Cryptococcu...   528   e-147   Cryptococcus neoformans var. neoformans JEC21
gi|241833933|ref|XP_002414971.1| asparaginyl-tRNA synthetase, pu...   528   e-147   Ixodes scapularis [blacklegged tick]
gi|134111763|ref|XP_775417.1| hypothetical protein CNBE1330 [Cry...   528   e-147   Cryptococcus neoformans var. neoformans B-3501A
gi|46129360|ref|XP_389041.1| hypothetical protein FG08865.1 [Fus...   525   e-146   
gi|405120646|gb|AFR95416.1| asparagine-tRNA ligase [Cryptococcus...   525   e-146   Cryptococcus neoformans var. grubii H99
gi|408392255|gb|EKJ71613.1| hypothetical protein FPSE_08252 [Fus...   525   e-146   Fusarium pseudograminearum CS3096
gi|472380975|ref|XP_004409884.1| PREDICTED: asparagine--tRNA lig...   524   e-146   Odobenus rosmarus divergens
gi|195160946|ref|XP_002021332.1| GL25269 [Drosophila persimilis]...   523   e-146   Drosophila persimilis
gi|448107141|ref|XP_004200920.1| Piso0_003530 [Millerozyma farin...   521   e-145   Millerozyma farinosa CBS 7064
gi|494831496|gb|EON67951.1| asparaginyl-tRNA synthetase [Coniosp...   520   e-145   Coniosporium apollinis CBS 100218
gi|330935893|ref|XP_003305169.1| hypothetical protein PTT_17935 ...   519   e-145   Pyrenophora teres f. teres 0-1
gi|342875307|gb|EGU77105.1| hypothetical protein FOXB_12403 [Fus...   519   e-144   Fusarium oxysporum Fo5176
gi|399168892|emb|CCE30180.1| probable asparaginyl-tRNA-synthetas...   518   e-144   Claviceps purpurea 20.1
gi|358254457|dbj|GAA55292.1| asparaginyl-tRNA synthetase, partia...   518   e-144   Clonorchis sinensis [oriental liver fluke]
gi|170587864|ref|XP_001898694.1| Asparaginyl-tRNA synthetase, cy...   516   e-144   Brugia malayi [agent of lymphatic filariasis]
gi|336469344|gb|EGO57506.1| asparaginyl-tRNA synthetase [Neurosp...   515   e-143   Neurospora tetrasperma FGSC 2508
gi|302921352|ref|XP_003053268.1| predicted protein [Nectria haem...   514   e-143   
gi|396500166|ref|XP_003845657.1| similar to cytoplasmic asparagi...   513   e-143   
gi|452004699|gb|EMD97155.1| hypothetical protein COCHEDRAFT_1199...   513   e-143   
gi|85084624|ref|XP_957348.1| asparaginyl-tRNA synthetase [Neuros...   512   e-142   
gi|500259471|gb|EOO02284.1| putative asparaginyl-trna synthetase...   512   e-142   
gi|451853281|gb|EMD66575.1| hypothetical protein COCSADRAFT_3508...   511   e-142   
gi|367027002|ref|XP_003662785.1| hypothetical protein MYCTH_2303...   511   e-142   
gi|482807910|gb|EOA84843.1| hypothetical protein SETTUDRAFT_1171...   511   e-142   
gi|156053|gb|AAA27849.1| 63kd antigen [Brugia malayi]                 510   e-142   
gi|322787451|gb|EFZ13539.1| hypothetical protein SINV_06357 [Sol...   509   e-142   
gi|112832|sp|P10723.1|SYNC_BRUMA RecName: Full=Asparagine--tRNA ...   509   e-141   
gi|336271493|ref|XP_003350505.1| hypothetical protein SMAC_02218...   508   e-141   
gi|290992025|ref|XP_002678635.1| asparaginyl-tRNA synthetase [Na...   507   e-141   
gi|226482506|emb|CAX73852.1| asparaginyl-tRNA synthetase [Schist...   505   e-140   
gi|238501880|ref|XP_002382174.1| cytoplasmic asparaginyl-tRNA sy...   503   e-140   
gi|340905287|gb|EGS17655.1| asparaginyl-tRNA synthetase-like pro...   503   e-140   
gi|400601198|gb|EJP68841.1| asparaginyl-tRNA synthetase [Beauver...   503   e-140   
gi|367050844|ref|XP_003655801.1| hypothetical protein THITE_2119...   502   e-139   
gi|361125045|gb|EHK97105.1| putative Asparaginyl-tRNA synthetase...   502   e-139   
gi|440639061|gb|ELR08980.1| asparaginyl-tRNA synthetase [Geomyce...   501   e-139   
gi|171686828|ref|XP_001908355.1| hypothetical protein [Podospora...   501   e-139   
gi|402079024|gb|EJT74289.1| asparaginyl-tRNA synthetase [Gaeuman...   501   e-139   
gi|380491415|emb|CCF35336.1| asparaginyl-tRNA synthetase [Collet...   500   e-139   
gi|429856546|gb|ELA31451.1| asparaginyl-trna synthetase [Colleto...   499   e-139   
gi|226468248|emb|CAX69801.1| asparaginyl-tRNA synthetase [Schist...   499   e-138   
gi|312083484|ref|XP_003143881.1| 63kd antigen [Loa loa] >gi|3077...   498   e-138   
gi|310793039|gb|EFQ28500.1| asparaginyl-tRNA synthetase [Glomere...   498   e-138   
gi|154294100|ref|XP_001547493.1| conserved hypothetical protein ...   498   e-138   
gi|347840150|emb|CCD54722.1| similar to asparaginyl-tRNA synthet...   498   e-138   
gi|350645930|emb|CCD59395.1| aspartyl-tRNA synthetase, putative ...   496   e-138   
gi|156387361|ref|XP_001634172.1| predicted protein [Nematostella...   494   e-137   
gi|389632547|ref|XP_003713926.1| asparaginyl-tRNA synthetase [Ma...   493   e-137   
gi|477526443|gb|ENH78310.1| asparaginyl-trna synthetase [Colleto...   493   e-137   
gi|452823611|gb|EME30620.1| asparaginyl-tRNA synthetase isoform ...   492   e-136   
gi|406864571|gb|EKD17616.1| asparaginyl-tRNA synthetase [Marsson...   491   e-136   
gi|512193071|gb|EPE08829.1| asparaginyl-trna synthetase [Ophiost...   490   e-136   
gi|449687973|ref|XP_002161050.2| PREDICTED: LOW QUALITY PROTEIN:...   489   e-136   
gi|320590287|gb|EFX02730.1| asparaginyl-tRNA synthetase [Grosman...   488   e-135   
gi|425765884|gb|EKV04528.1| Cytoplasmic asparaginyl-tRNA synthet...   488   e-135   
gi|346971421|gb|EGY14873.1| asparaginyl-tRNA synthetase [Vertici...   486   e-135   
gi|302406140|ref|XP_003000906.1| asparaginyl-tRNA synthetase [Ve...   486   e-135   
gi|281207090|gb|EFA81274.1| asparagine-tRNA ligase [Polysphondyl...   483   e-133   
gi|302495859|ref|XP_003009943.1| hypothetical protein ARB_03869 ...   475   e-131   
gi|195161004|ref|XP_002021360.1| GL24844 [Drosophila persimilis]...   474   e-131   
gi|302655131|ref|XP_003019360.1| hypothetical protein TRV_06641 ...   473   e-131   
gi|330790777|ref|XP_003283472.1| hypothetical protein DICPUDRAFT...   473   e-131   
gi|507112861|emb|CDF36522.1| asparaginyl-tRNA synthetase, partia...   466   e-129   
gi|485916620|gb|EOD43871.1| putative cytoplasmic asparaginyl-trn...   466   e-128   
gi|322695478|gb|EFY87285.1| asparaginyl-tRNA synthetase [Metarhi...   465   e-128   
gi|66820282|ref|XP_643772.1| asparagine-tRNA ligase [Dictyosteli...   462   e-127   
gi|322705019|gb|EFY96608.1| asparaginyl-tRNA synthetase [Metarhi...   462   e-127   
gi|470236958|ref|XP_004350432.1| asparagine-tRNA ligase [Dictyos...   460   e-127   
gi|449017569|dbj|BAM80971.1| asparagine--tRNA ligase, cytoplasmi...   446   e-123   
gi|156033277|ref|XP_001585475.1| conserved hypothetical protein ...   445   e-122   
gi|471560774|gb|EMR62791.1| putative cytoplasmic asparaginyl-trn...   444   e-122   
gi|459977802|dbj|BAM99023.1| asparaginyl-tRNA synthetase, partia...   440   e-121   
gi|452823610|gb|EME30619.1| asparaginyl-tRNA synthetase isoform ...   439   e-120   
gi|346326725|gb|EGX96321.1| asparaginyl-tRNA synthetase [Cordyce...   437   e-120   
gi|459977778|dbj|BAM99011.1| asparaginyl-tRNA synthetase, partia...   436   e-119   
gi|194387516|dbj|BAG60122.1| unnamed protein product [Homo sapiens]   435   e-119   
gi|256078425|ref|XP_002575496.1| aspartyl-tRNA synthetase [Schis...   434   e-119   
gi|346319125|gb|EGX88727.1| asparaginyl-tRNA synthetase [Cordyce...   429   e-117   
gi|344247086|gb|EGW03190.1| Asparaginyl-tRNA synthetase, cytopla...   427   e-117   
gi|123418390|ref|XP_001305315.1| asparaginyl-tRNA synthetase fam...   421   e-115   
gi|170594375|ref|XP_001901939.1| 60K filarial antigen - nematode...   418   e-114   
gi|389611886|dbj|BAM19499.1| asparaginyl-tRNA synthetase [Papili...   414   e-113   
gi|169599773|ref|XP_001793309.1| hypothetical protein SNOG_02712...   412   e-112   
gi|401428609|ref|XP_003878787.1| putative asparaginyl-tRNA synth...   405   e-110   
gi|167376054|ref|XP_001733836.1| asparaginyl-tRNA synthetase, cy...   405   e-110   
gi|207344772|gb|EDZ71801.1| YHR019Cp-like protein [Saccharomyces...   404   e-110   
gi|261327549|emb|CBH10525.1| asparaginyl-trna synthetase, putati...   404   e-110   
gi|72387914|ref|XP_844381.1| asparaginyl-tRNA synthetase [Trypan...   404   e-110   
gi|398022416|ref|XP_003864370.1| asparaginyl-tRNA synthetase, pu...   403   e-110   
gi|146099196|ref|XP_001468582.1| putative asparaginyl-tRNA synth...   403   e-110   
gi|154336461|ref|XP_001564466.1| putative asparaginyl-tRNA synth...   402   e-109   
gi|511083508|dbj|BAN37679.1| asparaginyl-tRNA synthetase, putati...   402   e-109   
gi|407035199|gb|EKE37594.1| asparagine--tRNA ligase [Entamoeba n...   402   e-109   
gi|291463763|pdb|3M4P|A Chain A, Entamoeba Histolytica Asparagin...   402   e-109   
gi|67471183|ref|XP_651543.1| asparaginyl-tRNA synthetase [Entamo...   402   e-109   
gi|471201648|ref|XP_004257661.1| asparaginyl-tRNA synthetase, cy...   400   e-109   
gi|157875933|ref|XP_001686332.1| putative asparaginyl-tRNA synth...   396   e-107   
gi|340053262|emb|CCC47550.1| putative asparaginyl-tRNA synthetas...   396   e-107   
gi|385305320|gb|EIF49308.1| asparaginyl-trna synthetase, partial...   392   e-106   
gi|342180647|emb|CCC90123.1| unnamed protein product [Trypanosom...   391   e-106   
gi|349578566|dbj|GAA23731.1| K7_Ded81ap, partial [Saccharomyces ...   387   e-105   
gi|71660150|ref|XP_821793.1| asparaginyl-tRNA synthetase [Trypan...   382   e-103   
gi|407850896|gb|EKG05067.1| asparaginyl-tRNA synthetase, putativ...   382   e-103   
gi|76156228|gb|AAX27451.2| SJCHGC05902 protein [Schistosoma japo...   378   e-102   
gi|407425210|gb|EKF39331.1| asparaginyl-tRNA synthetase, putativ...   378   e-102   
gi|240274904|gb|EER38419.1| asparaginyl-tRNA synthetase [Ajellom...   374   e-101   
gi|12851415|dbj|BAB29032.1| unnamed protein product [Mus musculus]    368   3e-99   
gi|223954271|gb|ACN30266.1| putative asparaginyl tRNA synthetase...   362   2e-97   
gi|308160927|gb|EFO63393.1| Asparaginyl-tRNA synthetase [Giardia...   359   1e-96   
gi|260822036|ref|XP_002606409.1| hypothetical protein BRAFLDRAFT...   358   3e-96   
gi|253744599|gb|EET00785.1| Asparaginyl-tRNA synthetase [Giardia...   354   4e-95   
gi|159109388|ref|XP_001704959.1| Asparaginyl-tRNA synthetase [Gi...   354   5e-95   
gi|429961525|gb|ELA41070.1| asparagine-tRNA ligase [Vittaforma c...   331   4e-88   
gi|387592423|gb|EIJ87447.1| asparaginyl-tRNA synthetase [Nematoc...   329   1e-87   
gi|440493344|gb|ELQ75829.1| Asparaginyl-tRNA synthetase [Trachip...   326   1e-86   
gi|303390853|ref|XP_003073657.1| asparagine-tRNA ligase [Encepha...   322   2e-85   
gi|429964908|gb|ELA46906.1| asparagine-tRNA ligase [Vavraia culi...   321   3e-85   
gi|429965125|gb|ELA47122.1| asparagine-tRNA ligase [Vavraia culi...   321   4e-85   
gi|401828661|ref|XP_003888044.1| asparaginyl-tRNA synthetase [En...   317   5e-84   
gi|396082172|gb|AFN83783.1| asparagine-tRNA ligase [Encephalitoz...   316   1e-83   
gi|510120724|sp|Q8SQK8.2|SYNC_ENCCU RecName: Full=Probable aspar...   313   1e-82   
gi|85014451|ref|XP_955721.1| asparagine--tRNA ligase [Encephalit...   312   2e-82   
gi|189191506|ref|XP_001932092.1| asparaginyl-tRNA synthetase [Py...   308   2e-81   
gi|300708164|ref|XP_002996267.1| hypothetical protein NCER_10065...   308   3e-81   
gi|238581429|ref|XP_002389606.1| hypothetical protein MPER_11243...   304   6e-80   
gi|47208665|emb|CAF88672.1| unnamed protein product [Tetraodon n...   303   9e-80   
gi|146332369|gb|ABQ22690.1| asparaginyl-tRNA synthetase-like pro...   302   2e-79   
gi|223478756|ref|YP_002583133.1| asparaginyl-tRNA synthetase [Th...   293   8e-77   
gi|240102785|ref|YP_002959094.1| asparaginyl-tRNA synthetase [Th...   291   4e-76   
gi|498164637|ref|WP_010478793.1| asparaginyl-tRNA synthase [Ther...   288   2e-75   
gi|315230963|ref|YP_004071399.1| asparaginyl-tRNA synthetase [Th...   288   3e-75   
gi|490168160|ref|WP_004066804.1| asparaginyl-tRNA synthase [Ther...   286   2e-74   
gi|402466097|gb|EJW01657.1| hypothetical protein EDEG_03801 [Edh...   284   4e-74   
gi|465956001|gb|EMP26697.1| Putative phospholipid-transporting A...   284   5e-74   
gi|212224110|ref|YP_002307346.1| asparaginyl-tRNA synthetase [Th...   282   2e-73   
gi|341583218|ref|YP_004763710.1| asparaginyl-tRNA synthetase [Th...   282   2e-73   
gi|242398977|ref|YP_002994401.1| Asparaginyl-tRNA synthetase [Th...   282   2e-73   
gi|390961869|ref|YP_006425703.1| asparaginyl-tRNA synthetase [Th...   281   3e-73   
gi|18313730|ref|NP_560397.1| asparaginyl-tRNA synthetase [Pyroba...   281   5e-73   
gi|16081630|ref|NP_393995.1| asparaginyl-tRNA synthetase [Thermo...   280   9e-73   
gi|383788661|ref|YP_005473230.1| asparaginyl-tRNA synthetase [Ca...   280   1e-72   
gi|161671290|gb|ABX75497.1| asparaginyl-tRNA synthetase [Lycosa ...   279   2e-72   
gi|13541827|ref|NP_111515.1| asparaginyl-tRNA synthetase [Thermo...   278   2e-72   
gi|57640694|ref|YP_183172.1| asparaginyl-tRNA synthetase [Thermo...   278   3e-72   
gi|116191979|ref|XP_001221802.1| conserved hypothetical protein ...   278   4e-72   
gi|198465133|ref|XP_002134918.1| GA23745 [Drosophila pseudoobscu...   276   1e-71   
gi|332158401|ref|YP_004423680.1| asparaginyl-tRNA synthetase [Py...   276   1e-71   
gi|315427092|dbj|BAJ48708.1| asparaginyl-tRNA synthetase [Candid...   276   1e-71   
gi|169806401|ref|XP_001827945.1| asparaginyl-tRNA synthetase [En...   275   2e-71   
gi|119871889|ref|YP_929896.1| asparaginyl-tRNA synthetase [Pyrob...   274   4e-71   
gi|145591555|ref|YP_001153557.1| asparaginyl-tRNA synthetase [Py...   273   8e-71   
gi|149570626|ref|XP_001520052.1| PREDICTED: asparaginyl-tRNA syn...   272   2e-70   
gi|187251209|ref|YP_001875691.1| asparaginyl-tRNA synthetase [El...   272   2e-70   
gi|47215828|emb|CAF96791.1| unnamed protein product [Tetraodon n...   271   3e-70   
gi|307595594|ref|YP_003901911.1| asparaginyl-tRNA synthetase [Vu...   271   4e-70   
gi|379003834|ref|YP_005259506.1| asparaginyl-tRNA synthetase [Py...   271   5e-70   
gi|325967662|ref|YP_004243854.1| asparaginyl-tRNA synthetase [Vu...   270   6e-70   
gi|408403108|ref|YP_006861091.1| asparagine--tRNA ligase [Candid...   270   7e-70   
gi|159042440|ref|YP_001541692.1| asparaginyl-tRNA synthetase [Ca...   269   2e-69   
gi|389861117|ref|YP_006363357.1| asparaginyl-tRNA synthetase [Th...   269   2e-69   
gi|14520441|ref|NP_125916.1| asparaginyl-tRNA synthetase [Pyroco...   269   2e-69   
gi|18976527|ref|NP_577884.1| asparaginyl-tRNA synthetase [Pyroco...   269   2e-69   
gi|397652132|ref|YP_006492713.1| asparaginyl-tRNA ligase [Pyroco...   268   2e-69   
gi|374327028|ref|YP_005085228.1| asparaginyl-tRNA synthetase [Py...   268   3e-69   
gi|126459746|ref|YP_001056024.1| asparaginyl-tRNA synthetase [Py...   268   3e-69   
gi|389851750|ref|YP_006353984.1| asparaginyl-tRNA synthetase [Py...   268   3e-69   
gi|297527051|ref|YP_003669075.1| asparaginyl-tRNA synthetase [St...   268   5e-69   
gi|14590172|ref|NP_142237.1| asparaginyl-tRNA synthetase [Pyroco...   268   5e-69   
gi|497573331|ref|WP_009887515.1| asparaginyl-tRNA synthase [Ferr...   266   1e-68   
gi|493961387|ref|WP_006904902.1| asparaginyl-tRNA synthase [Ther...   265   2e-68   
gi|383319249|ref|YP_005380090.1| asparaginyl-tRNA synthetase [Me...   265   3e-68   
gi|443922630|gb|ELU42042.1| Ded81p [Rhizoctonia solani AG-1 IA]       262   2e-67   
gi|126466260|ref|YP_001041369.1| asparaginyl-tRNA synthetase [St...   262   2e-67   
gi|171186197|ref|YP_001795116.1| asparaginyl-tRNA synthetase [Py...   262   2e-67   
gi|147919871|ref|YP_686378.1| asparaginyl-tRNA synthetase [Metha...   260   9e-67   
gi|429217562|ref|YP_007175552.1| asparaginyl-tRNA synthetase [Ca...   259   1e-66   
gi|322433972|ref|YP_004216184.1| asparaginyl-tRNA synthetase [Gr...   259   1e-66   
gi|433654974|ref|YP_007298682.1| asparaginyl-tRNA synthetase [Th...   259   1e-66   
gi|304316831|ref|YP_003851976.1| asparaginyl-tRNA synthetase [Th...   259   1e-66   
gi|206895765|ref|YP_002246946.1| asparaginyl-tRNA synthetase [Co...   259   2e-66   
gi|327310573|ref|YP_004337470.1| asparaginyl-tRNA synthetase [Th...   259   2e-66   
gi|511070284|ref|WP_016311850.1| asparaginyl-tRNA synthetase [Pa...   259   2e-66   
gi|490193104|ref|WP_004091679.1| asparaginyl-tRNA synthase [Acet...   259   2e-66   
gi|352682199|ref|YP_004892723.1| asparaginyl-tRNA synthetase [Th...   258   2e-66   
gi|496518682|ref|WP_009226965.1| asparaginyl-tRNA synthase [Paen...   258   3e-66   
gi|302348210|ref|YP_003815848.1| Asparaginyl-tRNA synthetase [Ac...   258   3e-66   
gi|397689142|ref|YP_006526396.1| asparaginyl-tRNA synthetase [Me...   258   5e-66   
gi|385810450|ref|YP_005846846.1| asparaginyl-tRNA synthetase [Ig...   257   5e-66   
gi|282163156|ref|YP_003355541.1| asparaginyl-tRNA synthetase [Me...   257   9e-66   
gi|495361417|ref|WP_008086136.1| asparaginyl-tRNA synthase [Acid...   256   1e-65   
gi|289596521|ref|YP_003483217.1| asparaginyl-tRNA synthetase [Ac...   256   1e-65   
gi|119719757|ref|YP_920252.1| asparaginyl-tRNA synthetase [Therm...   256   2e-65   
gi|497280953|ref|WP_009595170.1| asparaginyl-tRNA synthase [Paen...   256   2e-65   
gi|134299144|ref|YP_001112640.1| asparaginyl-tRNA synthetase [De...   255   2e-65   
gi|162454192|ref|YP_001616559.1| asparaginyl-tRNA synthetase [So...   255   2e-65   
gi|337748254|ref|YP_004642416.1| protein AsnS [Paenibacillus muc...   255   3e-65   
gi|317128623|ref|YP_004094905.1| asparaginyl-tRNA synthetase [Ba...   255   3e-65   
gi|261406095|ref|YP_003242336.1| asparaginyl-tRNA synthetase [Pa...   255   3e-65   
gi|386725895|ref|YP_006192221.1| asparaginyl-tRNA synthase [Paen...   255   3e-65   
gi|390934957|ref|YP_006392462.1| Asparaginyl-tRNA synthetase [Th...   255   3e-65   
gi|493987791|ref|WP_006930576.1| asparaginyl-tRNA synthase [Cald...   254   4e-65   
gi|494211531|ref|WP_007129869.1| asparaginyl-tRNA synthase [Paen...   254   4e-65   
gi|333897085|ref|YP_004470959.1| asparaginyl-tRNA synthetase [Th...   254   5e-65   
gi|339627947|ref|YP_004719590.1| asparaginyl-tRNA synthetase [Su...   254   6e-65   
gi|495913924|ref|WP_008638503.1| asparaginyl-tRNA ligase [Haloba...   253   1e-64   
gi|432328079|ref|YP_007246223.1| asparaginyl-tRNA synthetase [Ac...   252   2e-64   
gi|225873796|ref|YP_002755255.1| asparaginyl-tRNA synthetase [Ac...   252   3e-64   
gi|493235565|ref|WP_006209529.1| asparaginyl-tRNA synthase [Paen...   251   4e-64   
gi|206901450|ref|YP_002250648.1| asparaginyl-tRNA synthetase [Di...   251   4e-64   
gi|334341318|ref|YP_004546298.1| asparaginyl-tRNA synthetase [De...   251   4e-64   
gi|374852881|dbj|BAL55804.1| aspartyl/asparaginyl-tRNA synthetas...   251   5e-64   
gi|198465135|ref|XP_002134919.1| GA23746 [Drosophila pseudoobscu...   251   5e-64   
gi|217967320|ref|YP_002352826.1| asparaginyl-tRNA synthetase [Di...   251   5e-64   
gi|94971623|ref|YP_593671.1| asparaginyl-tRNA synthetase [Candid...   251   5e-64   
gi|385806425|ref|YP_005842823.1| asparaginyl-tRNA synthetase [Fe...   251   5e-64   
gi|497361341|ref|WP_009675554.1| asparaginyl-tRNA synthase [Paen...   250   7e-64   
gi|337283579|ref|YP_004623053.1| asparaginyl-tRNA synthetase [Py...   249   1e-63   
gi|497394470|ref|WP_009708683.1| asparaginyl-tRNA synthase [Desm...   249   1e-63   
gi|494997107|ref|WP_007723123.1| asparaginyl-tRNA synthase [Brev...   249   1e-63   
gi|498020554|ref|WP_010334710.1| asparaginyl-tRNA synthase [Baci...   249   2e-63   
gi|489436121|ref|WP_003341640.1| asparaginyl-tRNA synthase [Brev...   249   2e-63   
gi|489433056|ref|WP_003338612.1| asparaginyl-tRNA synthase [Brev...   249   2e-63   
gi|489482049|ref|WP_003387030.1| asparaginyl-tRNA ligase [Brevib...   248   3e-63   
gi|305674870|ref|YP_003866542.1| asparaginyl-tRNA synthetase [Ba...   248   3e-63   
gi|495685837|ref|WP_008410416.1| Asparagine--tRNA ligase [Desulf...   248   3e-63   
gi|496454893|ref|WP_009163738.1| asparaginyl-tRNA synthase [Pyra...   248   3e-63   
gi|490532846|ref|WP_004398018.1| asparaginyl-tRNA synthetase [Ba...   248   3e-63   
gi|226312103|ref|YP_002771997.1| asparaginyl-tRNA synthetase [Br...   248   3e-63   
gi|222151349|ref|YP_002560505.1| asparaginyl-tRNA synthetase [Ma...   248   4e-63   
gi|16079293|ref|NP_390117.1| asparaginyl-tRNA synthetase [Bacill...   248   4e-63   
gi|428279701|ref|YP_005561436.1| asparaginyl-tRNA synthetase [Ba...   248   4e-63   
gi|498177853|ref|WP_010492009.1| asparaginyl-tRNA synthase [Paen...   248   5e-63   
gi|402776494|ref|YP_006630438.1| asparaginyl-tRNA synthetase [Ba...   248   5e-63   
gi|237845635|ref|XP_002372115.1| OB-fold nucleic acid binding do...   248   5e-63   
gi|492406522|ref|WP_005834608.1| asparaginyl-tRNA synthase [Brev...   247   6e-63   
gi|472330613|ref|YP_007662889.1| asparaginyl-tRNA ligase [Bacill...   246   1e-62   
gi|494770166|ref|WP_007505574.1| asparaginyl-tRNA synthase [Cald...   246   1e-62   


>gi|384501255|gb|EIE91746.1| hypothetical protein RO3G_16457 [Rhizopus delemar RA 99-880]
          Length = 566

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/552 (62%), Positives = 420/552 (76%), Gaps = 2/552 (0%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXX 71
           E VY+DE+ G D    G++ AP+K+ ++A+++KG++I I ++K  E G+KDISG      
Sbjct: 16  EVVYVDELAGCDTNGQGSEAAPFKSILKAIELKGEDIKIQIKKDAE-GFKDISGAAFKKA 74

Query: 72  XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    IVL +D +LP+A KIKIRQ
Sbjct: 75  KKTFAEQQKKAKKLLEQQKKQEEELKKKLEDEAKALEHAKSIVLTEDTSLPVAEKIKIRQ 134

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
           S   RGKRVK+SGWVHR R QGKDM F+VLRDGSGYLQC+LTG+LCH+YDA+ LS+EST+
Sbjct: 135 STEKRGKRVKISGWVHRHRVQGKDMMFVVLRDGSGYLQCVLTGKLCHSYDAITLSIESTI 194

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
           T+YGVI+ELP GKTAP NHEL+ADYWE+   APGGDDAFTNK+  DADPS L + RHLVI
Sbjct: 195 TVYGVINELPEGKTAPGNHELVADYWEIVGKAPGGDDAFTNKVTPDADPSYLLDNRHLVI 254

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGETASAVL+AR+ ++KAFR  ++   F+EV PPCMVQTQVEGGSTLF  NYYG++AYLT
Sbjct: 255 RGETASAVLRARAEVIKAFRAFYEESHFTEVTPPCMVQTQVEGGSTLFAFNYYGQEAYLT 314

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLET LP+LGDV+C++ESYRAEKSHTRRHLSEYSHLEAEMAF+TF          
Sbjct: 315 QSSQLYLETALPALGDVFCLAESYRAEKSHTRRHLSEYSHLEAEMAFVTFDELLDHLENM 374

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +C  +DRV+A+E T +L+ QL+PDF  P+RPFLRM Y DAI YLK+H+IKKE+G+FYEFG
Sbjct: 375 MCFVIDRVMADEATSQLIKQLNPDFKKPERPFLRMKYADAIAYLKEHDIKKEDGTFYEFG 434

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD+I +PIFL  FP EIKAFYM++   D RVTESVDVL+PGVGE+VGGS
Sbjct: 435 EDIPEAPERAMTDKIGRPIFLTHFPHEIKAFYMQKDPSDRRVTESVDVLMPGVGEIVGGS 494

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MR+ D  ELL  Y +EGI+P+PYYWYTDQRKYGTT HGG+GLGVERFLAWLL+R  V+EC
Sbjct: 495 MRMHDREELLEAYAKEGIDPSPYYWYTDQRKYGTTPHGGYGLGVERFLAWLLNRYTVREC 554

Query: 551 CLYPRFMGRCLP 562
           CLYPRF GRC P
Sbjct: 555 CLYPRFTGRCTP 566



>gi|511004580|gb|EPB85946.1| asparaginyl-tRNA synthetase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 566

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/553 (62%), Positives = 417/553 (75%), Gaps = 2/553 (0%)

Query: 11  SETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXX 70
           +ETV++DE+ G D    GT+  P+K+ ++AL+VKGDNI + ++K  E G+KDISG     
Sbjct: 15  AETVFVDEIAGCDTNGNGTEATPFKSVIKALEVKGDNIKVQIKKDAE-GFKDISGAALKK 73

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXIVLKQDPNLPLAIKIKIR 129
                                                     ++L +D +LP A +IKIR
Sbjct: 74  AKKSLAEQQKKAKKLEEQKSKQDADLKKKQEDEAKALEYAKSVILTEDKSLPEAQQIKIR 133

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q+VA+RGKRVKVSGWVHRLR QGKDM FI+LRDGSGYLQC+LTG+LCH+ DA+ L++EST
Sbjct: 134 QAVANRGKRVKVSGWVHRLRVQGKDMMFIILRDGSGYLQCVLTGKLCHSLDAVTLTIEST 193

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           +T++GVI+ELP GKTAPD+HEL+ADYWE+   AP GDDAF NK+  DADP  L + RHLV
Sbjct: 194 ITVWGVINELPEGKTAPDHHELVADYWEIVGKAPSGDDAFNNKVTPDADPYYLLDNRHLV 253

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGETASAVL+AR+ ++KAFR  ++ + F+EV PPCMVQTQVEGGSTLF  NYYGE AYL
Sbjct: 254 LRGETASAVLRARAEVIKAFRAFYEEEHFTEVTPPCMVQTQVEGGSTLFAFNYYGENAYL 313

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCLPSLGDV+C++ESYRAEKSHTRRHLSEYSHLEAEMAFI F         
Sbjct: 314 TQSSQLYLETCLPSLGDVFCLAESYRAEKSHTRRHLSEYSHLEAEMAFIKFDDLLDHLEN 373

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +C  +DRVLA+E T KLV QL+PDF  P RPFLRM Y+DAI YLK++ IKKE+GS+Y+F
Sbjct: 374 MMCFVIDRVLADEETSKLVKQLNPDFKKPARPFLRMKYEDAITYLKENEIKKEDGSYYQF 433

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD+I +PIFL  FPAEIKAFYM++   D RVTESVDVL+PGVGE+VGG
Sbjct: 434 GEDIPEAPERAMTDKIGRPIFLTHFPAEIKAFYMQKVPSDRRVTESVDVLMPGVGEIVGG 493

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMR+ +  ELL  Y   GI+P PYYWYTDQRKYGTT HGG+GLGVERFLAWLL+R  V++
Sbjct: 494 SMRMDNREELLEAYGTAGIDPAPYYWYTDQRKYGTTPHGGYGLGVERFLAWLLNRYTVRD 553

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 554 CSLYPRFTGRCTP 566



>gi|501750602|emb|CCG84773.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 569

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 402/551 (72%), Gaps = 4/551 (0%)

Query: 15  YIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXXX 74
           ++DEV+GSD T TG++ +PYK++VR L+  G+  SI +RKT E  Y  I+ T        
Sbjct: 20  FVDEVSGSDITGTGSKISPYKSSVRVLEAHGNQASIYIRKTQEHEYTKITPTAMKKALKG 79

Query: 75  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIV-LKQDPNLPLAIKIKIRQSVA 133
                                                +V L+QD  LP + KIKIR + +
Sbjct: 80  LEVTLKKKAKSEELARAQASADESLRQQNAAKLEESRLVRLEQDETLPASNKIKIRAASS 139

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
           SR  RV+VSGWVHRLR+Q K + FIVLRDG+GYLQC+L+G L   YDA  L+LEST++IY
Sbjct: 140 SRDVRVRVSGWVHRLRSQ-KGLIFIVLRDGTGYLQCVLSGVLAQAYDAQTLTLESTISIY 198

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G+IS LP GKTAP NHEL ADY+E+ H APGGDDA TNK++ D+DPSILY+QRHLV+RGE
Sbjct: 199 GIISALPEGKTAPGNHELSADYFELLHRAPGGDDAITNKVSGDSDPSILYDQRHLVLRGE 258

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
           TASAVL+ R+ ++KAFR  F+  G +EV PPCMVQTQVEGGSTLF+ NYYGE+AYLTQ+S
Sbjct: 259 TASAVLRVRAGVLKAFRQTFEQMGMTEVTPPCMVQTQVEGGSTLFQFNYYGEQAYLTQSS 318

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETCLPSLGDV+CI ES+RAEK+HTRRHLSEY+H+E E+AF+ F          IC 
Sbjct: 319 QLYLETCLPSLGDVFCIQESFRAEKAHTRRHLSEYTHIEGELAFLDFEEFLAHLEELICS 378

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI--KKENGSFYEFGE 431
           T+D++L +     L+ QL+PDFVPP RPFLRM Y+DAI+Y+  HNI    E    + FG+
Sbjct: 379 TIDKLLNDPVVAPLIQQLNPDFVPPSRPFLRMTYEDAIEYVNKHNILTNDEPPRQHVFGD 438

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DI E  ER MTDQI KPIFL +FPAEIK+FYMKR   + + TESVDVL+P VGE+ GGSM
Sbjct: 439 DIAEAAERKMTDQIGKPIFLTQFPAEIKSFYMKRVQGNEKCTESVDVLMPNVGEITGGSM 498

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RISD++ELLAGYKREGI P PYYWYTDQRKYGT EHGG+G+G+ERFLAWL HR NV++CC
Sbjct: 499 RISDLDELLAGYKREGIAPEPYYWYTDQRKYGTCEHGGYGIGLERFLAWLTHRYNVRDCC 558

Query: 552 LYPRFMGRCLP 562
           LYPR+ GRC P
Sbjct: 559 LYPRYTGRCKP 569



>gi|328773412|gb|EGF83449.1| hypothetical protein BATDEDRAFT_9285 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 571

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/560 (56%), Positives = 392/560 (70%), Gaps = 7/560 (1%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYKDISGTXX 68
           S  +++I EV G+D    G++  PYKT ++AL+V G + +S   RK   EGY+  +    
Sbjct: 12  SGRSIWICEVQGNDVQGNGSEKMPYKTLLKALEVSGSEKVSYFTRKVVSEGYQPTAKAAI 71

Query: 69  XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       IVL++D  LP A KI 
Sbjct: 72  KKAMKLHEANVKKLQKAAERAVTDAAEALKNAAAEAAKLEEARKIVLEEDRLLPAAKKIH 131

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           IRQS   R  RVK+SGWVHRLR QGKDM F+VLRDGSGY+QC+LTG+ C+TYDAL L++E
Sbjct: 132 IRQSTTHREARVKISGWVHRLRVQGKDMMFVVLRDGSGYIQCVLTGKQCNTYDALTLTVE 191

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           STVTIYGVI  +P GK+AP  HEL++DYW ++  APGGD+AF NKLN ++ P IL +QRH
Sbjct: 192 STVTIYGVIKTVPEGKSAPGGHELISDYWVIHGKAPGGDEAFGNKLNTESSPDILLDQRH 251

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           LV+RGET S++++ R+ ++K FR  F+S+  +EV PP MVQTQVEGGSTLFE NYY EKA
Sbjct: 252 LVLRGETTSSIMRVRALMLKGFRSFFESRFITEVTPPLMVQTQVEGGSTLFEFNYYEEKA 311

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCLPS+GD YCI+ES+RAEKSHTRRHLSE++H EAE+AFITF       
Sbjct: 312 YLTQSSQLYLETCLPSIGDSYCITESFRAEKSHTRRHLSEFTHCEAELAFITFDDLLSCM 371

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF- 426
              + D V  +LA+     +V  L+P+F  P++PF RM Y +AI++L D+ +KK+     
Sbjct: 372 EDMVVDVVGSILADPIGASIVKDLNPNFKAPKKPFRRMQYTEAIKWLNDNGVKKDTTGQV 431

Query: 427 ----YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPG 482
               Y +GEDIPE PER MTD I +PI LCRFPAEIK FYMKRC E   +TESVD+L+P 
Sbjct: 432 MQVDYVYGEDIPEGPERRMTDTIGEPILLCRFPAEIKGFYMKRCPESLALTESVDLLMPN 491

Query: 483 VGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLL 542
           VGE+VGGSMRISD+ EL+AGY REGI+P+PYYW+TDQRKYGT EHGGFGLGVER LAWLL
Sbjct: 492 VGEIVGGSMRISDLAELMAGYSREGIDPSPYYWFTDQRKYGTCEHGGFGLGVERLLAWLL 551

Query: 543 HRDNVKECCLYPRFMGRCLP 562
            R +V+E CLYPRFMGRC P
Sbjct: 552 DRFSVREVCLYPRFMGRCTP 571



>gi|443897111|dbj|GAC74453.1| asparaginyl-trna synthetase [Pseudozyma antarctica T-34]
          Length = 583

 Score =  628 bits (1619), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 309/567 (54%), Positives = 388/567 (68%), Gaps = 15/567 (2%)

Query: 5   KPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRK---TP----- 56
           K ++     VY+DE  G+D+ + G++ +P+ T + AL  KG + S+ V+K   TP     
Sbjct: 23  KKAIGGGAPVYVDEKAGNDDAADGSKASPFATPLAALLAKGQDASVFVKKADATPGQDGV 82

Query: 57  -EEGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLK 115
             +GY  IS +                                              ++ 
Sbjct: 83  DADGYAPISASAAKKVSKLYATALKKKEKASEQAAKDEAQAAHDEKRLEDSKK----IIL 138

Query: 116 QDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGEL 175
           ++P+   A KIKI Q    R +RVK+ GWVHRLR+Q KD+ FIVLRDG+GYLQ +L+G+L
Sbjct: 139 EEPSSS-AKKIKISQGANFRDQRVKICGWVHRLRSQ-KDLTFIVLRDGTGYLQVVLSGKL 196

Query: 176 CHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNA 235
             TYDAL L+ ESTV I G +  +P GKTAP  HEL+ADYW+    APGGD+A+TN +  
Sbjct: 197 TTTYDALTLTTESTVEIQGQLKAVPEGKTAPGGHELVADYWKCLGKAPGGDEAYTNVVAE 256

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
            ADP+ L ++RHLVIRGETASAVLK RS ++KAFR  FDS G +EV PPCMVQTQVEGGS
Sbjct: 257 TADPNSLADRRHLVIRGETASAVLKVRSEVLKAFRAEFDSLGMTEVTPPCMVQTQVEGGS 316

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF  +YYG+ AYLTQ+SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+HLE E+
Sbjct: 317 TLFSFDYYGQPAYLTQSSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHLEGEL 376

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
           AFITF          IC T+ RVL +  T+ L+ QL+P+F  P RPF RMDYK+AIQ+L 
Sbjct: 377 AFITFDDLLEHLEQMICGTLARVLDDPKTKALLDQLNPNFQMPSRPFRRMDYKEAIQWLN 436

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
           DHNI  E+G  ++ G+DI E  ER MTD++N PIFLCRFP EIK+FYMKR   D   T+S
Sbjct: 437 DHNIPNEDGQPHKIGDDIAEAAERKMTDELNVPIFLCRFPREIKSFYMKRTEGDEEFTDS 496

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VDVL+PGVGE+VGGSMR++D +ELL  YK+EGI+  PY+WYTDQRKYGT EHGG+GLGVE
Sbjct: 497 VDVLMPGVGEIVGGSMRMADQHELLEAYKKEGIDAAPYFWYTDQRKYGTCEHGGYGLGVE 556

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL +R  V+E  LYPR+ GRC P
Sbjct: 557 RFLAWLTNRWTVREASLYPRWTGRCTP 583



>gi|501307050|dbj|GAC96038.1| hypothetical protein PHSY_003617 [Pseudozyma hubeiensis SY62]
          Length = 583

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/564 (54%), Positives = 387/564 (68%), Gaps = 9/564 (1%)

Query: 5   KPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRK---TPEEGYK 61
           K S+     VY+DE  G+D+++ G++++P+ T + AL  KG + S+ V+K   TP +   
Sbjct: 23  KKSIGGGAPVYVDEKAGNDDSADGSKSSPFATPLAALLAKGQDASVFVKKADATPGQDGV 82

Query: 62  DISG---TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDP 118
           D  G                                                 +VL+Q P
Sbjct: 83  DADGFAPISASAAKKVSKLYATALKKKEKASEQAAKDEAQAANDEKRLEESKMVVLEQ-P 141

Query: 119 NLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHT 178
           +   A KIKI Q    R +RVK+SGWVHRLR+Q KD+ FIVLRDG+GYLQ +L+G+L  T
Sbjct: 142 STS-AKKIKISQGANFRDQRVKISGWVHRLRSQ-KDLTFIVLRDGTGYLQVVLSGKLTTT 199

Query: 179 YDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADAD 238
           YDAL L+ ESTV I G +  +P GKTAP  HEL+ADYW+    APGGD+A+TN +   AD
Sbjct: 200 YDALTLTTESTVEIQGQLKAVPEGKTAPGGHELVADYWKCLGKAPGGDEAYTNVVAETAD 259

Query: 239 PSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLF 298
           P+ L ++RHLVIRGETASAVLK RS ++KAFR  +D  G +EV PPCMVQTQVEGGSTLF
Sbjct: 260 PNSLADRRHLVIRGETASAVLKVRSEVLKAFRAEYDHIGMTEVTPPCMVQTQVEGGSTLF 319

Query: 299 EMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFI 358
             +YYG+ AYLTQ+SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+HLE E+AFI
Sbjct: 320 SFDYYGQPAYLTQSSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHLEGELAFI 379

Query: 359 TFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHN 418
           +F          IC T+ RVL +  T+ L+ QL+P+F  P RPF RMDYK+AIQ+L DH+
Sbjct: 380 SFDDLLEHLEQLICGTLSRVLEDPKTKALLDQLNPNFKMPSRPFRRMDYKEAIQWLNDHD 439

Query: 419 IKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDV 478
           I  E+G  ++ G+DI E  ER MTD++N PIFLCRFP EIK+FYMKR   D   T+SVDV
Sbjct: 440 IPNEDGQPHKIGDDIAEAAERKMTDELNVPIFLCRFPREIKSFYMKRTEGDEEFTDSVDV 499

Query: 479 LIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFL 538
           L+PGVGE+VGGSMR++D +ELL  YK EGI+  PY+WYTDQRKYGT EHGG+GLGVERFL
Sbjct: 500 LMPGVGEIVGGSMRMADQHELLEAYKNEGIDAAPYFWYTDQRKYGTCEHGGYGLGVERFL 559

Query: 539 AWLLHRDNVKECCLYPRFMGRCLP 562
           AWL +R  V+E  LYPR+ GRC P
Sbjct: 560 AWLTNRWTVREASLYPRWTGRCTP 583



>gi|71020717|ref|XP_760589.1| hypothetical protein UM04442.1 [Ustilago maydis 521]
 gi|46100477|gb|EAK85710.1| hypothetical protein UM04442.1 [Ustilago maydis 521]
          Length = 583

 Score =  625 bits (1612), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 310/567 (54%), Positives = 388/567 (68%), Gaps = 15/567 (2%)

Query: 5   KPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRK---TP----- 56
           K ++     VY+DE  G+DET+ G++++P+ T + AL  KG + S+ V+K   TP     
Sbjct: 23  KKAIGGGAPVYVDEKAGNDETADGSKSSPFATPLAALLAKGQDASVFVKKADATPGQDGV 82

Query: 57  -EEGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLK 115
             +GY  IS +                                             +VL+
Sbjct: 83  DADGYAPISASAAKKVSKLYATALKKKEKASEQAAKDQAQAANDEKRLQESKK---VVLE 139

Query: 116 QDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGEL 175
           Q  +   A KIKI Q    R +RVK+ GWVHRLR+Q KD+ FIVLRDG+GYLQ +L+G+L
Sbjct: 140 QPSSS--AKKIKISQGADFRDQRVKICGWVHRLRSQ-KDLTFIVLRDGTGYLQVVLSGKL 196

Query: 176 CHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNA 235
             TYDAL L+ ESTV I G +  +P GKTAP  HEL+ADYW+    APGGD+A+TN +  
Sbjct: 197 TTTYDALTLTTESTVEIQGQLKAVPEGKTAPGGHELVADYWKCLGKAPGGDEAYTNVVAE 256

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
            ADP+ L ++RHLVIRGETASAVLK RS ++KAFR  FD  G +EV PPCMVQTQVEGGS
Sbjct: 257 TADPNSLADRRHLVIRGETASAVLKVRSEVLKAFRAEFDHLGMTEVTPPCMVQTQVEGGS 316

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF  +YYG+ AYLTQ+SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+HLE E+
Sbjct: 317 TLFSFDYYGQPAYLTQSSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHLEGEL 376

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
           AFI+F          IC T+ RVL +  T+ L+ QL+P+F  P RPF RMDYK+AI++L 
Sbjct: 377 AFISFDDLLEHLEQLICGTLSRVLQDPKTKALLDQLNPNFKMPTRPFRRMDYKEAIKWLN 436

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
           DHNI  E+G  ++ G+DI E  ER MTD++N PIFLCRFP EIK+FYMKR   D   T+S
Sbjct: 437 DHNIPNEDGEPHKIGDDIAEAAERKMTDELNVPIFLCRFPREIKSFYMKRTEGDEEFTDS 496

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VDVL+PGVGE+VGGSMR++D +ELL  YK EGI+  PY+WYTDQRKYGT EHGG+GLGVE
Sbjct: 497 VDVLMPGVGEIVGGSMRMADQHELLEAYKNEGIDAAPYFWYTDQRKYGTCEHGGYGLGVE 556

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL +R  V+E  LYPR+ GRC P
Sbjct: 557 RFLAWLTNRWTVREASLYPRWTGRCTP 583



>gi|388855369|emb|CCF51033.1| probable DED81-asparaginyl-tRNA-synthetase [Ustilago hordei]
          Length = 583

 Score =  625 bits (1612), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/558 (55%), Positives = 385/558 (68%), Gaps = 15/558 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRK---TPEE------GYKDIS 64
           VY+DE  G DE++ G++++P+ T + AL  KG + S+ V+K   TP E      GY  IS
Sbjct: 32  VYVDEKAGKDESADGSKSSPFATPLAALLAKGPDASLFVKKADATPGEDGVDADGYAPIS 91

Query: 65  GTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAI 124
            +                                              V+ Q+P L  A 
Sbjct: 92  ASAAKKVSKLYATALKKKGKAGEQAAKEQDKAANDEKRLEESKK----VVLQEP-LSSAK 146

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           KIKI Q    R +RVKV GWVHRLR+Q KD+ FIVLRDG+GYLQ +L+G+L  TY AL L
Sbjct: 147 KIKISQGANFRDQRVKVCGWVHRLRSQ-KDLTFIVLRDGTGYLQVVLSGKLTTTYHALTL 205

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           + ESTV I G +  +P GKTAP  HEL+ADYW+    APGGD+A+TN +  +ADP+ L +
Sbjct: 206 TTESTVEIQGQLKAVPEGKTAPGGHELVADYWKCLGKAPGGDEAYTNVVAENADPNSLAD 265

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
           +RHLVIRGETASAVLK RS ++KAFR  FD++G +EV PPCMVQTQVEGGSTLF  +YYG
Sbjct: 266 RRHLVIRGETASAVLKVRSEVLKAFRAEFDAQGMTEVTPPCMVQTQVEGGSTLFSFDYYG 325

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           + AYLTQ+SQLYLETCLPSLGDV+CI ES+RAEKSHTRRHLSEY+HLE E+AFITF    
Sbjct: 326 QPAYLTQSSQLYLETCLPSLGDVFCIQESFRAEKSHTRRHLSEYTHLEGELAFITFDDLL 385

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 IC T+ RVL +  T+ L+ QL+P+F  P RPF RMDYK+AI++L  HNI  E+G
Sbjct: 386 QHLEHLICGTLTRVLGDPKTKALLDQLNPNFQMPSRPFRRMDYKEAIKWLNQHNIPNEDG 445

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
             ++ G+DI E  ER MTD++N PIFLCRFP EIK+FYMKR   D   T+SVDVL+PGVG
Sbjct: 446 EPHKIGDDIAEAAERKMTDELNVPIFLCRFPREIKSFYMKRTQGDEEFTDSVDVLMPGVG 505

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMR++D +ELL  YK EGI+  PY+WYTDQRKYGT EHGG+GLGVERFLAWL +R
Sbjct: 506 EIVGGSMRMADQHELLEAYKNEGIDAAPYFWYTDQRKYGTCEHGGYGLGVERFLAWLTNR 565

Query: 545 DNVKECCLYPRFMGRCLP 562
             V+E  LYPR+ GRC P
Sbjct: 566 WTVREASLYPRWTGRCTP 583



>gi|402216878|gb|EJT96961.1| asparaginyl-tRNA synthetase [Dacryopinax sp. DJM-731 SS1]
          Length = 578

 Score =  625 bits (1612), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 309/555 (55%), Positives = 374/555 (67%), Gaps = 7/555 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           VY+DE  GSDE   GT  APY TAV A+ VKG +I+IL RK   + Y+ I+ +       
Sbjct: 25  VYVDEEKGSDEKGAGTVAAPYATAVHAMTVKGHDINILTRKKDAQEYQPITKSALKNVKK 84

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IVL +D +LP   + KI    
Sbjct: 85  TVETNERKSKKAAEEAEKNAKTAAEAKAREERRIEESKKIVLVEDSSLPKPTRSKIEGLQ 144

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R +RV+V GWVHRLR Q K+M FIVLRDG+G+LQC+L G    TYDALIL+ ESTV +
Sbjct: 145 PLREQRVRVFGWVHRLRQQ-KEMTFIVLRDGTGFLQCILAGRCAQTYDALILTTESTVEL 203

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
            G +  +P GKTAP  HEL+ D+W     APGGDDAF N+ N  +D S+L + RHL IRG
Sbjct: 204 VGTVQPVPEGKTAPGGHELIVDFWRTLGAAPGGDDAFNNRFNEQSDASVLADLRHLTIRG 263

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           ETA+AVL  R+A++ AFR  F     +EV PPCMVQTQVEGGSTLFE +YYG+KAYLTQ+
Sbjct: 264 ETAAAVLHVRAAVLNAFRTTFVKHSLTEVTPPCMVQTQVEGGSTLFEFDYYGQKAYLTQS 323

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLPSLGDV+CI ES+RAEKS TRRHLSEY+HLEAE+ FITF          IC
Sbjct: 324 SQLYLETCLPSLGDVFCIQESFRAEKSLTRRHLSEYTHLEAELCFITFDDLMTHIENIIC 383

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE---- 428
           +T+D +L++    +LV  L+P F PP+RPFLRMDY+DAI+YL DH I++ +    E    
Sbjct: 384 ETIDVLLSDPRMAELVQMLNPGFKPPKRPFLRMDYRDAIKYLNDHGIQRPDEVTGEIGDH 443

Query: 429 -FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
             G+DI E  ER MTDQ+N PIFL +FP EIKAFYMK    D + TESVD+L+PGVGE+V
Sbjct: 444 VIGDDIAEAAERQMTDQLNVPIFLNKFPKEIKAFYMKPIPGDPKYTESVDLLMPGVGEIV 503

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMRI+DM ELL  YKREGI+P PYYW+TDQRKYGT EHGG+GLGVERFLAWL  R  V
Sbjct: 504 GGSMRIADMQELLKAYKREGIDPEPYYWFTDQRKYGTCEHGGYGLGVERFLAWLTKRWTV 563

Query: 548 KECCLYPRFMGRCLP 562
           +EC LYPR+MGR  P
Sbjct: 564 RECSLYPRWMGRATP 578



>gi|343425723|emb|CBQ69257.1| probable DED81-asparaginyl-tRNA-synthetase [Sporisorium reilianum
           SRZ2]
          Length = 583

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/567 (54%), Positives = 388/567 (68%), Gaps = 15/567 (2%)

Query: 5   KPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRK---TP----- 56
           K ++     VY+DE  GSDET+ G++ +P+ T + AL  KG + S+ V+K   TP     
Sbjct: 23  KKAIGGGAPVYVDEKAGSDETADGSKASPFATPLAALLAKGQDASVFVKKPDATPGQDGV 82

Query: 57  -EEGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLK 115
             +GY  IS +                                              V+ 
Sbjct: 83  DADGYAPISASASKKVSKLYATALKKKEKAGEQAAKDQAQAANDEKRLEESKK----VVL 138

Query: 116 QDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGEL 175
           ++P+   A KIKI Q    R +RVK+ GWVHRLR+Q KD+ FIVLRDGSGYLQ +L+G+L
Sbjct: 139 EEPSSS-AKKIKISQGANFRDQRVKICGWVHRLRSQ-KDLTFIVLRDGSGYLQVVLSGKL 196

Query: 176 CHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNA 235
             TYDAL L+ ESTV I G +  +P GKTAP  HEL+ADYW+    APGGD+A+TN +  
Sbjct: 197 TTTYDALTLTTESTVEIQGQLKPVPEGKTAPGGHELVADYWKCLGKAPGGDEAYTNVVAE 256

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
            ADP+ L ++RHLVIRGETASAVLK RS ++KAFR  +DS G +EV PPCMVQTQVE GS
Sbjct: 257 TADPNSLADRRHLVIRGETASAVLKVRSEVLKAFRAEYDSIGMTEVTPPCMVQTQVESGS 316

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF  +YYG+ AYLTQ+SQLYLETCLPSLGDV+CI ES+RAEKSHTRRHLSEY+HLE E+
Sbjct: 317 TLFSFDYYGQPAYLTQSSQLYLETCLPSLGDVFCIQESFRAEKSHTRRHLSEYTHLEGEL 376

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
           AFI+F          IC T+ RVL +  T+ ++ QL+P+F  P RPF RMDYK+AIQ+L 
Sbjct: 377 AFISFDDLLEHLEQLICGTLARVLDDPKTKAMLDQLNPNFKMPSRPFRRMDYKEAIQWLN 436

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
           DHNI  E+G  ++ G+DI E  ER MTD++N PIFLCRFP EIK+FYMKR   D + T+S
Sbjct: 437 DHNIPNEDGQPHKIGDDIAEAAERKMTDELNVPIFLCRFPREIKSFYMKRTVGDEQFTDS 496

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VDVL+PGVGE+VGGSMR++D +ELL  YK EGI+  PY+WYTDQRKYGT EHGG+GLGVE
Sbjct: 497 VDVLMPGVGEIVGGSMRMADQHELLEAYKNEGIDAAPYFWYTDQRKYGTCEHGGYGLGVE 556

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL +R  V+E  LYPR+ GRC P
Sbjct: 557 RFLAWLTNRWTVREASLYPRWTGRCTP 583



>gi|443726020|gb|ELU13362.1| hypothetical protein CAPTEDRAFT_148401 [Capitella teleta]
          Length = 558

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 296/550 (53%), Positives = 385/550 (70%), Gaps = 8/550 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYKDISGTXXXXXX 72
           VY  E  G DET  GT+  P+KTA++A++  G +    +   + EEG             
Sbjct: 16  VYASEKTGCDETGDGTKAKPFKTALQAMKQYGKEPFPTIYVDSKEEG----ETWSVIAKA 71

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  I ++ D +L  A +IK+R + 
Sbjct: 72  QLKKLTKIFQQHMRKAESAKAKEDEDAQRRDKNLEEAKSITIEMDASLSAATQIKLRDAE 131

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R +R+K+ GWVHRLR QGK+M F+VLRDG+GYLQCLL  +LC TY+AL+LS EST+ +
Sbjct: 132 KHREQRIKIFGWVHRLRRQGKNMMFVVLRDGTGYLQCLLADKLCQTYNALVLSTESTICV 191

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
           YG +  LP GKTAP  HEL+ D+WE+   AP G     N LN +A   +  + RH++IRG
Sbjct: 192 YGTLKVLPEGKTAPGGHELVVDFWELIGLAPAG--GADNLLNEEAHIDVQLDNRHMMIRG 249

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           E  S +L+ RSA  +AFR+H+ S+G+ EV PP MVQTQVEGGSTLF+ +Y+GE A+LTQ+
Sbjct: 250 ENTSKILRLRSATTQAFREHYFSRGYYEVTPPTMVQTQVEGGSTLFKFDYFGEDAFLTQS 309

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLPSLGDV+C+++SYRAE+S TRRHL+EY+H+EAE  FI+F          +C
Sbjct: 310 SQLYLETCLPSLGDVFCVAQSYRAEQSRTRRHLAEYTHVEAECPFISFDDLLCRLEDLVC 369

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGED 432
           DTVDRV+ N    +L+ +++PDF PP+RPF RMDY +AI YLK+H+I+K++GSFYEFG+D
Sbjct: 370 DTVDRVI-NGPLGQLLKEVNPDFQPPKRPFRRMDYTEAIAYLKEHDIRKDDGSFYEFGDD 428

Query: 433 IPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMR 492
           IPE PER MTDQIN+PI LCRFPAEIK+FYM+RC +D RVTESVDVL+PGVGE+VGGSMR
Sbjct: 429 IPEAPERKMTDQINEPILLCRFPAEIKSFYMQRCEKDRRVTESVDVLMPGVGEIVGGSMR 488

Query: 493 ISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCL 552
           I D +ELLAGYKREGI+P+PYYWYTDQR YGT  HGG+GLG+ERFL W+L R+++++ CL
Sbjct: 489 IYDSDELLAGYKREGIDPSPYYWYTDQRVYGTCSHGGYGLGLERFLTWMLGRNHIRDVCL 548

Query: 553 YPRFMGRCLP 562
           YPRF+ RC P
Sbjct: 549 YPRFIQRCKP 558



>gi|307178011|gb|EFN66872.1| Asparaginyl-tRNA synthetase, cytoplasmic [Camponotus floridanus]
          Length = 1713

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 290/550 (52%), Positives = 383/550 (69%), Gaps = 10/550 (1%)

Query: 15   YIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYKDISGTXXXXXXX 73
            Y+DE NGSD+T  G++  P+KT +RA+   G +   ++   + E+G K            
Sbjct: 1172 YLDEQNGSDKTGDGSEKNPFKTILRAMHHAGKEPFPVIYHDSREDGKK----YELASKSQ 1227

Query: 74   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                  IV+++D +LP A +IKI++++ 
Sbjct: 1228 LKKIQKIWVREQHKNEEKEKKLLEDEEKRLKNLEEAKAIVIEEDKSLPEAKQIKIKEALN 1287

Query: 134  SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
             R +RVK+ GWVHRLR QGK + FI+LRDG+G+LQC+LT +LC TYDAL L+ E+ V ++
Sbjct: 1288 HRDQRVKLFGWVHRLRRQGKALMFIMLRDGTGFLQCVLTDKLCQTYDALTLATEAAVQLF 1347

Query: 194  GVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
            G +  +P GK APD HEL  DYW+ +    PGG D+    LN +A P +  + RH++IRG
Sbjct: 1348 GTLKIVPEGKNAPDGHELHVDYWKLIGSSPPGGADSI---LNEEALPDVQLDNRHIMIRG 1404

Query: 253  ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
            E  S VL  RS +++AFRDH+  +G+ EV PP +VQTQVEGGSTLF+++Y+GE A+LTQ+
Sbjct: 1405 ENTSKVLIMRSILVQAFRDHYRDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGENAFLTQS 1464

Query: 313  SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
            SQLYLETC+P++GDVYC+++SYRAE+S TRRHL+EY+H+EAE  FI F          IC
Sbjct: 1465 SQLYLETCMPAMGDVYCVAQSYRAEQSRTRRHLAEYTHIEAECPFIMFDDLLDRLEDLIC 1524

Query: 373  DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGED 432
            D V+RVL +     LV +L+P F  P+RPF RM+Y DAI+YL+++NI KE+GSFYEFGED
Sbjct: 1525 DVVERVLQSPFGH-LVQELNPGFQIPKRPFKRMNYTDAIEYLRENNITKEDGSFYEFGED 1583

Query: 433  IPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMR 492
            IPE PER MTD IN+PI LCRFP EIK+FYM+RCAE+ R+TESVDVL+P VGE+VGGSMR
Sbjct: 1584 IPEMPERKMTDAINEPILLCRFPVEIKSFYMQRCAENERLTESVDVLLPNVGEIVGGSMR 1643

Query: 493  ISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCL 552
            I +  ELL GYKRE I+PTPYYWYTDQRKYG+  HGG+GLG+ERFL WLL+R +++E CL
Sbjct: 1644 IWNYEELLEGYKRENIDPTPYYWYTDQRKYGSCPHGGYGLGLERFLCWLLNRYHIREVCL 1703

Query: 553  YPRFMGRCLP 562
            YPRFM RC P
Sbjct: 1704 YPRFMERCRP 1713



>gi|348505116|ref|XP_003440107.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like
           [Oreochromis niloticus]
          Length = 559

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 384/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILV-RKTPEEGYKDISGTXXXX 70
           +Y+ +  GSD+   GT+  P+KT ++AL   G     +I V  +  EE +  IS T    
Sbjct: 17  LYVSDKCGSDQDGDGTEQKPFKTPLKALLFAGKEPFPTIFVDSQKEEERWAVISKTQMKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    IV+K DP+LP A  +KI +
Sbjct: 77  AKKAFNREQMKNDAKEKKEAEDNERREKNLEEAKK------IVIKNDPSLPEAEAVKIHR 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ L+LS ESTV
Sbjct: 131 LQEKRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDQLCQCYNGLVLSTESTV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            IYG+++ +P GK AP  HEL  DYWE+   AP G     N LN ++D  +    RH++I
Sbjct: 191 AIYGIVTAVPEGKQAPGGHELHGDYWELVGLAPAG--GADNLLNEESDVDVQLNNRHMLI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +L+ RS + + FRDHF S+G+ E+ PP +VQTQVEGGSTLF +NY+GE+AYLT
Sbjct: 249 RGENVSKILRVRSTVTQCFRDHFFSRGYYEITPPTLVQTQVEGGSTLFNLNYFGEQAYLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETC+P+LGD +CI++SYRAE+S TRRHLSEY+H+EAE  FITF          
Sbjct: 309 QSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAECPFITFEDLLNRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +    +L+Y ++P+F PP+RPF RM+Y +AI++L++H++KK++G++YEFG
Sbjct: 369 VCDVVDRVLKSPAA-ELLYDINPNFKPPKRPFKRMNYSEAIEWLREHDVKKDDGTYYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+ I LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+VGGS
Sbjct: 428 EDIPEAPERLMTDTINETILLCRFPAEIKSFYMQRCTEDKRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ 
Sbjct: 488 MRIWDAEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRHHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFIQRCRP 559



>gi|471894609|emb|CCO31472.1| asparaginyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
          Length = 860

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 305/559 (54%), Positives = 381/559 (68%), Gaps = 11/559 (1%)

Query: 7   SVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQ-VKGDNISILVRKTPEEGYKDISG 65
           S +S   VY+DE  GSD+   GT+ +PY T V AL   +G  ++I +RK P + Y  ISG
Sbjct: 18  SSESMPKVYVDETAGSDDKGDGTEASPYATPVTALAGPQGAEVAIFIRKAPADEYAPISG 77

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
                                                         IVLK+DP+LP AIK
Sbjct: 78  AALKRAKKGLEQQKEKAKKAEAAAAKESQERQREAQKLEESKK---IVLKEDPSLPAAIK 134

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
            KI+     R KR+ VSGWVHRLR Q K + FIVLRDG+GYLQC+L+G+L  TYDAL+L 
Sbjct: 135 TKIQGCSELRSKRISVSGWVHRLRQQ-KGLTFIVLRDGTGYLQCVLSGQLAQTYDALVLM 193

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
            ESTV I G ++ELP GKTAP  HEL ADYW++   APGG +A++ K N + + ++LY+ 
Sbjct: 194 TESTVRIIGTLTELPEGKTAPGGHELAADYWQLLGAAPGGAEAYSTKFNEETEGAVLYDN 253

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHL++RGE ASAVL+ RS ++ AFR  F      EV PPC+VQTQVEGG+TLF+++YYG+
Sbjct: 254 RHLLLRGEIASAVLRVRSCVLSAFRHTFAKHSLIEVTPPCLVQTQVEGGATLFKLDYYGQ 313

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
            A+LTQ+SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSE++HLEAE+AFITF     
Sbjct: 314 PAFLTQSSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEFTHLEAELAFITFDELMA 373

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKK---E 422
                IC+TVD +L +    +LVYQLHP F  P+RPF+RM+YKDAI+YL +H IK+   E
Sbjct: 374 HIEAVICETVDTLLEDPKMAELVYQLHPKFEKPKRPFMRMNYKDAIKYLVEHGIKRKDEE 433

Query: 423 NGSF--YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLI 480
            G    +  G+DI E  ER MTDQ+N PIFL  FP E+K+FYMK+   D   TES D+L+
Sbjct: 434 TGELVDHAVGDDIAEAAERQMTDQLNVPIFLYGFPKELKSFYMKKIPGDEAFTESCDLLM 493

Query: 481 PGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAW 540
           P VGE+VGGSMRI+DM ELL GYKREGI+P PYYW+TDQRKYGT EHGG+GLGVER LAW
Sbjct: 494 PNVGEIVGGSMRIADMQELLEGYKREGIDPAPYYWFTDQRKYGTCEHGGYGLGVERLLAW 553

Query: 541 LLHRDNVKECCLYPR-FMG 558
           L  R  V+EC LYPR +MG
Sbjct: 554 LTDRFTVRECSLYPRCWMG 572



>gi|449514835|ref|XP_004174228.1| PREDICTED: LOW QUALITY PROTEIN: asparagine--tRNA ligase,
           cytoplasmic [Taeniopygia guttata]
          Length = 559

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/565 (52%), Positives = 389/565 (68%), Gaps = 12/565 (2%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE- 57
           + L + +  + E +Y+ E  G+D T  GTQ  P+KT ++AL   G     +I V    E 
Sbjct: 4   DVLGRTAALTLEELYVSEREGNDSTGDGTQKKPFKTVLKALMTAGKEPFPTIYVDSQKEN 63

Query: 58  EGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQD 117
           E +  IS +                                             +V+K D
Sbjct: 64  ERWAIISKSQMKNVKKLWHREQMKNEAKEKKEAEDLLRREKNLEEAKK------VVIKND 117

Query: 118 PNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
           P+LP    +KI+   A RG+RVK+ GW+HRLR QGK++ FIVLRDG+G+LQC+L+ ELC 
Sbjct: 118 PSLPEPTCVKIKALEAYRGQRVKIFGWIHRLRRQGKNLMFIVLRDGTGFLQCVLSDELCQ 177

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADA 237
            Y+ L+LS ES+V +YG ++ LP GK AP  HEL  DYWE+   AP G     N LN D+
Sbjct: 178 CYNGLVLSTESSVVVYGTLNLLPQGKQAPGGHELSCDYWELIGLAPAG--GADNLLNEDS 235

Query: 238 DPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTL 297
           +  +    RH++IRGE  S + K RS +++AFRDHF + G+ EV PP +VQTQVEGGSTL
Sbjct: 236 EVDVQLNNRHMMIRGENMSKIFKVRSMVVQAFRDHFFANGYYEVTPPTLVQTQVEGGSTL 295

Query: 298 FEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAF 357
           F+++Y+GE+AYLTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F
Sbjct: 296 FKLDYFGEEAYLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPF 355

Query: 358 ITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDH 417
           I+F          +CD VDRVL +     L+Y L+P F PP RPF RM+Y +AI++LK+H
Sbjct: 356 ISFEDLLDRLENLVCDVVDRVLKSPAA-TLLYDLNPGFQPPSRPFRRMNYAEAIEWLKEH 414

Query: 418 NIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
           ++KKE+G++YEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC++D+R+TESVD
Sbjct: 415 DVKKEDGTYYEFGEDIPEAPERLMTDTINEPILLCRFPAEIKSFYMQRCSDDSRLTESVD 474

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           VL+P VGE+VGGSMR  D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERF
Sbjct: 475 VLMPNVGEIVGGSMRTWDSEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERF 534

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           L W+L+R ++++ CLYPRF+ RC P
Sbjct: 535 LTWILNRHHIRDVCLYPRFVQRCKP 559



>gi|471388322|ref|XP_004379317.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Trichechus manatus
           latirostris]
          Length = 559

 Score =  615 bits (1586), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/551 (53%), Positives = 380/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQMKNECREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 132 EAHRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSLITRCFRDHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+EAE AF+TF          I
Sbjct: 310 SSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECAFLTFEDLLTRVEDLI 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPIA-SIVYDLNPNFKPPKRPFKRMNYLDAIVWLKEHNVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCAHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCTP 559



>gi|498925995|ref|XP_004538584.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Maylandia
           zebra]
          Length = 559

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD+   GT+  P+KT ++AL   G     +I V    E E +  IS T    
Sbjct: 17  LYVSDKCGSDQDGDGTEQKPFKTPLKALLFAGKEPFPTIFVESQKEGERWAVISKTQMKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    IV+K DP+LP A  +KI +
Sbjct: 77  AKKAFNREQIKNDAKEKKEAEDNERREKNLEEAKK------IVIKNDPSLPEAEAVKIHR 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ L+LS ESTV
Sbjct: 131 LQEKRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDQLCQCYNGLVLSTESTV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            IYG ++ +P GK AP  HEL  DYWE+   AP G     N LN ++D  +    RH++I
Sbjct: 191 AIYGTVTAVPEGKQAPGGHELHGDYWELVGLAPAG--GADNLLNEESDVDVQLNNRHMLI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +L+ RS + + FRDHF S G+ E+ PP +VQTQVEGGSTLF +NY+GE+AYLT
Sbjct: 249 RGENVSKILRVRSTVTQCFRDHFFSCGYYEITPPTLVQTQVEGGSTLFNLNYFGEQAYLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETC+P+LGD +CI++SYRAE+S TRRHLSEY+H+EAE  FITF          
Sbjct: 309 QSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAECPFITFEDLLNRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +    +L+Y ++P+F PP+RPF RM+Y +AI++L++H++KK++G++YEFG
Sbjct: 369 VCDVVDRVLKSPAA-ELLYDINPNFKPPKRPFKRMNYSEAIEWLREHDVKKDDGTYYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+ I LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+VGGS
Sbjct: 428 EDIPEAPERLMTDTINETILLCRFPAEIKSFYMQRCTEDKRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ 
Sbjct: 488 MRIWDAEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRHHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFIQRCRP 559



>gi|449282950|gb|EMC89675.1| Asparaginyl-tRNA synthetase, cytoplasmic, partial [Columba livia]
          Length = 544

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 384/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ E  GSD T  GTQ  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 2   LYVSEREGSDSTGDGTQKKPFKTVLKALMTAGKEPFPTIYVDSQKENERWAIISKSQMKN 61

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    +V+K DP+LP    +KI  
Sbjct: 62  VKKLWHREQMKNEAKEKKEAEDLLRREKNLEEAKK------VVIKNDPSLPEPKCVKIGA 115

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
             A RG+RVK+ GW+HRLR QGK++ FIVLRDG+G+LQC+L+ ELC  Y+ L+LS ES+V
Sbjct: 116 LEAYRGQRVKIFGWIHRLRRQGKNLMFIVLRDGTGFLQCVLSDELCQCYNGLVLSTESSV 175

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG ++ +P GK AP  HEL  DYWE+   AP G     N LN D++  +    RH++I
Sbjct: 176 AVYGTLNLVPEGKQAPGGHELSCDYWELLGLAPAG--GADNLLNEDSEVDVQLNNRHMMI 233

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S + K RS  ++AFRDHF + G+ EV PP +VQTQVEGGSTLF+++Y+GE+AYLT
Sbjct: 234 RGENMSKIFKVRSMAVQAFRDHFFANGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAYLT 293

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  FI+F          
Sbjct: 294 QSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPFISFEDLLARLESL 353

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +  +  L+Y+L+P F PP+RPF RM+Y +AI++LK+H++KK++G++YEFG
Sbjct: 354 VCDVVDRVLKSPAS-SLLYELNPGFKPPKRPFRRMNYSEAIEWLKEHDVKKDDGTYYEFG 412

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC +D+R+TESVDVL+P VGE+VGGS
Sbjct: 413 EDIPEAPERLMTDTINEPILLCRFPAEIKSFYMQRCQDDSRLTESVDVLMPNVGEIVGGS 472

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 473 MRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRDV 532

Query: 551 CLYPRFMGRCLP 562
           CLYPRFM RC P
Sbjct: 533 CLYPRFMQRCKP 544



>gi|148231213|ref|NP_001086948.1| asparaginyl-tRNA synthetase [Xenopus laevis]
 gi|50414890|gb|AAH77811.1| Nars-prov protein [Xenopus laevis]
          Length = 559

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 290/553 (52%), Positives = 379/553 (68%), Gaps = 10/553 (1%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXX 69
           E +YI +  G+D T  GT+  P+KT ++A+ V G     +  V    E    D+      
Sbjct: 15  EEMYISDREGNDSTGDGTKEKPFKTILKAMLVAGKEPFPTFYVDSQKENERWDV-----I 69

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     I++  DP+LP  + +KIR
Sbjct: 70  SKSQVKNNRKLWVREQMKNEAKEKKEAEDNLRREKNLEDAKKIIISNDPSLPAPVTLKIR 129

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           +  A RG+RVKV GWVHRLR QGK++ FIVLRDG+GYLQC+L+ +LC  Y+ L+LS EST
Sbjct: 130 ELEAYRGQRVKVFGWVHRLRRQGKNLMFIVLRDGTGYLQCVLSDQLCQCYNGLVLSTEST 189

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V +YG ++ +P GK AP  HEL  DYWE+   AP G     N LN ++D  +    RH++
Sbjct: 190 VAVYGTLNLVPDGKQAPGGHELACDYWELVGLAPAG--GADNLLNEESDVDVQLNNRHMM 247

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           IRGE  S + K RS ++  FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+AYL
Sbjct: 248 IRGENMSKIFKVRSTVIHCFRNHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAYL 307

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETC+P+LGD +CI++SYRAE+S TRRHL+EY+H+EAE  F+TF         
Sbjct: 308 TQSSQLYLETCIPALGDSFCIAQSYRAEQSRTRRHLAEYTHIEAECPFMTFENLLERLED 367

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +CD VDRVL +     L+Y LHP+F PP+RPF RM+Y +AI +LK+H++KK++G++YEF
Sbjct: 368 LVCDVVDRVLKSPVA-SLLYDLHPEFKPPKRPFRRMNYSEAITWLKEHDVKKDDGTYYEF 426

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RCAED R+TESVDVL+P VGE+VGG
Sbjct: 427 GEDIPEAPERLMTDAINEPILLCRFPAEIKSFYMQRCAEDKRLTESVDVLMPNVGEIVGG 486

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI D  ELL GYKRE I+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++
Sbjct: 487 SMRIWDSEELLEGYKREEIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRD 546

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 547 VCLYPRFVQRCKP 559



>gi|443698706|gb|ELT98564.1| hypothetical protein CAPTEDRAFT_130706, partial [Capitella teleta]
          Length = 466

 Score =  612 bits (1578), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 277/451 (61%), Positives = 360/451 (79%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I ++ D +LP+A +IK+R +   R +R+K+ GWVHRLR QGK+M F+VLRDG+GYLQCLL
Sbjct: 19  ITIEMDASLPVATQIKLRDAEKHREQRIKIFGWVHRLRRQGKNMMFVVLRDGTGYLQCLL 78

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
             +LC TY+AL+LS EST+ +YG +  LP GKTAP  HEL+ D+WE+   AP G     N
Sbjct: 79  ADKLCQTYNALVLSTESTICVYGTLKVLPEGKTAPGGHELVVDFWELVGLAPAG--GADN 136

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            LN +A   +  + RH++IRGE  S +L+ RSA  +AFR+H+ S+G+ EV PP MVQTQV
Sbjct: 137 LLNEEAHIDVQLDNRHMMIRGENTSKILRLRSATTQAFREHYFSRGYYEVTPPTMVQTQV 196

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLF+ +Y+G+ A+LTQ+SQLYLETCLPSLGDV+C+++SYRAE+S TRRHL+EY+H+
Sbjct: 197 EGGSTLFKFDYFGDDAFLTQSSQLYLETCLPSLGDVFCVAQSYRAEQSRTRRHLAEYTHV 256

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  FI+F          +CDTVDRV+ N +  +L+ +++PDF PP+RPF RMDY +AI
Sbjct: 257 EAECPFISFDDLLCRLEDLVCDTVDRVI-NGSLGQLLKEVNPDFQPPKRPFRRMDYMEAI 315

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            YLK+H+I+K++GS+YEFG+DIPE PER MTDQIN+PI LCRFPAEIK+FYM+RC +D R
Sbjct: 316 AYLKEHDIRKDDGSYYEFGDDIPEAPERKMTDQINEPILLCRFPAEIKSFYMQRCDKDRR 375

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           VTESVDVL+PGVGE+VGGSMRI D +ELLAGYKREGI+P+PYYWYTDQR YGT  HGG+G
Sbjct: 376 VTESVDVLMPGVGEIVGGSMRIYDSDELLAGYKREGIDPSPYYWYTDQRVYGTCSHGGYG 435

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL W+L R ++++ CLYPRF+ RC P
Sbjct: 436 LGLERFLTWMLGRHHIRDVCLYPRFIQRCRP 466



>gi|512809930|ref|XP_002934488.2| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Xenopus (Silurana)
           tropicalis]
          Length = 558

 Score =  612 bits (1577), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/553 (52%), Positives = 377/553 (68%), Gaps = 10/553 (1%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXX 69
           E +Y+ +  G+D T  GT+  P+KT ++A+   G     +  V    E    D+      
Sbjct: 14  EEMYVSDREGNDSTGDGTKEKPFKTILKAMLAAGKEPFPTFYVDSQKENERWDV-----I 68

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     IV+  DP+LP  + +KIR
Sbjct: 69  SKSQMKNNRKLWVREQMKNEAKEKKEAEDNLRREKNLEEAKKIVITNDPSLPAPVTLKIR 128

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q  A RG+RVKV GWVHRLR QGK + FIVLRDG+GYLQC+L+ +LC  Y+ L+LS EST
Sbjct: 129 QLEAYRGQRVKVFGWVHRLRRQGKTLMFIVLRDGTGYLQCVLSDQLCQCYNGLVLSTEST 188

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V +YG ++ +P GK AP  HEL  DYWE+   AP G     N LN ++D  +    RH++
Sbjct: 189 VAVYGTLNLVPDGKQAPGGHELACDYWEIVGLAPAG--GADNLLNEESDVDVQLNNRHMM 246

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           IRGE  S + K RS ++  FR+HF  +G+ E+ PP +VQTQVEGGSTLF+++Y+GE+AYL
Sbjct: 247 IRGENMSKIFKVRSTVIHCFRNHFFDRGYYEITPPTLVQTQVEGGSTLFKLDYFGEEAYL 306

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETC+P++GD +CI++SYRAE+S TRRHL+EY+H+EAE  F+TF         
Sbjct: 307 TQSSQLYLETCIPAMGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFMTFEDLLNRLED 366

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +CD VDRVL +     L+Y LHP+F PP+RPF RM+Y +AI +LK+H++KK++G++YEF
Sbjct: 367 LVCDVVDRVLKSPVA-SLLYDLHPEFKPPKRPFRRMNYTEAITWLKEHDVKKDDGTYYEF 425

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RCAED R+TESVDVL+P VGE+VGG
Sbjct: 426 GEDIPEAPERLMTDSINEPILLCRFPAEIKSFYMQRCAEDKRLTESVDVLMPNVGEIVGG 485

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI D  ELL GYKREGI+ TPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++
Sbjct: 486 SMRIWDSEELLEGYKREGIDATPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRD 545

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 546 VCLYPRFVQRCKP 558



>gi|392884348|gb|AFM91006.1| asparaginyl-tRNA synthetase, cytoplasmic-like protein
           [Callorhinchus milii]
          Length = 560

 Score =  612 bits (1577), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 297/557 (53%), Positives = 387/557 (69%), Gaps = 14/557 (2%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGT 66
           S + +Y+ +  G D   TGT+  P+KTA++AL   G     +I V    E E +  IS T
Sbjct: 14  SLDELYVSDREGDDSAGTGTKEKPFKTALQALTAFGKEPFPTIYVDSQKEGERWDVISNT 73

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        +V+K DP+LP    +
Sbjct: 74  QLKNLKKLCQRGQVKNETAAQKEIEDALRREKNLEEARK------VVIKLDPSLPEPKLV 127

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KIR + A RG+RVK+ GW+HRLR QGK++ F++LRDG+G+LQC+L+ ELC  Y+AL+LS 
Sbjct: 128 KIRDTEAHRGERVKIFGWIHRLRRQGKNLMFVILRDGTGFLQCVLSDELCQCYNALVLST 187

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG +  +P GK AP  HEL+ DYWE+   AP GG D   N LN ++D  +    
Sbjct: 188 ESSVALYGTLKIVPEGKMAPGGHELICDYWELIGLAPPGGAD---NLLNEESDVDVQLNN 244

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH+++RGE  S + K RSA+++ FRDH+  +G+ E+ PP +VQTQVEGGSTLF+MNY+GE
Sbjct: 245 RHMMLRGENMSKIFKVRSALIQCFRDHYFDRGYFEITPPTLVQTQVEGGSTLFKMNYFGE 304

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+E E AFIT+     
Sbjct: 305 EAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHIEGECAFITYDDLLN 364

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDR+L +     LV +LHP+F PP+RPF RM+Y DAI +LK+H+ KKE+G+
Sbjct: 365 RLEDLVCDVVDRILKSPFG-DLVRELHPEFQPPKRPFRRMNYTDAITWLKEHDYKKEDGT 423

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE
Sbjct: 424 FYEFGEDIPEAPERMMTDAINEPILLCRFPAEIKSFYMERCPEDRRLTESVDVLMPNVGE 483

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI D +ELL GYKREGI+ TPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R 
Sbjct: 484 IVGGSMRIWDSDELLEGYKREGIDCTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRH 543

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++  LYPRF+ RC P
Sbjct: 544 HIRDVVLYPRFVQRCKP 560



>gi|344268976|ref|XP_003406332.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Loxodonta
           africana]
          Length = 559

 Score =  611 bits (1576), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 291/551 (52%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D+T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDDTGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQTKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ L+LS ES+V 
Sbjct: 132 EAHRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGLVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YGV++  P GK AP  HEL  D+WE+   AP G     N LN ++D  +    RH++IR
Sbjct: 192 VYGVLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLLNEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +L+ARS   + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILRARSLATRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H+EAE  F TF          +
Sbjct: 310 SSQLYLETCLPALGDVFSIAQSYRAEQSRTRRHLAEYTHIEAEFPFATFEDLLARVEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDR+L +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRILKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP +IK+FYM+RC+ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVQIKSFYMQRCSEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ C
Sbjct: 489 RIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCAHGGYGLGLERFLTWLLNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFLQRCTP 559



>gi|507951721|ref|XP_004683991.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Condylura
           cristata]
          Length = 559

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/551 (52%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTAGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPSCVKINAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVLLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELMGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPVA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|194759334|ref|XP_001961904.1| GF15206 [Drosophila ananassae]
 gi|190615601|gb|EDV31125.1| GF15206 [Drosophila ananassae]
          Length = 558

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 298/556 (53%), Positives = 384/556 (69%), Gaps = 16/556 (2%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILV-RKTPE--EGYKDISGTX 67
           +++  E  G+DE+  G+++ PYKT ++A++  G     +I V  K P   E Y+  + + 
Sbjct: 13  SLFTSEKKGNDESGNGSESKPYKTILQAMRHAGKEPFPTIYVDSKDPNAAEPYEPAAKSQ 72

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I + +DP+ P+A KI+
Sbjct: 73  LKKIQKLFVRESHKNAEKQQREAEDAEKRQQNLEEARK------IKIAEDPSWPVARKIR 126

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I +  A+RG RVK+ GWVHRLR QGK + FI LRDG+G+LQC+L  +LC TYDAL LS E
Sbjct: 127 ILEGTANRGSRVKIYGWVHRLRRQGKSLIFITLRDGTGFLQCVLNDQLCQTYDALTLSTE 186

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQR 246
           STV ++G +  +P GKTAP  HEL  DYWE +    PGG DA    LN +A P +  + R
Sbjct: 187 STVVLFGTLKLVPEGKTAPGGHELNVDYWELIGLAPPGGADAI---LNEEAQPDVQLDNR 243

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           H++IRGE  S VLK RS + +AFR H++ +G++EV PP +VQTQVEGGSTLF++ Y+GE+
Sbjct: 244 HIMIRGENTSKVLKMRSVVAQAFRAHYEERGYNEVTPPTLVQTQVEGGSTLFKLKYFGEE 303

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EYSH+EAE  FITF      
Sbjct: 304 AYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYSHVEAECPFITFEELLDR 363

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               +CD VDRVL +     LV +L+PDF PP++PF RM+Y DAIQ+LKD+N+ K++G+F
Sbjct: 364 LEDLVCDVVDRVLKSPWGY-LVKELNPDFQPPKKPFRRMNYVDAIQWLKDNNVTKDDGTF 422

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           YEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM RC ED R+TESVDVL+P VGE+
Sbjct: 423 YEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMSRCKEDQRLTESVDVLLPNVGEI 482

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
           VGGSMRI D  ELL GY+REGI+P PYYWYTDQR YGT  HGG+GLG+ERFL WLL+R +
Sbjct: 483 VGGSMRIHDSEELLKGYEREGIDPKPYYWYTDQRIYGTMPHGGYGLGLERFLCWLLNRYH 542

Query: 547 VKECCLYPRFMGRCLP 562
           ++E CLYPR++ RC P
Sbjct: 543 IREVCLYPRYLDRCRP 558



>gi|194879712|ref|XP_001974286.1| GG21647 [Drosophila erecta]
 gi|190657473|gb|EDV54686.1| GG21647 [Drosophila erecta]
          Length = 558

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 281/452 (62%), Positives = 354/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+LPLA KI+I +  A+R  RVKV GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 111 VKISEDPSLPLARKIRIFEGTANRDSRVKVYGWVHRLRRQGKSLIFITLRDGTGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ES+V ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 171 NDQLCQTYDALTLSTESSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS + +AFR H++++G++EV PP +VQTQ
Sbjct: 230 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRAHYEARGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+GE+AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EYSH
Sbjct: 288 VEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYSH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE AF+TF          +CD VDRVL +     LV +L+PDF PPQ+PF RM+Y+DA
Sbjct: 348 VEAECAFLTFDDLLDRLEDLVCDVVDRVLKSPWGY-LVKELNPDFKPPQKPFRRMNYEDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED 
Sbjct: 407 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GY REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYAREGIDPKPYYWYTDQRIYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 558



>gi|327277896|ref|XP_003223699.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Anolis
           carolinensis]
          Length = 559

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 387/552 (70%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILV-RKTPEEGYKDISGTXXXX 70
           VY+ +  G+D    GTQ  P+KTA+RAL   G     +I V  +  ++ ++ IS T    
Sbjct: 17  VYVSDREGNDAAGDGTQEKPFKTALRALLSVGKEPFPTIYVDSQKDDQRWETISKTQFKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I++K+D +LP    +KIR 
Sbjct: 77  VKKLWQREKQKNEAREKKEAEDLLRREKNLEEAKK------IIIKKDSSLPEPKCVKIRA 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
             A RG+RVKV GWVHRLR QGK++ FIVLRDG+GYLQC+L+ ELC  Y+ ++LS ESTV
Sbjct: 131 LEAHRGERVKVFGWVHRLRRQGKNLMFIVLRDGTGYLQCVLSDELCQCYNGVVLSTESTV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG ++ +P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 191 AVYGTLNLVPEGKQAPGGHELSCDFWELIGLAPAG--GADNLVNEESDVDVQLNNRHMMI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGET S + K RS ++++FRDHF  +G+ E+ PP +VQTQVEGGSTLF+M+Y+GE+AYLT
Sbjct: 249 RGETLSRIFKVRSTVIQSFRDHFFDRGYYEITPPTLVQTQVEGGSTLFKMDYFGEEAYLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETC+P+LGD +CI++SYRAE+S TRRHL+EY+H+EAE  F++F          
Sbjct: 309 QSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFMSFEDLLNRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +  + +L+Y L+P+F PP+RPF RM+Y DA+ +LK+H++KKE+G++YEFG
Sbjct: 369 VCDVVDRVLKSPVS-ELLYALNPNFEPPKRPFRRMNYTDALVWLKEHDVKKEDGTYYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           +DIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+VGGS
Sbjct: 428 DDIPEAPERQMTDAINEPILLCRFPAEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 488 MRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFVQRCKP 559



>gi|19111917|ref|NP_595125.1| cytoplasmic asparagine-tRNA ligase Nrs1 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|59798599|sp|O94567.1|SYNC_SCHPO RecName: Full=Probable asparagine--tRNA ligase, cytoplasmic;
           AltName: Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|3850088|emb|CAA21915.1| cytoplasmic asparagine-tRNA ligase Nrs1 (predicted)
           [Schizosaccharomyces pombe]
          Length = 568

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/558 (53%), Positives = 383/558 (68%), Gaps = 5/558 (0%)

Query: 8   VKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDIS-GT 66
           +KS    YIDE +G+DET  G+Q +P+KTA+ AL+    N +I V+K   E ++ I+   
Sbjct: 13  IKSDVVFYIDEASGNDETGNGSQTSPFKTAIHALETDA-NCTIFVKKNGSEEFEPITTNA 71

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        IVLK+  + P A KI
Sbjct: 72  LKKAKKGVEQAAKKKAKAAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKKI 131

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH--TYDALIL 184
            I  S   R  RV+V+GWVHR+RTQ K + FI+LRDG+G+LQC+L+G++    +YD + L
Sbjct: 132 AIIDSTNFRDSRVRVNGWVHRMRTQ-KGIIFIILRDGTGFLQCVLSGKVYDRASYDFINL 190

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
             ESTV +YGVI ELP GK+AP NHEL+ DY+++ H AP G++AFTN+LNA+A+PS L +
Sbjct: 191 GPESTVCLYGVIKELPEGKSAPGNHELVVDYYQILHAAPTGEEAFTNRLNAEAEPSYLLD 250

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
           QRHLVIRGETAS+VLK R+  ++A RD F++   +EV PPCMVQTQVEGG+TLF+ NYYG
Sbjct: 251 QRHLVIRGETASSVLKVRARALRAMRDTFENLKMTEVTPPCMVQTQVEGGATLFKFNYYG 310

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           + AYLTQ+SQLYLE  LP+LG VY I ES+RAEKS TRRHLSE++H+E E+ F+ F    
Sbjct: 311 QDAYLTQSSQLYLEAALPALGSVYTIQESFRAEKSLTRRHLSEFTHVEFELPFVNFGEFL 370

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 IC T+DR+L +     L+ QL+PDFV P RPF+R+ Y+DAI+YL +HNI    G
Sbjct: 371 EIIEEFICQTIDRLLDDPIATPLIKQLNPDFVKPSRPFMRLSYEDAIKYLNEHNILTPEG 430

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
             ++FG+DI E  ER MTDQIN+PIFL  FP EIK+FYMKR  +   +TESVD L+P VG
Sbjct: 431 EQHKFGDDIAEAAERKMTDQINRPIFLTYFPLEIKSFYMKRVVDRPELTESVDCLMPNVG 490

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMRISD+ ELLA YKREGI+P PYYW+T+QRKYGTTEHGG GLG+ERFLAWL  R
Sbjct: 491 EIVGGSMRISDIQELLAAYKREGIDPAPYYWFTEQRKYGTTEHGGCGLGLERFLAWLCDR 550

Query: 545 DNVKECCLYPRFMGRCLP 562
             V+ECCL+PRF  RC P
Sbjct: 551 YTVRECCLFPRFTERCTP 568



>gi|465999409|ref|XP_004268091.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Orcinus orca]
          Length = 559

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 380/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPSCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ E++PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYCEISPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V+ L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPVA-SVVHDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|340727529|ref|XP_003402094.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Bombus
           terrestris]
          Length = 556

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 298/563 (52%), Positives = 389/563 (69%), Gaps = 14/563 (2%)

Query: 6   PSVKSSET----VYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGY 60
           P ++SS++    +Y  +  G+DET  GT   P+KT +RA++  G +      + + E+G 
Sbjct: 2   PVMESSKSLLDAIYTSQKYGNDETGNGTDTNPFKTILRAMRYVGKEPFPPFYQDSNEDGK 61

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
           K +                                                I++++D  L
Sbjct: 62  KYV----IVSKSQFKKAQKIWARNEYKNEDKQKKLLEDEEKRLKNLEEAKTIIIQEDTTL 117

Query: 121 PLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYD 180
           P AI IKIR S+  R +RVK+ GWVHRLR QG+ + FI LRDG+G+LQC+L+  LC TY+
Sbjct: 118 PPAICIKIRDSIYHRDQRVKLFGWVHRLRRQGRALMFITLRDGTGFLQCVLSNILCQTYN 177

Query: 181 ALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADP 239
           AL LS E+++ I+G +  +P GK AP+ HEL  DYW  +    PGG D+    LN +A P
Sbjct: 178 ALTLSTEASIEIFGTLKIVPEGKNAPNGHELHVDYWRLIGTSPPGGADSI---LNEEALP 234

Query: 240 SILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFE 299
            +  + RH++IRGE  S VL  RS +M+AFRDHF+ KG+SEV PP +VQTQVEGGSTLF+
Sbjct: 235 DVQLDNRHIMIRGENTSRVLLVRSVLMQAFRDHFNEKGYSEVTPPTLVQTQVEGGSTLFK 294

Query: 300 MNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFIT 359
           ++Y+GE+A+LTQ+SQLYLETCLP++GDVYCI++SYRAE+S TRRHL+EY+H+EAE AFIT
Sbjct: 295 LDYFGEEAFLTQSSQLYLETCLPAMGDVYCIAQSYRAEQSRTRRHLAEYTHVEAEYAFIT 354

Query: 360 FXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI 419
           F          ICD VDRVL ++    LV +L+PDF  P++PF RMDYKDAI+YL+ +NI
Sbjct: 355 FEELLDRLEDMICDVVDRVLKSKFGY-LVKELNPDFKIPRKPFKRMDYKDAIEYLQINNI 413

Query: 420 KKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVL 479
            K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RCA+D R+TESVDVL
Sbjct: 414 TKDDGTFYEFGEDIPEMPERKMTDIINEPIMLCRFPAEIKSFYMQRCADDKRLTESVDVL 473

Query: 480 IPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLA 539
           +P VGE+VGGSMRI D +ELL GY    I+P PYYWYTDQRKYGT  HGGFGLG+ERFL 
Sbjct: 474 LPNVGEIVGGSMRIWDYDELLEGYSSANIDPKPYYWYTDQRKYGTCPHGGFGLGLERFLC 533

Query: 540 WLLHRDNVKECCLYPRFMGRCLP 562
           WLL+R +++E CLYPRF+ RC P
Sbjct: 534 WLLNRYHIREACLYPRFLERCRP 556



>gi|405953092|gb|EKC20816.1| Asparaginyl-tRNA synthetase, cytoplasmic [Crassostrea gigas]
          Length = 558

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 280/452 (61%), Positives = 357/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IV+++D +LP   +IKIR SV  R  RVK+ GWVHRLR QGK++ F+VLRDG+G+LQC+ 
Sbjct: 111 IVIEEDKSLPAPKQIKIRNSVEMRDVRVKIFGWVHRLRRQGKNLMFVVLRDGTGFLQCVF 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
           +  LC TYDA++LS E+++ +YG I++LP GK APD HEL  D+WE V H  PGG D   
Sbjct: 171 SDALCQTYDAVLLSTEASICVYGKITKLPEGKVAPDGHELTVDFWELVGHSPPGGADTI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A+  +  + RH++IRGE  S VLK RS IM+AFRDHF ++G+ EV PP +VQTQ
Sbjct: 230 --LNEEANIDVQLDNRHMMIRGENTSKVLKMRSVIMQAFRDHFINRGYYEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++NY+GE+AYLTQ+SQLYLETC+PS+GDV+ I++SYRAE S TRRHL+EY+H
Sbjct: 288 VEGGSTLFKLNYFGEEAYLTQSSQLYLETCIPSMGDVFSIAQSYRAEHSRTRRHLAEYTH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FITF          +CD VDRVL N     +V +L+P+F PP+RPF R++YKDA
Sbjct: 348 IEAECPFITFDDLLNKLEDLVCDVVDRVL-NGPYGSVVKELNPNFQPPKRPFKRLEYKDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I YLK+H+IKK++G+FYEFGEDIPE PER MTDQIN+PI LC+FPAEIK+FYM+RCA+D 
Sbjct: 407 ITYLKEHDIKKDDGTFYEFGEDIPEAPERKMTDQINEPILLCKFPAEIKSFYMQRCADDR 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  EL+ G+KREGI+ T YYWYTDQRKYGT  HGG+
Sbjct: 467 RLTESVDVLMPNVGEIVGGSMRIWDHEELMEGFKREGIDTTNYYWYTDQRKYGTCPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERF+ WLL R +++E  LYPRF+ RC P
Sbjct: 527 GLGLERFMCWLLDRYHIREVTLYPRFVERCKP 558



>gi|332376021|gb|AEE63151.1| unknown [Dendroctonus ponderosae]
 gi|478258545|gb|ENN78616.1| hypothetical protein YQE_04920, partial [Dendroctonus ponderosae]
          Length = 552

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 281/452 (62%), Positives = 355/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IV+++D +LP A KI+I      R KRVK++GWVHRLR QGK++ FI LRDGSG+LQC+L
Sbjct: 105 IVIEEDKSLPAATKIRISNGQKYREKRVKLNGWVHRLRRQGKNLMFITLRDGSGFLQCIL 164

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFT 230
           + +LC TY+AL+L  ESTV ++G + ++P GKTAP  HEL  DYWE+   AP GG D+  
Sbjct: 165 SNQLCSTYNALVLQTESTVLLFGTLKQVPEGKTAPGGHELHVDYWELIGLAPPGGADSL- 223

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  E RH++IRGE  S VL+ RS +++AFRDH+  +G+ EV PP +VQTQ
Sbjct: 224 --LNEEALPDVQAENRHIMIRGENTSKVLRMRSVLLQAFRDHYLDRGYCEVTPPSIVQTQ 281

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+++Y+GE+AYLTQ+SQLYLETCLPS+GDVYCI+ES+RAE+S TRRHL+EY+H
Sbjct: 282 VEGGSTLFKLDYFGEEAYLTQSSQLYLETCLPSMGDVYCIAESFRAEQSRTRRHLAEYTH 341

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FI+F          ICD VDRVL +    ++V +L+P+F  P RPF+RM+Y DA
Sbjct: 342 VEAECPFISFNDLLDRLEDLICDVVDRVLKSPYG-EIVRELNPNFQVPTRPFMRMNYSDA 400

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I YLK+HNI KE+GSFYEFGEDIPE PER MTD+INKPI LCRFPA IK+FYM +C ED 
Sbjct: 401 IDYLKEHNITKEDGSFYEFGEDIPEMPERKMTDEINKPIMLCRFPANIKSFYMSKCPEDV 460

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GYKREGI+P PY+WYTDQRKYGT  HGG+
Sbjct: 461 RLTESVDVLLPNVGEIVGGSMRIWDSEELLEGYKREGIDPAPYFWYTDQRKYGTCPHGGY 520

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPR++  C P
Sbjct: 521 GLGLERFLCWLLNRYHIREVCLYPRYLNHCKP 552



>gi|71897197|ref|NP_001026571.1| asparaginyl-tRNA synthetase, cytoplasmic [Gallus gallus]
 gi|53132771|emb|CAG31935.1| hypothetical protein RCJMB04_13p14 [Gallus gallus]
          Length = 559

 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/565 (51%), Positives = 389/565 (68%), Gaps = 12/565 (2%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE- 57
           E + + +  + E +Y+ E  GSD T  GTQ  P+KT ++AL   G     +I V    E 
Sbjct: 4   EVIGRTAALALEELYVSEREGSDSTGDGTQKKPFKTVLKALMTAGKEPFPTIYVDSQREN 63

Query: 58  EGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQD 117
           E +  IS +                                             I++K D
Sbjct: 64  ERWAIISKSQMKNVKKLWHREQMKNEAKEKKEAEDLLRREKNLEEAKK------IIIKND 117

Query: 118 PNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
           P+LP    +KI    A RG+RVK+ GW+HRLR QGK++ FIVLRDG+G+LQC+L+  LC 
Sbjct: 118 PSLPEPKCVKIGALGAYRGQRVKIFGWIHRLRRQGKNLMFIVLRDGTGFLQCVLSDALCQ 177

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADA 237
            Y+ L+LS ES+V +YG+++ +P GK AP  HEL  DYWE+   AP G     N LN D+
Sbjct: 178 CYNGLLLSTESSVAVYGMLNLVPEGKQAPGGHELNCDYWELIGLAPAG--GADNLLNEDS 235

Query: 238 DPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTL 297
           +  +    RH++IRGE  S + K RS +++AFRDHF + G+ EV PP +VQTQVEGGSTL
Sbjct: 236 EVDVQLNNRHMMIRGENMSKIFKVRSMVVQAFRDHFFANGYYEVTPPTLVQTQVEGGSTL 295

Query: 298 FEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAF 357
           F+++Y+GE+AYLTQ+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F
Sbjct: 296 FKLDYFGEEAYLTQSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPF 355

Query: 358 ITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDH 417
           I+F          +CD VDRVL +  +  L+  L+P+F PP+RPF RM+Y +AI++LK+H
Sbjct: 356 ISFEDLLNRLESLVCDVVDRVLTSPAS-ALLLDLNPNFKPPKRPFRRMNYAEAIEWLKEH 414

Query: 418 NIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
           ++KK++G++YEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC +D+R+TESVD
Sbjct: 415 DVKKDDGTYYEFGEDIPEAPERFMTDTINEPILLCRFPAEIKSFYMQRCHDDSRLTESVD 474

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           VL+P VGE+VGGSMRI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERF
Sbjct: 475 VLMPNVGEIVGGSMRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERF 534

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           L W+L R ++++ CLYPRF+ RC P
Sbjct: 535 LTWILDRHHIRDVCLYPRFVQRCKP 559



>gi|395511543|ref|XP_003760018.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Sarcophilus
           harrisii]
          Length = 559

 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/551 (52%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +KQDPNLP A  +KI   
Sbjct: 72  SQLKNIKKIWNRERMKNESREQREAEDILRREKNLEEAKKITIKQDPNLPEAKCVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 132 EAHRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  DYWE+   AP G     N +N ++D  +    R+++IR
Sbjct: 192 VYGTLNLTPEGKQAPGGHELSCDYWELIGLAPAG--GADNLINEESDVDVQLNNRYMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPFLTFDDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     L+Y L+P F PP+RPF RM+Y DAI +LK+H++KKE+G++YEFGE
Sbjct: 370 CDVVDRVLKSPAA-SLLYDLNPTFTPPKRPFKRMNYSDAIVWLKEHDVKKEDGTYYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEELLKGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|470598025|ref|XP_004311639.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Tursiops
           truncatus]
          Length = 559

 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 379/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDTLRREKNLEEAKKITIKNDPSLPEPSCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ E++PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYCEISPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPVA-SVVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|66511652|ref|XP_623490.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Apis
           mellifera]
          Length = 556

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 293/567 (51%), Positives = 385/567 (67%), Gaps = 22/567 (3%)

Query: 6   PSVKSSET----VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTP----- 56
           P+++SSE+    +YI + NG+DET  G++  P+KT +RA+   G        K P     
Sbjct: 2   PAMESSESLLDAIYICQKNGNDETGDGSKTNPFKTILRAMNHAG--------KEPFPPIY 53

Query: 57  EEGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQ 116
           +   KD                                                 I++++
Sbjct: 54  QNSLKDDKEYELVSKSQLKKMHKIWARKEYKNEDKQKKLLEDEEKRLKNLEEAKTIIIQE 113

Query: 117 DPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELC 176
           D  LP AI IKIR+S+  R +R+KV GWVHRLR QG+ + FI LRDG+G+LQC+ T  LC
Sbjct: 114 DNTLPSAICIKIRESIKYRNQRIKVLGWVHRLRRQGRALMFITLRDGTGFLQCVFTDTLC 173

Query: 177 HTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNA 235
            TYDAL LS E+++ ++G +  +P GK APD HEL  D+W  +    PGG D+    LN 
Sbjct: 174 QTYDALTLSTEASIEVFGTLKIVPEGKNAPDGHELHIDFWRLIGTSPPGGADSI---LNE 230

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
           +A P +  + RH++IRGE  S +L+ RS + +AFRDHF  +G  EV PP +VQTQVEGGS
Sbjct: 231 EALPDVQLDNRHIMIRGENTSRILRLRSVLTQAFRDHFHERGCYEVTPPTLVQTQVEGGS 290

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF+++Y+GE+A+LTQ+SQLYLETCLP++GDVYCI++SYRAE+S TRRHL+EY+H+EAE 
Sbjct: 291 TLFKLDYFGEEAFLTQSSQLYLETCLPAMGDVYCIAQSYRAEQSRTRRHLAEYTHVEAEY 350

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
           AFITF          +CD VDRVL N     L+ +L+PDF  P+RPF RMDYKDAI+YL+
Sbjct: 351 AFITFEDLLNRLEDMVCDVVDRVL-NSNLGYLIKELNPDFKIPKRPFKRMDYKDAIEYLR 409

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
            +NI K++G+FYEFGEDIPE PER MTD IN+PI LC+FPAEIK+FYM+RCA++ R+TES
Sbjct: 410 ANNITKDDGTFYEFGEDIPEMPERKMTDTINEPIMLCKFPAEIKSFYMQRCADNKRLTES 469

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VDVL+P VGE++GGSMRI + +ELL GY    I+P PYYWYTDQRKYGT  HGGFGLG+E
Sbjct: 470 VDVLLPNVGEIIGGSMRIWNYDELLEGYSNANIDPKPYYWYTDQRKYGTCPHGGFGLGLE 529

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFL WLL+R +++E CLYPRF+ RC P
Sbjct: 530 RFLCWLLNRYHIREVCLYPRFLERCRP 556



>gi|19921528|ref|NP_609948.1| Asparaginyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 gi|442628315|ref|NP_001260561.1| Asparaginyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gi|5901824|gb|AAD55420.1|AF181634_1 BcDNA.GH06451 [Drosophila melanogaster]
 gi|7298549|gb|AAF53768.1| Asparaginyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 gi|220943736|gb|ACL84411.1| Aats-asn-PA [synthetic construct]
 gi|220953642|gb|ACL89364.1| Aats-asn-PA [synthetic construct]
 gi|440213918|gb|AGB93096.1| Asparaginyl-tRNA synthetase, isoform B [Drosophila melanogaster]
          Length = 558

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 279/452 (61%), Positives = 354/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+LP+A KI+I +  A+R  RVKV GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 111 VKISEDPSLPVARKIRIYEGTANRDSRVKVYGWVHRLRRQGKSLIFITLRDGTGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ES+V ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 171 NDQLCQTYDALTLSTESSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS + +AFR H++++G++EV PP +VQTQ
Sbjct: 230 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+GE+AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EY+H
Sbjct: 288 VEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYTH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  F+TF          +CD VDRVL +     LV +L+PDF PPQ+PF RM+Y+DA
Sbjct: 348 VEAECPFLTFDDLLDRLEDLVCDVVDRVLKSPWGY-LVKELNPDFKPPQKPFRRMNYEDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED 
Sbjct: 407 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GYKREGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 558



>gi|164657151|ref|XP_001729702.1| hypothetical protein MGL_3246 [Malassezia globosa CBS 7966]
 gi|159103595|gb|EDP42488.1| hypothetical protein MGL_3246 [Malassezia globosa CBS 7966]
          Length = 518

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 284/451 (62%), Positives = 348/451 (77%), Gaps = 1/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IV++   +   A +IKI   V +R  RVKV GWVHRLR+Q KD  F+VLRDG+GYLQC+L
Sbjct: 69  IVIEPPSDAAPAKRIKICAGVQNRDVRVKVCGWVHRLRSQ-KDRMFLVLRDGTGYLQCVL 127

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
            G L  TYDAL L+LES+V +YGVI  LP GKTAPDNHEL+ DYW     APGGDDA  N
Sbjct: 128 QGALIQTYDALTLTLESSVELYGVIKTLPEGKTAPDNHELVVDYWTCVGKAPGGDDAIMN 187

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
           +++ +ADPSIL + RHLV+RGETASA+L+ R+A++  FR  F S G  EV PPCMVQTQV
Sbjct: 188 RVSENADPSILADNRHLVLRGETASAILRVRAAVLDGFRAEFASSGMLEVTPPCMVQTQV 247

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+ +YYG+K++LTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+HL
Sbjct: 248 EGGATLFQFDYYGQKSFLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHL 307

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           E E+AF++F          IC  VDRVL ++ TR L+ QL+P F PP+RPFLR++YKDAI
Sbjct: 308 EIELAFVSFDDLLSHIEQDICGMVDRVLKDDKTRALIEQLNPGFQPPKRPFLRLNYKDAI 367

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            YL +HNI  E+G  ++ G+DI E  ER MTDQ+  PI L  FP EIKAFYMKR   D  
Sbjct: 368 AYLNEHNITNEHGEPHKIGDDIAEAAERKMTDQLGVPILLHSFPREIKAFYMKRVPGDEA 427

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TESVD+L+PGVGE+VGGSMR++  +ELL  YKREGI+P+PYYWYT+QRKYGT EHGG+G
Sbjct: 428 FTESVDLLMPGVGEIVGGSMRMTGHDELLDAYKREGIDPSPYYWYTEQRKYGTCEHGGYG 487

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVER LAWL +R  V+EC LYPR+ GRC P
Sbjct: 488 LGVERLLAWLTNRWTVRECSLYPRWTGRCTP 518



>gi|488520842|ref|XP_004452348.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform 2 [Dasypus
           novemcinctus]
          Length = 558

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 383/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  G+D T  GT+  P+K+ ++AL   G     +I V    E E ++ IS +    
Sbjct: 16  LYVSDREGNDATGDGTKERPFKSGLKALMTVGKEPFPAIYVDSQKENERWEVISKSQMKN 75

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 76  IKKMWHREQMKSESRDKKEAEDNLRREKNLEEARK------ITIKNDPSLPEPKCVKINA 129

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
             A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V
Sbjct: 130 LEAHRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSV 189

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG++S +P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 190 AVYGMLSLMPEGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 247

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 248 RGENMSKILKARSVVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 307

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLPSLGDV+C+++SYRAE+S TRRHL+EY+H+EAE  F++F          
Sbjct: 308 QSSQLYLETCLPSLGDVFCVAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDL 367

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFG
Sbjct: 368 VCDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFG 426

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 427 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 486

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKRE I+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 487 MRIWDSEEILAGYKREEIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 546

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 547 CLYPRFVQRCKP 558



>gi|395830741|ref|XP_003788477.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Otolemur
           garnettii]
          Length = 559

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 383/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E E +  IS T    
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDVISKTQMKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP A  +KI  
Sbjct: 77  IKKMWHREQMKSESREKKEAEDNFRREKNLEEAKK------ITIKNDPSLPEAKCVKISS 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V
Sbjct: 131 LKGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP +HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 191 AVYGMLNLTPKGKQAPGDHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + +  RDHF  +G+ EV PP +VQTQVEGG+TLF+++++GE+A+LT
Sbjct: 249 RGENMSKILKARSTVTRCLRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDFFGEEAFLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 309 QSSQLYLETCMPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRVEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +     +V++L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFG
Sbjct: 369 VCDVVDRVLKSPAA-SVVHELNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 428 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 488 MRIWDGEELLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFVQRCRP 559



>gi|472586898|gb|EMS24397.1| asparaginyl-trna synthetase [Rhodosporidium toruloides NP11]
          Length = 609

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/565 (53%), Positives = 383/565 (67%), Gaps = 19/565 (3%)

Query: 11  SETVYIDEVNGSDETSTGTQNAPYKTAVRALQVK-GDNISILVRKTPEEGYKDISGTXXX 69
           ++ VY+DE  G D+   G+Q  P+KT   A   +  D I++ VR+ P EG  + S     
Sbjct: 29  ADAVYVDEATGDDKDGDGSQAKPFKTVAGAYIARTSDAINVHVRQAPAEGQTEGSWAAAT 88

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI-----VLKQDPNLPLAI 124
                                                     +     ++ ++P    A 
Sbjct: 89  ASAKKKAAKLLQTHKNKLAKQEELRKREEAEGEARRAAEAKKLEEAKAIVLEEPTTE-AT 147

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           +IKIRQ+   RGKRV+V GWVHRLR QG  M F++LRDGSGYLQC+L+G L  TYDAL L
Sbjct: 148 RIKIRQATEQRGKRVRVFGWVHRLRQQGG-MTFVILRDGSGYLQCVLSGRLSQTYDALTL 206

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           +LEST+ I GVI++LP GKTAP+NHEL AD++ V   APGGDDAF N++N DADPS L +
Sbjct: 207 TLESTIQITGVINQLPEGKTAPENHELTADWFAVVGKAPGGDDAFLNQVNEDADPSQLAD 266

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RHLVIRGE ASA+LK R+A++++FR  + + G  EV PPCMVQTQVEGG+TLF  +YYG
Sbjct: 267 ARHLVIRGENASAILKVRAALLQSFRQSYANLGLLEVTPPCMVQTQVEGGATLFAFDYYG 326

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+AYLTQ+SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF    
Sbjct: 327 EQAYLTQSSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHVEAELAFLTFNDLL 386

Query: 365 XXXXXXICDTVDRVLANETTRKLV---YQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKK 421
                 IC T+DRVLA+   ++L+   +     F PP RPF+RMDY+DAI++L DHNI +
Sbjct: 387 DHIEELICQTIDRVLADPKIKELIDFLWAGKGKFEPPSRPFMRMDYRDAIKWLNDHNITR 446

Query: 422 ENGSFYE----FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
            + +  E     G+DI E  ER MTD I +PIFL  FP +IK+FYM R   D   TESVD
Sbjct: 447 PDDNGVEGPHVVGDDIAEAAERKMTDTIGRPIFLINFPKDIKSFYMSRVPGDEEYTESVD 506

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           +L+P VGE+VGGSMRISD++ELLA YKREGI+P PYYW+TDQRKYGT+ HGG+GLG+ER 
Sbjct: 507 LLMPNVGEIVGGSMRISDLDELLAAYKREGIDPEPYYWFTDQRKYGTSPHGGYGLGLERL 566

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           LAWLL+R  V+EC LYP    RC+P
Sbjct: 567 LAWLLNRYTVRECSLYP----RCIP 587



>gi|488520840|ref|XP_004452347.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform 1 [Dasypus
           novemcinctus]
          Length = 559

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 383/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  G+D T  GT+  P+K+ ++AL   G     +I V    E E ++ IS +    
Sbjct: 17  LYVSDREGNDATGDGTKERPFKSGLKALMTVGKEPFPAIYVDSQKENERWEVISKSQMKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 77  IKKMWHREQMKSESRDKKEAEDNLRREKNLEEARK------ITIKNDPSLPEPKCVKINA 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
             A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V
Sbjct: 131 LEAHRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG++S +P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 191 AVYGMLSLMPEGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 249 RGENMSKILKARSVVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLPSLGDV+C+++SYRAE+S TRRHL+EY+H+EAE  F++F          
Sbjct: 309 QSSQLYLETCLPSLGDVFCVAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFG
Sbjct: 369 VCDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 428 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKRE I+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 488 MRIWDSEEILAGYKREEIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFVQRCKP 559



>gi|392882636|gb|AFM90150.1| asparaginyl-tRNA synthetase, cytoplasmic-like protein
           [Callorhinchus milii]
          Length = 560

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 296/557 (53%), Positives = 386/557 (69%), Gaps = 14/557 (2%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGT 66
           S + +Y+ +  G D   TGT+  P+KTA++AL   G     +I V    E E +  IS T
Sbjct: 14  SLDELYVSDREGDDSAGTGTKEKPFKTALQALIAFGKEPLPTIYVDSQKEGERWDVISNT 73

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        +V+K DP+LP    +
Sbjct: 74  QLKNLKKLCQRGQVKNETAAQKEIEDALRREKNLEEARK------VVIKLDPSLPEPKLV 127

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KIR + A RG+RVK+ GW+HRLR QGK++ F++LRDG+G+LQC+L+ ELC  Y+AL+LS 
Sbjct: 128 KIRDTEAHRGERVKIFGWIHRLRRQGKNLMFVILRDGTGFLQCVLSDELCQCYNALVLST 187

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG +  +P GK AP  HEL+ DYWE+   AP GG D   N LN ++D  +    
Sbjct: 188 ESSVALYGTLKIVPEGKMAPGGHELICDYWELIGLAPPGGAD---NLLNEESDVDVQLNN 244

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH+++RGE  S + K RSA+++ FRDH+  +G+ E+ PP +VQTQVEGGSTLF+MNY+GE
Sbjct: 245 RHMMLRGENMSKIFKVRSALIQCFRDHYFDRGYFEITPPTLVQTQVEGGSTLFKMNYFGE 304

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+E E AFIT+     
Sbjct: 305 EAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHIEGECAFITYDDLLN 364

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDR+L +     LV +LHP+F PP+RPF RM+Y DAI +LK+H+ KKE+G+
Sbjct: 365 RLEDLVCDVVDRILKSPFG-DLVRELHPEFQPPKRPFRRMNYTDAITWLKEHDYKKEDGT 423

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE
Sbjct: 424 FYEFGEDIPEAPERMMTDAINEPILLCRFPAEIKSFYMERCPEDRRLTESVDVLMPNVGE 483

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI D +E L GYKREGI+ TPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R 
Sbjct: 484 IVGGSMRIWDSDERLEGYKREGIDCTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRH 543

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++  LYPRF+ RC P
Sbjct: 544 HIRDVVLYPRFVQRCKP 560



>gi|195484386|ref|XP_002090672.1| GE12667 [Drosophila yakuba]
 gi|194176773|gb|EDW90384.1| GE12667 [Drosophila yakuba]
          Length = 558

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 279/452 (61%), Positives = 353/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+LPLA KI+I +  A+R  RVK+ GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 111 VKISEDPSLPLARKIRIVEGTANRDSRVKIYGWVHRLRRQGKSLIFITLRDGTGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ES+V ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 171 NDQLCQTYDALTLSTESSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS + +AFR H++++G++EV PP +VQTQ
Sbjct: 230 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRAHYEARGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+GE+AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EYSH
Sbjct: 288 VEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYSH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  F+TF          +CD VDRVL +     LV +L+PDF PPQ+PF RM+Y+DA
Sbjct: 348 VEAECPFLTFDDLLDRLEDLVCDVVDRVLKSPWGY-LVKELNPDFKPPQKPFRRMNYEDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED 
Sbjct: 407 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GY REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYAREGIDPKPYYWYTDQRVYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 558



>gi|195345035|ref|XP_002039081.1| GM17026 [Drosophila sechellia]
 gi|194134211|gb|EDW55727.1| GM17026 [Drosophila sechellia]
          Length = 558

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 278/452 (61%), Positives = 354/452 (78%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+LP+A +I+I +  A+R  RVKV GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 111 VKISEDPSLPVARRIRILEGTANRDSRVKVYGWVHRLRRQGKSLIFITLRDGTGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ES+V ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 171 NDQLCQTYDALTLSTESSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGSAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS + +AFR H++++G++EV PP +VQTQ
Sbjct: 230 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRAHYEARGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+GE+AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EYSH
Sbjct: 288 VEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYSH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE +F+TF          +CD VDRVL +     LV +L+PDF PPQ+PF RM+Y+DA
Sbjct: 348 VEAECSFLTFDELLDRLEDLVCDVVDRVLKSPWG-YLVKELNPDFKPPQKPFRRMNYEDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED 
Sbjct: 407 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GY REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYAREGIDPQPYYWYTDQRVYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 558



>gi|195580101|ref|XP_002079894.1| GD21774 [Drosophila simulans]
 gi|194191903|gb|EDX05479.1| GD21774 [Drosophila simulans]
          Length = 558

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 295/556 (53%), Positives = 385/556 (69%), Gaps = 16/556 (2%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILV-RKTPE--EGYKDISGTX 67
            ++  E  GSDE+  G+++ P+KT ++A++  G     +I V  K P   E Y+  + + 
Sbjct: 13  AIFTSEKKGSDESGDGSESKPFKTILQAMRHAGKEPFPTIYVDTKDPNAAEPYEPAAKSQ 72

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       + + +DP+LP+A +I+
Sbjct: 73  LKKIQKLFVRESHKNAEKQQREAEDAEKRQQNLEDARK------VKISEDPSLPVARRIR 126

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I +  A+R  RVKV GWVHRLR QGK + FI LRDG+G+LQC+L  +LC TYDAL LS E
Sbjct: 127 ILEGTANRDSRVKVYGWVHRLRRQGKSLIFITLRDGTGFLQCVLNDQLCQTYDALTLSTE 186

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQR 246
           S+V ++G +  +P GKTAP  HEL  DYWE +    PGG DA    LN +A P +  + R
Sbjct: 187 SSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGPAPPGGADAI---LNEEAQPDVQLDNR 243

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           H++IRGE  S VLK RS + +AFR H++++G++EV PP +VQTQVEGGSTLF++ Y+GE+
Sbjct: 244 HIMIRGENTSKVLKMRSVVTQAFRAHYEARGYNEVTPPTLVQTQVEGGSTLFKLKYFGEE 303

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDV+ IS+SYRAE+S TRRHL+EYSH+EAE  F+TF      
Sbjct: 304 AYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYSHVEAECPFLTFDELLDR 363

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               +CD VDRVL +     LV +L+PDF PPQ+PF RM+Y+DAI++LK++N+ K++G+F
Sbjct: 364 LEDLVCDVVDRVLKSPWG-YLVKELNPDFKPPQKPFRRMNYEDAIKWLKENNVTKDDGTF 422

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           YEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+
Sbjct: 423 YEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQRLTESVDVLLPNVGEI 482

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
           VGGSMRI D  ELL GY REGI+P PYYWYTDQR YGT  HGG+GLG+ERFL WLL+R +
Sbjct: 483 VGGSMRIYDSEELLKGYAREGIDPQPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNRYH 542

Query: 547 VKECCLYPRFMGRCLP 562
           ++E CLYPRF+ RC P
Sbjct: 543 IREVCLYPRFLDRCRP 558



>gi|505773863|ref|XP_004601765.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Sorex araneus]
          Length = 559

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    DI        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDI-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIKKLWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPTCVKIHSL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELLGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +L+ARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILRARSVVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLSRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDARLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|387914232|gb|AFK10725.1| asparaginyl-tRNA synthetase-like protein [Callorhinchus milii]
          Length = 560

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 295/557 (52%), Positives = 386/557 (69%), Gaps = 14/557 (2%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGT 66
           S + +Y+ +  G D   TGT+  P+KTA++AL   G     +I V    E E +  IS T
Sbjct: 14  SLDELYVSDREGDDSAGTGTKEKPFKTALQALTAFGKEPFPTIYVDSQKEGERWDVISNT 73

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        +V+K DP+LP    +
Sbjct: 74  QLKNLKKLCQRGQVKNETAAQKEIEDALRREKNLEEARK------VVIKLDPSLPEPKLV 127

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KIR + A RG+RVK+ GW+ RLR QGK++ F++LRDG+G+LQC+L+ ELC  Y+AL+LS 
Sbjct: 128 KIRDTEAHRGERVKIFGWIRRLRRQGKNLMFVILRDGTGFLQCVLSDELCQCYNALVLST 187

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG +  +P GK AP  HEL+ DYWE+   AP GG D   N LN ++D  +    
Sbjct: 188 ESSVALYGTLKIVPEGKMAPGGHELICDYWELIGLAPPGGAD---NLLNEESDVDVQLNN 244

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH+++RGE  S + K RSA+++ FRDH+  +G+ E+ PP +VQTQVEGGSTLF+MNY+GE
Sbjct: 245 RHMMLRGENMSKIFKVRSALIQCFRDHYFDRGYFEITPPTLVQTQVEGGSTLFKMNYFGE 304

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+E E AFIT+     
Sbjct: 305 EAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHIEGECAFITYDDLLN 364

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDR+L +     LV +LHP+F PP+RPF +M+Y DAI +LK+H+ KKE+G+
Sbjct: 365 RLEDLVCDVVDRILKSPFG-DLVRELHPEFQPPKRPFRKMNYTDAITWLKEHDYKKEDGT 423

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE
Sbjct: 424 FYEFGEDIPEAPERMMTDAINEPILLCRFPAEIKSFYMERCPEDRRLTESVDVLMPNVGE 483

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI D +ELL GYKREGI+ TPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R 
Sbjct: 484 IVGGSMRIWDSDELLEGYKREGIDCTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRH 543

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++  LYPRF+ RC P
Sbjct: 544 HIRDVVLYPRFVQRCKP 560



>gi|392882842|gb|AFM90253.1| asparaginyl-tRNA synthetase, cytoplasmic-like protein
           [Callorhinchus milii]
          Length = 560

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 295/557 (52%), Positives = 386/557 (69%), Gaps = 14/557 (2%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGT 66
           S + +Y+ +  G D   TGT+  P+KTA++AL   G     +I V    E E +  IS T
Sbjct: 14  SLDELYVSDREGDDSAGTGTKEKPFKTALQALIAFGKEPLPTIYVDSQKEGERWDVISNT 73

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        +V+K DP+LP    +
Sbjct: 74  QLKNLKKLCQRGQVKNETAAQKEIEDALRREKNLEEARK------VVIKLDPSLPEPKLV 127

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KIR + A RG+RVK+ GW+HRLR QGK++ F++LRDG+G+LQC+L+ ELC  Y+AL+LS 
Sbjct: 128 KIRDTEAHRGERVKIFGWIHRLRRQGKNLMFVILRDGTGFLQCVLSDELCQCYNALVLST 187

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG +  +P GK AP  HEL+ DYWE+   AP GG D   N LN ++D  +    
Sbjct: 188 ESSVALYGTLKIVPEGKMAPGGHELICDYWELIGLAPPGGAD---NLLNEESDVDVQLNN 244

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH+++RGE  S + K RSA+++ FRDH+  +G+ E+ PP +VQTQVEGGSTLF+MNY+GE
Sbjct: 245 RHMMLRGENMSKIFKVRSALIQCFRDHYFDRGYFEITPPTLVQTQVEGGSTLFKMNYFGE 304

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S T RHL+EY+H+E E AFIT+     
Sbjct: 305 EAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTHRHLAEYTHIEGECAFITYDDLLN 364

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDR+L +     LV +LHP+F PP+RP+ RM+Y DAI +LK+H+ KKE+G+
Sbjct: 365 RLEDLVCDVVDRILKSPFG-DLVRELHPEFQPPKRPYRRMNYTDAITWLKEHDYKKEDGT 423

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE
Sbjct: 424 FYEFGEDIPEAPERMMTDAINEPILLCRFPAEIKSFYMERCPEDRRLTESVDVLMPNVGE 483

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI D +ELL GYKREGI+ TPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R 
Sbjct: 484 IVGGSMRIWDSDELLEGYKREGIDCTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRH 543

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++  LYPRF+ RC P
Sbjct: 544 HIRDVVLYPRFVQRCKP 560



>gi|444732531|gb|ELW72821.1| Asparaginyl-tRNA synthetase, cytoplasmic [Tupaia chinensis]
          Length = 559

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   + +K DP+LP    +KI + 
Sbjct: 72  SQMKNIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKVTIKNDPSLPAPECVKIHKL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCLCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNVINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S + KARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKIFKARSMVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|350422932|ref|XP_003493333.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Bombus
           impatiens]
          Length = 556

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 297/563 (52%), Positives = 387/563 (68%), Gaps = 14/563 (2%)

Query: 6   PSVKSS----ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGY 60
           P ++SS    + +Y  +  G+DET  GT   P+KT +RA++  G +      + + E+G 
Sbjct: 2   PVMESSKPLLDAIYTSQKYGNDETGNGTDTNPFKTILRAMRYVGKEPFPPFYQDSNEDGK 61

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
           K +                                                I++++D  L
Sbjct: 62  KYV----IVSKSQFKKAQKIWARNEYKNEDKQKKLLEDEEKRLKNLEEAKTIIIQEDTTL 117

Query: 121 PLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYD 180
             AI IKIR S+  R +RVK+ GWVHRLR QG+ + FI LRDG+G+LQC+L+  LC TY+
Sbjct: 118 SPAICIKIRDSIYHRDQRVKLFGWVHRLRRQGRALMFITLRDGTGFLQCVLSNILCQTYN 177

Query: 181 ALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADP 239
           AL LS E+++ I+G +  +P GK AP+ HEL  DYW  +    PGG D+    LN +A P
Sbjct: 178 ALTLSTEASIEIFGTLKIVPEGKNAPNGHELHVDYWRLIGTSPPGGADSI---LNEEALP 234

Query: 240 SILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFE 299
            +  + RH++IRGE  S VL  RS +M+AFRDHF+ KG+SEV PP +VQTQVEGGSTLF+
Sbjct: 235 DVQLDNRHIMIRGENTSRVLLVRSVLMQAFRDHFNEKGYSEVTPPTLVQTQVEGGSTLFK 294

Query: 300 MNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFIT 359
           ++Y+GE+A+LTQ+SQLYLETCLP++GDVYCI++SYRAE+S TRRHL+EY+H+EAE AFIT
Sbjct: 295 LDYFGEEAFLTQSSQLYLETCLPAMGDVYCIAQSYRAEQSRTRRHLAEYTHVEAEYAFIT 354

Query: 360 FXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI 419
           F          ICD VDRVL ++    LV +L+PDF  P++PF RMDYKDAI+YL+ +NI
Sbjct: 355 FEELLDRLEDMICDVVDRVLKSKFGY-LVKELNPDFKIPRKPFKRMDYKDAIEYLQINNI 413

Query: 420 KKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVL 479
            K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RCA+D R+TESVDVL
Sbjct: 414 TKDDGTFYEFGEDIPEMPERKMTDIINEPIMLCRFPAEIKSFYMQRCADDKRLTESVDVL 473

Query: 480 IPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLA 539
           +P VGE+VGGSMRI D +ELL GY    I+P PYYWYTDQRKYGT  HGGFGLG+ERFL 
Sbjct: 474 LPNVGEIVGGSMRIWDYDELLEGYSSANIDPKPYYWYTDQRKYGTCPHGGFGLGLERFLC 533

Query: 540 WLLHRDNVKECCLYPRFMGRCLP 562
           WLL+R +++E CLYPRF+ RC P
Sbjct: 534 WLLNRYHIREACLYPRFLERCRP 556



>gi|432101403|gb|ELK29585.1| Asparaginyl-tRNA synthetase, cytoplasmic [Myotis davidii]
          Length = 559

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I ++ DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIENDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|50284857|ref|XP_444856.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524158|emb|CAG57749.1| unnamed protein product [Candida glabrata]
          Length = 548

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 299/551 (54%), Positives = 377/551 (68%), Gaps = 5/551 (0%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXX 71
           +VYI EV G DET   GTQ  P+KTA  AL        + V K  +  Y++IS +     
Sbjct: 2   SVYIHEVKGVDETGVAGTQEQPFKTAAFALFCSETEPKLFVYKEADGEYQEISASALKKA 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +++D +LP A K KI QS
Sbjct: 62  RKGCEGLKKKAIKQKEQDAKKQQQDADNAAKQMAALN---IKIEEDKSLPEAKKCKIGQS 118

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
               G+RVK+SGW+HRLR+  K M FIVLRDG GYLQ +LTG+L     +L L++ESTVT
Sbjct: 119 YELVGQRVKISGWIHRLRSNKKVM-FIVLRDGYGYLQSVLTGDLAIAQQSLDLTIESTVT 177

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG I+++P GK+AP   ELL DY+EV   AP GD+AFTNK+   ADPS+L +QRHL +R
Sbjct: 178 LYGTITKVPEGKSAPGGVELLVDYYEVVGLAPSGDEAFTNKIAEGADPSLLLDQRHLALR 237

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GET SAV+K R+A+MK+ R  +  +  +EV PPCMVQTQVEGGSTLF+++YYGE+AYLTQ
Sbjct: 238 GETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGSTLFKLDYYGEQAYLTQ 297

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF          +
Sbjct: 298 SSQLYLETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLDHIERVL 357

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           C TV  +L +     LV QL+PDF  P+ PF+R++YKDAI++LK+H+IK E+G  ++FG+
Sbjct: 358 CKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEWLKEHDIKNEDGEEFKFGD 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DI E  ER MTD I  PI L +FPAEIK+FYM RC +DNRVTESVDVL+P VGE+ GGSM
Sbjct: 418 DIAEAAERKMTDTIGVPILLTKFPAEIKSFYMPRCKDDNRVTESVDVLMPTVGEITGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI+   ELLAG+KRE I+P  YYW+ DQRKYGT  HGG+GLG ER LAWL +R  V++C 
Sbjct: 478 RINTEEELLAGFKRENIDPKAYYWFIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCS 537

Query: 552 LYPRFMGRCLP 562
           LYPRF GRC P
Sbjct: 538 LYPRFSGRCKP 548



>gi|504133962|ref|XP_004579528.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X1
           [Ochotona princeps]
          Length = 559

 Score =  605 bits (1561), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  G++  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGSDATGDGSKEKPFKTGLKALLTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQMKNESREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P++GDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPAMGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEMLAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCRP 559



>gi|149721122|ref|XP_001488269.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Equus
           caballus]
          Length = 559

 Score =  605 bits (1560), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K D +LP    +KI   
Sbjct: 72  SQMKNIRKIWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDASLPEPKCVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGRRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF++NY+GE+A+LTQ
Sbjct: 250 GENMSKILKARCIVTRCFRDHFFDRGYCEVTPPTLVQTQVEGGATLFKLNYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EYSH+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYSHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAILWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCTP 559



>gi|91091536|ref|XP_970641.1| PREDICTED: similar to Asparaginyl-tRNA synthetase CG10687-PA
           [Tribolium castaneum]
 gi|270000923|gb|EEZ97370.1| hypothetical protein TcasGA2_TC011193 [Tribolium castaneum]
          Length = 550

 Score =  605 bits (1560), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/557 (52%), Positives = 380/557 (68%), Gaps = 9/557 (1%)

Query: 7   SVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGT 66
           S  S   +Y  E  G+D++  GT++ P++T +RA++  G     ++    +EG K     
Sbjct: 2   SGDSGNPIYTSEKTGNDDSGLGTEDKPFQTILRAMRHAGAEPFPVIYVDGKEGTK----Y 57

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I L +D +LP A  I
Sbjct: 58  EPASKSQLKKIQKIWLRETYKQSSVAKREEEDAAKREKNLEEATKITLTEDKSLPAAKLI 117

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KI +    R +RVK+ GWVHRLR QGK++ FI LRDG+G+LQ +LT +LC TY+AL+LS 
Sbjct: 118 KIAKGKEFRDQRVKIYGWVHRLRRQGKNLMFITLRDGTGFLQSVLTDKLCQTYNALVLST 177

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG + ++P GKTAP  HEL  DYWE V    PGG D+    LN  A P +  E 
Sbjct: 178 ESSVLLYGSLKKVPEGKTAPGGHELAVDYWELVGLAPPGGADSI---LNEQALPDVQAEN 234

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH++IRGE  S +L+ RS +++AFRDH+  +G+ EV PP +VQTQ EGGSTLF+M+Y+GE
Sbjct: 235 RHIMIRGENTSKILRMRSVLLQAFRDHYLDRGYCEVTPPSIVQTQCEGGSTLFKMDYFGE 294

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETCLPS+GDV+CI+ES+RAE+S TRRHL+EY+H+EAE  FI+F     
Sbjct: 295 EAYLTQSSQLYLETCLPSMGDVFCIAESFRAEQSRTRRHLAEYTHVEAECPFISFNDLLD 354

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                ICD VDRVL +     +V++L+PDF  P RPFLRM+Y DAI YLK +NI KE+GS
Sbjct: 355 RLEDLICDVVDRVLKSPYG-DIVHELNPDFQVPTRPFLRMNYSDAIDYLKKNNITKEDGS 413

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTDQINKPI LCRFPA IK+FYM +C ED R+TESVDVL+P VGE
Sbjct: 414 FYEFGEDIPEMPERKMTDQINKPIMLCRFPANIKSFYMSKCPEDARLTESVDVLLPNVGE 473

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI ++ EL+ GYKREGI+PTPY+WYTDQRKYGT  HGG+GLG+ERF+ WLL+R 
Sbjct: 474 IVGGSMRIHNLEELMDGYKREGIDPTPYFWYTDQRKYGTCPHGGYGLGLERFVCWLLNRY 533

Query: 546 NVKECCLYPRFMGRCLP 562
           +++E CLYPR++  C P
Sbjct: 534 HIREVCLYPRYLHHCKP 550



>gi|504133964|ref|XP_004579529.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X2
           [Ochotona princeps]
          Length = 558

 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  G++  P+KT ++AL   G     +I V    E    D+        
Sbjct: 16  LYVSDREGSDATGDGSKEKPFKTGLKALLTVGKEPFPTIYVDSQKENERWDV-----ISK 70

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 71  SQMKNIRKMWHREQMKNESREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPKCVKIHAL 130

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 131 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 190

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 191 VYGMLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 248

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 249 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 308

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P++GDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 309 SSQLYLETCIPAMGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 368

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 369 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 427

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 428 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 487

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 488 RIWDSEEMLAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 547

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 548 LYPRFVQRCRP 558



>gi|380017127|ref|XP_003692514.1| PREDICTED: LOW QUALITY PROTEIN: asparagine--tRNA ligase,
           cytoplasmic-like [Apis florea]
          Length = 556

 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 292/563 (51%), Positives = 388/563 (68%), Gaps = 14/563 (2%)

Query: 6   PSVKSSET----VYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGY 60
           P+++SSE+    +YI + NG+DET  G++  P+KT +RA+   G +    + + +P    
Sbjct: 2   PAMESSESLLDAIYISQKNGNDETGDGSKTNPFKTILRAMCHAGKEPFPPIYQNSP---- 57

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
           KD                                                 I++++D  L
Sbjct: 58  KDDKEYELVSKSQLKKVHKIWARKEYKNEDNXKKLLEDEEKRLKNLEEAKTIIIQEDNTL 117

Query: 121 PLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYD 180
           P AI IKIR+S+  R +RVK+ GWVHRLR QG+ + FI LRDG+G+LQC+ T  LC  YD
Sbjct: 118 PSAICIKIRESIKYRDQRVKLLGWVHRLRRQGRALMFITLRDGTGFLQCVFTDTLCQIYD 177

Query: 181 ALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADP 239
           AL LS E+++ ++G +  +P GK APD HEL  D+W+ +    PGG D+    LN +A P
Sbjct: 178 ALTLSTEASIEVFGTLKIVPEGKNAPDGHELHVDFWKLIGTSPPGGADSI---LNEEALP 234

Query: 240 SILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFE 299
            +  + RH++IRGE  S +L+ RS + +AFRDHF+ +G  EV PP +VQTQVEGGSTLF+
Sbjct: 235 DVQLDNRHIMIRGENTSRILRLRSVLTQAFRDHFNERGCYEVTPPTLVQTQVEGGSTLFK 294

Query: 300 MNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFIT 359
           ++Y+GE+A+LTQ+SQLYLETCLP++GDVYCI++SYRAE+S TRRHL+EY+H+EAE AFIT
Sbjct: 295 LDYFGEEAFLTQSSQLYLETCLPAMGDVYCIAQSYRAEQSRTRRHLAEYTHVEAEYAFIT 354

Query: 360 FXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI 419
           F          ICD VDRVL N     LV +L+PDF  P+RPF RMDYKDAI+YL+ +NI
Sbjct: 355 FEDLLNRLEDMICDVVDRVL-NSNLGYLVKELNPDFKIPKRPFKRMDYKDAIEYLRANNI 413

Query: 420 KKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVL 479
            K++G+FYEFGEDIPE PER MTD IN+PI LC+FPAEIK+FYM+RC+++ R+TESVDVL
Sbjct: 414 TKDDGTFYEFGEDIPEMPERKMTDTINEPIMLCKFPAEIKSFYMQRCSDNKRLTESVDVL 473

Query: 480 IPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLA 539
           +P VGE++GGSMR  + +ELL GY    I+P PYYWYTDQRKYGT  HGGFGLG+ERFL 
Sbjct: 474 LPNVGEIIGGSMRTWNYDELLEGYSNANIDPKPYYWYTDQRKYGTCPHGGFGLGLERFLC 533

Query: 540 WLLHRDNVKECCLYPRFMGRCLP 562
           WLL+R +++E CLYPRF+ RC P
Sbjct: 534 WLLNRYHIREVCLYPRFLERCRP 556



>gi|114052923|ref|NP_001040037.1| asparagine--tRNA ligase, cytoplasmic [Bos taurus]
 gi|193806383|sp|Q2KJG3.3|SYNC_BOVIN RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|86823811|gb|AAI05359.1| Asparaginyl-tRNA synthetase [Bos taurus]
          Length = 559

 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDVTGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+R+KV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 KGYRGQRIKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YGV++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGVLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVITRCFRDHFFDRGYHEITPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-NIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|402903191|ref|XP_003914461.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Papio anubis]
          Length = 558

 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/552 (52%), Positives = 379/552 (68%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 16  LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 75

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP LP    +KI  
Sbjct: 76  IKKMWHREQMKTESREKKEAEDSLRREKNLEEAKK------ITIKNDPALPEPKCVKISA 129

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 130 LGGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 189

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 190 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 247

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS I + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 248 RGENMSKILKARSMITRCFRDHFFDRGYHEVTPPSLVQTQVEGGATLFKLDYFGEEAFLT 307

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+C+++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 308 QSSQLYLETCLPALGDVFCVAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 367

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +VY+L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEFG
Sbjct: 368 VCDVVDRILKSPAG-SIVYELNPNFQPPKRPFKRMNYSDAIIWLKEHDIKKEDGTFYEFG 426

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 427 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 486

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MR SD  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 487 MRSSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 546

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 547 CLYPRFVQRCTP 558



>gi|507647239|ref|XP_004703067.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Echinops telfairi]
          Length = 548

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G D T  GTQ  P+KT ++AL   G     +I V    E    D+        
Sbjct: 6   LYVSDREGDDATGDGTQGKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 60

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 61  SQMKNIRKLWHKEQMKSESREKKEVEDTLRREKNLEEARKITIKNDPSLPEPKCVKIDAL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F+VLRDGSG+LQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 121 EAHRGRRVKVFGWVHRLRRQGKNLMFLVLRDGSGFLQCILSDELCQCYNGMVLSTESSVA 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH+++R
Sbjct: 181 VYGMLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMLR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GET S ++KARS + + FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE A+LTQ
Sbjct: 239 GETMSRIMKARSMVTRCFREHFFDRGYCEVTPPTLVQTQVEGGSTLFKLDYFGEMAFLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+T+          +
Sbjct: 299 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTYEELLDRLEDLV 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V+ L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 359 CDVVDRVLKSPVA-SVVFDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP  IK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 418 DIPEAPERLMTDTINEPILLCRFPVNIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 478 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 537

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 538 LYPRFVQRCKP 548



>gi|478496585|ref|XP_004422631.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Ceratotherium
           simum simum]
          Length = 559

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPECVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVLLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF++NY+GE+A+LTQ
Sbjct: 250 GENMSKILKARCIVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLNYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EYSH+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPTLGDVFCIAQSYRAEQSRTRRHLAEYSHVEAECPFVTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD V+RVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVERVLKSPAG-SIVYDLNPNFKPPKRPFRRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEELLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCTP 559



>gi|432889274|ref|XP_004075195.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Oryzias
           latipes]
          Length = 559

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 285/549 (51%), Positives = 376/549 (68%), Gaps = 6/549 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +Y+ +  GSD+   G++  P+KT ++AL   G      V     +  KD           
Sbjct: 17  LYVSDKCGSDQDGDGSEQKPFKTPLKALLFAGKEPFPTVYV---DSQKDGERWAVISKTQ 73

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 I ++ DP+LP    +KIR    
Sbjct: 74  MKNAKKAFNREQLKSDSKEKKEAEDIERREKNMEEAKKITIENDPSLPAPETVKIRHLEE 133

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            RG+RVKV GWVHRLR QGK++ FIVLRDG+G+LQC+L+ +LC  Y+ L+LS ES+V +Y
Sbjct: 134 KRGQRVKVFGWVHRLRRQGKNLMFIVLRDGTGFLQCVLSDKLCQCYNGLMLSTESSVVLY 193

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G I+ +P GK AP  HEL  D+WE+   AP G     N LN ++D  +    RH++IRGE
Sbjct: 194 GTINAVPEGKQAPGGHELHCDFWELIGLAPAG--GADNLLNEESDVDVQLNNRHMMIRGE 251

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
             S +L+ RS + + FRDHF S+G+ E+ PP +VQTQVEGGSTLF +NY+GE+AYLTQ+S
Sbjct: 252 NVSKILRVRSTVTQCFRDHFFSRGYYEITPPTLVQTQVEGGSTLFNLNYFGEEAYLTQSS 311

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETC+P+LGD +CI++SYRAE+S TRRHL+EY+H+EAE  FITF          +CD
Sbjct: 312 QLYLETCIPALGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFITFEDLLNRLEDLVCD 371

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDI 433
            VDRVL +    +L+Y ++P+F PP+RPF RM+Y +AI++LK+H++KK++GS+YEFGEDI
Sbjct: 372 VVDRVLKSPAG-QLLYDINPNFQPPKRPFKRMNYTEAIEWLKEHDVKKDDGSYYEFGEDI 430

Query: 434 PEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRI 493
           PE PER MTD IN+ I LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+VGGSMRI
Sbjct: 431 PEAPERQMTDAINETILLCRFPAEIKSFYMQRCPEDRRLTESVDVLMPNVGEIVGGSMRI 490

Query: 494 SDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLY 553
            D +ELL GYKREGI+PTPYYWYTDQRKYGT  HGG+GLG++RFL WLL+R ++++ CLY
Sbjct: 491 WDSDELLDGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLDRFLTWLLNRHHIRDVCLY 550

Query: 554 PRFMGRCLP 562
           PRF+ RC P
Sbjct: 551 PRFIQRCRP 559



>gi|507541655|ref|XP_004654825.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X1 [Jaculus
           jaculus]
          Length = 559

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    DI        
Sbjct: 17  LYVSDREGNDATGDGTKERPFKTGLKALMTIGKEPFPTIYVDSQKENERWDI-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DPNLP   ++KI   
Sbjct: 72  SQMKNIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKNDPNLPEPTRVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGFRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVV 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YGV++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGVLNLTPRGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FR+HF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSEVTRCFREHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFRRMNYSDAIVWLKEHDVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+T+SVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTQSVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RTWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|507541657|ref|XP_004654826.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X2 [Jaculus
           jaculus]
          Length = 558

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 378/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    DI        
Sbjct: 16  LYVSDREGNDATGDGTKERPFKTGLKALMTIGKEPFPTIYVDSQKENERWDI-----ISK 70

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DPNLP   ++KI   
Sbjct: 71  SQMKNIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKNDPNLPEPTRVKICAL 130

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 131 EGFRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVV 190

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YGV++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 191 VYGVLNLTPRGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 248

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FR+HF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 249 GENMSKILKARSEVTRCFREHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 308

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F          +
Sbjct: 309 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDLV 368

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFGE
Sbjct: 369 CDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFRRMNYSDAIVWLKEHDVKKEDGTFYEFGE 427

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+T+SVDVL+P VGE+VGGSM
Sbjct: 428 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTQSVDVLMPNVGEIVGGSM 487

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 488 RTWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 547

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 548 LYPRFVQRCKP 558



>gi|296473717|tpg|DAA15832.1| TPA: asparaginyl-tRNA synthetase [Bos taurus]
          Length = 559

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDVTGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+R+KV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 KGYRGQRIKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVITRCFRDHFFDRGYHEITPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-NIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|4758762|ref|NP_004530.1| asparagine--tRNA ligase, cytoplasmic [Homo sapiens]
 gi|3915059|sp|O43776.1|SYNC_HUMAN RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|2764505|emb|CAA04008.1| asparaginyl-tRNA synthetase [Homo sapiens]
 gi|3894218|dbj|BAA34600.1| Asparaginyl tRNA Synthetase [Homo sapiens]
 gi|12804549|gb|AAH01687.1| Asparaginyl-tRNA synthetase [Homo sapiens]
 gi|119583452|gb|EAW63048.1| asparaginyl-tRNA synthetase, isoform CRA_a [Homo sapiens]
 gi|261859390|dbj|BAI46217.1| asparaginyl-tRNA synthetase [synthetic construct]
          Length = 548

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 6   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 65

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 66  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKIGA 119

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 120 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 180 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 238 RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 298 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +V++L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 358 VCDVVDRILKSPAG-SIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFG 416

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 417 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 476

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 477 MRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 536

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 537 CLYPRFVQRCTP 548



>gi|403268030|ref|XP_003926092.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Saimiri
           boliviensis boliviensis]
          Length = 548

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ E  G D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 6   LYVSEREGDDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 60

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 61  SQMKNIKKMWHREQMKSDSRDKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKINAL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+G+LQC+L  ELC  Y+ ++LS ES+V 
Sbjct: 121 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLADELCLCYNGVLLSTESSVA 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 181 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S + +ARS I + FRDHF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+A+LTQ
Sbjct: 239 GENMSKIFRARSMITRCFRDHFFDRGYCEVAPPTLVQTQVEGGSTLFKLDYFGEEAFLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F          +
Sbjct: 299 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDLV 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 359 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 418 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 478 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 537

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 538 LYPRFVQRCKP 548



>gi|119583453|gb|EAW63049.1| asparaginyl-tRNA synthetase, isoform CRA_b [Homo sapiens]
          Length = 547

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 5   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 64

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 65  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKIGA 118

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 119 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 178

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 179 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 236

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 237 RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 296

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 297 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 356

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +V++L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 357 VCDVVDRILKSPAG-SIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFG 415

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 416 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 475

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 476 MRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 535

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 536 CLYPRFVQRCTP 547



>gi|345569198|gb|EGX52066.1| hypothetical protein AOL_s00043g456 [Arthrobotrys oligospora ATCC
           24927]
          Length = 581

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/572 (52%), Positives = 374/572 (65%), Gaps = 13/572 (2%)

Query: 3   LQKPSVKSSETVYIDEVNGSDETST-GTQNAPYKTAVRALQV----------KGDNISIL 51
           L+  S+   E +YIDE  G D T    +Q  PYKT + AL +          +     + 
Sbjct: 11  LEGLSIAHPEIIYIDEDGGVDSTDIPNSQETPYKTLLFALSLLPPPTTTFHTRKSKTVVP 70

Query: 52  VRKTPEEGYKDISGTXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 110
             + P   YK +S T                                             
Sbjct: 71  PAEEPSLEYKPVSPTALKKSKKLHEAAVRKAAKEAAGAAQREKEVAEKAEKERLKLEAAK 130

Query: 111 XIVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCL 170
             VLK+D +LP+A  IKIR S A R  RVKVSGW+HRLR Q   M FIVLRDG+GYLQC+
Sbjct: 131 AFVLKEDASLPIAKSIKIRDSTAHRDTRVKVSGWIHRLRVQAH-MIFIVLRDGTGYLQCI 189

Query: 171 LTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFT 230
           L G+L  T DAL    E+T+TIYG I  LP GKTAP  HEL ADY+ V   AP GD A  
Sbjct: 190 LEGDLIKTLDALQFIEETTITIYGTIKTLPEGKTAPGGHELTADYYTVVGKAPSGDAAIG 249

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
           N +  DA+  I  +QRHLV+RGE AS VLK R+ +++AFR  F+  G  EV PPCMVQTQ
Sbjct: 250 NIVAPDAEQQIKLDQRHLVLRGEQASGVLKVRAGVLRAFRRAFEDLGLLEVTPPCMVQTQ 309

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLFE NYYGEKAYLTQ+SQLYLETCLP+LGDV+C+ ES+RAE+S TRRHLSEY+H
Sbjct: 310 VEGGSTLFEFNYYGEKAYLTQSSQLYLETCLPALGDVFCVQESFRAERSVTRRHLSEYTH 369

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +E E+AFI+F          I   +D VL + + + ++ +L+PDF  P+RPF+RM Y+DA
Sbjct: 370 IEGELAFISFDDLLSHLEELISRVLDYVLEDPSCKDIIKELNPDFKVPERPFMRMKYEDA 429

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++L +H+IK + G  +EFG+DI E  ER MTD IN+PIFL  FP EIK+FYMKR   D 
Sbjct: 430 IKWLNEHDIKTDEGKDHEFGDDIAEAAERRMTDMINRPIFLTHFPVEIKSFYMKRDESDK 489

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           RVTESVDVL+PGVGE+VGGSMR+ D+ EL+ GY REGI+P PYYW+TDQRKYGT  HGG+
Sbjct: 490 RVTESVDVLMPGVGEIVGGSMRMDDLTELMGGYAREGIDPAPYYWFTDQRKYGTCPHGGY 549

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ER+LAWL +R  V+ECCLYPR++GRC P
Sbjct: 550 GLGLERYLAWLCNRWTVRECCLYPRYVGRCTP 581



>gi|73945455|ref|XP_849060.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic isoform 1
           [Canis lupus familiaris]
          Length = 559

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L+ ES+VT
Sbjct: 132 EEYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLATESSVT 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDSINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|511842261|ref|XP_004745606.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X2 [Mustela
           putorius furo]
 gi|511974307|ref|XP_004805122.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X2 [Mustela
           putorius furo]
          Length = 558

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/559 (51%), Positives = 378/559 (67%), Gaps = 10/559 (1%)

Query: 6   PSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDI 63
           P+      +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+
Sbjct: 8   PTAGMVLELYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV 67

Query: 64  SGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLA 123
                                                           I +K DPNLP  
Sbjct: 68  -----ISKSQMKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPNLPEP 122

Query: 124 IKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALI 183
             +KI      +G+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++
Sbjct: 123 KCVKIHALGGYKGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVV 182

Query: 184 LSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILY 243
           L+ ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +  
Sbjct: 183 LATESSVAVYGTLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQL 240

Query: 244 EQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYY 303
             RH++IRGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+
Sbjct: 241 NNRHMMIRGENMSKILKARSVVTRCFRDHFFDRGYHEVTPPTLVQTQVEGGATLFKLDYF 300

Query: 304 GEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXX 363
           GE+A+LTQ+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF   
Sbjct: 301 GEEAFLTQSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDEL 360

Query: 364 XXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKEN 423
                  +CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+
Sbjct: 361 LNRLEDLVCDVVDRVLKSPAA-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKED 419

Query: 424 GSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGV 483
           G+FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P V
Sbjct: 420 GTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNV 479

Query: 484 GEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLH 543
           GE+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+
Sbjct: 480 GEIVGGSMRIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILN 539

Query: 544 RDNVKECCLYPRFMGRCLP 562
           R ++++ CLYPRF+ RC P
Sbjct: 540 RYHIRDVCLYPRFVQRCKP 558



>gi|465796322|emb|CCV00613.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 558

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 295/555 (53%), Positives = 367/555 (66%), Gaps = 13/555 (2%)

Query: 8   VKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTX 67
           V     VY +E  GSDET  GT+ AP+ TAV A+  +G  I +  +K   +GY+ +S + 
Sbjct: 17  VSDMPAVYFNEAVGSDETGQGTEAAPFATAVGAMTARGAQIQLFTKKADADGYEPLSASG 76

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I L      P   +IK
Sbjct: 77  VKKAKKLYEMAQKKKQKAAENASQEAERAAQEQKKLEESKK---ITLAPPEGAPAPKRIK 133

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I   V  R  RVKV GWVHRLR Q KD  F++LRDG+G+LQC+L G L  TYDAL L+LE
Sbjct: 134 IVAGVQHRDTRVKVCGWVHRLRVQ-KDRMFLILRDGTGFLQCVLQGRLTQTYDALTLTLE 192

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           S+V +YGVI  LP GKTAPD+HE++ DYWE    APGGD+A TN+++ +ADPSIL + RH
Sbjct: 193 SSVEMYGVIQALPEGKTAPDHHEMVVDYWECVGKAPGGDEAITNRVSENADPSILADLRH 252

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           LV+RGETAS+VL+ R+A+++AFRD F S G  EV PPCMVQTQVEGGSTLF  +YYGEKA
Sbjct: 253 LVLRGETASSVLRVRAAVLQAFRDEFASTGMLEVTPPCMVQTQVEGGSTLFAFDYYGEKA 312

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+HLE E+AF++F       
Sbjct: 313 YLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHLEIELAFVSFDDLLSHI 372

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              IC  VDR+L  +  R L+  L+P F PP+RPFLR++YKDAIQYL +H I  E+G  +
Sbjct: 373 EQDICGVVDRLLRVDKIRALIETLNPGFQPPKRPFLRLNYKDAIQYLNEHGILNEDGEPH 432

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           + G+DI E  ER MTDQ+  PI L  FP E+KAFYMKR   +   TESVD+L+PGVGE+V
Sbjct: 433 KIGDDIAEAAERKMTDQMGVPILLHSFPRELKAFYMKRVPGNEAFTESVDLLMPGVGEIV 492

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMR+ +  ELL  YKREGI+P+P         YGT EHGG+GLGVER LAWL +R  V
Sbjct: 493 GGSMRMKNHAELLEAYKREGIDPSP---------YGTCEHGGYGLGVERLLAWLTNRWTV 543

Query: 548 KECCLYPRFMGRCLP 562
           +EC L+PR+ G C P
Sbjct: 544 RECSLFPRWTGHCTP 558



>gi|426386062|ref|XP_004059513.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Gorilla gorilla
           gorilla]
          Length = 548

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 6   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 65

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 66  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKISA 119

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 120 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 180 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 238 RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 298 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +V++L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 358 VCDVVDRILKSPAG-SIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFG 416

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 417 EDIPEAPERLMTDAINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 476

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI +  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 477 MRIFNSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 536

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 537 CLYPRFVQRCTP 548



>gi|511842259|ref|XP_004745605.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X1 [Mustela
           putorius furo]
 gi|511974305|ref|XP_004805121.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X1 [Mustela
           putorius furo]
          Length = 559

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DPNLP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPNLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              +G+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L+ ES+V 
Sbjct: 132 GGYKGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLATESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYHEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|449542287|gb|EMD33267.1| hypothetical protein CERSUDRAFT_87578 [Ceriporiopsis subvermispora
           B]
          Length = 571

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 305/571 (53%), Positives = 380/571 (66%), Gaps = 23/571 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           ++YIDE  GSDET  GTQ  PY+T   AL    D + +L+RK P   Y++          
Sbjct: 3   SIYIDETAGSDETGKGTQEQPYQTLAFALYSHSDAL-LLIRKDPNSEYEEPTQSALKKAK 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL++D +LP A K KI   
Sbjct: 62  KGADGIEKKRKKAEELAERDAQQKKEERERREKVLEESKKIVLEEDSSLPAATKSKIVNL 121

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RGKRV+VSGWVHRLR Q K + FIVLRDG+GYLQC+L+G    TY AL L++ESTV 
Sbjct: 122 AELRGKRVRVSGWVHRLRDQ-KGIIFIVLRDGTGYLQCVLSGLTAQTYSALTLTIESTVE 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G +  +P GKTAP  HEL  D+W+V   APGGDDAFTN+LN  +DPSIL + RHLV+R
Sbjct: 181 LVGTLQPVPEGKTAPGGHELSVDFWQVLGAAPGGDDAFTNRLNEKSDPSILADLRHLVLR 240

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GETASAVLK R+A++ AFRD   S    EV PPC+VQTQVEGG+TLF+++YYG+  +LTQ
Sbjct: 241 GETASAVLKLRAALLNAFRDALVSHDLIEVTPPCLVQTQVEGGATLFKLDYYGQPTFLTQ 300

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFI F          I
Sbjct: 301 SSQLYLETCLPALGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFIKFEDLMDHIESII 360

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHN------------I 419
           C+TVDR+LAN  T  L+ QL+P F  P RPF+R+ Y DAI++L +H+            I
Sbjct: 361 CETVDRLLANPRTAALIQQLNPGFTAPVRPFMRLSYVDAIKWLNEHSIQHEAEDAEGNVI 420

Query: 420 KKENGSF----YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC----AEDNR 471
           K ++G+     +  G+DI E  ER MTD +  PIFL  FPAE+KAFYMK+     A+ + 
Sbjct: 421 KNDDGTSKMVDHVVGDDIAEAAERRMTDILGCPIFLHGFPAELKAFYMKKVPGAGADGHV 480

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGE+VGGSMRISDM+EL A YKREGI+P+PYYW+TDQRKYGT EHGG+G
Sbjct: 481 FTESCDLLMPGVGEIVGGSMRISDMDELFAAYKREGIDPSPYYWFTDQRKYGTCEHGGYG 540

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 541 LGVERFLAWLANRYTVRECSLYPRWPGRATP 571



>gi|498940568|ref|XP_004521427.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Ceratitis
           capitata]
          Length = 558

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 291/566 (51%), Positives = 387/566 (68%), Gaps = 15/566 (2%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG----DNISILVRKTP 56
           E+ + P +   + +Y  E +GSDE   G++  PYKT ++A++         I +  +   
Sbjct: 4   ESSESPQI---DGIYTSEKSGSDENGNGSKENPYKTILQAMRHAKVEPFPTIYVDSKDPK 60

Query: 57  EEGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQ 116
           EEG  +++                                               I + +
Sbjct: 61  EEGQFEVAAKSQLKKIHKIFAREGYKNAEKQQREADDNEKRLQNLEEARK-----IKIVE 115

Query: 117 DPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELC 176
           DPNLP A +I IR     RG+R+KV GWVHRLR QGK + FI LRDG+G+LQC+LT + C
Sbjct: 116 DPNLPTARRIYIRHGEEYRGERIKVYGWVHRLRRQGKGLIFITLRDGTGFLQCVLTDQRC 175

Query: 177 HTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNAD 236
            TY+AL+L+ ES+V ++GV+  +P GK+AP  HEL+ DYWE+   AP G     + LN +
Sbjct: 176 QTYEALVLTTESSVVLFGVLKPVPDGKSAPGGHELIVDYWELIGLAPAG--GAESILNEE 233

Query: 237 ADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGST 296
           A P +  + RH++IRGE  S VL+ RSA+++AFR H+  +G+ EV PP +VQTQVEGGST
Sbjct: 234 AHPDVQLDNRHIMIRGENTSKVLRMRSAVLQAFRAHYIERGYVEVTPPTLVQTQVEGGST 293

Query: 297 LFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMA 356
           LF++ Y+GE+AYLTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+HLEAE  
Sbjct: 294 LFKLKYFGEEAYLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHLEAECP 353

Query: 357 FITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKD 416
           F+TF          ICD VDR+L +     LV++L+P+F  P+RPF RM+Y DAI++LK+
Sbjct: 354 FVTFDEFLDRLEDLICDVVDRILKSPMG-PLVHELNPEFKVPKRPFRRMNYADAIKWLKE 412

Query: 417 HNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESV 476
           +N+ K++GSFYE+GEDIPE PER MTD IN+PI LCRFP  IK+FYM +CAED+ +TESV
Sbjct: 413 NNVTKDDGSFYEYGEDIPEAPERKMTDTINEPIMLCRFPVNIKSFYMSKCAEDSNLTESV 472

Query: 477 DVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVER 536
           DVL+P VGE+VGGSMRI D  ELL GY+REGI+PTPYYWYTDQR YGT  HGG+GLGVER
Sbjct: 473 DVLLPNVGEIVGGSMRIYDYEELLKGYEREGIDPTPYYWYTDQRIYGTQPHGGYGLGVER 532

Query: 537 FLAWLLHRDNVKECCLYPRFMGRCLP 562
           FL WLL+R +++E CLYPRF+ RC P
Sbjct: 533 FLCWLLNRYHIREVCLYPRFLDRCKP 558



>gi|292625063|ref|XP_696748.3| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic [Danio rerio]
          Length = 556

 Score =  602 bits (1552), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 292/565 (51%), Positives = 384/565 (67%), Gaps = 15/565 (2%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEG 59
           E + K S+K    +Y+ +  GSD    G++  P+KT ++AL   G +   ++   + +EG
Sbjct: 4   EGVGKMSIKE---LYVSDKQGSDADGDGSEQKPFKTPLKALLFAGKEPFPVIYVDSQKEG 60

Query: 60  --YKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQD 117
             +  IS T                                             I ++ D
Sbjct: 61  ERWTVISKTQMKNTKKAFHREQMKNESKDKKEAEDAERREKNLEEAKK------ITIEND 114

Query: 118 PNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
            +LP    +KI +  A R +RVKV GWVHRLR QGK++ FIVLRDG+G+LQC+LT +LC 
Sbjct: 115 SSLPEPKTVKIDKLEALREQRVKVFGWVHRLRRQGKNLLFIVLRDGTGFLQCVLTDKLCQ 174

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADA 237
            Y+ L+LS ES+V +YG +  +P GK AP  HEL  D+WE+   AP G     N LN ++
Sbjct: 175 CYNGLVLSTESSVALYGTVKPVPEGKQAPGGHELHCDFWELVGLAPAG--GADNLLNEES 232

Query: 238 DPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTL 297
           D  +    RH++IRGE  S +LK RSA+ + FRDHF S+G+ E+ PP +VQTQVEGGSTL
Sbjct: 233 DVDVQLNNRHMMIRGENVSKILKVRSAVTQCFRDHFFSRGYCEITPPTLVQTQVEGGSTL 292

Query: 298 FEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAF 357
           F +NY+GE AYLTQ+SQLYLETC+P+LGD +CI++SYRAE+S TRRHLSEY+H+EAE  F
Sbjct: 293 FGLNYFGENAYLTQSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAECPF 352

Query: 358 ITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDH 417
           +++          +CD VDRVL +     L+Y ++PDF PP+RPF RM+Y +AI +LK+H
Sbjct: 353 MSYEDLLNRLEDLVCDVVDRVLKSPAA-PLLYDINPDFKPPKRPFKRMNYTEAIDWLKEH 411

Query: 418 NIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
           NIKK++G+FYEFGEDIPE PER MTD IN+ I LCRFPAEIK+FYM+RC ED R+TESVD
Sbjct: 412 NIKKDDGTFYEFGEDIPEAPERLMTDSINETILLCRFPAEIKSFYMQRCPEDRRLTESVD 471

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           VL+P VGE+VGGSMRI D +ELL GYKREGI+PTPYYWYTDQRK+GT  HGG+GLG+ERF
Sbjct: 472 VLMPNVGEIVGGSMRIWDSDELLEGYKREGIDPTPYYWYTDQRKFGTCPHGGYGLGLERF 531

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           L WLL+R ++++ CLYPRF+ RC P
Sbjct: 532 LTWLLNRHHIRDVCLYPRFIQRCRP 556



>gi|350539187|ref|NP_001233302.1| asparaginyl-tRNA synthetase, cytoplasmic [Pan troglodytes]
 gi|397514006|ref|XP_003827295.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Pan paniscus]
 gi|343961363|dbj|BAK62271.1| asparaginyl-tRNA synthetase, cytoplasmic [Pan troglodytes]
          Length = 548

 Score =  602 bits (1552), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 6   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 65

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 66  IKKMWHREQMKNESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKISA 119

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 120 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 180 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 238 RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 298 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +V++L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 358 VCDVVDRILKSPAG-SIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFG 416

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 417 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 476

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI +  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 477 MRIFNSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 536

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 537 CLYPRFVQRCTP 548



>gi|62897229|dbj|BAD96555.1| asparaginyl-tRNA synthetase variant [Homo sapiens]
          Length = 548

 Score =  602 bits (1551), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 381/552 (69%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 6   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 65

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 66  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKIGA 119

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 120 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 180 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 238 RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 298 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +V++L+P+F PP+RPF R++Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 358 VCDVVDRILKSPAG-SIVHELNPNFQPPKRPFKRVNYSDAIVWLKEHDVKKEDGTFYEFG 416

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 417 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 476

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 477 MRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 536

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 537 CLYPRFVQRCTP 548



>gi|75075861|sp|Q4R4Z1.1|SYNC_MACFA RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|67970984|dbj|BAE01834.1| unnamed protein product [Macaca fascicularis]
          Length = 558

 Score =  602 bits (1551), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 377/552 (68%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 16  LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 75

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP LP    +KI  
Sbjct: 76  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPALPEPKCVKISA 129

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 130 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 189

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 190 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 247

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF++NY+GE+A+LT
Sbjct: 248 RGENMSKILKARSMITRCFRDHFFDRGYHEITPPSLVQTQVEGGATLFKLNYFGEEAFLT 307

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE   +TF          
Sbjct: 308 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPLLTFDDLLNRLEDL 367

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDR+L +     +VY+L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEFG
Sbjct: 368 VCDVVDRILKSPAG-SIVYELNPNFQPPKRPFKRMNYSDAIIWLKEHDIKKEDGTFYEFG 426

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+ +TESVDVL+P VGE+VGGS
Sbjct: 427 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSCLTESVDVLMPNVGEIVGGS 486

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MR SD  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 487 MRTSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 546

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 547 CLYPRFVQRCTP 558



>gi|426253872|ref|XP_004020615.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Ovis aries]
          Length = 559

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I ++ DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDNLRREKNLEEAKKITIENDPSLPEPKCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYHEITPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|410977772|ref|XP_003995274.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Felis catus]
          Length = 586

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 285/559 (50%), Positives = 379/559 (67%), Gaps = 10/559 (1%)

Query: 6   PSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDI 63
           P+      +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+
Sbjct: 36  PTAGMVLELYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV 95

Query: 64  SGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLA 123
                                                           I +K DP+LP  
Sbjct: 96  -----ISKSQMKNIKKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEP 150

Query: 124 IKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALI 183
             +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++
Sbjct: 151 KCVKIHALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVV 210

Query: 184 LSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILY 243
           L+ ES+V +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +  
Sbjct: 211 LATESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQL 268

Query: 244 EQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYY 303
             RH++IRGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+
Sbjct: 269 NNRHMMIRGENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYF 328

Query: 304 GEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXX 363
           GE+A+LTQ+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF   
Sbjct: 329 GEEAFLTQSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEEL 388

Query: 364 XXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKEN 423
                  +CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+
Sbjct: 389 LNRLEDLVCDVVDRVLKSPAA-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHDIKKED 447

Query: 424 GSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGV 483
           G+FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P V
Sbjct: 448 GTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNV 507

Query: 484 GEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLH 543
           GE+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+
Sbjct: 508 GEIVGGSMRIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILN 567

Query: 544 RDNVKECCLYPRFMGRCLP 562
           R ++++ CLYPRF+ RC P
Sbjct: 568 RYHIRDVCLYPRFVQRCKP 586



>gi|242006633|ref|XP_002424153.1| asparaginyl-tRNA synthetase, cytoplasmic, putative [Pediculus
           humanus corporis]
 gi|212507478|gb|EEB11415.1| asparaginyl-tRNA synthetase, cytoplasmic, putative [Pediculus
           humanus corporis]
          Length = 552

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 291/555 (52%), Positives = 376/555 (67%), Gaps = 6/555 (1%)

Query: 8   VKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTX 67
           + S++ +Y  E  GSDET  G++  P+K+ ++A++  G        K   +G  D     
Sbjct: 4   LTSADEIYTSETRGSDETGDGSEQKPFKSILQAMRKAGKEP---FPKIYVDGKGDGIIYD 60

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       IVL++D  L  AI+I+
Sbjct: 61  LAAKSQLKKIQKIWVRENMKQAEKNKKEAENAEKRVKNLEEAKKIVLEEDKTLTPAIRIR 120

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I+ S   R KRVK+ GWVHRLR QGK + FI LRDG+G+LQC+L   LC +Y+ALILS E
Sbjct: 121 IKDSTEYRDKRVKIYGWVHRLRRQGKSLIFITLRDGTGFLQCVLNDLLCQSYEALILSTE 180

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           STV +YG + +LP GKTAP  HEL  DYW++   AP G     N LN +A   I  + RH
Sbjct: 181 STVLLYGTLKKLPEGKTAPGGHELHVDYWKLIGLAPPG--GAENILNEEAHIDIQLDNRH 238

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           ++IRGE  + VLK RS +M+AFRDH+  +G+ EV PP +VQTQVEGGSTLF++NY+GE+A
Sbjct: 239 IMIRGENTAKVLKMRSVVMQAFRDHYAERGYYEVTPPTLVQTQVEGGSTLFKLNYFGEEA 298

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCL S+GDV+CI++SYRAE+S TRRHL+EY+H+EAE  FI +       
Sbjct: 299 YLTQSSQLYLETCLASMGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFIDYEEFLNRV 358

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              + D VD+VL + +   LVY+L+PDF PP++PF RMDY DAI+YLK++NI KE+GSFY
Sbjct: 359 EDLLTDVVDKVLKS-SHGHLVYELNPDFKPPKKPFKRMDYADAIKYLKENNITKEDGSFY 417

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           EFGEDIPE PER MTDQIN+PI LCRFP  IK+FYM RCAED+ +TESVDVL+PGVGE++
Sbjct: 418 EFGEDIPEMPERKMTDQINEPIMLCRFPVNIKSFYMARCAEDSNLTESVDVLLPGVGEII 477

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMR  D  EL+ G+ R  INP PYYWY DQRKYG+  HGG+GLG+ERF+ WLL+R ++
Sbjct: 478 GGSMRSWDEKELIDGFVRNNINPEPYYWYIDQRKYGSCPHGGYGLGLERFMCWLLNRYHI 537

Query: 548 KECCLYPRFMGRCLP 562
           +E CLYPRF+ RC P
Sbjct: 538 REVCLYPRFLERCRP 552



>gi|332230291|ref|XP_003264323.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Nomascus
           leucogenys]
          Length = 548

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/552 (51%), Positives = 378/552 (68%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDN---ISILVRKTPEEGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     I  +  +   E +  IS +    
Sbjct: 6   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPIIYVDSQKENERWNVISKSQLKN 65

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 66  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPSLPEPKCVKISA 119

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 120 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 180 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE    +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LT
Sbjct: 238 RGENMCKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 298 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +     +V++L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFG
Sbjct: 358 VCDVVDRVLKSPAG-SIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFG 416

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGS
Sbjct: 417 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGS 476

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MR  D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 477 MRTYDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 536

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 537 CLYPRFVQRCTP 548



>gi|126321623|ref|XP_001366376.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic [Monodelphis
           domestica]
          Length = 548

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  GT++ P+KT ++AL   G     +I V    E    D+        
Sbjct: 6   LYVSDREGSDATGDGTKDKPFKTGLKALMTAGKEPFPTIYVDSQKENERWDV-----ISK 60

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +KQDP+LP A  +KI   
Sbjct: 61  SQLKNIKKIWHRERMKNESREQREAEDNLRRERNLEEAKKISIKQDPSLPEAKCVKICAL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F++LRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 121 EAHRGQRVKVFGWVHRLRRQGKNLMFLILRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  DYWE+   AP G     N +N ++D  +    RH++IR
Sbjct: 181 VYGTLNLTPEGKQAPGGHELSCDYWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LK RS +   FRDHF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE A+LTQ
Sbjct: 239 GENMSKILKVRSVVTGCFRDHFFDRGYYEITPPTLVQTQVEGGATLFKLDYFGEDAFLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 299 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPFLTFDDLLNRLEDLV 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDR+L +     L+Y L+P F PP+RPF RM+Y DAI +LK+H++KKE+G++YEFGE
Sbjct: 359 CDVVDRILKSPAA-SLLYDLNPTFTPPKRPFKRMNYSDAIVWLKEHDVKKEDGTYYEFGE 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 418 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELL GYKRE I+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 478 RIWDGEELLKGYKREEIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 537

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 538 LYPRFVQRCKP 548



>gi|350578507|ref|XP_003121503.3| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Sus
           scrofa]
          Length = 559

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGSDATGDGTKEKPFKTGLKALMTAGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIRKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG++   P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLKLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FR+HF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVITRCFREHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD V+RV+ + +   +V +L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVERVMKS-SAAGIVRELNPNFKPPKRPFRRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELLAGYKRE I+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEELLAGYKREEIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|301769781|ref|XP_002920308.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like
           [Ailuropoda melanoleuca]
          Length = 559

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 284/551 (51%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L+ ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLATESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHDIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|281337495|gb|EFB13079.1| hypothetical protein PANDA_009023 [Ailuropoda melanoleuca]
          Length = 545

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 284/551 (51%), Positives = 377/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+        
Sbjct: 3   LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV-----ISK 57

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KI   
Sbjct: 58  SQMKNIKKMWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIHAL 117

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L+ ES+V 
Sbjct: 118 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLATESSVA 177

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 178 VYGMLNLTPEGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 235

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 236 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 295

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 296 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 355

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEFGE
Sbjct: 356 CDVVDRVLKSPAA-SIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHDIKKEDGTFYEFGE 414

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 415 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 474

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 475 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 534

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 535 LYPRFVQRCKP 545



>gi|470318357|gb|EMR10025.1| hypothetical protein PNEG_01779 [Pneumocystis murina B123]
          Length = 560

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 291/549 (53%), Positives = 384/549 (69%), Gaps = 2/549 (0%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +YIDE++GSDE   G+   P+KTAV+AL++ G+   I +RK+  E YK+I+ T       
Sbjct: 14  LYIDEISGSDELGVGSIENPFKTAVKALEIGGEESLIYIRKSAGEEYKEITQTSLKKAKK 73

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 IV++++ +L  A++I+IR S  
Sbjct: 74  SLCILLKKKQKLDDAFSHMKVQDENSGEIEKLKQAEK-IVIEKNKSLDEAVRIRIRDSKL 132

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            +   V++SGWVHRLR Q K++ FI+LRDG+GYLQC+L G++  TYD+L L+LE+T+T+Y
Sbjct: 133 YKDTVVQISGWVHRLRHQ-KELIFIILRDGTGYLQCVLGGKIAQTYDSLTLTLETTLTVY 191

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G I+ LP GK APDNHEL   Y+E+ H APGGD +F NKLN +++  ++Y+QRHLVIRGE
Sbjct: 192 GTITSLPDGKIAPDNHELNVLYYEIIHKAPGGDLSFANKLNVESESQVIYDQRHLVIRGE 251

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
            +S+VLK RS ++ AFR  ++  GF EV PPC+VQTQVEGG+TLF++NYYGEKAYLTQ+S
Sbjct: 252 ASSSVLKVRSYLLSAFRKVYEKMGFVEVTPPCLVQTQVEGGATLFDLNYYGEKAYLTQSS 311

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETCLPSLGDVYC+ ES+RAE SHTRRHLSEYSHLEAE+ F++F          +C 
Sbjct: 312 QLYLETCLPSLGDVYCLQESFRAETSHTRRHLSEYSHLEAELMFLSFDEFLSHIEDFLCL 371

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDI 433
           ++D +L N   R L+  L+P F  PQ+PFLRM Y+DAI+Y  +HNI   NG  + FG+DI
Sbjct: 372 SLDILLDNSLARSLIEYLNPRFEKPQKPFLRMKYEDAIKYCNEHNILNTNGELHVFGDDI 431

Query: 434 PEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRI 493
            E  ER + D+I KPIFL  FPA +K+FYMKR   +  +TESVD+L+PG+GEVVGGSMRI
Sbjct: 432 AEAAERRIVDEIQKPIFLIHFPASLKSFYMKRIPGNEVLTESVDLLLPGIGEVVGGSMRI 491

Query: 494 SDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLY 553
           SD +EL   ++RE I+  PYYWY D R+YG+  HGG+GLG+ER LAWL +R+ VKECCLY
Sbjct: 492 SDYDELKKAFEREKIDVGPYYWYLDLRRYGSCPHGGYGLGLERILAWLTNRNTVKECCLY 551

Query: 554 PRFMGRCLP 562
           PRF GRC P
Sbjct: 552 PRFTGRCKP 560



>gi|440892048|gb|ELR45417.1| Asparaginyl-tRNA synthetase, cytoplasmic [Bos grunniens mutus]
          Length = 559

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDVTGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K DP+LP    +KIR+ 
Sbjct: 72  SQMKNIRKLWHREQMKSESREKKEAEDNLRREKNLEEAKKITIKNDPSLPEPKCVKIREL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+R+KV GWVHRLR QGK++ F+VLRDG+G+LQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 KGYRGQRIKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I 
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIW 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE+AYLTQ
Sbjct: 250 GENMSKILKARSVITRCFRDHFFDRGYHEITPPTLVQTQVEGGATLFKLDYFGEEAYLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HNIKKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-NIVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L R ++++ C
Sbjct: 489 RIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|156547524|ref|XP_001606841.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like [Nasonia
           vitripennis]
          Length = 555

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 290/562 (51%), Positives = 385/562 (68%), Gaps = 13/562 (2%)

Query: 6   PSVKSSETV---YIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYK 61
           P V+S   +   Y  E  GSDE   GT++ P+K+ ++A++  G +    + + + EEG K
Sbjct: 2   PEVESKAAIAAIYTSEKTGSDENGDGTESKPFKSILQAMRHAGKEPFPEIYQDSKEEGKK 61

Query: 62  DISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLP 121
                                                             I++++D +LP
Sbjct: 62  ----YELAAKSQLKKIQKIWLREQYKSEGKQKKLQEDEEKRSKNLDEAKTIIIEEDKSLP 117

Query: 122 LAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDA 181
            A+ IKI  +   + +RV++ GWVHRLR QGK M FI LRDG+G+LQC+L  +LC TYDA
Sbjct: 118 EAVLIKINCAKNHKEQRVQIFGWVHRLRRQGKAMMFITLRDGTGFLQCILNDKLCQTYDA 177

Query: 182 LILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPS 240
           ++L+ E++V I+G +  +P GKTAP   ELL DYW+ + +  PGG D     LN +A P 
Sbjct: 178 VVLNTEASVHIFGTLKPVPEGKTAPGGLELLVDYWKLIGNSPPGGADGI---LNEEAHPD 234

Query: 241 ILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEM 300
           +  + RH++IRGE  S +L  RS + +AFRDH+  +G+ EV PP +VQTQVEGGSTLF++
Sbjct: 235 VQLDNRHIMIRGENTSRILIMRSVLTQAFRDHYKDRGYCEVTPPTLVQTQVEGGSTLFKL 294

Query: 301 NYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITF 360
           NY+GE+AYLTQ+SQLYLETC+P++GDVYCI++SYRAE+S TRRHL+EY+H+EAE  FITF
Sbjct: 295 NYFGEEAYLTQSSQLYLETCIPAMGDVYCIAQSYRAEQSRTRRHLAEYTHIEAECPFITF 354

Query: 361 XXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK 420
                     ICD VDRVL +     LV +L+P+F  P+RPF RM+Y +AI+YLK++NI 
Sbjct: 355 DDLLDRLEDLICDVVDRVLQSPMG-PLVKELNPNFQVPKRPFRRMNYSEAIEYLKENNIT 413

Query: 421 KENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLI 480
           K++GSFYEFGEDIPE PER MTD+IN+PI LCRFPAEIK+FYM+RC EDNR+TESVDVL+
Sbjct: 414 KDDGSFYEFGEDIPEMPERKMTDKINEPIMLCRFPAEIKSFYMQRCEEDNRLTESVDVLL 473

Query: 481 PGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAW 540
           P VGE+VGGSMRI D + LL GYK  GI+P PYYWYTDQRKYGT  HGG+GLG+ERF+ W
Sbjct: 474 PNVGEIVGGSMRIWDHDALLEGYKSVGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFICW 533

Query: 541 LLHRDNVKECCLYPRFMGRCLP 562
           LL+R +++E CLYPRF+ RC P
Sbjct: 534 LLNRYHIREVCLYPRFLERCRP 555



>gi|390474009|ref|XP_002757320.2| PREDICTED: asparagine--tRNA ligase, cytoplasmic [Callithrix
           jacchus]
          Length = 559

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 377/552 (68%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ E  G D T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 17  LYVSEREGDDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQMKN 76

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP+LP    +KI  
Sbjct: 77  IKKMWHREQMKSDSRDKKEAEDNLRREKNLEEAKK------ITIKNDPSLPEPKCVKISA 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+G+LQC+L  ELC  Y+ L+LS ES+V
Sbjct: 131 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGFLQCVLADELCLCYNGLLLSTESSV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 191 AVYGTLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S + +ARS I + FRDHF  +G+ E+ PP +VQTQVEGGSTLF+++Y+GE+A+LT
Sbjct: 249 RGENMSKIFRARSMITRCFRDHFFDRGYCEIAPPTLVQTQVEGGSTLFKLDYFGEEAFLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F          
Sbjct: 309 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           +CD VDRVL +     +V++L+P+F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEFG
Sbjct: 369 VCDVVDRVLKSPVA-SIVHELNPNFKPPKRPFKRMNYSDAIVWLKEHDIKKEDGTFYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGS
Sbjct: 428 EDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ 
Sbjct: 488 MRIWDNEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFVQRCKP 559



>gi|410730863|ref|XP_003980252.1| hypothetical protein NDAI_0G05930 [Naumovozyma dairenensis CBS 421]
 gi|401780429|emb|CCK73576.1| hypothetical protein NDAI_0G05930 [Naumovozyma dairenensis CBS 421]
          Length = 553

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/556 (51%), Positives = 382/556 (68%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL----QVKG-DNISILVRKTPEEGYKDISGT 66
           ++YI E  G DE T +GTQ  P+KT   AL    Q +G     + V K  +  +++IS +
Sbjct: 2   SLYIKESVGIDELTVSGTQEQPFKTPAFALFAASQQEGVPEPKLFVFKAEDAEFQEISAS 61

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +++D +LP+A K+
Sbjct: 62  ALKKARKGCDGLKKKAIKQKEQELKKQQQDADNAAKQMAALN---IKIEEDKSLPVAKKL 118

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KI+Q+    G+RVKVSGW+HRLR+  K + F+VLRDG+ +LQC+L+G+L      L L++
Sbjct: 119 KIKQTYEQVGQRVKVSGWIHRLRSN-KKVVFLVLRDGTAFLQCVLSGDLALAKSTLDLTI 177

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTVT+YG + E+P GKTAP N EL  D++E+   AP GDD+FTNK+  D+DPS+L +QR
Sbjct: 178 ESTVTLYGTVIEVPEGKTAPGNVELAVDFYEIVSLAPSGDDSFTNKIAEDSDPSLLLDQR 237

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RGET S V+K R+A+++A R  ++ +G  EV PPCMVQTQVEGGSTLF+++YYGE+
Sbjct: 238 HLALRGETLSGVMKVRAALLRAIRRVYEEEGLLEVTPPCMVQTQVEGGSTLFKLDYYGEE 297

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDV+C+ ES+RAEKSHTRRHLSEY+H+EAE+ F+TF      
Sbjct: 298 AYLTQSSQLYLETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELGFLTFEDLLEH 357

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  +V  V+ +     +V +LHP+FV P+ PF+R++YKDAI +L++HNIK E G  
Sbjct: 358 IETLIVKSVQYVMEDPVAGAIVKELHPNFVAPKGPFMRLEYKDAIAWLQEHNIKNEEGED 417

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           ++FG+DI E  ER MTD I  PIFL RFP EIK+FYMKRCA+D RVTESVDVL+P VGE+
Sbjct: 418 FKFGDDIAEAAERKMTDTIGVPIFLTRFPVEIKSFYMKRCADDPRVTESVDVLMPTVGEI 477

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI D  EL+AG+KREGI+P PYYW+ DQRKYG+  HGG+GLG ER LAWL +R  
Sbjct: 478 TGGSMRIEDTEELMAGFKREGIDPKPYYWFIDQRKYGSCPHGGYGLGTERILAWLCNRFT 537

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 538 VRDCSLYPRFSGRCKP 553



>gi|348576868|ref|XP_003474207.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like isoform 1
           [Cavia porcellus]
          Length = 559

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGDDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 72  SQMKNIKKLWHREQMKTESQEKREAEDSLRREKNLEEAKKISIKKDPSLPEPKCVKIGAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCLCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++ +P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLIPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +L+ARS I   FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILRARSMITACFREHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F          +
Sbjct: 310 SSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYTDAIAWLKEHNVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|213512082|ref|NP_001133698.1| syncoilin [Salmo salar]
 gi|209154978|gb|ACI33721.1| Asparaginyl-tRNA synthetase, cytoplasmic [Salmo salar]
          Length = 559

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 284/551 (51%), Positives = 374/551 (67%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D+   GT+  P+KT++RAL   G     +I V     +  KD         
Sbjct: 17  LYVSDKEGNDQDGDGTEQKPFKTSLRALTFAGKEPFPTIYV-----DSQKDGERWAVISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I ++ D +LP    +KI Q 
Sbjct: 72  TQMKNVMKVFAREQMKSDSKDKKEAEDSERREKNLEDAKKITIENDSSLPEPKTVKIYQL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHR+R QGK++ FIVLRDG+G+LQC+L  +LC  Y+AL+LS ESTV 
Sbjct: 132 EPLRGERVKVFGWVHRMRKQGKNLLFIVLRDGTGFLQCVLNDKLCQCYNALVLSTESTVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG + ++P GK AP  HEL  D+WE+   AP G     N LN ++D  +    RH++IR
Sbjct: 192 LYGTVKQVPEGKQAPGGHELHCDFWELVGLAPAG--GADNLLNMESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +L+ RS + + FRDHF ++G+ E+ PP +VQTQVEGGSTLF +NY+GE+A+LTQ
Sbjct: 250 GENVSKILRIRSTVTQCFRDHFFNRGYYEITPPTLVQTQVEGGSTLFNLNYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGD +CI++SYRAE+S TRRHLSEY+H+EAE  F+T+          +
Sbjct: 310 SSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAECPFMTYEDLLSRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     L+YQ++PDF PP+RPF R++Y DAI +LK+H+IKK++G++YEFGE
Sbjct: 370 CDVVDRVLKSPAA-SLLYQVNPDFKPPKRPFKRINYSDAIIWLKEHDIKKDDGTYYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD I + I LCRFPAEIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDAIGETILLCRFPAEIKSFYMQRCPEDRRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELL GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ C
Sbjct: 489 RIWDAEELLEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRHHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFIQRCRP 559



>gi|225581052|gb|ACN94629.1| GA10495 [Drosophila miranda]
          Length = 557

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 275/452 (60%), Positives = 348/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+ P+A KI+I +   +RG RVKV GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 110 VKISEDPSWPVARKIRIMEGTENRGSRVKVYGWVHRLRRQGKALIFITLRDGTGFLQCVL 169

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ESTV ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 170 NDQLCQTYDALTLSTESTVVLFGTLKLIPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 228

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS +M+AFR H+ ++G++EV PP +VQTQ
Sbjct: 229 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRAHYLARGYNEVTPPTLVQTQ 286

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+ E+AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H
Sbjct: 287 VEGGSTLFKLQYFSEEAYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTH 346

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  F+TF          +CD VDRVL +     LV +L+PDF PP +PF RM+Y DA
Sbjct: 347 IEAECPFLTFEDLLDRLEDLVCDVVDRVLKSPWG-NLVKELNPDFKPPTKPFRRMNYSDA 405

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM RC ED 
Sbjct: 406 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDAINEPIMLCRFPAEIKSFYMSRCPEDK 465

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
            +TESVDVL+P VGE+VGGSMRI D  ELL GY+REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 466 TLTESVDVLLPNVGEIVGGSMRIFDSEELLKGYQREGIDPKPYYWYTDQRIYGTLPHGGY 525

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 526 GLGLERFLCWLLNRYHIREVCLYPRFLDRCKP 557



>gi|348576874|ref|XP_003474210.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like isoform 1
           [Cavia porcellus]
          Length = 559

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGDDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 72  SQMKNIKKLWHREQMKTESQEKREAEDSLRREKNLEEAKKISIKKDPSLPEPKCVKIGAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCLCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++ +P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLIPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +L+ARS I   FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILRARSVITACFREHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYTDAIAWLKEHDVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|297716158|ref|XP_002834410.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Pongo abelii]
          Length = 515

 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 271/451 (60%), Positives = 352/451 (78%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I +K DP+LP    +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L
Sbjct: 68  ITIKNDPSLPEPKCVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVL 127

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
             ELC  Y+ ++LS ES+V +YG+++  P GK AP  HEL  D+WE+   AP G     N
Sbjct: 128 ADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADN 185

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +N ++D  +    RH++IRGE  S +LKARS + + FRDHF  +G+ EV PP +VQTQV
Sbjct: 186 LINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQV 245

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+++Y+GE+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+
Sbjct: 246 EGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHV 305

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  F+TF          +CD VDRVL +     +V++L+P+F PP+RPF RM+Y DAI
Sbjct: 306 EAECPFLTFDDLLNRLEDLVCDVVDRVLKSPAG-SVVHELNPNFQPPKRPFKRMNYSDAI 364

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            +LK+H++KKE+G+FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R
Sbjct: 365 VWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSR 424

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+G
Sbjct: 425 LTESVDVLMPNVGEIVGGSMRICDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYG 484

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL W+L+R ++++ CLYPRF+ RC P
Sbjct: 485 LGLERFLTWILNRYHIRDVCLYPRFVQRCTP 515



>gi|347968958|ref|XP_311928.3| AGAP002969-PA [Anopheles gambiae str. PEST]
 gi|333467763|gb|EAA07595.3| AGAP002969-PA [Anopheles gambiae str. PEST]
          Length = 553

 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 290/551 (52%), Positives = 376/551 (68%), Gaps = 8/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYKDISGTXXXXXX 72
           +Y  E  G+DET  GT   P+KT +RA++  G +    +   + +E  K  S        
Sbjct: 9   LYTSEKRGNDETGKGTAEEPFKTILRAMKHAGKEPFPTIYADSKDE--KAESPYEVAAKS 66

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  I +++DP+ P A  IKI    
Sbjct: 67  QLKKIQKIWARDNMKGDKQKREEEEKAKNREQNLEEAKKITIQEDPSWPAAKSIKITHGA 126

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
            +RG RV++ GWVHRLR QGK + FI LRDG+G+LQC+LT  LC TY+AL+LS ES+V +
Sbjct: 127 DNRGVRVRIYGWVHRLRRQGKGLMFITLRDGTGFLQCVLTDTLCQTYNALVLSTESSVQL 186

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRHLVIR 251
           +G + E+PAGKTAP  HEL ADYWE+   AP GG DA    LN +A P +  + RH++IR
Sbjct: 187 FGTLKEVPAGKTAPGGHELHADYWELIGLAPAGGADAI---LNEEAHPDVQLDNRHIMIR 243

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LK R  +M+AFR H+  +G++EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 244 GENTSKILKMRDVVMQAFRSHYFDRGYTEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 303

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+C+++SYRAE+S TRRHL+EYSH+E E  FITF          I
Sbjct: 304 SSQLYLETCIPALGDVFCVAQSYRAEQSRTRRHLAEYSHIEGECPFITFDDLLDRLEDLI 363

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V +L+P FV P+RPF RM+Y DAI +LK++N+ KE+GSFYEFGE
Sbjct: 364 CDVVDRVLKSPWGY-MVQELNPGFVAPKRPFRRMNYADAIVWLKENNVTKEDGSFYEFGE 422

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFPAEIK+FYM +C +D R+TESVDVL+P VGE+VGGSM
Sbjct: 423 DIPEAPERKMTDTINEPIMLCRFPAEIKSFYMAKCEDDPRLTESVDVLLPNVGEIVGGSM 482

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R    +ELL GYKREGI+P PYYWY DQR YGT  HGG+GLG+ERFL WLL+R +++E C
Sbjct: 483 RSWKYDELLDGYKREGIDPKPYYWYVDQRVYGTEPHGGYGLGLERFLCWLLNRYHIREVC 542

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 543 LYPRFLERCRP 553



>gi|345305699|ref|XP_001510627.2| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic
           [Ornithorhynchus anatinus]
          Length = 574

 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 373/551 (67%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 32  LYVSDREGNDATGDGTKEKPFKTGLKALMTAGKEPFPTIYVDSQKENERWDV-----ISK 86

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DPNL     +KI   
Sbjct: 87  SQMKNIKKIWHREQMKSESREQREAEDNLRREKNLEEAKKITIKKDPNLQEPECVKIDAL 146

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            A RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ ELC  Y+ ++LS ES+V 
Sbjct: 147 EAFRGQRVKVFGWVHRLRRQGKNLMFVVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVA 206

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG +   P GK AP  HEL  DYWE+   AP G     N +N ++D  +    RH++IR
Sbjct: 207 VYGTLKLTPKGKQAPGGHELSCDYWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 264

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S + KARSA+ + FR+HF  +G+ E+ PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 265 GENMSKIFKARSAVTRCFREHFFDRGYCEITPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 324

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 325 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPFLTFDDMLNRLEDLV 384

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     LVY L+P F PP+RPF RM+Y DAI +LK+H++KKE+G++YEFGE
Sbjct: 385 CDVVDRVLKSPAA-SLVYDLNPGFKPPKRPFKRMNYSDAIVWLKEHDVKKEDGTYYEFGE 443

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 444 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 503

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  ELL GYKRE I+PTPYYWYTDQRKYG   HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 504 RIWDSEELLKGYKREDIDPTPYYWYTDQRKYGACPHGGYGLGLERFLTWILNRYHIRDVC 563

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 564 LYPRFVQRCKP 574



>gi|431906955|gb|ELK11074.1| Asparaginyl-tRNA synthetase, cytoplasmic [Pteropus alecto]
          Length = 537

 Score =  598 bits (1542), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 269/451 (59%), Positives = 351/451 (77%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I ++ DP+LP    +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L
Sbjct: 90  ITIQSDPSLPEPKCVKIHALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVL 149

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           + +LC  Y  ++LS ES+V +YG+++  P GK AP  HEL  D+WE+   AP G     N
Sbjct: 150 SDDLCQCYSGVVLSTESSVAVYGILNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADN 207

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +N ++D  +    RH++IRGE  S ++KARS + + FRDHF  +G+ EV PP +VQTQV
Sbjct: 208 LINEESDVDVQLNNRHMMIRGENVSKIMKARSMVTRCFRDHFFDRGYCEVTPPTLVQTQV 267

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+++Y+GE+A+LTQ+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+
Sbjct: 268 EGGATLFKLDYFGEEAFLTQSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHV 327

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  F+TF          +CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI
Sbjct: 328 EAECPFLTFEDLLNRLEDLVCDVVDRVLKSPAA-SIVYDLNPNFKPPKRPFKRMNYSDAI 386

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            +LK++NIKKE+G+FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R
Sbjct: 387 VWLKENNIKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSR 446

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+G
Sbjct: 447 LTESVDVLMPNVGEIVGGSMRIWDSEEMLAGYKREGIDPTPYYWYTDQRKYGTCPHGGYG 506

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL W+L+R ++++ CLYPRF+ RC P
Sbjct: 507 LGLERFLTWILNRYHIRDVCLYPRFVQRCKP 537



>gi|126002159|ref|XP_001352279.1| GA10495 [Drosophila pseudoobscura pseudoobscura]
 gi|54640540|gb|EAL29381.1| GA10495 [Drosophila pseudoobscura pseudoobscura]
          Length = 557

 Score =  598 bits (1542), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 275/452 (60%), Positives = 348/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+ P+A KI+I +   +RG RVKV GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 110 VKISEDPSWPVARKIRIMEGTENRGSRVKVYGWVHRLRRQGKALIFITLRDGTGFLQCVL 169

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
             +LC TYDAL LS ESTV ++G +  +P GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 170 NDQLCQTYDALTLSTESTVVLFGTLKLIPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 228

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS +M+AFR H+ ++G++EV PP +VQTQ
Sbjct: 229 --LNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRAHYLARGYNEVTPPTLVQTQ 286

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF++ Y+ E+AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H
Sbjct: 287 VEGGSTLFKLQYFSEEAYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTH 346

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  F+TF          +CD VDRVL +     LV +L+PDF PP +PF RM+Y DA
Sbjct: 347 IEAECPFLTFDDLLDRLEDLVCDVVDRVLKSPWG-NLVKELNPDFKPPTKPFRRMNYSDA 405

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM RC ED 
Sbjct: 406 IKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDAINEPIMLCRFPAEIKSFYMSRCPEDK 465

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
            +TESVDVL+P VGE+VGGSMRI D  ELL GY+REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 466 TLTESVDVLLPNVGEIVGGSMRIFDSEELLKGYQREGIDPKPYYWYTDQRIYGTLPHGGY 525

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 526 GLGLERFLCWLLNRYHIREVCLYPRFLDRCKP 557



>gi|219276601|ref|NP_001136422.1| asparagine--tRNA ligase, cytoplasmic isoform 1 [Mus musculus]
 gi|193806326|sp|Q8BP47.2|SYNC_MOUSE RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|148677754|gb|EDL09701.1| asparaginyl-tRNA synthetase, isoform CRA_a [Mus musculus]
          Length = 559

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/551 (51%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI++LK+H++KKE+G+FYEFG+
Sbjct: 370 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGD 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++ C
Sbjct: 489 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFLQRCRP 559



>gi|219275596|ref|NP_081626.2| asparagine--tRNA ligase, cytoplasmic isoform 2 [Mus musculus]
 gi|148677757|gb|EDL09704.1| asparaginyl-tRNA synthetase, isoform CRA_c [Mus musculus]
          Length = 558

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/551 (51%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 16  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 70

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 71  SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 130

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 131 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 190

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 191 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 248

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 249 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 308

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 309 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLV 368

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI++LK+H++KKE+G+FYEFG+
Sbjct: 369 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGD 427

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 428 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 487

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++ C
Sbjct: 488 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVC 547

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 548 LYPRFLQRCRP 558



>gi|26346633|dbj|BAC36965.1| unnamed protein product [Mus musculus]
          Length = 547

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/551 (51%), Positives = 376/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 5   LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 59

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 60  SQMKNIKKMWRREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 119

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 120 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 179

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 180 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 237

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 238 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 297

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 298 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLV 357

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI++LK+H++KKE+G+FYEFG+
Sbjct: 358 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGD 416

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 417 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 476

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++ C
Sbjct: 477 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVC 536

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 537 LYPRFLQRCRP 547



>gi|195050025|ref|XP_001992811.1| GH13480 [Drosophila grimshawi]
 gi|193899870|gb|EDV98736.1| GH13480 [Drosophila grimshawi]
          Length = 558

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 290/557 (52%), Positives = 380/557 (68%), Gaps = 18/557 (3%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILV----RKTPE--EGYKDISGT 66
           +++  E  GSDE+  G++  P+KT +RA++   D   +       K PE  E ++  + T
Sbjct: 13  SLFTSEKRGSDESGDGSEAKPFKTLLRAMR-HADKEPLFTFYVDSKDPEATELFEPATKT 71

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I + +DP+ P+A +I
Sbjct: 72  QLKKMHKLFAREGQKNAGKEQREAEDAAKREQNLEEARK------IKISEDPSWPVAKRI 125

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +I      RG RVK+ GWVHRLR QGK + FI LRDG+G++QC+L   LC TY+A++L+ 
Sbjct: 126 RIVDGAQERGTRVKIYGWVHRLRRQGKSLMFITLRDGTGFVQCVLNDLLCQTYEAVVLNT 185

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQ 245
           ES+V +YG +S +P GKTAP  HEL  DYWE+   AP GG DA    LN +A+P +  + 
Sbjct: 186 ESSVLLYGTLSLVPEGKTAPGGHELNVDYWELIGLAPPGGADAI---LNEEANPDVQLDN 242

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH++IRGE  S VLK RS +M+AFR H+  +G++EV PP +VQTQVEGGSTLF+M Y+ E
Sbjct: 243 RHIMIRGENTSKVLKMRSVVMQAFRSHYFERGYTEVTPPTLVQTQVEGGSTLFKMQYFNE 302

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H+E E  FITF     
Sbjct: 303 EAYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTHIEGECPFITFEDLLN 362

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDRVL +     LV +L+PDF PP +PF RM+Y DAI++LK+HN+ K++G+
Sbjct: 363 RLEDLVCDVVDRVLKSPWGY-LVKELNPDFKPPTKPFRRMEYADAIKWLKEHNVTKDDGT 421

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI L +FPAEIK+FYM RC ED R+TESVDVL+P VGE
Sbjct: 422 FYEFGEDIPEAPERKMTDTINEPILLIKFPAEIKSFYMSRCKEDQRLTESVDVLLPNVGE 481

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           ++GGSMRI D  EL+ GY+REGI+PTPYYWYTDQR YGTT HGG+GLG+ERFL WLL+R 
Sbjct: 482 IIGGSMRIYDSEELMKGYEREGIDPTPYYWYTDQRVYGTTPHGGYGLGLERFLCWLLNRY 541

Query: 546 NVKECCLYPRFMGRCLP 562
           +++E CLYPRF+ RC P
Sbjct: 542 HIREVCLYPRFLDRCKP 558



>gi|355755054|gb|EHH58921.1| hypothetical protein EGM_08890, partial [Macaca fascicularis]
          Length = 548

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 289/553 (52%), Positives = 378/553 (68%), Gaps = 13/553 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  GSD T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 5   LYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 64

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K +P LP    +KI  
Sbjct: 65  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNNPALPEPKCVKISA 118

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 119 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 178

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 179 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 236

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF++NY+GE+A+LT
Sbjct: 237 RGENMSKILKARSMITRCFRDHFFDRGYHEITPPSLVQTQVEGGATLFKLNYFGEEAFLT 296

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 297 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 356

Query: 371 ICDTVDRVLANETTRKLVYQLHP-DFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
           +CD VDR+L +     +VY+L+P +F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEF
Sbjct: 357 VCDVVDRILKSPAG-SIVYELNPVNFQPPKRPFKRMNYSDAIIWLKEHDIKKEDGTFYEF 415

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+ +TESVDVL+P VGE+VGG
Sbjct: 416 GEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSCLTESVDVLMPNVGEIVGG 475

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMR SD  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++
Sbjct: 476 SMRTSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRD 535

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 536 VCLYPRFVQRCTP 548



>gi|512993647|ref|XP_004858452.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X1
           [Heterocephalus glaber]
          Length = 559

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 72  SQMKSIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKKDPSLPEPECVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 ERYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGILNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARCTVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYSDAIVWLKEHNVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE++GGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEILGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RTWDSEELLAGYKREGIDPTPYYWYTDQRKYGTYPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|355701966|gb|EHH29319.1| hypothetical protein EGK_09713, partial [Macaca mulatta]
          Length = 548

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 289/553 (52%), Positives = 377/553 (68%), Gaps = 13/553 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  G D T  GT+  P+KT ++AL   G     +I V    E E +  IS +    
Sbjct: 5   LYVSDREGCDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKN 64

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP LP    +KI  
Sbjct: 65  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPALPEPKCVKISA 118

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 119 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 178

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 179 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 236

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF++NY+GE+A+LT
Sbjct: 237 RGENMSKILKARSMITRCFRDHFFDRGYHEITPPSLVQTQVEGGATLFKLNYFGEEAFLT 296

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 297 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 356

Query: 371 ICDTVDRVLANETTRKLVYQLHP-DFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
           +CD VDR+L +     +VY+L+P +F PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEF
Sbjct: 357 VCDVVDRILKSPAG-SIVYELNPVNFQPPKRPFKRMNYSDAIIWLKEHDIKKEDGTFYEF 415

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+ +TESVDVL+P VGE+VGG
Sbjct: 416 GEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSCLTESVDVLMPNVGEIVGG 475

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMR SD  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++
Sbjct: 476 SMRTSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRD 535

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 536 VCLYPRFVQRCTP 548



>gi|512993649|ref|XP_004858453.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X2
           [Heterocephalus glaber]
          Length = 558

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 16  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 70

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 71  SQMKSIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKKDPSLPEPECVKICAL 130

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 131 ERYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 190

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 191 VYGILNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 248

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 249 GENMSKILKARCTVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 308

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 309 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 368

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 369 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYSDAIVWLKEHNVKKEDGTFYEFGE 427

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE++GGSM
Sbjct: 428 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEILGGSM 487

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 488 RTWDSEELLAGYKREGIDPTPYYWYTDQRKYGTYPHGGYGLGLERFLTWILNRYHIRDVC 547

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 548 LYPRFVQRCKP 558



>gi|383855496|ref|XP_003703246.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Megachile
           rotundata]
          Length = 556

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/555 (51%), Positives = 382/555 (68%), Gaps = 14/555 (2%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEG---YKDISGTXX 68
           + +Y  E +G+DET  G+++ P+KT ++A+   G      +     +G   Y+ +S +  
Sbjct: 12  DAIYTSEKSGNDETGDGSESNPFKTVLKAMHSVGKEPFPQIYHDSSKGSEKYELVSKSQL 71

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      IV+++D  LP AI+IKI
Sbjct: 72  KKIQKIWVREQYKSEEKQKKLLEDEEKRTKNLEDAKM------IVIQEDSTLPPAIRIKI 125

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
           R S+A R +RVK+ GWVHRLR QGK + F+ LRDG+G+LQC+L   LC TY+AL LS E+
Sbjct: 126 RDSIAYRDRRVKLYGWVHRLRRQGKALMFVTLRDGTGFLQCVLNDILCQTYEALTLSTEA 185

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRH 247
           ++ ++G +  +P GK AP+ HELL DYW++   +P GG D+    LN +A P +  + RH
Sbjct: 186 SIEVFGTLKIVPEGKNAPNGHELLVDYWKLIGSSPSGGADSI---LNEEALPDVQLDNRH 242

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           ++IRGE  S +L  RS + +AFRDH+  +G+ EV PP +VQTQVEGGSTLF+++Y+GE+A
Sbjct: 243 IMIRGENTSRILIMRSILTQAFRDHYKDRGYCEVTPPTLVQTQVEGGSTLFKLDYFGEEA 302

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           +LTQ+SQLYLETC+P++GDVYCI++SYRAE+S TRRHL+EY+H+EAE  FITF       
Sbjct: 303 FLTQSSQLYLETCIPAMGDVYCIAQSYRAEQSRTRRHLAEYAHVEAECPFITFEELLDRL 362

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              ICD V+RVL N     LV +L+P+F  P++PF RM+Y DAI+YL+ +NI KE+G+FY
Sbjct: 363 EDLICDVVERVL-NSPYGHLVKELNPNFQVPKKPFKRMNYTDAIEYLRANNITKEDGTFY 421

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           EFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM RCAED R+TESVDVL+P VGE+V
Sbjct: 422 EFGEDIPEMPERKMTDAINEPIMLCRFPAEIKSFYMSRCAEDRRLTESVDVLLPNVGEIV 481

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMRI   +ELL GYK   I+P PYYWYTDQRKYG+  HGG+GLG+ERFL WLL+R ++
Sbjct: 482 GGSMRIWKYDELLEGYKNANIDPKPYYWYTDQRKYGSCPHGGYGLGLERFLCWLLNRYHI 541

Query: 548 KECCLYPRFMGRCLP 562
           +E CLYPRF+ RC P
Sbjct: 542 REVCLYPRFLDRCRP 556



>gi|74196771|dbj|BAE43117.1| unnamed protein product [Mus musculus]
          Length = 559

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/551 (51%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI++LK+H++KKE+G+FYEFG+
Sbjct: 370 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGD 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRPTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++ C
Sbjct: 489 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFLQRCRP 559



>gi|302308063|ref|NP_984841.2| AEL020Wp [Ashbya gossypii ATCC 10895]
 gi|299789278|gb|AAS52665.2| AEL020Wp [Ashbya gossypii ATCC 10895]
 gi|374108063|gb|AEY96970.1| FAEL020Wp [Ashbya gossypii FDAG1]
          Length = 551

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/554 (51%), Positives = 378/554 (68%), Gaps = 8/554 (1%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKTPEE--GYKDISGTXX 68
           ++YI+E+ G+DE   GT+ AP+K+A   L  Q  G+   +   K+ E   GY +IS +  
Sbjct: 2   SIYINELTGADEAGRGTEEAPFKSAAFGLFAQQDGEEPKVFTYKSDEGAGGYVEISASGL 61

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I +++D +LP A+ +K+
Sbjct: 62  KKARKGAEGLRKAAAKEVEQQRRRAEQEARDAAKKLELMS---IKIEEDASLPPAVGLKV 118

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
            ++  + G RVKVSGW+HRLR  GK + F+VLRDG+GYLQ +L+ +L   Y    L+LES
Sbjct: 119 GKAHGAVGTRVKVSGWIHRLR-MGKAVVFLVLRDGTGYLQAVLSKDLARAYQTSTLTLES 177

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TVT+YG + +LP GKTAP   EL  DY+E+   AP GDD+F+N++   ADPS+L + RHL
Sbjct: 178 TVTLYGTVKQLPEGKTAPGGVELDVDYYEIVSLAPSGDDSFSNRVQEGADPSLLMDMRHL 237

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           ++RGE+ SAV+K R+A ++A R  ++ +G  EV PPCMVQTQVEGGSTLF+++YYGE+A+
Sbjct: 238 MLRGESLSAVMKVRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGSTLFKLDYYGEEAF 297

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDV+CI ES+RAEKSHTRRHLSEY+H+EAE+ F+ F        
Sbjct: 298 LTQSSQLYLETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTE 357

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             I   V  VL +     LV QL+PDFVPPQ PF+R++YKDAI +L +H IK E G  ++
Sbjct: 358 RVITSLVRYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGEEFK 417

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD I KPIFL RFP E+K+FYMKRCA+D RVTES DVL+P VGEV G
Sbjct: 418 FGDDIAEAAERKMTDTIGKPIFLTRFPLELKSFYMKRCADDPRVTESFDVLMPTVGEVTG 477

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMRI  ++EL+AG+KREG+NP PYYW++DQR+YG+  HGG+GLG ER LAWL +R  V+
Sbjct: 478 GSMRIDSLDELMAGFKREGVNPEPYYWFSDQRRYGSCPHGGYGLGTERILAWLCNRYTVR 537

Query: 549 ECCLYPRFMGRCLP 562
           +C LYPR+ GRC P
Sbjct: 538 DCSLYPRYTGRCKP 551



>gi|170059943|ref|XP_001865582.1| aspartyl-tRNA synthetase [Culex quinquefasciatus]
 gi|167878527|gb|EDS41910.1| aspartyl-tRNA synthetase [Culex quinquefasciatus]
          Length = 550

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 291/554 (52%), Positives = 376/554 (67%), Gaps = 10/554 (1%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXX 69
           + +Y  +  G D T TGT + P+KT + A++  G     +I V    E   K  S     
Sbjct: 4   DELYTSDKRGDDATGTGTSDKPFKTILAAMKHAGKEPFPTIYVDAKDE---KSESPYEVA 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     +V+ +DP+   A  +KI 
Sbjct: 61  AKSQLKKIQKLWTRDNSKNADKAKREEEDAKKREQNLEEARKVVIAEDPSWAPAKAVKIS 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           +   +RG RVK+ GWVHRLR QGK + F+ LRDG+G+LQC+LT   C TY+A++LS ES+
Sbjct: 121 KGGENRGIRVKIYGWVHRLRRQGKGLMFVTLRDGTGFLQCVLTDARCQTYNAVVLSTESS 180

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRHL 248
           V ++G + E+P GKTAP  HEL  DYWE+   AP GG D     LN DA+P +  + RH+
Sbjct: 181 VRLFGTLKEVPEGKTAPGGHELHVDYWELIGLAPAGGADTL---LNEDANPDVQLDNRHI 237

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           +IRGE  S VLK R  IM+AFR H+  +G++EV PP +VQTQVEGGSTLF++NY+GE+A+
Sbjct: 238 MIRGENTSKVLKMRDVIMQAFRAHYQDRGYTEVTPPTLVQTQVEGGSTLFKLNYFGEEAF 297

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EYSH+EAE  FI+F        
Sbjct: 298 LTQSSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYSHVEAECPFISFDDLLDRLE 357

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             + DTVDRVL +     LV +L+P FVPP+RPF RM+Y +AI +LK++N+ KE+G+FYE
Sbjct: 358 DLVVDTVDRVLKSPHGH-LVQELNPGFVPPKRPFRRMNYSEAIVWLKENNVTKEDGTFYE 416

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FGEDIPE PER MTD IN+PI LCRFPAEIK+FYM +C ED R+TESVDVL+P VGE+VG
Sbjct: 417 FGEDIPEGPERKMTDTINEPIMLCRFPAEIKSFYMAKCPEDLRLTESVDVLLPNVGEIVG 476

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMR  D  ELLAGYKREGI+P PYYWYTDQR YGT  HGG+GLG+ERF+ WLL+R +++
Sbjct: 477 GSMRSWDNEELLAGYKREGIDPKPYYWYTDQRVYGTQPHGGYGLGLERFMCWLLNRYHIR 536

Query: 549 ECCLYPRFMGRCLP 562
           E CLYPRF+ RC P
Sbjct: 537 EVCLYPRFLERCRP 550



>gi|198431081|ref|XP_002128269.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Ciona
           intestinalis]
          Length = 559

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/552 (51%), Positives = 379/552 (68%), Gaps = 12/552 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRAL---QVKGDNISILVRKTPEEGYKDISGTXXXX 70
           +Y  E  G DE+  GT+  P+KT +RA+   Q +      +  K P + +  I+      
Sbjct: 17  LYTSEKTGCDESGDGTEAKPFKTILRAMMFHQSEPFPTLYVDSKEPNKKFDPIA------ 70

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I++ +D +LP A  IKI  
Sbjct: 71  KAQLKKQTKIFTAEKRKDVARKVREQEDAERREKNLEDAKKIIISEDKSLPAAKSIKIGA 130

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
           + A RG+RVKV+GW HR+R QGK + FIVLRDGSGYLQ +L  +LC TY+A++LS ESTV
Sbjct: 131 ATAHRGQRVKVNGWSHRIRRQGKTLMFIVLRDGSGYLQAVLNDQLCQTYNAVMLSTESTV 190

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YGVI+ +  GK+AP  HEL+ DYWE+   AP G       LN +AD  ++ + RHLVI
Sbjct: 191 CLYGVITPVMEGKSAPGGHELICDYWELIGLAPPG--GIDTVLNQEADVDVMLDNRHLVI 248

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +L+ RS +M+AFRDH+  +G+ EV PPC+VQTQ EGGSTLF+++++GE+AYLT
Sbjct: 249 RGEQTSKILRVRSYLMQAFRDHYFERGYYEVTPPCLVQTQCEGGSTLFKLDFFGEQAYLT 308

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLPSLGDV+C++ESYRAE+S TRRHL+EY+H+EAE AFITF          
Sbjct: 309 QSSQLYLETCLPSLGDVFCLAESYRAEQSRTRRHLAEYTHVEAECAFITFNDLLDRLEDL 368

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           ICD VD++L +    +L+  L+P FV P+RPF RMDY +AI YLK+H+IKKE+GS+YEFG
Sbjct: 369 ICDVVDKLLKSPAG-ELIKDLNPGFVAPKRPFRRMDYAEAIVYLKEHDIKKEDGSYYEFG 427

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           EDIPE PER MTDQIN+PI LCRFP +IK+FYM++C ++  +TESVD+L+P VGE+VGGS
Sbjct: 428 EDIPEMPERKMTDQINEPILLCRFPYKIKSFYMQKCKDNLELTESVDLLMPNVGEIVGGS 487

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MR+ +  ELL GYK EG++P+ YYWYTDQRK+GT EHGG+GLG+ER L WL  R ++++ 
Sbjct: 488 MRMDNHEELLEGYKSEGVDPSKYYWYTDQRKFGTCEHGGYGLGLERLLTWLTDRYHIRDV 547

Query: 551 CLYPRFMGRCLP 562
           CLYPRF+ RC P
Sbjct: 548 CLYPRFLERCCP 559



>gi|323337256|gb|EGA78509.1| Ded81p [Saccharomyces cerevisiae Vin13]
 gi|323348346|gb|EGA82594.1| Ded81p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 554

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/556 (53%), Positives = 377/556 (67%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL---QVKGDNI--SILVRKTPEEGYKDISGT 66
           ++YI E  G DE T+ G+Q+ P+KT   AL   Q K D     + V KT +  Y++IS +
Sbjct: 3   SLYIKEATGVDEXTTAGSQDHPFKTPAYALFASQQKSDATEPKLFVFKTEDNEYQEISAS 62

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +K+D +LP AIK 
Sbjct: 63  ALKKARKGCDGLKKKAVKQKEQELKKQQKEAENAAKQLSALN---ITIKEDESLPAAIKT 119

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +I  S +  G+RVKVSGW+HRLR+  K + F+VLRDGSG++QC+L+G+L      L L+L
Sbjct: 120 RIYDSYSKVGQRVKVSGWIHRLRSN-KKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTL 178

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTVT+YG I +LP GKTAP   EL  DY+EV   APGG+D+FTNK+   +DPS+L +QR
Sbjct: 179 ESTVTLYGTIVKLPEGKTAPGGVELNVDYYEVVGLAPGGEDSFTNKIAEGSDPSLLLDQR 238

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RG+  SAV+K R+A++K+ R  +D +  +EV PPCMVQTQVEGGSTLF+MNYYGE+
Sbjct: 239 HLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKMNYYGEE 298

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCL SLGDVY I ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 299 AYLTQSSQLYLETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLQH 358

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  +V  VL +     LV QL+P+F  P+ PF+R+ YKDAI +L +H+IK E G  
Sbjct: 359 IETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIKNEEGED 418

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           ++FG+DI E  ER MTD I  PIFL RFP EIK+FYMKRC++D RVTESVDVL+P VGE+
Sbjct: 419 FKFGDDIAEAAERKMTDTIGVPIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEI 478

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI DM+EL+AG+KREGI+   YYW+ DQRKYGT  HGG+G+G ER LAWL  R  
Sbjct: 479 TGGSMRIDDMDELMAGFKREGIDTDAYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFT 538

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 539 VRDCSLYPRFSGRCKP 554



>gi|6321807|ref|NP_011883.1| asparagine--tRNA ligase DED81 [Saccharomyces cerevisiae S288c]
 gi|731638|sp|P38707.1|SYNC_YEAST RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|500693|gb|AAB68874.1| Ded81p: Asparaginyl-tRNA synthetase [Saccharomyces cerevisiae]
 gi|151943961|gb|EDN62254.1| asparaginyl-tRNA synthetase [Saccharomyces cerevisiae YJM789]
 gi|190405803|gb|EDV09070.1| asparaginyl-tRNA synthetase [Saccharomyces cerevisiae RM11-1a]
 gi|256269240|gb|EEU04565.1| Ded81p [Saccharomyces cerevisiae JAY291]
 gi|259147047|emb|CAY80302.1| Ded81p [Saccharomyces cerevisiae EC1118]
 gi|285809921|tpg|DAA06708.1| TPA: asparagine--tRNA ligase DED81 [Saccharomyces cerevisiae S288c]
 gi|323333337|gb|EGA74734.1| Ded81p [Saccharomyces cerevisiae AWRI796]
 gi|323354779|gb|EGA86613.1| Ded81p [Saccharomyces cerevisiae VL3]
 gi|365765349|gb|EHN06860.1| Ded81p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392299072|gb|EIW10167.1| Ded81p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 554

 Score =  595 bits (1535), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/556 (53%), Positives = 377/556 (67%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL---QVKGDNI--SILVRKTPEEGYKDISGT 66
           ++YI E  G DE T+ G+Q+ P+KT   AL   Q K D     + V KT +  Y++IS +
Sbjct: 3   SLYIKEATGVDELTTAGSQDHPFKTPAYALFASQQKSDATEPKLFVFKTEDNEYQEISAS 62

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +K+D +LP AIK 
Sbjct: 63  ALKKARKGCDGLKKKAVKQKEQELKKQQKEAENAAKQLSALN---ITIKEDESLPAAIKT 119

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +I  S +  G+RVKVSGW+HRLR+  K + F+VLRDGSG++QC+L+G+L      L L+L
Sbjct: 120 RIYDSYSKVGQRVKVSGWIHRLRSN-KKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTL 178

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTVT+YG I +LP GKTAP   EL  DY+EV   APGG+D+FTNK+   +DPS+L +QR
Sbjct: 179 ESTVTLYGTIVKLPEGKTAPGGVELNVDYYEVVGLAPGGEDSFTNKIAEGSDPSLLLDQR 238

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RG+  SAV+K R+A++K+ R  +D +  +EV PPCMVQTQVEGGSTLF+MNYYGE+
Sbjct: 239 HLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKMNYYGEE 298

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCL SLGDVY I ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 299 AYLTQSSQLYLETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLQH 358

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  +V  VL +     LV QL+P+F  P+ PF+R+ YKDAI +L +H+IK E G  
Sbjct: 359 IETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIKNEEGED 418

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           ++FG+DI E  ER MTD I  PIFL RFP EIK+FYMKRC++D RVTESVDVL+P VGE+
Sbjct: 419 FKFGDDIAEAAERKMTDTIGVPIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEI 478

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI DM+EL+AG+KREGI+   YYW+ DQRKYGT  HGG+G+G ER LAWL  R  
Sbjct: 479 TGGSMRIDDMDELMAGFKREGIDTDAYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFT 538

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 539 VRDCSLYPRFSGRCKP 554



>gi|213405907|ref|XP_002173725.1| cytoplasmic asparagine-tRNA ligase Nrs1 [Schizosaccharomyces
           japonicus yFS275]
 gi|212001772|gb|EEB07432.1| cytoplasmic asparagine-tRNA ligase Nrs1 [Schizosaccharomyces
           japonicus yFS275]
          Length = 570

 Score =  595 bits (1534), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/557 (52%), Positives = 383/557 (68%), Gaps = 5/557 (0%)

Query: 9   KSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDI-SGTX 67
           +SS T Y+DEV G++ET  G+++AP+KTA++A++   +   IL+RK   + ++ I +   
Sbjct: 16  ESSVTYYVDEVAGNNETGNGSESAPFKTALKAVETNKE-CKILIRKEAGKPFEPIGTNAL 74

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       +VLK+  + P A++ K
Sbjct: 75  KKARKGAEQAARKKAKADELKAAAAAKAASSKAADAARLEAAKNLVLKEPADAPAAVESK 134

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH--TYDALILS 185
           I      R KRVKV GWVHRLR Q K + FIVLRDG+GYLQ +LTG++     Y+ L   
Sbjct: 135 ICALEPLREKRVKVYGWVHRLRNQ-KGIIFIVLRDGTGYLQAVLTGDVYEKANYEFLTAG 193

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
            ES + + G +  +P GK+AP  HEL+ DY+ + H AP G++AFTN+LNA+ADPS+L +Q
Sbjct: 194 PESAIELRGTLKPVPEGKSAPGGHELVVDYYTIVHAAPIGEEAFTNQLNAEADPSVLLDQ 253

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHLVIRGETASAVLK R+  ++A RD +++   +EV PPCMVQTQVEGGSTLF+++YYG+
Sbjct: 254 RHLVIRGETASAVLKVRARALRAVRDTYEALHLTEVTPPCMVQTQVEGGSTLFKLDYYGQ 313

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
            AYLTQ+SQLYLE  LP+LGDV+CI ES+RAEKS TRRHLSEY+H+EAE+ F+ F     
Sbjct: 314 PAYLTQSSQLYLEASLPALGDVFCIQESFRAEKSLTRRHLSEYTHVEAELVFLDFETYLQ 373

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                IC TV+R+LA+     L+ QL+P F  P+RPF+R+ Y DAI+YL +HNI    G 
Sbjct: 374 HLEEFICQTVERLLADPVAAPLIKQLNPGFKMPERPFMRLKYADAIKYLNEHNILDGEGK 433

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            ++FG+DI E  ER MTDQIN+PIFL  FP E+KAFYMKR      +TESVDVL+P VGE
Sbjct: 434 QHKFGDDIAEAAERKMTDQINRPIFLTYFPTELKAFYMKRVPGHPEITESVDVLMPNVGE 493

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI DM+ELLAGYKREGI+P+PYYW+TDQRKYG+  HGG+GLG+ERFLAWLL+R 
Sbjct: 494 IVGGSMRIDDMDELLAGYKREGIDPSPYYWFTDQRKYGSAPHGGYGLGLERFLAWLLNRY 553

Query: 546 NVKECCLYPRFMGRCLP 562
            V+ECCL+PRF  RC P
Sbjct: 554 TVRECCLFPRFTERCKP 570



>gi|109122288|ref|XP_001085923.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic [Macaca
           mulatta]
          Length = 559

 Score =  595 bits (1533), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/553 (51%), Positives = 376/553 (67%), Gaps = 13/553 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPE-EGYKDISGTXXXX 70
           +Y+ +  G D T  GT+  P+KT ++AL   G     +I +    E E +  IS +    
Sbjct: 16  LYVSDREGCDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWNVISKSQLKN 75

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K DP LP    +KI  
Sbjct: 76  IKKMWHREQMKSESREKKEAEDSLRREKNLEEAKK------ITIKNDPALPEPKCVKISA 129

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V
Sbjct: 130 LEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSV 189

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++I
Sbjct: 190 AVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMI 247

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGE  S +LKARS I + FRDHF  +G+ E+ PP +VQTQVEGG+TLF++NY+GE+A+LT
Sbjct: 248 RGENMSKILKARSMITRCFRDHFFDRGYHEITPPSLVQTQVEGGATLFKLNYFGEEAFLT 307

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          
Sbjct: 308 QSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDL 367

Query: 371 ICDTVDRVLANETTRKLVYQLHP-DFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
           +CD VDR+L +     +VY+L+P +  PP+RPF RM+Y DAI +LK+H+IKKE+G+FYEF
Sbjct: 368 VCDVVDRILKSPAG-SIVYELNPVELQPPKRPFKRMNYSDAIIWLKEHDIKKEDGTFYEF 426

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+ +TESVDVL+P VGE+VGG
Sbjct: 427 GEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSCLTESVDVLMPNVGEIVGG 486

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMR SD  E+LAGYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++
Sbjct: 487 SMRTSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRD 546

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 547 VCLYPRFVQRCTP 559



>gi|31127138|gb|AAH52849.1| Asparaginyl-tRNA synthetase [Mus musculus]
          Length = 548

 Score =  595 bits (1533), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 281/551 (50%), Positives = 375/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 6   LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 60

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 61  SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 121 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 181 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 239 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 299 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLV 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI++LK+H++KKE+G+FYEFG+
Sbjct: 359 CDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGD 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 418 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HG +GLG+ERFL+W+L+R ++++ C
Sbjct: 478 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGEYGLGLERFLSWILNRYHIRDVC 537

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 538 LYPRFLQRCRP 548



>gi|358057054|dbj|GAA96961.1| hypothetical protein E5Q_03635 [Mixia osmundae IAM 14324]
          Length = 566

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/561 (53%), Positives = 382/561 (68%), Gaps = 13/561 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKT---------PEEG---YK 61
           VY+D+  GSDE   G+   P+++ + A   KG  + +LVRK          P +G   + 
Sbjct: 7   VYVDDKVGSDELGDGSIGRPFQSPLGAYIAKGTEVKVLVRKALSPTQDEPAPAQGGQEWV 66

Query: 62  DISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLP 121
           + + +                                              V+  +P   
Sbjct: 67  EATSSSLKKAKKLHEAHLRKQQKAQDTKQRDEAAAKAKADSDAAKIEAAKAVVITEPEGA 126

Query: 122 LAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDA 181
            A+KIK+RQ+  +RG RV+V GWVHRLR Q   + F+VLRDG+GYLQC+L+G+L  TYD+
Sbjct: 127 QAVKIKLRQTTQNRGHRVRVFGWVHRLRQQ-SGLTFLVLRDGTGYLQCVLSGKLIETYDS 185

Query: 182 LILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSI 241
           L L+LE++V I G I+ LP GKTAPD HEL+AD+W V   APGG+ A TNK+   A   +
Sbjct: 186 LTLNLEASVEITGTITALPEGKTAPDGHELMADWWRVLGAAPGGEAAITNKVAETASADL 245

Query: 242 LYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMN 301
           L + RHLVIRGETASAVL+ R+A++KAFR+ ++  G  EV PPCMVQTQVEGGSTLF  +
Sbjct: 246 LADNRHLVIRGETASAVLRVRAALLKAFRETYERLGLLEVTPPCMVQTQVEGGSTLFSFD 305

Query: 302 YYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFX 361
           YYG++AYLTQTSQLYLETCLP+LGDV+C+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF 
Sbjct: 306 YYGQQAYLTQTSQLYLETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHVEAELAFLTFD 365

Query: 362 XXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKK 421
                    IC +V+ VL +     L+ QL+PDF PP RPF+RMDYKDAI+YL+D+ I  
Sbjct: 366 DLLEHIEEMICGSVELVLKDPVAGPLLKQLNPDFKPPTRPFMRMDYKDAIKYLQDNEILT 425

Query: 422 ENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIP 481
            +G  +E G DI E PER MTD+I KPIFLCRFP EIKAFYMK+C ED   TESVDVL+P
Sbjct: 426 GDGKRHELGVDISEAPERQMTDRIGKPIFLCRFPKEIKAFYMKKCPEDPGYTESVDVLMP 485

Query: 482 GVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWL 541
            VGE+VGGSMRISD+NELL GYKREGI+PTPYYW+TDQR YG+   GG+GLG+ER LAWL
Sbjct: 486 NVGEIVGGSMRISDINELLEGYKREGIDPTPYYWFTDQRVYGSGNSGGYGLGLERCLAWL 545

Query: 542 LHRDNVKECCLYPRFMGRCLP 562
            +R  V++C LYPR+ GR  P
Sbjct: 546 TNRFTVRDCSLYPRWTGRATP 566



>gi|401625480|gb|EJS43488.1| ded81p [Saccharomyces arboricola H-6]
          Length = 554

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 290/556 (52%), Positives = 378/556 (67%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL---QVKGDNI--SILVRKTPEEGYKDISGT 66
           ++YI E  G DE T+ G+Q+ P+KT   AL   Q K D     + V KT +  +++IS +
Sbjct: 3   SLYIKEATGVDELTTAGSQDQPFKTPAYALFASQQKSDTTEPKLFVFKTEDNEFQEISAS 62

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +K+D +LP A+K 
Sbjct: 63  ALKKARKGCDGLKKKAIKQKEQELKKQQKDAEDAAKQLSALK---ITIKEDESLPAAVKA 119

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +I+ S    G+RVK+SGW+HRLR+  K + FIVLRDGSG++QC+L+G+L      L L+L
Sbjct: 120 RIQDSYGKVGQRVKISGWIHRLRSN-KKVIFIVLRDGSGFIQCVLSGDLALAQQTLDLTL 178

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTVT+YG +++LP GKTAP   EL  DY+EV   APGG+D+FTN++   +DPS+L +QR
Sbjct: 179 ESTVTLYGTVAKLPEGKTAPGGVELNVDYYEVVGLAPGGEDSFTNQIAEGSDPSLLLDQR 238

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RG+  SAV+K R+A++++ R  +D +  +EV PPCMVQTQVEGGSTLF+MNYYGE+
Sbjct: 239 HLALRGDALSAVMKVRAALLRSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKMNYYGEE 298

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDVY I ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 299 AYLTQSSQLYLETCLPALGDVYSIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLHH 358

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I   V  VL +     LV QL+PDF  P+ PF+R++YKDAI +LK+H+IK E G  
Sbjct: 359 IETLIVKCVQYVLEDPIAGPLVKQLNPDFKAPKSPFMRLEYKDAITWLKEHDIKNEEGED 418

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           +EFG+DI E  ER MTD I  PI L RFP EIK+FYMKRC++D RVTESVDVL+P VGE+
Sbjct: 419 FEFGDDIAEAAERKMTDTIGVPILLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEI 478

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI D++EL+AG+KREGI+   YYW+ DQR+YGT  HGG+G+G ER L WL  R  
Sbjct: 479 TGGSMRIDDVDELMAGFKREGIDTNAYYWFIDQRRYGTCPHGGYGIGTERILTWLCDRFT 538

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 539 VRDCSLYPRFSGRCKP 554



>gi|195438242|ref|XP_002067046.1| GK24233 [Drosophila willistoni]
 gi|194163131|gb|EDW78032.1| GK24233 [Drosophila willistoni]
          Length = 558

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/556 (51%), Positives = 384/556 (69%), Gaps = 16/556 (2%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILV-RKTPE--EGYKDISGTX 67
            ++  E  G+DET  G++  P+KT ++A++  G     +I V  K P+  E Y+  + + 
Sbjct: 13  AIFTSEKRGNDETGEGSEAKPFKTILQAMRHAGKEPFPTIYVDSKDPDAKETYEPAAKSQ 72

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       + +++DP  P+A K++
Sbjct: 73  LKKIQKLFVREGHKNAEKLQREAGDAEKRQQNLEEAKK------VKIQEDPAWPVAKKVR 126

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I + VA RG+RVK+ GWVHRLR QGK + FI LRDG+G+LQC+L   LC TY+AL L+ E
Sbjct: 127 IVEGVAHRGERVKIYGWVHRLRRQGKALIFITLRDGTGFLQCVLNDLLCQTYEALTLTTE 186

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQR 246
           S+V +YG +  +P GKTAP  HE+  DYWE+   AP GG DA    LN +A P +  +QR
Sbjct: 187 SSVVLYGTLKLVPEGKTAPGGHEMSVDYWELVGLAPAGGADAI---LNEEAQPDVQLDQR 243

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           H++IRGE  S VLK RS +++AFR H+  + ++EV PP +VQTQVEGGSTLF++ Y+GE+
Sbjct: 244 HIMIRGENTSNVLKMRSVVLQAFRAHYLGRDYNEVTPPTLVQTQVEGGSTLFKLQYFGEE 303

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  FI+F      
Sbjct: 304 AYLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFISFDDLLDR 363

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               +CD VDRVL +     LVY+L+PDF  P++PF RM+Y DAI++LK++N+ K++G+F
Sbjct: 364 LEDLVCDVVDRVLKSPWGH-LVYELNPDFKVPKKPFRRMNYSDAIKWLKENNVTKDDGTF 422

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           YEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM RC ED R+TESVDVL+P VGE+
Sbjct: 423 YEFGEDIPEAPERKMTDTINEPIMLCRFPVEIKSFYMSRCPEDQRLTESVDVLLPNVGEI 482

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
           VGGSMRI +  ELL GY+REGI+P PYYWYTDQR YG+  HGG+GLG+ERF+ WLL+R +
Sbjct: 483 VGGSMRIWNSEELLKGYEREGIDPKPYYWYTDQRVYGSMPHGGYGLGLERFICWLLNRYH 542

Query: 547 VKECCLYPRFMGRCLP 562
           +++ CLYPRF+ RC P
Sbjct: 543 IRDVCLYPRFLDRCKP 558



>gi|366988149|ref|XP_003673841.1| hypothetical protein NCAS_0A09020 [Naumovozyma castellii CBS 4309]
 gi|342299704|emb|CCC67460.1| hypothetical protein NCAS_0A09020 [Naumovozyma castellii CBS 4309]
          Length = 555

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 288/556 (51%), Positives = 383/556 (68%), Gaps = 12/556 (2%)

Query: 15  YIDEVNGSDE-TSTGTQNAPYKTAVRAL----QVKGDNIS---ILVRKTPEEGYKDISGT 66
           YI E  G DE T +G+Q  P+KT   AL    Q  G++ +   + V K  +  + +IS +
Sbjct: 4   YIKESVGIDELTVSGSQEQPFKTPAFALFANLQNNGEDAAEPKLFVFKPEDNEFVEISAS 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +++D +LP+A K 
Sbjct: 64  ALKKARKGADGLKKKLLKQKEQELKKQQQDVENAAKQMAAMN---ITIEEDKSLPVAKKF 120

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KI+ S    G+RVK+SGWVHR R+  K + F+VLRDG+G+LQC+LTG+L      L ++L
Sbjct: 121 KIKGSYGQVGQRVKISGWVHRFRSN-KKVVFLVLRDGTGFLQCVLTGDLALAKQTLDITL 179

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           E+TVT+YG I ++P GKTAP + EL+ DY+EV   AP G++AFTNK+  D+DPS+L +QR
Sbjct: 180 ETTVTLYGTIIKVPEGKTAPGDVELVVDYYEVVGQAPSGEEAFTNKIAEDSDPSLLLDQR 239

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RGET S V+K R+A+++A R  ++ +G  EV PPCMVQTQVEGGSTLF+++YYGE+
Sbjct: 240 HLALRGETLSGVMKVRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGSTLFKLDYYGEE 299

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           A+LTQ+SQLYLETCLP+LGDV+C+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 300 AFLTQSSQLYLETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEH 359

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  +V  V+ +     +V QLHP FVPP+ PF+R++YKDAI +L++HNIK E+G  
Sbjct: 360 IETLIVKSVQYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKNEDGED 419

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           ++FG+DI E  ER MTD +N PI L RFP EIK+FYM +C +D RVTESVDVL+P VGE+
Sbjct: 420 FKFGDDIAEAAERKMTDTLNVPILLTRFPVEIKSFYMPKCKDDPRVTESVDVLMPTVGEI 479

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRISD++EL+AG+KREGI+P PYYW+ DQRKYGT  HGG+GLG ER LAWL +R  
Sbjct: 480 TGGSMRISDIDELMAGFKREGIDPKPYYWFIDQRKYGTCPHGGYGLGTERILAWLCNRFT 539

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 540 VRDCSLYPRFSGRCKP 555



>gi|195398059|ref|XP_002057642.1| GJ17991 [Drosophila virilis]
 gi|194141296|gb|EDW57715.1| GJ17991 [Drosophila virilis]
          Length = 558

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 274/452 (60%), Positives = 347/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +DP+LP+A +I+I +    R  RVK+ GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 111 VKISEDPSLPVAKRIRIVEGTEQRNTRVKIYGWVHRLRRQGKSLMFITLRDGTGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
              LC TY+AL+LS ESTV +YG +  LP GKTAP  HEL  DYWE +    PGG DA  
Sbjct: 171 NDLLCQTYEALMLSTESTVLLYGTLRLLPEGKTAPGGHELNVDYWELIGLAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS +M+AFR H+  +G++EV PP +VQTQ
Sbjct: 230 --LNEEAHPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRGHYIERGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+M Y+GE+AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H
Sbjct: 288 VEGGSTLFKMQYFGEEAYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FITF          +CD VDRVL +     LV +L+PDF PP++PF RM Y DA
Sbjct: 348 IEAECPFITFDDLLDRLEDLVCDVVDRVLKSPWGY-LVKELNPDFKPPKKPFRRMPYADA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ KE+G+FYEFGEDIPE PER MTD IN+PI L +FPAEIK+FYM RC +D 
Sbjct: 407 IKWLKENNVPKEDGTFYEFGEDIPEAPERKMTDTINEPILLIKFPAEIKSFYMSRCKDDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  EL+ GY+REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIYDSAELMKGYEREGIDPKPYYWYTDQRVYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R ++++ CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIRDVCLYPRFLDRCKP 558



>gi|321476711|gb|EFX87671.1| hypothetical protein DAPPUDRAFT_306578 [Daphnia pulex]
          Length = 560

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/566 (52%), Positives = 383/566 (67%), Gaps = 15/566 (2%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVR-KTPE 57
           E ++  ++   ET Y  E +GSDE   GTQ  PYKT + AL+  G     +I V  KT +
Sbjct: 6   EDMKGLAIGPGET-YTSEKHGSDENGEGTQEKPYKTVLEALRRAGQEPFPAIFVDGKTED 64

Query: 58  EGYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQD 117
           + Y+  S +                                             IV+K+D
Sbjct: 65  KKYEPASASSMKKMIKVFKIEQKKTNEKAKKEAEDAEKRGKNLEEAKK------IVIKED 118

Query: 118 PNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
            +LP A   KI +    RG+RVKV GWVHRLR QGK + FI LRDG+G LQC+L+ +LC 
Sbjct: 119 VSLPPAQLAKISKLEPFRGQRVKVFGWVHRLRRQGKALMFITLRDGTGLLQCVLSDQLCQ 178

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNAD 236
           TYDA+ LS ES+V ++G +  +P GK+AP  HEL  DYW+ +    PGG +A    LN D
Sbjct: 179 TYDAVTLSTESSVQLFGTLKLVPEGKSAPGGHELNVDYWKLIGSAPPGGAEAL---LNED 235

Query: 237 ADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGST 296
           A P +  +QRH++IRGE  S VL+ RS I +AFRDH+ S+G++EV PP  VQTQVEGGST
Sbjct: 236 AHPDVQLDQRHMMIRGENTSKVLRLRSVITQAFRDHYSSRGYNEVAPPTFVQTQVEGGST 295

Query: 297 LFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMA 356
           LFE+NY+GEKAYLTQ+SQLYLET +P+LGDVYCI++SYRAE+S TRRHLSEYSH+EAE  
Sbjct: 296 LFELNYFGEKAYLTQSSQLYLETAIPALGDVYCIAQSYRAEQSRTRRHLSEYSHVEAECP 355

Query: 357 FITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKD 416
           FI+F          + D  +RV+A+     LV +L+P FV P++PF RM+Y +AI YLK+
Sbjct: 356 FISFDDLLDRLEDLVVDVSERVMASPYA-NLVLELNPTFVVPKKPFRRMNYSEAIVYLKE 414

Query: 417 HNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESV 476
           + I KE+GSFYEFGEDIPE PER MTD+I++PI LCRFPA IKAFYMKRC ED ++TESV
Sbjct: 415 NGITKEDGSFYEFGEDIPEMPERKMTDKISEPIMLCRFPAGIKAFYMKRCPEDRQLTESV 474

Query: 477 DVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVER 536
           D+L+PGVGE++GGSMR  D +EL+  +K   I+PTPYYWY DQR++GT  HGG+GLG+ER
Sbjct: 475 DLLMPGVGEIIGGSMRTDDHDELVEAFKAADIDPTPYYWYIDQRRFGTCPHGGYGLGLER 534

Query: 537 FLAWLLHRDNVKECCLYPRFMGRCLP 562
           FL W+L+R +++E CLYPRF+ RC P
Sbjct: 535 FLCWMLNRYHIREVCLYPRFLERCKP 560



>gi|291231216|ref|XP_002735562.1| PREDICTED: asparaginyl-tRNA synthetase-like [Saccoglossus
           kowalevskii]
          Length = 562

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 291/563 (51%), Positives = 378/563 (67%), Gaps = 8/563 (1%)

Query: 1   ETLQKPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGY 60
           E +   S+     +YI E  GSD +  GTQ+ P+KT ++A++  G        K   +G 
Sbjct: 7   EKMADLSLGDDTVLYISEKEGSD-SGDGTQDKPFKTVLQAMKSYGKEP---FPKMYVDGK 62

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
           ++                                                 IV+K++P+L
Sbjct: 63  EENQRWEELSLAQRKKITKMWSKEQRKLVEKEKKEAEDLKRREENLLKAKEIVIKENPDL 122

Query: 121 PLAIKIKIRQSVASRGK-RVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTY 179
           P    IKI     +RG  RVKV GWVHRLR QGK + FI+LRDG+GYLQC+ +  LC +Y
Sbjct: 123 PAPKLIKIALCEKNRGDTRVKVLGWVHRLRRQGKALMFIILRDGTGYLQCVCSDLLCQSY 182

Query: 180 DALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADP 239
           +AL LS ESTV + G I E+P GK+AP  HEL+ DYWE+   AP G     N LN ++  
Sbjct: 183 EALSLSTESTVFVCGTIKEVPDGKSAPGGHELIVDYWELVSAAPAG--GIDNILNEESHV 240

Query: 240 SILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFE 299
            +  + RH++IRGE  S +LK RS + + FRDH+ +  + E+ PP +VQTQVEGGSTLF+
Sbjct: 241 DVQLDNRHMMIRGENLSKILKIRSVVTQCFRDHYFNNSYFEIFPPTLVQTQVEGGSTLFK 300

Query: 300 MNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFIT 359
           +NY+GE++YLTQ+SQLYLET LPS+GDV+CI+ SYRAE+S TRRHLSEY+H+EAE +FI 
Sbjct: 301 LNYFGEESYLTQSSQLYLETALPSMGDVFCIASSYRAEQSRTRRHLSEYTHVEAECSFIC 360

Query: 360 FXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI 419
           F          +CD V+R L N    +L+ +LHP+F PP+RPF RM+Y +AI YL++H I
Sbjct: 361 FDDLLNRIESLVCDVVERAL-NSPVGQLIKELHPEFKPPKRPFKRMNYSEAIVYLREHEI 419

Query: 420 KKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVL 479
           KKE+ ++YEFGEDIPE PER MTDQIN+PIFLCRFP EIK+FYM RC E+ +VTESVD+L
Sbjct: 420 KKEDDTYYEFGEDIPEMPERKMTDQINEPIFLCRFPTEIKSFYMFRCPENRKVTESVDLL 479

Query: 480 IPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLA 539
           +P VGE+VGGSMRI D  ELLAGYKREGI+PTPYYWYTDQRKYG+  HGG+GLG+ERFL 
Sbjct: 480 MPNVGEIVGGSMRIWDNEELLAGYKREGIDPTPYYWYTDQRKYGSCPHGGYGLGLERFLT 539

Query: 540 WLLHRDNVKECCLYPRFMGRCLP 562
           WLL+R ++++ CLYPRF GRC P
Sbjct: 540 WLLNRPHIRDVCLYPRFTGRCKP 562



>gi|219275589|ref|NP_001020806.2| asparaginyl-tRNA synthetase, cytoplasmic isoform 1 [Rattus
           norvegicus]
 gi|149064471|gb|EDM14674.1| rCG46601, isoform CRA_b [Rattus norvegicus]
          Length = 558

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 280/551 (50%), Positives = 374/551 (67%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 16  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 70

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 71  SQMKNIKKMWHREQMKSDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL 130

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 131 EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 190

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 191 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 248

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 249 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 308

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF          +
Sbjct: 309 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLSRLEDLV 368

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +VY L+P+F  P+RPF RM+Y DAI++L++H++KKE+G+FYEFG+
Sbjct: 369 CDVVDRVLKSPVA-SIVYDLNPNFKAPKRPFRRMNYSDAIEWLREHDVKKEDGTFYEFGD 427

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGGSM
Sbjct: 428 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSM 487

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++ C
Sbjct: 488 RSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVC 547

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 548 LYPRFLQRCRP 558



>gi|195161006|ref|XP_002021361.1| GL25284 [Drosophila persimilis]
 gi|194118474|gb|EDW40517.1| GL25284 [Drosophila persimilis]
          Length = 517

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 276/452 (61%), Positives = 348/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I + +D +LP A KIKI +    RG RVK+ GWVHRLR QGK + F+ LRDG+G+LQC+L
Sbjct: 70  IRILEDASLPKARKIKIAKGPEFRGVRVKIFGWVHRLRRQGKALMFLTLRDGTGFLQCVL 129

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFT 230
           T  LC TY AL+LS ES+V +YG++  +P+GK AP  HEL  DYWE+   AP GG DA  
Sbjct: 130 TDLLCQTYQALVLSTESSVVLYGILKAVPSGKIAPGGHELHVDYWELIGLAPPGGADAI- 188

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS +M+AFRDH+  +G++EV PP +VQTQ
Sbjct: 189 --LNEEALPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRDHYFDRGYNEVTPPTLVQTQ 246

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+M ++GE+A+LTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H
Sbjct: 247 VEGGSTLFKMQFFGEEAFLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTH 306

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FI++          +CD VDRVL +     LV +L+PDF PP++PF RMDY  A
Sbjct: 307 VEAECPFISYDDLLDRLEDLVCDVVDRVLKSPYGH-LVMELNPDFKPPKKPFRRMDYAAA 365

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK +N+ K++G+FYEFGEDIPE PER MTD IN+PI LCRFP  IK+FYM RC ED 
Sbjct: 366 IEWLKKNNVTKDDGTFYEFGEDIPEAPERKMTDTINEPILLCRFPVAIKSFYMSRCPEDK 425

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D  ELL GYKREGI+PTPYYWYTDQR YGT  HGG+
Sbjct: 426 RLTESVDVLLPNVGEIVGGSMRIWDSEELLNGYKREGIDPTPYYWYTDQRIYGTIPHGGY 485

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 486 GLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 517



>gi|254565875|ref|XP_002490048.1| Cytosolic asparaginyl-tRNA synthetase, required for protein
           synthesis [Komagataella pastoris GS115]
 gi|238029844|emb|CAY67767.1| Cytosolic asparaginyl-tRNA synthetase, required for protein
           synthesis [Komagataella pastoris GS115]
 gi|328350452|emb|CCA36852.1| asparaginyl-tRNA synthetase [Komagataella pastoris CBS 7435]
          Length = 551

 Score =  592 bits (1526), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 369/552 (66%), Gaps = 2/552 (0%)

Query: 11  SETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXX 70
           S T YI+E++GSDETS+G++  P+KTA  A     D   + V KT ++G +D        
Sbjct: 2   SATYYINELSGSDETSSGSKEQPFKTAAYAFYRTADA-KLFVFKTLDDGTQDFVEISASA 60

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I +K+D +LP A  IK+R 
Sbjct: 61  LKKAKKGAEGLKKKLQKANLAAEKDAAKKAAEAASQLEAMKITIKEDESLPEARTIKLRA 120

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
              + G RV+V GW+HRLR Q K + FIVLRDG+G+LQCLL+G+L + Y    L+LESTV
Sbjct: 121 LQDNLGTRVRVHGWIHRLRAQ-KGLVFIVLRDGTGFLQCLLSGDLANAYQTSTLTLESTV 179

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
           T+ G++ +LPAGK AP   EL  DY+E+   AP GDD F+NK+   ADPS+L +QRHL I
Sbjct: 180 TLKGIVEKLPAGKQAPGGVELKVDYYEIIGLAPAGDDCFSNKIQEGADPSLLLDQRHLAI 239

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGET SAVLK R+++++A R  +D +G  EV PPCMVQTQVEGGSTLF++ YYGE+AYLT
Sbjct: 240 RGETLSAVLKVRASLLQAIRRVYDEEGVIEVTPPCMVQTQVEGGSTLFKLQYYGEEAYLT 299

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLET LP+LGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+AF+TF          
Sbjct: 300 QSSQLYLETALPALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELAFLTFEDLLSHIERV 359

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           I  TV  V+ +     LV QL+P F  P+ PF RM+Y +A+++L DH+I  E G  ++FG
Sbjct: 360 ITKTVKYVVNDPVAGPLVKQLNPGFAAPELPFKRMEYVEALKWLNDHSIPNEEGQPFKFG 419

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           +DI E  ER MTD I  PI L RFP EIK+FYMKRCA+D RVTESVDVL+P VGE+ GGS
Sbjct: 420 DDIAEAAERKMTDTIGVPILLTRFPLEIKSFYMKRCADDPRVTESVDVLMPTVGEITGGS 479

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI  +NELL G++RE ++ + YYW+ DQRKYGT  HGG+GLG ER LAWL  R  VK+C
Sbjct: 480 MRIDSLNELLEGFEREKLDKSAYYWFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVKDC 539

Query: 551 CLYPRFMGRCLP 562
            LYPRF GRC P
Sbjct: 540 SLYPRFTGRCKP 551



>gi|148677755|gb|EDL09702.1| asparaginyl-tRNA synthetase, isoform CRA_b [Mus musculus]
 gi|148677756|gb|EDL09703.1| asparaginyl-tRNA synthetase, isoform CRA_b [Mus musculus]
          Length = 515

 Score =  592 bits (1525), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 266/451 (58%), Positives = 350/451 (77%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I++K DP+LP    +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L
Sbjct: 68  IIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVL 127

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           + +LC  Y+ ++LS ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N
Sbjct: 128 SDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADN 185

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +N ++D  +    RH++IRGE  S +LKARS I + FRDHF  +G+ EV  P +VQTQV
Sbjct: 186 LINEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQV 245

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+++Y+GE+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+
Sbjct: 246 EGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHV 305

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  F+TF          +CD VDRVL +     +VY+L+P+F PP+RPF RM+Y DAI
Sbjct: 306 EAECPFLTFEDLLNRLEDLVCDVVDRVLKSPVA-SIVYELNPNFKPPKRPFRRMNYSDAI 364

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++LK+H++KKE+G+FYEFG+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R
Sbjct: 365 EWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPR 424

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE+VGGSMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+G
Sbjct: 425 LTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYG 484

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL+W+L+R ++++ CLYPRF+ RC P
Sbjct: 485 LGLERFLSWILNRYHIRDVCLYPRFLQRCRP 515



>gi|472391938|ref|XP_004415254.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Odobenus
           rosmarus divergens]
          Length = 559

 Score =  592 bits (1525), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/551 (50%), Positives = 374/551 (67%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I +    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYIDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K D +LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKSESWEKKEAEDNLRREKNLEEAKKITIKNDLSLPEPKCVKIHAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GW+HRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L+ ES+V 
Sbjct: 132 EGYRGQRVKVFGWIHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLATESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETC+P+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+  PP+RP  RM+Y DAI +LK+HNIK+E+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAA-SIVRDLNPNVKPPKRPVKRMNYSDAIVWLKEHNIKREDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPLEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFMGRCLP 562
           LYPRF+ RC P
Sbjct: 549 LYPRFVQRCKP 559



>gi|351704024|gb|EHB06943.1| Asparaginyl-tRNA synthetase, cytoplasmic [Heterocephalus glaber]
          Length = 622

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/549 (51%), Positives = 373/549 (67%), Gaps = 10/549 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 6   LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 60

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 61  SQMKSIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKKDPSLPEPECVKICAL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 121 ERYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 181 VYGILNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 239 GENMSKILKARCTVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 299 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 359 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYSDAIVWLKEHNVKKEDGTFYEFGE 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE++GGSM
Sbjct: 418 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEILGGSM 477

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 478 RTWDSEELLAGYKREGIDPTPYYWYTDQRKYGTYPHGGYGLGLERFLTWILNRYHIRDVC 537

Query: 552 LYPRFMGRC 560
           LYPRF+  C
Sbjct: 538 LYPRFVQHC 546



>gi|512993651|ref|XP_004858454.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X3
           [Heterocephalus glaber]
 gi|512993653|ref|XP_004858455.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic isoform X4
           [Heterocephalus glaber]
          Length = 515

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 269/451 (59%), Positives = 349/451 (77%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I +K+DP+LP    +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L
Sbjct: 68  ITIKKDPSLPEPECVKICALERYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVL 127

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           + +LC  Y+ ++LS ES+V +YG+++  P GK AP  HEL  D+WE+   AP G     N
Sbjct: 128 SDDLCQCYNGVVLSTESSVAVYGILNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADN 185

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +N ++D  +    RH++IRGE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQV
Sbjct: 186 LINEESDVDVQLNNRHMMIRGENMSKILKARCTVTRCFRDHFFDRGYYEVTPPTLVQTQV 245

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+++Y+GE+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+
Sbjct: 246 EGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHV 305

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  F+TF          +CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI
Sbjct: 306 EAECPFLTFEDLLNRLEDLVCDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYSDAI 364

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            +LK+HN+KKE+G+FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R
Sbjct: 365 VWLKEHNVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPR 424

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE++GGSMR  D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+G
Sbjct: 425 LTESVDVLMPNVGEILGGSMRTWDSEELLAGYKREGIDPTPYYWYTDQRKYGTYPHGGYG 484

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL W+L+R ++++ CLYPRF+ RC P
Sbjct: 485 LGLERFLTWILNRYHIRDVCLYPRFVQRCKP 515



>gi|332022079|gb|EGI62404.1| Asparaginyl-tRNA synthetase, cytoplasmic [Acromyrmex echinatior]
          Length = 516

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 272/452 (60%), Positives = 351/452 (77%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IV++++  LP A KIKI+Q+V  R +RVK+ GWVHRLR QGK + FI LRDG+G+LQC+L
Sbjct: 69  IVIEENKTLPEAKKIKIKQAVDHRDQRVKLYGWVHRLRRQGKALMFITLRDGTGFLQCVL 128

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFT 230
           T +LC TY+AL L+ E+ V ++G++  +P GK AP +HEL  DYWE V    PGG D+  
Sbjct: 129 TDKLCQTYNALTLATEAAVQLFGILKAVPEGKNAPGDHELSVDYWELVGSSPPGGADSI- 187

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S +L  RS +M+A RDH+  +G+ EV PP +VQTQ
Sbjct: 188 --LNEEALPDVQLDNRHIMIRGENTSRILIMRSILMQAVRDHYKDRGYHEVTPPTLVQTQ 245

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+++Y+GE A+LTQ+SQLYLETCLP++GDVYCI++SYRAE+S TRRHL+EY+H
Sbjct: 246 VEGGSTLFKLDYFGEPAFLTQSSQLYLETCLPAMGDVYCIAQSYRAEQSRTRRHLAEYTH 305

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FITF          ICD V+RVL   +   LV +L+P+F  P++PF RM+Y DA
Sbjct: 306 IEAECPFITFDDLLDRLEDLICDVVERVLKT-SLGHLVKELNPNFQIPKKPFKRMNYSDA 364

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I+YL+++NI KE+GSFYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC +D 
Sbjct: 365 IEYLRENNITKEDGSFYEFGEDIPEMPERKMTDAINEPIMLCRFPAEIKSFYMQRCKDDE 424

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMR  D  EL+ GYKRE I+PT YYWYTDQRKYG+  HGG+
Sbjct: 425 RLTESVDVLLPNVGEIVGGSMRTWDHEELMEGYKRENIDPTLYYWYTDQRKYGSCPHGGY 484

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 485 GLGLERFLCWLLNRYHIREVCLYPRFLERCRP 516



>gi|512865432|ref|XP_004890930.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic, partial
           [Heterocephalus glaber]
          Length = 555

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 282/546 (51%), Positives = 372/546 (68%), Gaps = 10/546 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+DP+LP    +KI   
Sbjct: 72  SQMKSIKKMWHREQMKNESREKKEAEDNLRREKNLEEAKKITIKKDPSLPEPECVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 ERYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG+++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGILNLTPKGKQAPGGHELNCDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKAR  + + FRDHF  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARCTVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLV 369

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
           CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G+FYEFGE
Sbjct: 370 CDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYSDAIVWLKEHNVKKEDGTFYEFGE 428

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE++GGSM
Sbjct: 429 DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEILGGSM 488

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R  D  ELLAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ C
Sbjct: 489 RTWDSEELLAGYKREGIDPTPYYWYTDQRKYGTYPHGGYGLGLERFLTWILNRYHIRDVC 548

Query: 552 LYPRFM 557
           LYPRF+
Sbjct: 549 LYPRFV 554



>gi|195115232|ref|XP_002002168.1| GI17232 [Drosophila mojavensis]
 gi|193912743|gb|EDW11610.1| GI17232 [Drosophila mojavensis]
          Length = 558

 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 272/452 (60%), Positives = 346/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + + +D +LP A +I+I +    R  RVK+ GWVHRLR QGK + FI LRDGSG+LQC+L
Sbjct: 111 VKISEDASLPAAQRIRIEKGADYRNARVKIYGWVHRLRRQGKSLIFITLRDGSGFLQCVL 170

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFT 230
              LC TY+AL+LS ESTV +YG +  +P GKTAP  HEL+ DYWE+   AP GG DA  
Sbjct: 171 NDLLCQTYEALVLSTESTVVLYGTLKVVPEGKTAPGGHELIVDYWELIGLAPPGGADAI- 229

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +  + RH++IRGE  S VLK RS +M+AFR H+  +G++EV PP +VQTQ
Sbjct: 230 --LNEEAHPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRAHYLDRGYNEVTPPTLVQTQ 287

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+M Y+GE+AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H
Sbjct: 288 VEGGSTLFKMQYFGEEAYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTH 347

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  F+TF          ICD VDR+L +     +V +L+PDF PP +PF RM+Y DA
Sbjct: 348 IEAECPFLTFEDLLDRIEDLICDVVDRILKSPWGY-IVKELNPDFKPPTKPFKRMEYVDA 406

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++LK++N+ KE+G+FYEFGEDIPE PER MTD IN+PI L RFPAEIK+FYM RC +D 
Sbjct: 407 IKWLKENNVPKEDGTFYEFGEDIPEAPERKMTDTINEPILLIRFPAEIKSFYMSRCQDDQ 466

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+P VGE+VGGSMRI D +E+L  Y REGI+P PYYWYTDQR YGT  HGG+
Sbjct: 467 RLTESVDVLLPNVGEIVGGSMRIFDNDEILKAYAREGIDPAPYYWYTDQRVYGTMPHGGY 526

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R ++++ CLYPRF+ RC P
Sbjct: 527 GLGLERFLCWLLNRYHIRDVCLYPRFLDRCKP 558



>gi|395328274|gb|EJF60667.1| asparaginyl-tRNA synthetase [Dichomitus squalens LYAD-421 SS1]
          Length = 572

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 291/571 (50%), Positives = 379/571 (66%), Gaps = 24/571 (4%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +Y+DE  GSD+T  G+Q APY++   AL    D     +RK  +  Y + + +       
Sbjct: 4   IYVDEAAGSDDTGKGSQEAPYQSLAFALYTHPDG-QFQIRKDADTPYDEPTQSALKKAKK 62

Query: 74  XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IVL++DP LP A K KI    
Sbjct: 63  GADGIEKKKKKAEELAQREAKEKAEARERKEKKLEESKKIVLQEDPGLPKATKAKIANLT 122

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R +RV+ SGWVHRLR Q K++ FIVLRDG+GYLQC+L+G++  TY+AL L+LEST+ +
Sbjct: 123 PLRSQRVRTSGWVHRLRDQ-KEIIFIVLRDGTGYLQCVLSGQVAQTYEALTLTLESTIEV 181

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
            G +  +P G+TAP  HEL+ DYW+V   APGGD+AFTN+LN  +DPSI  + RHLV+RG
Sbjct: 182 VGTLKVVPEGQTAPGGHELVVDYWKVLGAAPGGDEAFTNRLNEKSDPSIQADLRHLVLRG 241

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           ETASAVLK R+A++  FR    S    EV PPC+VQTQVEGG+TLF+++YYG+ A+LTQ+
Sbjct: 242 ETASAVLKLRAALLAGFRSSLTSHDLLEVTPPCLVQTQVEGGATLFKLDYYGQPAFLTQS 301

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHL+EY+HLEAE+AFITF          IC
Sbjct: 302 SQLYLETCLPSLGDVFCVQESFRAENSHTRRHLAEYTHLEAELAFITFDDLMTHIEAIIC 361

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE----NGSF-- 426
           +TVD++LA+  +  L+ QL+P FV P+RPFLR+ Y DAI++L  H+IK E    +G+   
Sbjct: 362 ETVDKLLADPASATLIKQLNPGFVKPERPFLRLSYVDAIEWLNKHDIKHEAEDADGNVIK 421

Query: 427 ----------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR----- 471
                     ++ G+DI E  ER MTD + +P+FL  FPAE+KAFYMK+   +       
Sbjct: 422 DEQGNPVMVEHKVGDDIAEAAERRMTDILARPVFLYGFPAELKAFYMKKIKTEGEQGSTT 481

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGE+VGGSMRI+D +E++A YKREGI+P PYYWYTDQRKYGT EHGG+G
Sbjct: 482 FTESCDLLMPGVGEIVGGSMRIADADEMIAAYKREGIDPEPYYWYTDQRKYGTCEHGGYG 541

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVER LAWL +R  V+EC LYPR+ GR  P
Sbjct: 542 LGVERLLAWLANRYTVRECSLYPRWPGRATP 572



>gi|193666902|ref|XP_001951757.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like
           [Acyrthosiphon pisum]
          Length = 560

 Score =  588 bits (1516), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 274/452 (60%), Positives = 347/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           ++L +D  LP A  IKI+ +   R  R+K+ GWVHRLR QGK + FI LRDG+G++Q +L
Sbjct: 113 LILTEDSTLPPATLIKIKNASEYRNSRIKMYGWVHRLRRQGKSLMFITLRDGTGFIQTVL 172

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFT 230
             +LC TY+AL+LS ES+V ++GV+ ++P GK+AP  HEL  DYWE+   AP GG D+  
Sbjct: 173 NEKLCQTYNALMLSTESSVLLFGVLKQVPEGKSAPGGHELQVDYWELITLAPPGGADSI- 231

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN DA+P +L + RH+ IRGE  S +L  RS + +AFR H   KG  EV PP +VQTQ
Sbjct: 232 --LNEDANPEVLLDNRHIAIRGENTSKILLMRSVVTQAFRMHNLDKGCIEVVPPTLVQTQ 289

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF+++Y+G++AYLTQ+SQLYLETCLP+LGDV+C+++SYRAE+S TRRHLSEY+H
Sbjct: 290 VEGGSTLFKLDYFGQEAYLTQSSQLYLETCLPALGDVFCMAQSYRAEQSRTRRHLSEYTH 349

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE AFITF          ICD V RVL +     +V QL+P+F  P+RPF RMDYK A
Sbjct: 350 VEAEFAFITFDDLLDRIEDMICDVVKRVLESPHA-DIVKQLNPEFAAPKRPFKRMDYKMA 408

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           IQ+L+++NI KE+ SFYEFGEDIPE  ER MTD IN+PI LCRFPAEIK+FYM RC EDN
Sbjct: 409 IQFLRENNITKEDNSFYEFGEDIPEMAERKMTDLINQPIMLCRFPAEIKSFYMSRCPEDN 468

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
            +TESVDVL+PGVGE+VGGSMRI D  ELLAGYK+ GI+P PYYWYTDQRK+G+  HGG+
Sbjct: 469 TLTESVDVLLPGVGEIVGGSMRIWDEEELLAGYKKVGIDPKPYYWYTDQRKFGSCPHGGY 528

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 529 GLGLERFLCWLLNRYHIREVCLYPRFLDRCTP 560



>gi|307202947|gb|EFN82167.1| Asparaginyl-tRNA synthetase, cytoplasmic [Harpegnathos saltator]
          Length = 516

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 266/451 (58%), Positives = 353/451 (78%), Gaps = 5/451 (1%)

Query: 113 VLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLT 172
           V+++D +LP A +IKI++++  R KRVK+ GW+HRLR QGK + FI LRDG+G+LQC+LT
Sbjct: 70  VIEEDKSLPDAKQIKIKEALNYRDKRVKLYGWIHRLRRQGKALMFITLRDGTGFLQCVLT 129

Query: 173 GELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTN 231
            +LC TYDALIL+ E+ V ++G +  +P GK+AP  HEL  DYW+ +    PGG D+   
Sbjct: 130 DKLCQTYDALILATEAAVQLFGTLKIVPEGKSAPGGHELCVDYWKLIGSSPPGGADSI-- 187

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            LN +A P +  + RH++IRGE  S +L  RS + +AFRDH+  +G+ EV PP +VQTQV
Sbjct: 188 -LNEEALPDVQLDNRHIMIRGENTSRILIMRSILTQAFRDHYKDRGYYEVTPPTLVQTQV 246

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLF+++Y+GE A+LTQ+SQLYLETC+P++GDVYCI++SYRAE+S TRRHL+E++H+
Sbjct: 247 EGGSTLFKLDYFGENAFLTQSSQLYLETCIPAMGDVYCIAQSYRAEQSRTRRHLAEFTHI 306

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  FITF          IC+ V+RVL +     LV +L+P+F  P++PF RM+Y DAI
Sbjct: 307 EAECPFITFDDLLDRLEDLICNVVERVLQSPLG-SLVKELNPNFQVPKKPFKRMNYSDAI 365

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           +YL+++NI KE+GSFYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+RC ED R
Sbjct: 366 EYLRENNITKEDGSFYEFGEDIPEMPERKMTDAINEPIMLCRFPAEIKSFYMQRCTEDRR 425

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE+VGGSMRI + +E++ GY RE I+PTPYYWYTDQRKYG+  HGG+G
Sbjct: 426 LTESVDVLLPNVGEIVGGSMRIWNYDEMMEGYNRENIDPTPYYWYTDQRKYGSCPHGGYG 485

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL WLL+R +++E CLYPRF+ RC P
Sbjct: 486 LGLERFLCWLLNRYHIREVCLYPRFLERCRP 516



>gi|340380675|ref|XP_003388847.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like
           [Amphimedon queenslandica]
          Length = 554

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/557 (50%), Positives = 382/557 (68%), Gaps = 14/557 (2%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVR---KTPEEGYKDISGT 66
           S +  Y  +  G D T  GT++ P+KT ++AL+  G + S L+    K+ ++ Y+++S  
Sbjct: 8   SKKVYYTSDKEGDDSTGDGTESKPFKTVLQALRASGSDESSLIMVDAKSDDKRYEEVS-- 65

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I  +QDP+LP A  I
Sbjct: 66  ----LSQLKKIKKIYQREQYKGAAKEEKDKEDMLRRAENLEKAKQIKFEQDPSLPPAKTI 121

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KIR S+A+R  RV ++GW+HRLR QG  + FIVLRDG+G LQC+L+  LC +Y+AL+LS 
Sbjct: 122 KIRDSIANRETRVAINGWIHRLRRQGTSLMFIVLRDGTGLLQCVLSNVLCQSYEALLLST 181

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEV-NHHAPGGDDAFTNKLNADADPSILYEQ 245
           E+TV +YGVI  LP GK+AP  HEL+ DYWEV     PGG D   N +N D+   +  +Q
Sbjct: 182 EATVKVYGVIKALPEGKSAPGGHELVCDYWEVVGLSPPGGAD---NLVNEDSLVDVQLDQ 238

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH+++RG+  S + + RS +   FR HF  +G+ EV PP +V+TQVEGG+TLF+++Y+G+
Sbjct: 239 RHMMLRGDVLSKIFRVRSTVGFCFRQHFFDRGYIEVTPPTLVKTQVEGGATLFKLDYFGD 298

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETC+PSLGDV+C+++SYRAE S TRRH++EY+H+EAE  FI+F     
Sbjct: 299 EAYLTQSSQLYLETCIPSLGDVFCMAQSYRAEPSRTRRHIAEYTHIEAECPFISFEDLLD 358

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD  +R L+     +LV +L+PD   P++PF RM+Y DAI YLK++NI K++G+
Sbjct: 359 KVEDLVCDVAER-LSKSPIWELVLELNPDIKLPKKPFKRMNYADAIVYLKENNITKDDGT 417

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD+IN+PI LCRFPAEIK+FYM RC ED R+TESVD+L+PGVGE
Sbjct: 418 FYEFGEDIPEAPERKMTDKINEPILLCRFPAEIKSFYMPRCPEDKRLTESVDLLVPGVGE 477

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI +  ELL+G+KREGI+P PYYWYTDQRKYG+  HGG+GLG+ER+L WLL R+
Sbjct: 478 IVGGSMRIWNEEELLSGFKREGIDPAPYYWYTDQRKYGSCPHGGYGLGMERYLVWLLGRN 537

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++  LYPR++ RC P
Sbjct: 538 HIRDVTLYPRYIERCKP 554



>gi|409044157|gb|EKM53639.1| hypothetical protein PHACADRAFT_260100 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 571

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 299/571 (52%), Positives = 378/571 (66%), Gaps = 23/571 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           T+++DE  GSDET  GT   PY++   AL    +   +LVRK     Y++          
Sbjct: 3   TIHVDESIGSDETGKGTPEQPYQSLAFALYTHAE-AKLLVRKDAAGTYEEPTQSALKKAK 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL +D +L  A K KI   
Sbjct: 62  KGADGLEKKRKKAEELAEREAKEKEGERERREKLIEESKRIVLTEDESLAKAKKAKIGHL 121

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
            + RG+RV VSGWVHRLR Q KD+ FIVLRDG+GYLQ +L+G++  TY AL L+LESTV 
Sbjct: 122 GSLRGQRVSVSGWVHRLRNQ-KDIIFIVLRDGTGYLQSVLSGKVAQTYAALTLTLESTVQ 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           ++G +  +P GKTAP  HEL+ DYW+V   APGGD+AFTN+LN  +DPSIL + RHLV+R
Sbjct: 181 LHGTLQAVPEGKTAPGGHELVVDYWKVLGGAPGGDEAFTNRLNEKSDPSILADLRHLVLR 240

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE ASAVLK R+A++ +FRD   S    EV PPC+VQTQVEGG+TLF+++YYG+ AYLTQ
Sbjct: 241 GEIASAVLKLRAALLSSFRDTLVSHDLLEVTPPCLVQTQVEGGATLFKLDYYGQPAYLTQ 300

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF          I
Sbjct: 301 SSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFDDLLTHIEAII 360

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE----NGSF- 426
           C+TVDR+LAN TT  L+ QL+P+F  P RPFLRM Y DAI++L +H I+ E    +G+  
Sbjct: 361 CETVDRLLANPTTAALIKQLNPNFTAPARPFLRMSYVDAIKWLNEHGIQHEAEDADGNVI 420

Query: 427 -----------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC----AEDNR 471
                      +  G+DI E  ER MTD +  P+FL  FPAE+K+FYMKR      + + 
Sbjct: 421 LDEQGKPKMVDHAVGDDIAEAAERRMTDILGVPMFLYGFPAELKSFYMKRMPYGDGDVHL 480

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGE+VGGSMR++D +EL A YK+EGI+PTPYYW+TDQRKYGT EHGG+G
Sbjct: 481 FTESCDLLMPGVGEIVGGSMRMTDQDELSAAYKKEGIDPTPYYWFTDQRKYGTCEHGGYG 540

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVERFLAWL +R  V+EC LYPR+  R  P
Sbjct: 541 LGVERFLAWLANRYTVRECSLYPRWPSRATP 571



>gi|149064469|gb|EDM14672.1| rCG46601, isoform CRA_a [Rattus norvegicus]
 gi|149064470|gb|EDM14673.1| rCG46601, isoform CRA_a [Rattus norvegicus]
          Length = 515

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 264/451 (58%), Positives = 348/451 (77%), Gaps = 3/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I++K DP+LP    +KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L
Sbjct: 68  IIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVL 127

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           + +LC  Y+ ++LS ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N
Sbjct: 128 SDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADN 185

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +N ++D  +    RH++IRGE  S +LKARS I + FRDHF  +G+ EV  P +VQTQV
Sbjct: 186 LINEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQV 245

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+++Y+GE+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+
Sbjct: 246 EGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHV 305

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  F+TF          +CD VDRVL +     +VY L+P+F  P+RPF RM+Y DAI
Sbjct: 306 EAECPFLTFEDLLSRLEDLVCDVVDRVLKSPVA-SIVYDLNPNFKAPKRPFRRMNYSDAI 364

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++L++H++KKE+G+FYEFG+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R
Sbjct: 365 EWLREHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPR 424

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVDVL+P VGE+VGGSMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+G
Sbjct: 425 LTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYG 484

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFL+W+L+R ++++ CLYPRF+ RC P
Sbjct: 485 LGLERFLSWILNRYHIRDVCLYPRFLQRCRP 515



>gi|312373072|gb|EFR20897.1| hypothetical protein AND_18332 [Anopheles darlingi]
          Length = 549

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 292/555 (52%), Positives = 380/555 (68%), Gaps = 10/555 (1%)

Query: 11  SETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXX 68
           S+ +Y  E  G+DET  GT + P+KT +RA++  G     +I V    E   K  S    
Sbjct: 2   SKNLYTSEKRGNDETGKGTADEPFKTILRAMKEAGKEPFPTIYVDSKDE---KSESPFDV 58

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I +++DP+LP A  IKI
Sbjct: 59  AAKSQLKKVQKIWLRDSQKGEKQKREEEEKAKNREQNLEEAKKITIQEDPSLPAAKLIKI 118

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
            Q  A+RG R++V GW+HRLR QGK + F+ LRDG+G+LQC+LT  LC TY+AL+LS ES
Sbjct: 119 PQGAANRGVRIRVYGWIHRLRRQGKGLMFVTLRDGTGFLQCVLTDTLCQTYNALVLSTES 178

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRH 247
           +V ++G ++E+PAGKTAP  HEL  DYWE+   AP GG DA    LN +A P +  + RH
Sbjct: 179 SVQLFGTLNEVPAGKTAPGGHELKVDYWELIGLAPAGGADAI---LNEEAHPDVQLDNRH 235

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           ++IRGE  S +LK R  +M+AFR H+  +G++EV PP +VQTQVEGGSTLF+++Y+GE+A
Sbjct: 236 IMIRGENTSKILKMRDVVMQAFRSHYFDRGYTEVTPPTLVQTQVEGGSTLFKLDYFGEEA 295

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETC+P+LGDV+C+++SYRAE+S TRRHL+EYSH+E E  FITF       
Sbjct: 296 YLTQSSQLYLETCIPALGDVFCVAQSYRAEQSRTRRHLAEYSHIEGECPFITFEELLNRL 355

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              + D VDRVL +     +V +L+P FVPP+RPF RM+Y DAI +LK++N+ KE+G+FY
Sbjct: 356 EDLVVDVVDRVLKSPWGY-MVQELNPGFVPPKRPFRRMNYADAIVWLKENNVTKEDGTFY 414

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           EFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM +C +D R+TESVD L+P VGE+V
Sbjct: 415 EFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMAKCEDDPRLTESVDALLPNVGEIV 474

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMR    +ELL GYKREGI+P PYYWY DQR YGT  HGG+GLG+ERFL WLL+R ++
Sbjct: 475 GGSMRSWKYDELLEGYKREGIDPKPYYWYVDQRVYGTQPHGGYGLGLERFLCWLLNRYHI 534

Query: 548 KECCLYPRFMGRCLP 562
           +E CLYPRF+ RC P
Sbjct: 535 REVCLYPRFLERCKP 549



>gi|470323313|ref|XP_004349464.1| Nars-like protein [Capsaspora owczarzaki ATCC 30864]
 gi|320167790|gb|EFW44689.1| Nars-like protein [Capsaspora owczarzaki ATCC 30864]
          Length = 563

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/555 (50%), Positives = 381/555 (68%), Gaps = 13/555 (2%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG--DNISILVRKTPEEG--YKDISGTX 67
           +  Y  E  GSDE+  G++  P+KT ++AL+  G   N+ I +     +G  +  +S + 
Sbjct: 18  KVFYTSERAGSDESGDGSEAKPFKTVMQALRAGGPDANVVIFLDGQAADGPRWDKLSDSQ 77

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I + Q+ +LP A  IK
Sbjct: 78  LKKQKKNFATELKKADARAKKDAEDAEKREKALEEASK------IKITQNKDLPAAKTIK 131

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           +R +VA RG RVKV GW+H LR QGKDM F+VLRDG+GYLQCLLTG++C T +A+ L  E
Sbjct: 132 LRDTVAHRGTRVKVQGWLHNLRRQGKDMMFLVLRDGTGYLQCLLTGDMCRTIEAVKLETE 191

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           STV+++G+I ELP GKTAPD HEL ADYWE+   AP G     +  N ++DP +L++ RH
Sbjct: 192 STVSVFGIIKELPEGKTAPDGHELAADYWELMGTAPAG--GLDHAFNKESDPDVLFDNRH 249

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           LV+R +T S +LK RS + +AFR+HF ++G+ EV PP +VQT  EGGSTLF+++Y+G++A
Sbjct: 250 LVLRTDTYSKILKLRSVVTQAFREHFFNRGYFEVTPPTLVQTMCEGGSTLFKLDYFGKEA 309

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLET +P++GDV+CI++SYRAEKS TRRHL+EY+H+EAE  F+ F       
Sbjct: 310 YLTQSSQLYLETAIPAVGDVFCIAQSYRAEKSRTRRHLTEYTHIEAECPFLDFETLLHKL 369

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              +CD V+RVLA+     L+ +L+P+F  P+RPF RM+YKDAI +LK+++++K +G+FY
Sbjct: 370 EDLVCDVVERVLASPYA-GLLKELNPNFKAPKRPFRRMEYKDAIVWLKENDVRKPDGTFY 428

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           EFGEDIPE PER MTD+I +PI L RFP EIKAFYM+R A D R+TESVD+L+PGVGE+V
Sbjct: 429 EFGEDIPEAPERAMTDKIGEPILLMRFPREIKAFYMQRDAGDQRLTESVDMLMPGVGEIV 488

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMRI ++ EL A Y+RE I+P  YYWY DQR+YGT  HGG+GLG++RFL W+ +RD++
Sbjct: 489 GGSMRIWNLEELEAAYRREEIDPAEYYWYIDQRRYGTCPHGGYGLGLDRFLTWMFNRDHI 548

Query: 548 KECCLYPRFMGRCLP 562
           ++ C YPR + RC P
Sbjct: 549 RDVCFYPRNIDRCKP 563



>gi|512909262|ref|XP_004926878.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Bombyx mori]
          Length = 554

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/550 (52%), Positives = 378/550 (68%), Gaps = 8/550 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +Y  + NG+D+T  GT+  P+KT ++A+   G      +    ++  KD           
Sbjct: 12  IYTSDKNGNDDTGDGTKEKPFKTILKAMHHAGKEPFPTIYVDSKDDTKDYD---VAAKSQ 68

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 I+L++DP+LP A  +KI ++  
Sbjct: 69  LKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTE 128

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            RG+R+ + GWVHRLR QGK + F+ LRDG+GYLQC+L G LC TY+AL+LS ES+V +Y
Sbjct: 129 HRGQRICIRGWVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLY 188

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRHLVIRG 252
           G +  +P GK AP  HEL ADYWE+   AP GG DA    LN +A P +  + RH++IRG
Sbjct: 189 GKLEAVPEGKKAPGGHELTADYWELIGLAPPGGADAI---LNEEALPDVQLDNRHIMIRG 245

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           E  S VL+AR+A+ +AFR+HF S+ ++EV PP +VQTQ EGGSTLF+ +Y+GE+AYLTQ+
Sbjct: 246 ENTSKVLRARAAVTRAFREHFASRRYTEVTPPTLVQTQCEGGSTLFKFSYFGEEAYLTQS 305

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCL +LGDVYCI++SYRAE+S TRRHL+EYSH+EAE  FITF          + 
Sbjct: 306 SQLYLETCLATLGDVYCIAQSYRAEQSRTRRHLAEYSHVEAECPFITFEDLLSRLEDLVV 365

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGED 432
           D VDRVLA+    +LVY+L+P+F  PQ+PF RM Y +AI+YL+ +NI KE+GSFYEFGED
Sbjct: 366 DVVDRVLASPEG-QLVYELNPNFKKPQKPFKRMTYIEAIEYLRANNITKEDGSFYEFGED 424

Query: 433 IPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMR 492
           IPE PER MTD I  PI LC+FPAEIK+FYM  C +D R+TESVDVL+PGVGE+VGGSMR
Sbjct: 425 IPEMPERKMTDAIGVPILLCKFPAEIKSFYMSSCVDDRRLTESVDVLMPGVGEIVGGSMR 484

Query: 493 ISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCL 552
           I D  EL+ GYKREGI+P+PYYWYTDQRK+G+  HGG+GLG+ERFL WLL R ++++ CL
Sbjct: 485 IWDHEELMEGYKREGIDPSPYYWYTDQRKFGSVPHGGYGLGLERFLCWLLDRYHIRDVCL 544

Query: 553 YPRFMGRCLP 562
           YPRF+ RC P
Sbjct: 545 YPRFLERCTP 554



>gi|410074169|ref|XP_003954667.1| hypothetical protein KAFR_0A00940 [Kazachstania africana CBS 2517]
 gi|372461249|emb|CCF55532.1| hypothetical protein KAFR_0A00940 [Kazachstania africana CBS 2517]
          Length = 551

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/557 (51%), Positives = 374/557 (67%), Gaps = 14/557 (2%)

Query: 13  TVYIDEVNGSDETST-GTQNAPYKTAVRAL----QVKGD--NISILVRKTPEEGYKDISG 65
           ++YI +  G DE S  GTQ  P+KT   AL    Q   D     + V K  +  + +IS 
Sbjct: 2   SLYIKDATGVDELSVAGTQEQPFKTPAYALFAFQQQNADAPEPKLYVFKAEDSEFLEISA 61

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
           +                                             I +++D +LP A  
Sbjct: 62  SALKKARKGCEGLKKKLIKQKELELKQQEQKLTKQMSALQ------ISIEEDKSLPAAKS 115

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
            K+ +     G+RVKVSGW+HRLR+  K + F+VLRDG+G+LQC+LTG+L      + L+
Sbjct: 116 FKVAKVYEQVGERVKVSGWIHRLRSN-KKVVFVVLRDGTGFLQCVLTGDLALAQQTVDLT 174

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
           LESTVT+YG I++LP GK A    EL+ DY++V   AP GDDAFTNK+  D+DPS+L +Q
Sbjct: 175 LESTVTLYGTITKLPEGKNAAGGVELVVDYYQVLGLAPSGDDAFTNKIAEDSDPSLLLDQ 234

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHL +RGE  S V+K R+A+++AFR  F+ +  +EV PPCMVQTQVEGGSTLF+++YYGE
Sbjct: 235 RHLALRGEAISGVMKVRAALLRAFRRFFEEESLTEVTPPCMVQTQVEGGSTLFKLDYYGE 294

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+E+E+AFITF     
Sbjct: 295 EAYLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHVESELAFITFDDLLQ 354

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                I  +V  VL +     ++ QL+PDFV P  PF+R++YKDAI +L +H IK E+G 
Sbjct: 355 HLERLISQSVKYVLEDPVAGPIIKQLNPDFVAPTGPFMRLEYKDAITWLNEHGIKNEDGK 414

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            ++FG+DI E  ER MTD I  PI L +FP EIK+FYMKRCA+D RVTESVDVL+P VGE
Sbjct: 415 DFKFGDDIAEAAERKMTDTIGVPILLIKFPVEIKSFYMKRCADDPRVTESVDVLMPTVGE 474

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           + GGSMRI+ ++EL+AG+KREGI+P  YYW+ DQRKYGT EHGG+GLG ER LAWL +R 
Sbjct: 475 ITGGSMRITQIDELMAGFKREGIDPKAYYWFIDQRKYGTCEHGGYGLGTERILAWLCNRF 534

Query: 546 NVKECCLYPRFMGRCLP 562
            V++C LYPRF GRC P
Sbjct: 535 TVRDCSLYPRFSGRCKP 551



>gi|50302869|ref|XP_451372.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640503|emb|CAH02960.1| KLLA0A08426p [Kluyveromyces lactis]
          Length = 554

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 291/557 (52%), Positives = 376/557 (67%), Gaps = 11/557 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDN--ISILVRKTPEEG----YKDISG 65
           +VY++E +G DE T  GT+  P+KTA  AL  K ++    I V K  ++G    Y +IS 
Sbjct: 2   SVYVNEFSGVDESTVAGTEQQPFKTAAFALYSKAESEPKEIYVFKKEDDGAEGAYVEISA 61

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
           +                                             I +++D +LP A +
Sbjct: 62  SALKKAKKGVEGLKKKAAKQKELEQKQQEQEAKNAAKKLEAMN---ITIEEDLSLPKAER 118

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
            KIR +  +  KRVKVSGWVHRLR   K + FI+LRDG+G+LQ +LTG+L  +Y  + L+
Sbjct: 119 RKIRSAYDAVDKRVKVSGWVHRLRNN-KSVVFIILRDGTGFLQTVLTGDLARSYQIVNLT 177

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
           LE+T+T+YG I  +P  K+AP   EL  DY+E+   AP G++AFTN++  +ADPSIL +Q
Sbjct: 178 LETTITLYGTIKVVPESKSAPGGVELFVDYFEIVGPAPSGENAFTNRVQENADPSILLDQ 237

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHL++RGET SAV+K R+A+MK+ R  +D +G +EVNPPCMVQTQVEGGSTLF+++YYGE
Sbjct: 238 RHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYGE 297

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCL +LGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ F+ F     
Sbjct: 298 EAFLTQSSQLYLETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFDDLLS 357

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                I  T+  VL +     LV +L+P+F  PQ PF RM+YKDAI++LK+H IK E   
Sbjct: 358 HIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIKNEEDK 417

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            ++FG+DI E  ER MTD I  PI L RFP EIK+FYMKRC +D RVTESVDVL+P VGE
Sbjct: 418 EFQFGDDIAEAAERKMTDTIGVPILLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGE 477

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           + GGSMRI D  EL+AG+KREGI+P PYYW+ DQRKYGT  HGG+GLG ER LAWL  R 
Sbjct: 478 ITGGSMRIDDTEELMAGFKREGIDPAPYYWFIDQRKYGTCPHGGYGLGTERILAWLCDRF 537

Query: 546 NVKECCLYPRFMGRCLP 562
            V++C LYPRF GRC P
Sbjct: 538 TVRDCSLYPRFSGRCKP 554



>gi|392560859|gb|EIW54041.1| asparaginyl-tRNA synthetase [Trametes versicolor FP-101664 SS1]
          Length = 571

 Score =  585 bits (1509), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 291/570 (51%), Positives = 374/570 (65%), Gaps = 23/570 (4%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +++DE  GSDET  GT  APY+T   AL    D     +RK     Y++ + +       
Sbjct: 4   IHVDESAGSDETGKGTSEAPYQTLAFALYTHPDE-KFAIRKDAAGTYEEPTQSALKKAKK 62

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IVL++D +LP A+K KI    
Sbjct: 63  GADGIEKKRKKAEELAEREAKEQAAARERKEKRFEESKKIVLQEDASLPAAVKAKIGNLT 122

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R KR++ SGWVHRLR Q K++ F+VLRDG+GYLQC+L+G++  TY+AL L+LEST+ +
Sbjct: 123 PLRSKRIRASGWVHRLRDQ-KEIIFVVLRDGTGYLQCVLSGQVAQTYEALTLTLESTIEV 181

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
            G +  +P G+TAP  HEL+ DYW+V   +PGG+DAFTNKLN  +DPSI  + RHLV+RG
Sbjct: 182 VGTLKTVPEGQTAPGGHELVVDYWKVLGASPGGEDAFTNKLNEKSDPSIQADLRHLVLRG 241

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           ETASAVLK R+A++ AFR         EV PPC+VQTQVEGG+TLF+++YY + A+LTQ+
Sbjct: 242 ETASAVLKLRAALLTAFRQTLIEHDLLEVTPPCLVQTQVEGGATLFKLDYYNQPAFLTQS 301

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF          IC
Sbjct: 302 SQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFTDLMDHIEAIIC 361

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE----NGSF-- 426
           +T +++L N T+  L+ QL+P F  P+RPFLRM Y DAI++L +H+IK E     G+   
Sbjct: 362 ETTNKLLQNPTSAALIKQLNPTFTAPERPFLRMSYVDAIKWLNEHDIKHEAEDAEGNVIR 421

Query: 427 ----------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRV---- 472
                     ++ G+DI E  ER MTD + +P+FL  FP E+KAFYMK+   D       
Sbjct: 422 DESGAPVMVEHKVGDDIAEAAERRMTDILARPMFLYGFPTELKAFYMKKMPRDGATGPTF 481

Query: 473 TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGL 532
           TES D+L+PGVGE+VGGSMRI+D  ELLA YKREGI+P PYYW+TDQRKYGT EHGG+GL
Sbjct: 482 TESCDLLMPGVGEIVGGSMRIADEEELLAAYKREGIDPAPYYWFTDQRKYGTCEHGGYGL 541

Query: 533 GVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GVERFLAWL  R  V+EC LYPR+ GR  P
Sbjct: 542 GVERFLAWLGKRFTVRECSLYPRWPGRATP 571



>gi|336372331|gb|EGO00670.1| hypothetical protein SERLA73DRAFT_178541 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336385075|gb|EGO26222.1| hypothetical protein SERLADRAFT_463033 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 568

 Score =  585 bits (1508), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 292/567 (51%), Positives = 370/567 (65%), Gaps = 20/567 (3%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGY-KDISGTXXXXXX 72
           VYIDE  GSD T TGT + PY++  +A+     +   L+RK P   Y             
Sbjct: 4   VYIDESAGSDTTGTGTIDLPYQSLAQAI-FSTQSTEYLIRKDPNTEYDAPTQSALKKAKK 62

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IVL +D  LP A K KI    
Sbjct: 63  GAEGLEKKKKKAEEAAEREAGEEKEKREKREKLLEESKQIVLVEDEALPKATKAKIVSLT 122

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             RG RV+VSGWVHRLR Q KD+ F+VLRDG+GYLQ +L+  +  T++AL L+LES++ +
Sbjct: 123 PLRGSRVRVSGWVHRLRDQ-KDLIFVVLRDGTGYLQTILSSRVAKTFNALTLTLESSIEV 181

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
           +G +  +P GKTAP  HEL+ DYW+V   APG +DAFTN+LN  +DPSIL + RHLV+RG
Sbjct: 182 FGTLQAVPEGKTAPGGHELIVDYWQVLGSAPGNEDAFTNRLNEKSDPSILADLRHLVLRG 241

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           ET+S+VL+ R+A++ AFR  + +    EV PPCMVQTQVEGG+TLF+ +YYG+ A+LTQ+
Sbjct: 242 ETSSSVLRLRAALLSAFRASYGAHDILEVTPPCMVQTQVEGGATLFKFDYYGQPAFLTQS 301

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLP+LGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AF+TF          IC
Sbjct: 302 SQLYLETCLPALGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFVTFDDLMTHIEAIIC 361

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF------ 426
           +TVD++LA+  +  L+ QL+P+F PP RPFLR+ Y DAI +L +H I+ E          
Sbjct: 362 ETVDKLLADPASAALIKQLNPNFTPPSRPFLRISYVDAIDWLNEHGIQHEKEDAEGNAVR 421

Query: 427 ----------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC-AEDNRVTES 475
                     +  G+DI E  ER MTD I KP+FL  FPAE+KAFYMK+   E    TES
Sbjct: 422 DADGRPIMVDHAVGDDIAEAAERQMTDIIGKPVFLHGFPAELKAFYMKKIKGEGPAYTES 481

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
            D+L+P VGE+VGGSMRISDM ELLA YKREGI+PTPYYW+TDQRKYGT EHGG+GLGVE
Sbjct: 482 CDLLMPNVGEIVGGSMRISDMEELLAAYKREGIDPTPYYWFTDQRKYGTCEHGGYGLGVE 541

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL +R  V+EC LYPR+  R  P
Sbjct: 542 RFLAWLANRYTVRECTLYPRWPNRATP 568



>gi|195427261|ref|XP_002061695.1| GK17133 [Drosophila willistoni]
 gi|194157780|gb|EDW72681.1| GK17133 [Drosophila willistoni]
          Length = 548

 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/557 (51%), Positives = 380/557 (68%), Gaps = 14/557 (2%)

Query: 10  SSET-VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI-SILVRKT-PEEGYKDISGT 66
           S ET +Y  E  G+D++  GTQ  P KT ++A++  G+   +I V  T P + ++  + +
Sbjct: 2   SGETGLYTSEKRGNDQSGDGTQKKPLKTILQAMRSVGEPFPTIFVDSTAPGQIFEPAAKS 61

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        + +++D  LP+A +I
Sbjct: 62  QLKKIQKIYARDGQKNVGKIQREAEDAVKRQQNLDEARK------VKIQEDKKLPVAKRI 115

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +IR+     G RVKV GWVHRLR QGK + F+ LRDG+G+LQ +LT   C TY+AL+LS 
Sbjct: 116 RIREIGTHGGSRVKVFGWVHRLRRQGKALMFVTLRDGTGFLQSVLTDLRCQTYEALMLST 175

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQ 245
           ES V +YGV+  +P GK+AP + EL  D+WE +    PGG DA    LN +A P +  + 
Sbjct: 176 ESAVALYGVLKPVPDGKSAPGDLELHVDFWELIGLAPPGGADAI---LNEEAHPDVQLDN 232

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RH++IRGE  S VLK RS +M+AFR H++ +G++EV PP +VQTQVEGGSTLF+M Y+GE
Sbjct: 233 RHIMIRGENTSKVLKMRSVVMQAFRAHYEDRGYNEVTPPTLVQTQVEGGSTLFKMQYFGE 292

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H+EAE  FI++     
Sbjct: 293 EAFLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTHIEAECPFISYDDLLT 352

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CD VDRVL      +LVY+L+PDF  P+RPF RMDY DAI++LK ++++K++G+
Sbjct: 353 RLEDLVCDVVDRVLKGPYG-QLVYELNPDFKAPKRPFRRMDYADAIKWLKANDVRKDDGT 411

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           FYEFGEDIPE PER MTD IN+PI LCRFP  IK+FYM RC ED R+TESVDVL+P VGE
Sbjct: 412 FYEFGEDIPEAPERKMTDTINEPILLCRFPVAIKSFYMSRCPEDQRLTESVDVLLPNVGE 471

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI D  ELL GY RE I+PTPYYWYTDQR YGT  HGG+GLG+ERFL WLL+R 
Sbjct: 472 IVGGSMRIWDSEELLKGYAREEIDPTPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNRY 531

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++ CLYPRF+ RC P
Sbjct: 532 HIRDVCLYPRFLDRCRP 548



>gi|444321494|ref|XP_004181403.1| hypothetical protein TBLA_0F03470 [Tetrapisispora blattae CBS 6284]
 gi|387514447|emb|CCH61884.1| hypothetical protein TBLA_0F03470 [Tetrapisispora blattae CBS 6284]
          Length = 547

 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 291/554 (52%), Positives = 379/554 (68%), Gaps = 13/554 (2%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDNIS---ILVRKTPEEGYKDISGTXX 68
           T+YI++  G DE T +G+++AP+KT   AL    D+ +   + V KT  + Y++IS +  
Sbjct: 3   TIYINDTIGVDEPTQSGSKDAPFKTPAFALFQSIDSATEPKLFVFKT--DDYEEISASAL 60

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I ++QD +LP A K+KI
Sbjct: 61  KKARKGCEGLKKKAIKLKEQELKKKEEAVAKQLSNLN------ITIEQDTSLPPAKKVKI 114

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
            QS    G+RVKVSGW+HRLR+  K + FIVLRDG GYLQC+L+G L      + L++ES
Sbjct: 115 DQSYKLVGERVKVSGWIHRLRSN-KKVVFIVLRDGKGYLQCVLSGNLALAQQTVDLTIES 173

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TVT+YG I ++P GK AP   EL+ DY+EV   AP GD+AFTNK+   ADPS+L +QRHL
Sbjct: 174 TVTLYGSIVKVPEGKAAPGGVELVVDYYEVVGLAPSGDEAFTNKVAEGADPSLLLDQRHL 233

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
            +RGET SAV+K R A + A R  +  +G +EV  PCMVQTQVEGGSTLF+++YYGE+AY
Sbjct: 234 TLRGETLSAVMKVRHAFLAAIRRVYREEGLTEVTTPCMVQTQVEGGSTLFKLDYYGEEAY 293

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF++F        
Sbjct: 294 LTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLSFDELLDHLE 353

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             + +++  VL +     LV QL+PDFV P+ PF+R++YKDAI++L +H+IK E G  ++
Sbjct: 354 TLVINSIKYVLEDPVAGPLVKQLNPDFVAPKGPFMRLEYKDAIKWLVEHDIKNEEGEPFK 413

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD I  PIFL +FP EIK+FYMKRC +D RVTESVD+L+P VGE+ G
Sbjct: 414 FGDDIAEAAERKMTDTIGVPIFLTKFPVEIKSFYMKRCTDDPRVTESVDLLMPTVGEITG 473

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMRI   +ELLAG+KREGI+P+ YYW+ DQRKYGT  HGG+G+G ER LAWL +R  V+
Sbjct: 474 GSMRIETTDELLAGFKREGIDPSAYYWFIDQRKYGTCPHGGYGIGTERILAWLCNRFTVR 533

Query: 549 ECCLYPRFMGRCLP 562
           EC LYPRF GRC P
Sbjct: 534 ECSLYPRFSGRCKP 547



>gi|169846462|ref|XP_001829946.1| asparaginyl-tRNA synthetase [Coprinopsis cinerea okayama7#130]
 gi|116508973|gb|EAU91868.1| asparaginyl-tRNA synthetase [Coprinopsis cinerea okayama7#130]
          Length = 582

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 304/582 (52%), Positives = 374/582 (64%), Gaps = 34/582 (5%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           +VYIDE  GSD T TGT  APY+T   A+  +    S L+RK     Y +    +     
Sbjct: 3   SVYIDEAAGSDTTGTGTIEAPYQTLGFAVYSQ-PTASYLIRKDSAAEYAEPTQSSLKKAK 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL++DP LP A K KI   
Sbjct: 62  KTAEGIEKKKKKQEELEERERKAKGEEKEKREKLLEESKKIVLEEDPALPKAPKAKITHL 121

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RV+V GWVHRLR Q KD+ FIVLRDG+GYLQ +L+G +  TY AL L+LES+V 
Sbjct: 122 EKHRGQRVRVFGWVHRLRQQ-KDIIFIVLRDGTGYLQAVLSGRVAQTYSALTLTLESSVE 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G + ++P GKTAP  HEL+ DYW+    APGGDDAFTN+LN  +DPSI  + RHLV+R
Sbjct: 181 LVGSLQQVPEGKTAPGGHELIVDYWKALGPAPGGDDAFTNRLNEKSDPSIQADLRHLVLR 240

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE AS++L+ R+ +M AFRD   S    EV PPC+VQTQVEGG+TLF+++YYG+ A+LTQ
Sbjct: 241 GENASSILRLRAYMMTAFRDALHSHDLMEVTPPCLVQTQVEGGATLFKLDYYGQPAFLTQ 300

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+CI ES+RAE SHTRRHLSEY+HLEAE+AFITF          I
Sbjct: 301 SSQLYLETCLPSLGDVFCIQESFRAENSHTRRHLSEYTHLEAELAFITFDDLMNHIEDVI 360

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK----DHNIKKENGSF- 426
           C TVD +LAN  +  LV QL+PDF PP+RPF+RM Y DAI++L      H  + E G+  
Sbjct: 361 CKTVDSLLANPVSAALVKQLNPDFKPPERPFMRMSYVDAIEWLNKRGIQHPAEDEQGNVI 420

Query: 427 --------------------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC 466
                               ++ G+DI E  ER MTD+I KPIFL  FPAE+KAFYMK+ 
Sbjct: 421 KVDKEGKPTTDGTGEVLMVDHKIGDDIAEAAERRMTDEIGKPIFLHGFPAELKAFYMKKA 480

Query: 467 A-----EDNRV-TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQR 520
                 E   V TES D+L+P VGE+VGGSMRI+D  ELLA YKREGI+P PYYW+TDQR
Sbjct: 481 PVKPGQEGGPVFTESCDLLMPNVGEIVGGSMRIADAEELLAAYKREGIDPDPYYWFTDQR 540

Query: 521 KYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           KYGT EHGG+GLGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 541 KYGTCEHGGYGLGVERFLAWLANRYTVRECSLYPRWPGRATP 582



>gi|348576870|ref|XP_003474208.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like isoform 2
           [Cavia porcellus]
          Length = 507

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 266/438 (60%), Positives = 342/438 (78%), Gaps = 3/438 (0%)

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           ++KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L
Sbjct: 73  EVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCLCYNGVVL 132

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           S ES+V +YG ++ +P GK AP  HEL  D+WE+   AP G     N +N ++D  +   
Sbjct: 133 STESSVAVYGTLNLIPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLN 190

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RH++IRGE  S +L+ARS I   FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+G
Sbjct: 191 NRHMMIRGENMSKILRARSMITACFREHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFG 250

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F++F    
Sbjct: 251 EEAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLSFEDLL 310

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+HN+KKE+G
Sbjct: 311 NRLEDLVCDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYTDAIAWLKEHNVKKEDG 369

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           +FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VG
Sbjct: 370 TFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVG 429

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R
Sbjct: 430 EIVGGSMRIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNR 489

Query: 545 DNVKECCLYPRFMGRCLP 562
            ++++ CLYPRF+ RC P
Sbjct: 490 YHIRDVCLYPRFVQRCKP 507



>gi|357631715|gb|EHJ79184.1| hypothetical protein KGM_15441 [Danaus plexippus]
          Length = 516

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/452 (59%), Positives = 346/452 (76%), Gaps = 5/452 (1%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IV+K+DP+LP AI +KI  +   RG+R+ + GWVHR+R QGK + F+ +RDG+GY+QC+L
Sbjct: 69  IVIKEDPSLPKAITVKILNAGEYRGQRICIRGWVHRMRCQGKALIFLTVRDGTGYMQCVL 128

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFT 230
            G LC  Y+ALILS ES+V +YG +  +P G+TAP  HEL  DYWE+   AP GG DA  
Sbjct: 129 HGALCQVYNALILSTESSVIMYGKLEAVPEGQTAPGGHELTVDYWELVGLAPAGGTDAV- 187

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
             LN +A P +L + RH+ IRGE    +L+AR+ + +AFR+HF S+ ++EV PP +VQTQ
Sbjct: 188 --LNEEAHPDVLLDNRHIAIRGEATIKILRARALVTRAFREHFASRNYTEVTPPTLVQTQ 245

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
            EGGSTLF+ +Y+G++AYLTQ+SQLYLETCL SLGDVYCI++SYRAE+S TRRHL+EYSH
Sbjct: 246 CEGGSTLFKFDYFGQQAYLTQSSQLYLETCLASLGDVYCIAQSYRAEQSRTRRHLAEYSH 305

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE  FI+F          + D V+RVL +     LV +L+P F PPQ+PF RM Y +A
Sbjct: 306 VEAECPFISFDELLDRIEDLVVDVVERVL-DSPEGNLVRELNPSFQPPQKPFKRMTYIEA 364

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I YL+++NI K++GSFYEFGEDIPE PER MTD+I  PI LC+FP  IK+FYM RC ED 
Sbjct: 365 IDYLRENNITKDDGSFYEFGEDIPEGPERKMTDKIGVPILLCKFPVTIKSFYMSRCPEDE 424

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           R+TESVDVL+PGVGE+VGGSMRI D  ELL GY+REGI+P+PYYWYTDQRK+G+  HGG+
Sbjct: 425 RLTESVDVLMPGVGEIVGGSMRIWDNEELLKGYEREGIDPSPYYWYTDQRKFGSVPHGGY 484

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFL WLL R +++E CLYPRF+ RC P
Sbjct: 485 GLGLERFLCWLLDRYHIREVCLYPRFLDRCTP 516



>gi|348576876|ref|XP_003474211.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic-like isoform 2
           [Cavia porcellus]
          Length = 507

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 266/438 (60%), Positives = 342/438 (78%), Gaps = 3/438 (0%)

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           ++KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L
Sbjct: 73  EVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCLCYNGVVL 132

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           S ES+V +YG ++ +P GK AP  HEL  D+WE+   AP G     N +N ++D  +   
Sbjct: 133 STESSVAVYGTLNLIPKGKQAPGGHELSCDFWELIGLAPAG--GADNLINEESDVDVQLN 190

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RH++IRGE  S +L+ARS I   FR+HF  +G+ EV PP +VQTQVEGGSTLF+++Y+G
Sbjct: 191 NRHMMIRGENMSKILRARSVITACFREHFFDRGYYEVTPPTLVQTQVEGGSTLFKLDYFG 250

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+A+LTQ+SQLYLETCLPSLGDV+CI++SYRAE+S TRRHL+EY+H+EAE  F+TF    
Sbjct: 251 EEAFLTQSSQLYLETCLPSLGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLL 310

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +CD VDRVL +     +V  L+P+F PP+RPF RM+Y DAI +LK+H++KKE+G
Sbjct: 311 NRLEDLVCDVVDRVLKSPAG-SIVSDLNPNFKPPKRPFKRMNYTDAIAWLKEHDVKKEDG 369

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           +FYEFGEDIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VG
Sbjct: 370 TFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVG 429

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMRI D  E+LAGYKREGI+PTPYYWYTDQRKYGT  HGG+GLG+ERFL WLL+R
Sbjct: 430 EIVGGSMRIWDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWLLNR 489

Query: 545 DNVKECCLYPRFMGRCLP 562
            ++++ CLYPRF+ RC P
Sbjct: 490 YHIRDVCLYPRFVQRCKP 507



>gi|403217448|emb|CCK71942.1| hypothetical protein KNAG_0I01550 [Kazachstania naganishii CBS
           8797]
          Length = 558

 Score =  582 bits (1500), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/556 (50%), Positives = 370/556 (66%), Gaps = 9/556 (1%)

Query: 15  YIDEVNGSDETS-TGTQNAPYKTAVRAL-------QVKGDNISILVRKTPEEGYKDISGT 66
           YI E  G DE S  G++  P+KT   AL               + V K  E G ++    
Sbjct: 4   YIKESTGVDEASIAGSKEQPFKTPAFALFAHYQAADADAAEPKLFVSKVDENGVEEYLEI 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +++D +L  A K 
Sbjct: 64  SASALKKAKKGCEGLKKKAVKQKELQEKQEQQRVDNASKQMAALDISIEEDKSLAPAKKS 123

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KI +S +  G+RVK+SGW+HR R+  K + F+VLRDGSG++QC+LTG+L      + L+L
Sbjct: 124 KIDRSYSMIGERVKISGWIHRFRSN-KKVVFVVLRDGSGFIQCVLTGDLALAKQTVELTL 182

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTVT+YG +++LP GK+AP   EL+ DY+EV   AP G+++F+NK+  DADPS+L +QR
Sbjct: 183 ESTVTLYGTVTKLPEGKSAPGGVELVVDYYEVVGLAPSGEESFSNKITEDADPSLLLDQR 242

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RGET S V+K R+A+++A R  +  +G +EV PPCMVQTQVEGGSTLF+++YYGE+
Sbjct: 243 HLALRGETLSGVMKVRAALLRAIRRVYVEEGLTEVTPPCMVQTQVEGGSTLFKLDYYGEE 302

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           A+LTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 303 AFLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEH 362

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               +  +V  VL +     +V QL+PDFVPPQ PF R++YKDAI++L++H I  E G  
Sbjct: 363 IETLLVKSVKYVLEDPVAGPIVKQLNPDFVPPQAPFKRLEYKDAIEWLREHQILNEEGKE 422

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           +EFG+DI E  ER MTD I  PI L +FP EIK+FYM RC +D RVTESVDVL+P VGE+
Sbjct: 423 FEFGDDIAEAAERKMTDTIGVPILLTKFPVEIKSFYMPRCKDDPRVTESVDVLMPTVGEI 482

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI+++ EL+AG+KREGI+P PYYW+ DQRKYGT  HGG+GLG ER LAWL +R  
Sbjct: 483 TGGSMRINNIEELMAGFKREGIDPKPYYWFIDQRKYGTCPHGGYGLGTERILAWLCNRYT 542

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 543 VRDCSLYPRFSGRCKP 558



>gi|354474573|ref|XP_003499505.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic isoform 1
           [Cricetulus griseus]
          Length = 561

 Score =  582 bits (1500), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/553 (50%), Positives = 373/553 (67%), Gaps = 12/553 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y+ +  G+D T  GT+  P+KT ++AL   G     +I V    E    D+        
Sbjct: 17  LYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDV-----ISK 71

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I++K DP+LP    +KI   
Sbjct: 72  SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKICAL 131

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RVKV GWVHRL  +GK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++LS ES+V 
Sbjct: 132 EGYRGQRVKVFGWVHRLLREGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA 191

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +    RH++IR
Sbjct: 192 VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLNNRHMMIR 249

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 250 GENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQ 309

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLE--AEMAFITFXXXXXXXXX 369
           +SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+E  +E  F+TF         
Sbjct: 310 SSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVETESECPFLTFEDLLNRLED 369

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI++L++H++KKE+G+ YEF
Sbjct: 370 LVCDVVDRVLKSPVA-SIVYDLNPNFKPPKRPFRRMNYSDAIEWLREHDVKKEDGTLYEF 428

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VGE+VGG
Sbjct: 429 GDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGG 488

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R ++++
Sbjct: 489 SMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRD 548

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+ RC P
Sbjct: 549 VCLYPRFVQRCRP 561



>gi|365760410|gb|EHN02133.1| Ded81p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 554

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 374/556 (67%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL---QVKGDNI--SILVRKTPEEGYKDISGT 66
           ++YI E  G DE T+ G+Q+ P+K+   AL   Q K D     + V KT +  +++IS +
Sbjct: 3   SLYIKEATGVDELTTAGSQDQPFKSPAYALFASQQKSDTTEPKLFVFKTEDNEFQEISAS 62

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +K+D +LP A K 
Sbjct: 63  ALKKARKGCDGLKKKAVKQKEQELKKQQKEAENAAKQLSALK---ITIKKDESLPAANKT 119

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           +I  S A  G+RVK+SGW+HRLR+  K + FIVLRDGSG++QC+L+G+L      L L+L
Sbjct: 120 RIYDSYAKIGQRVKISGWIHRLRSN-KKVVFIVLRDGSGFVQCVLSGDLALAQQTLDLTL 178

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTV +YG +++LP GKTAP   EL  DY+E+   APGG+D+FTN++   +DPS+L +QR
Sbjct: 179 ESTVNLYGTVAKLPEGKTAPGGVELDVDYYEIVGLAPGGEDSFTNQIAEGSDPSLLLDQR 238

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RG+  SAV+K R+A++K+ R  +D +  +EV PPCMVQTQVEGGSTLF+M+YYGE+
Sbjct: 239 HLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKMDYYGEE 298

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           A+LTQ+SQLYLETCL SLGDVY I ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 299 AFLTQSSQLYLETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFEDLLQH 358

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  +V+ VL +     LV QL+P F  P+ PF+R+ YKDAI +L +H IK E G  
Sbjct: 359 IETLIVKSVEYVLEDPIAGPLVKQLNPGFKAPKSPFMRLQYKDAITWLNEHGIKNEEGED 418

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           + FG+DI E  ER MTD I  PIFL RFP EIK+FYMKRC++D RVTESVDVL+P VGE+
Sbjct: 419 FTFGDDIAEAAERKMTDAIGVPIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEI 478

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI D++EL+AG+KREGI+   YYW+ DQR+YGT  HGG+G+G ER LAWL  R  
Sbjct: 479 TGGSMRIDDVDELMAGFKREGIDTDAYYWFIDQRRYGTCPHGGYGIGTERILAWLCDRFT 538

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 539 VRDCSLYPRFSGRCKP 554



>gi|313232355|emb|CBY09464.1| unnamed protein product [Oikopleura dioica]
          Length = 554

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/557 (50%), Positives = 376/557 (67%), Gaps = 8/557 (1%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILV---RKTPEEGYKDIS-G 65
           +S+T+++ E  GSDE + GT+ AP K+ +           I+V    +  E  + ++S  
Sbjct: 2   ASDTLFVSEKLGSDENN-GTEAAPLKSVLAGFIASQGKAKIMVPNAEEKAEAAWVELSQA 60

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
                                                         IVL+ D +LP A  
Sbjct: 61  QKKKMTKLYQQHVRKTEKGAENEAKKAAQAAIEAKAREANLAAAKKIVLELDESLPEATT 120

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           +KIR +   R  R+ V+ W+HR+R QG ++ F+V+RDG+GYLQC+LT +LC TYDAL+L 
Sbjct: 121 VKIRDAKPLRDSRITVNAWIHRIRRQGNNLMFLVVRDGTGYLQCVLTDKLCQTYDALVLQ 180

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
            E+TV ++G +  +P GK A   HEL  D+W++  +AP G     N +N +ADP  L++ 
Sbjct: 181 PEATVELHGKLEAVPEGKNAEGGHELKVDFWKMIANAPPG--GVENVVNKEADPDTLFDN 238

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHLVIRGE  S +LK RS +M+AFR+H+ ++G+ EV PPC+VQT  EGGSTLF+ +Y+GE
Sbjct: 239 RHLVIRGEKTSKILKIRSHLMQAFREHYFARGYHEVTPPCLVQTMCEGGSTLFKFDYFGE 298

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETC+P+LGDV+C++ESYRAEKS TRRHLSEY+H+EAE  FITF     
Sbjct: 299 EAYLTQSSQLYLETCMPALGDVFCMAESYRAEKSRTRRHLSEYTHVEAECPFITFEQLLD 358

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                + D +DR+L +    + VY LHP+FVPP++PF+RMDYKDAI YLK+H+IKK++GS
Sbjct: 359 RIEDLLVDVIDRLLKSPAG-QYVYDLHPNFVPPKKPFMRMDYKDAITYLKEHDIKKDDGS 417

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
           +YEFG+DIPE PER MTDQI + I L RFPAEIK+FYM RC +D RVTESVDVLIP VGE
Sbjct: 418 YYEFGDDIPEAPERKMTDQIGQVIMLHRFPAEIKSFYMPRCEDDERVTESVDVLIPNVGE 477

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           V+GGSMR+ D + L++ YK EGI+P  YYWYTDQRKYG+  HGG+GLG+ER L WL  + 
Sbjct: 478 VIGGSMRMWDYDTLMSKYKEEGIDPKDYYWYTDQRKYGSCPHGGYGLGLERMLTWLCDQY 537

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++ CLYPR+ GRC P
Sbjct: 538 HIRDVCLYPRYTGRCKP 554



>gi|393227604|gb|EJD35275.1| asparaginyl-tRNA synthetase [Auricularia delicata TFB-10046 SS5]
          Length = 563

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 290/564 (51%), Positives = 372/564 (65%), Gaps = 10/564 (1%)

Query: 8   VKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDN--ISILVRKTPEEGYKDISG 65
           +  + TVY+D ++G+D T  G+Q  PY +A  AL   G +  ++ILVRK   E Y +I+ 
Sbjct: 1   MAEARTVYVDLLSGNDTTGDGSQATPYLSASLALYTHGPSPPLTILVRKAAGEEYVEITQ 60

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAI 124
           +                                              +VL +DP LP A+
Sbjct: 61  SALKKAVKDAQGIEKKKKRAAELAARDAEQQAAAKERREKELSEARKVVLTEDPQLPQAV 120

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           K KI      R +RV+V GWVHR R Q K + FIV+RDG+G LQ +L+G +  TYDAL L
Sbjct: 121 KSKILNLAPLRDQRVRVRGWVHRKREQSKIL-FIVVRDGTGLLQAVLSGRVAQTYDALTL 179

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           +LES+V + G + E+PAG+TAP  HEL+ D+W     APGG +AFTNK+N D+ P     
Sbjct: 180 TLESSVELVGKLVEVPAGQTAPGGHELVVDWWRTLGAAPGGAEAFTNKVNEDSGPEDRAN 239

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RHLV+RGETASAVL  R+ ++ AFR         EV PPC+VQTQVEGG+TLF+++YYG
Sbjct: 240 LRHLVMRGETASAVLTLRAHLLTAFRATLIKHQLIEVTPPCLVQTQVEGGATLFKLDYYG 299

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           + A+LTQ+SQLYLETCLPS+GDV+CI ES+RAE SHTRRHLSEY+HLE E+AFITF    
Sbjct: 300 QPAFLTQSSQLYLETCLPSIGDVFCIQESFRAENSHTRRHLSEYTHLEGELAFITFDELM 359

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKK--E 422
                 IC++VD +LAN  +  L+ QL+PDF PP RPF R+ Y DAI +L++H IK+  E
Sbjct: 360 DHIETLICESVDILLANPHSAALIKQLNPDFAPPARPFKRLSYVDAIAWLREHGIKRPAE 419

Query: 423 NGSFYE----FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDV 478
           +GS  E     G+DI E  ER MTD I  P+FL  FPAE+KAFYMKR   + + TES D+
Sbjct: 420 DGSGGEVEHAMGDDIAEAAERRMTDIIGTPVFLHGFPAELKAFYMKRIPGNEKFTESCDL 479

Query: 479 LIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFL 538
           L+PGVGE+VGGSMR+SD  EL+A Y+REGI+P PYYWYTDQRKYGT EHGG+GLGVER L
Sbjct: 480 LMPGVGEIVGGSMRMSDEQELIAAYRREGIDPAPYYWYTDQRKYGTCEHGGYGLGVERLL 539

Query: 539 AWLLHRDNVKECCLYPRFMGRCLP 562
           AWL +R  V++C LYPR+ GR  P
Sbjct: 540 AWLANRFTVRDCSLYPRWPGRATP 563



>gi|296424997|ref|XP_002842030.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638287|emb|CAZ86221.1| unnamed protein product [Tuber melanosporum]
          Length = 579

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 269/451 (59%), Positives = 340/451 (75%), Gaps = 1/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           +++ +D + P AI IK+R +V  R  RV V GWVHRLR Q K + FI LRDG+GYLQCLL
Sbjct: 130 VIIVEDASKPKAISIKLRDTVKRREARVVVRGWVHRLRVQ-KSLVFITLRDGTGYLQCLL 188

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           +G+L  TYDAL L++E+T+ IYGVIS +P    APD HEL ADY++V   APGGDD  +N
Sbjct: 189 SGDLTKTYDALTLTVETTIAIYGVISPVPEENHAPDGHELHADYFQVIGKAPGGDDTISN 248

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            +  +ADP   Y+ RHLVIRG+ AS+VLK R+++++AFR  ++  G  EV PPCMVQTQV
Sbjct: 249 IVAPNADPQTKYDNRHLVIRGDVASSVLKVRASVLRAFRKSYEDLGLLEVTPPCMVQTQV 308

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLFE NYYGEKAYLTQ+SQLYLETCLPSLGDV+C+ ES+RAE+S TRRHLSEY+H+
Sbjct: 309 EGGSTLFEFNYYGEKAYLTQSSQLYLETCLPSLGDVFCVQESFRAERSLTRRHLSEYTHI 368

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE+AFITF          IC T++  L +   +  V +L+P F  P+RPF+RM Y DAI
Sbjct: 369 EAELAFITFDDLLNHLEEVICRTINYALTDPLIKGKVAELNPKFEAPERPFMRMTYADAI 428

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
            +L ++NI  E G+ ++FG+DI E  ER MTD I KPIFL +FP +IKAFYMK+   D R
Sbjct: 429 GWLVENNIPNEEGNPHKFGDDIAEAAERKMTDIIAKPIFLTKFPVKIKAFYMKKDPADPR 488

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           VTESVD L+PGVGE+VGGSMR+ ++ EL+  Y REGI+P PYYW+TDQRKYGT+ HGG+G
Sbjct: 489 VTESVDCLMPGVGEIVGGSMRMENLEELMGAYAREGISPDPYYWFTDQRKYGTSPHGGYG 548

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +G+ER LAW+  R  VKEC LYPR+ GRC P
Sbjct: 549 IGLERLLAWMCDRYTVKECSLYPRWTGRCTP 579



>gi|196013129|ref|XP_002116426.1| hypothetical protein TRIADDRAFT_38262 [Trichoplax adhaerens]
 gi|190581017|gb|EDV21096.1| hypothetical protein TRIADDRAFT_38262 [Trichoplax adhaerens]
          Length = 549

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 272/551 (49%), Positives = 379/551 (68%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEGYKDISGTXXXXXX 72
           +Y  E  GSDE   G+Q  P++T ++A +  G +   ++   + EEG +  S +      
Sbjct: 7   IYTSEKEGSDENGDGSQAKPFQTLLQAYRSYGKEPFPVIYVDSKEEGQRWASVSLSQSKK 66

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IV++ D +LP  I+IK+R + 
Sbjct: 67  VLKIWYRECRKSQEIEKREAEDAARREKNLEEAKK----IVIEADESLPKPIQIKLRDAT 122

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
           + R KRVK+ GWVHRLR QGK++ F++LRDG+GY+QC+   +LCHTYDAL L+ E ++ +
Sbjct: 123 SHRQKRVKIYGWVHRLRRQGKNLIFVLLRDGTGYIQCVFNDKLCHTYDALTLTTEYSIAV 182

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRHLVIR 251
           YG+I  LP GKTAP  HEL+ D+WEV   AP GG D+  N+   D++  +  + RH+++R
Sbjct: 183 YGIIEPLPEGKTAPGGHELIVDFWEVVGSAPPGGHDSLVNE---DSNVDVQLDYRHMMLR 239

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           G+T S ++K RS   KAF DHF  +G+ ++ PP +VQTQVEGG+TLF+++Y+GE+A+LTQ
Sbjct: 240 GDTLSKIMKIRSITEKAFNDHFYDRGYFKLTPPTLVQTQVEGGATLFKLDYFGEQAFLTQ 299

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLET LPS+GDVYCI++SYRAE+S TRRHL+EY+H+EAE  F+TF          +
Sbjct: 300 SSQLYLETVLPSMGDVYCIAQSYRAEQSRTRRHLAEYTHIEAECPFVTFEDMLDKIEDLV 359

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
            D  +R++ +   R+++ +++PDF  PQ+PF RMDY +AI YLK+HNI K++G+FYE+GE
Sbjct: 360 VDVAERIMQS-PLREMLLEMNPDFKVPQKPFRRMDYGEAIVYLKEHNITKDDGTFYEYGE 418

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTDQIN+PI LCRFPAEIK+FYM RC E+ RVT+SVD+L+P VGE+VGGSM
Sbjct: 419 DIPEAPERKMTDQINEPIMLCRFPAEIKSFYMPRCPENRRVTQSVDLLMPNVGEIVGGSM 478

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R   + +L+ GYKR GI+PTPYYWY DQRKYGT  HGG+GLG+ER+L WLL+R ++++  
Sbjct: 479 RTHVLEDLMEGYKRSGIDPTPYYWYLDQRKYGTCPHGGYGLGMERYLTWLLNRPHIRDVT 538

Query: 552 LYPRFMGRCLP 562
            YPRF+ RC P
Sbjct: 539 FYPRFIERCKP 549



>gi|328861275|gb|EGG10379.1| hypothetical protein MELLADRAFT_51822 [Melampsora larici-populina
           98AG31]
          Length = 567

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 290/566 (51%), Positives = 371/566 (65%), Gaps = 13/566 (2%)

Query: 7   SVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDN-ISILVRKTPEEGYKDISG 65
           S+ S+ TVYI+E  GSD T  G++++P++T + A   + +  ++ LV KT E    D  G
Sbjct: 5   SISSASTVYINETTGSDTTGNGSESSPFQTILGAYIAQNNTELTCLVFKTEEA--PDSKG 62

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL----- 120
           +                                             + L++   +     
Sbjct: 63  SFQPATSTAIKRAKKGYELHQKKQSKANKAEEALKDRESSSKADDAVKLEEAKKIVLEET 122

Query: 121 -PLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTY 179
             LA +IKI Q+V +R  +V+V GW+HRLR Q K + F+VLRDG+G+LQC+LTG+L  TY
Sbjct: 123 DGLAKRIKIHQAVDNREVKVRVFGWIHRLRQQ-KGLIFLVLRDGTGFLQCVLTGKLAQTY 181

Query: 180 DALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADP 239
           DAL L++ESTV + G I  LP GK+APD HEL  D+W +   APG  ++FTN+++ D+ P
Sbjct: 182 DALTLTIESTVQLTGKIVALPEGKSAPDGHELQVDWWSIMGKAPGDSESFTNQISEDSGP 241

Query: 240 SILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFE 299
             L ++RHLV+RGETAS+VLK RSA++ AFR  +      EV PPCMVQTQVEGGSTLF 
Sbjct: 242 DTLADRRHLVLRGETASSVLKVRSALLDAFRQSYAKLSLIEVTPPCMVQTQVEGGSTLFA 301

Query: 300 MNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFIT 359
            +YYGEKAYLTQ+SQLYLETCLPSLGD +CI ES+RAEKS TRRHLSEY+HLEAE+ F+T
Sbjct: 302 FDYYGEKAYLTQSSQLYLETCLPSLGDCFCIQESFRAEKSRTRRHLSEYTHLEAELGFLT 361

Query: 360 FXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNI 419
           F          IC T+D +LAN   + LV  L+PDF  P RPF RMDY++AI +L +  I
Sbjct: 362 FEDLLSHIEELICSTLDILLANPKVKALVETLNPDFKYPSRPFKRMDYQEAIAWLNERGI 421

Query: 420 KK---ENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESV 476
            K   + G  +   +DIPE PER MTD  N PIFL  FP EIKAFYMKR + +   TESV
Sbjct: 422 NKAEEDGGGPFTIADDIPEAPERLMTDTFNVPIFLINFPKEIKAFYMKRISGNPNFTESV 481

Query: 477 DVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVER 536
           DVL+PGVGE+VGGSMR++  +ELL  Y+  GI   PYYWYTDQRKYGT EHGG+GLGVER
Sbjct: 482 DVLMPGVGEIVGGSMRMTGYDELLEAYRGAGIPAEPYYWYTDQRKYGTCEHGGYGLGVER 541

Query: 537 FLAWLLHRDNVKECCLYPRFMGRCLP 562
           FLAWL+ R +V+EC LYPR+  RC P
Sbjct: 542 FLAWLVKRPHVRECSLYPRYTSRCTP 567



>gi|426197830|gb|EKV47757.1| hypothetical protein AGABI2DRAFT_185659 [Agaricus bisporus var.
           bisporus H97]
          Length = 576

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 373/575 (64%), Gaps = 26/575 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           T YIDE  GSD T TG+Q+APY++   AL   GD++  L RK     Y +    +     
Sbjct: 3   TSYIDEAAGSDATGTGSQDAPYQSLGYALFTHGDSVKYLFRKDATAAYDEPTQSSLKKAK 62

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL++D +LP A + K+ + 
Sbjct: 63  KTADGLEKKKKKAEELAAKEAKEKAEQKEKKEKLLEESKKIVLEEDQSLPKATRAKVSKL 122

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RV+V GWVHR R QG  + F+VLRDG+GYLQ +L+G +  TY+AL L+LEST+ 
Sbjct: 123 ADLRGQRVRVFGWVHRRRDQG-GIIFVVLRDGTGYLQTILSGRVAQTYEALTLTLESTIE 181

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G +  +P GKTAP  HEL  DYW V   APG +DAFTN+LN  +DPSI  + RHLVIR
Sbjct: 182 VIGTLHPVPEGKTAPGGHELSVDYWRVIGSAPGAEDAFTNRLNEKSDPSIQADLRHLVIR 241

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE AS VL+ RS ++ AFR+ + S+   EVNPPC+VQTQVEGG+TLF+++YYG+ A+LTQ
Sbjct: 242 GENASGVLRLRSYLLNAFREAYASENILEVNPPCLVQTQVEGGATLFKLDYYGQPAFLTQ 301

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFI F          I
Sbjct: 302 SSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFIDFNDLMSHIEEII 361

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK--KENGSF--- 426
           C TVD +LAN  T  L+  L+P F  P RPF R+ Y +AI +L +H I+  +E+ S    
Sbjct: 362 CKTVDILLANPITAGLIKSLNPSFQAPTRPFTRLSYVEAITWLNEHQIQHPEEDSSGNPI 421

Query: 427 ------------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC------AE 468
                       ++ G+DI E  ER MTD I KP+FL  FPAE+KAFYMK+        E
Sbjct: 422 KDEQTNQIKMVDHKVGDDIAEAAERQMTDIIGKPVFLYGFPAELKAFYMKKMDGKEGEGE 481

Query: 469 DN-RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
            N R TES D+L+P VGE+VGGSMRISD  ELLA YK+EGI+P+PYYWYTDQRKYGTTEH
Sbjct: 482 KNVRYTESCDLLMPNVGEIVGGSMRISDEEELLAAYKKEGIDPSPYYWYTDQRKYGTTEH 541

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 542 GGYGLGVERFLAWLANRYTVRECALYPRWPGRATP 576



>gi|513032346|gb|AGO12338.1| AaceriAEL020Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 551

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/554 (51%), Positives = 374/554 (67%), Gaps = 8/554 (1%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKTPE--EGYKDISGTXX 68
           ++YI+E+ GSDE   G++ AP+KTA   L  Q  G+   +   K  E  EGY +IS +  
Sbjct: 2   SIYINELTGSDEAGRGSKEAPFKTAAFGLFAQQDGEEPKVFTYKGDEGDEGYVEISASGL 61

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I + +D +LP A+ +K+
Sbjct: 62  KKARKGAEGLRKKAAKEAEQQQKKAEQEAREAAKKLELMN---ITIAEDSSLPPAVGMKV 118

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
            ++  + G RVKVSGW+HRLR  GK   F+VLRDG+GYLQ +L+G+L   Y    L+LE+
Sbjct: 119 GKTHGAVGTRVKVSGWIHRLRV-GKAFVFLVLRDGTGYLQAVLSGDLARAYQTSTLTLET 177

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TVT+YG + +LP GKTAP   EL  DY+E+   AP GDD+F+N++   ADPS+L + RHL
Sbjct: 178 TVTLYGTVKQLPEGKTAPGGVELDVDYYEIVGLAPSGDDSFSNRVQEGADPSLLMDMRHL 237

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           ++RGE+ SAV+K R+A ++A R  +  +G  EV PPCMVQTQVEGGSTLF+++YYGE+A+
Sbjct: 238 MLRGESLSAVMKVRAAFLRAIRRVYQEEGLLEVTPPCMVQTQVEGGSTLFKLDYYGEEAF 297

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDV+C+ ES+RAEKSHTRRHLSEY+H+EAE+ F+TF        
Sbjct: 298 LTQSSQLYLETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELGFVTFDELMCHME 357

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             I   V  VL +     LV QL+PDF PPQ PF+R++YKDAI +L +H IK E G  ++
Sbjct: 358 KVITSLVKYVLEDPVAGPLVKQLNPDFQPPQMPFMRLEYKDAITWLNEHGIKNEEGEEFK 417

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD I  PIFL RFP E+K+FYMKRCA+D RVTES DVL+P VGE+ G
Sbjct: 418 FGDDIAEAAERKMTDTIGVPIFLTRFPLELKSFYMKRCADDPRVTESFDVLMPTVGEITG 477

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMRI  ++EL+AG+KREG+NP  YYW++DQR+YGT  HGG+GLG ER LAWL +R  V+
Sbjct: 478 GSMRIDSLDELMAGFKREGVNPDSYYWFSDQRRYGTCPHGGYGLGTERILAWLCNRFTVR 537

Query: 549 ECCLYPRFMGRCLP 562
           +C LYPR+ GRC P
Sbjct: 538 DCSLYPRYTGRCKP 551



>gi|409080912|gb|EKM81272.1| hypothetical protein AGABI1DRAFT_112944 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 576

 Score =  579 bits (1492), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 373/575 (64%), Gaps = 26/575 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           T YIDE  GSD T TG+Q+APY++   AL   GD++  L RK     Y +    +     
Sbjct: 3   TSYIDEAAGSDATGTGSQDAPYQSLGYALFTHGDSVKYLFRKDATAAYDEPTQSSLKKAK 62

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL++D +LP A + K+ + 
Sbjct: 63  KTADGLEKKKKKAEELAAKEAKDKAEQKEKKEKLLEESKKIVLEEDQSLPKATRAKVSKL 122

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              RG+RV+V GWVHR R QG  + F+VLRDG+GYLQ +L+G +  TY+AL L+LEST+ 
Sbjct: 123 ADLRGQRVRVFGWVHRRRDQG-GIIFVVLRDGTGYLQTILSGRVAQTYEALTLTLESTIE 181

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G +  +P GKTAP  HEL  DYW V   APG +DAFTN+LN  +DPSI  + RHLVIR
Sbjct: 182 VIGTLHPVPEGKTAPGGHELSVDYWRVIGSAPGAEDAFTNRLNEKSDPSIQADLRHLVIR 241

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE AS VL+ RS ++ AFR+ + S+   EVNPPC+VQTQVEGG+TLF+++YYG+ A+LTQ
Sbjct: 242 GENASGVLRLRSYLLNAFREAYASENILEVNPPCLVQTQVEGGATLFKLDYYGQPAFLTQ 301

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFI F          I
Sbjct: 302 SSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFIDFNDLMSHIEEII 361

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK--KENGSF--- 426
           C TVD +LAN  T  L+  L+P F  P RPF R+ Y +AI +L +H I+  +E+ S    
Sbjct: 362 CKTVDILLANPITAGLIKSLNPSFQTPTRPFTRLSYVEAITWLNEHQIQHPEEDSSGNPI 421

Query: 427 ------------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC------AE 468
                       ++ G+DI E  ER MTD I KP+FL  FPAE+KAFYMK+        E
Sbjct: 422 KDEQTNQINMVDHKVGDDIAEAAERQMTDIIGKPVFLYGFPAELKAFYMKKMDDKEGEGE 481

Query: 469 DN-RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
            N R TES D+L+P VGE+VGGSMRISD  ELLA YK+EGI+P+PYYWYTDQRKYGTTEH
Sbjct: 482 KNVRYTESCDLLMPNVGEIVGGSMRISDEEELLAAYKKEGIDPSPYYWYTDQRKYGTTEH 541

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 542 GGYGLGVERFLAWLANRYTVRECALYPRWPGRATP 576



>gi|255720298|ref|XP_002556429.1| KLTH0H13024p [Lachancea thermotolerans]
 gi|238942395|emb|CAR30567.1| KLTH0H13024p [Lachancea thermotolerans CBS 6340]
          Length = 554

 Score =  579 bits (1492), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 289/554 (52%), Positives = 364/554 (65%), Gaps = 5/554 (0%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRAL---QVKGDNISILVRKTPEEGYKDISGTXX 68
           ++YI+E  G D+ S TG+Q+ P+KT   AL   +   +   + V K  EE          
Sbjct: 2   SLYINESTGVDDISVTGSQDQPFKTPAYALFSAREDDEEPKLFVFKKDEEKGDCFVEISA 61

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I +++D +LP AIK KI
Sbjct: 62  SALKKARKGSDGLKKKLAKQLELEKKKQEKDENEAAKKLEALNIKIEEDKSLPEAIKCKI 121

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
           ++S  +  +RVKVSGW+HRLR+  K + FIVLRDG+G+LQ +LTG+L   Y    L+LES
Sbjct: 122 QKSYDAVDQRVKVSGWIHRLRSS-KSLVFIVLRDGTGFLQAVLTGDLARAYQTTALTLES 180

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TVT+YG + +LP GK AP   ELL DY+EV   AP G+DAFTNK+   ADPS+L +QRHL
Sbjct: 181 TVTLYGKVCKLPEGKNAPGGVELLVDYYEVVSLAPSGEDAFTNKIAEGADPSLLLDQRHL 240

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
            +RGET S V+K R+A+++A R  +  +G +EVN PCMVQTQVEGGSTLF + YYGE+AY
Sbjct: 241 ALRGETLSGVMKVRAALLRAVRRFYYEEGLTEVNTPCMVQTQVEGGSTLFNLGYYGEEAY 300

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCL SLGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ F+TF        
Sbjct: 301 LTQSSQLYLETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLTFDDLLVHIE 360

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             I   V  VL +     LV QL+P F  P  PF+R+DY+DAI++L +H IK E G  ++
Sbjct: 361 KLITTAVRYVLEDPVAGPLVEQLNPGFKAPTMPFMRLDYRDAIKWLNEHGIKNEEGEDFK 420

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD I  PIFL RFP EIK+FYMKRCA+D  VTESVDVL+P VGE+ G
Sbjct: 421 FGDDIAEAAERKMTDTIGVPIFLIRFPVEIKSFYMKRCADDANVTESVDVLMPNVGEITG 480

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMRI  M+EL+AG+KREGI   PYYW+ DQRKYG+  HGG+G+G ER LAWL  R  V+
Sbjct: 481 GSMRIDAMDELMAGFKREGIATDPYYWFIDQRKYGSCPHGGYGIGTERILAWLCDRFTVR 540

Query: 549 ECCLYPRFMGRCLP 562
           +C LYPRF GRC P
Sbjct: 541 DCSLYPRFTGRCKP 554



>gi|393222658|gb|EJD08142.1| asparaginyl-tRNA synthetase [Fomitiporia mediterranea MF3/22]
          Length = 569

 Score =  579 bits (1492), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 293/571 (51%), Positives = 370/571 (64%), Gaps = 25/571 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRAL-QVKGDNISILVRKTPEEGYKDISGTXXXXX 71
           ++YIDE  GSDE+ +GTQNAPYKT   AL +    ++ + +RK  E  Y   + +     
Sbjct: 3   SIYIDEATGSDESGSGTQNAPYKTLAYALFKHDSPDVQLQIRKDSETPYDKPTDSSLKKA 62

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL +D +LP AIK KI + 
Sbjct: 63  KKNADGLRKKAAKAAEIAEREARERAEADKRLEESKK---IVLVEDASLPKAIKAKINKL 119

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              R KRV+V+GW+HRLR Q K + FIVLRDG+GYLQ +L+G+   TY+AL L+LES+V 
Sbjct: 120 PPLRSKRVRVAGWIHRLRQQ-KGIIFIVLRDGTGYLQAVLSGQTSQTYEALTLTLESSVE 178

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G + ELP GKTAP  HEL+ DYW+V   AP GD+AF N+ N  +DPSIL E RH VIR
Sbjct: 179 LTGTLQELPEGKTAPGGHELVVDYWKVIGAAPSGDEAFANRFNEKSDPSILAELRHFVIR 238

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GETAS+VL+ RS ++ AFR     +   EV PPC+VQT VEGG+TLF +NYYG+ AYLTQ
Sbjct: 239 GETASSVLRLRSHLLSAFRASLIEENLLEVTPPCLVQTSVEGGATLFALNYYGQTAYLTQ 298

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPS+GDV+C+ ES+RAE SHTRRHLSEY+HLE E+AFI F          I
Sbjct: 299 SSQLYLETCLPSIGDVFCVQESFRAENSHTRRHLSEYTHLEGELAFINFDDLMTHIEAII 358

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF----- 426
           C TVD++LA+  +  L+ QL+P F PP RPF R+ Y DAI +L +H I+ E         
Sbjct: 359 CSTVDKLLADPESASLIKQLNPSFKPPSRPFKRLAYTDAIAWLNEHGIQHEKEDAEGNVI 418

Query: 427 -----------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKR---CAEDNRV 472
                      +  G+DI E  ER MTD +  P+FL  FPAE+KAFYMK+     E  +V
Sbjct: 419 RDAEGKPVMVDHAVGDDIAEAAERRMTDILGVPVFLYGFPAELKAFYMKKIPGTGESGKV 478

Query: 473 -TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGE+VGGSMRI+D +EL+A YKREGI+PT YYW+TDQRKYGT EHGG+G
Sbjct: 479 FTESCDLLMPGVGEIVGGSMRIADHDELMAAYKREGIDPTSYYWFTDQRKYGTCEHGGYG 538

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVERFLAWL  R  V++C LYPR+ GR  P
Sbjct: 539 LGVERFLAWLADRYTVRDCSLYPRWPGRATP 569



>gi|115400689|ref|XP_001215933.1| asparaginyl-tRNA synthetase [Aspergillus terreus NIH2624]
 gi|114191599|gb|EAU33299.1| asparaginyl-tRNA synthetase [Aspergillus terreus NIH2624]
          Length = 574

 Score =  578 bits (1489), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 289/573 (50%), Positives = 371/573 (64%), Gaps = 24/573 (4%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRAL--QVKGDNISILVRKTPEE---------GY 60
           ++YIDE  G D+ S TG+++APYKT V A       D +  L RK+  +           
Sbjct: 3   SIYIDEDVGRDDASATGSESAPYKTLVHAFMQHPPADGVQYLTRKSQTDPVGENVDPAAK 62

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
            +                                                 +V+K+DP+L
Sbjct: 63  LEWKPATKSALKKATNLYEQRKKKAAKEHELAIREKQEAEKRQQVLEEAKKVVIKEDPSL 122

Query: 121 PLAIKIKIRQS-----------VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQC 169
           P  +KI++ ++             + G RV+V G +HRLR Q KD+ FI L DG GY+QC
Sbjct: 123 PKPVKIRLDETDPAVVKLGSPESDTPGTRVRVLGRIHRLRAQ-KDVIFITLADGYGYMQC 181

Query: 170 LLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAF 229
           +LTG L  TYDA+ L++ +++ I+G +  +P G+ AP+N EL AD++ V   A G  +A 
Sbjct: 182 ILTGNLTKTYDAMTLTIATSMAIHGEMRAVPPGQHAPNNRELHADFFTVIGRAAGDKEAI 241

Query: 230 TNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQT 289
           TN++  DADP  LY+ RHLV+RGETASAV+K R+A ++AFR  F+     EV PP MVQT
Sbjct: 242 TNRVAHDADPQTLYDNRHLVLRGETASAVMKVRAATLRAFRQTFEEHRMLEVTPPAMVQT 301

Query: 290 QVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYS 349
           QVEGGSTLF+ +YYGE AYLTQ+SQLYLETCLPS+GDV+C+  S+RAEKS TRRHLSEY+
Sbjct: 302 QVEGGSTLFKFDYYGENAYLTQSSQLYLETCLPSMGDVFCVCPSFRAEKSLTRRHLSEYT 361

Query: 350 HLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKD 409
           H+EAE+ FITF          IC  +D  LA+  T  L+ QL+PDF  P RPF RM Y D
Sbjct: 362 HIEAELDFITFNDLLDHLESVICRVIDLTLADPATAALLKQLNPDFKTPSRPFRRMKYSD 421

Query: 410 AIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAED 469
           AIQ+L++H+I  E G  +EFG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  ED
Sbjct: 422 AIQWLREHDIPNEEGKPHEFGDDIAEAAERKMTDMINQPIFLTHFPAEIKAFYMKKDVED 481

Query: 470 NRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGG 529
            RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P+PYYWYTDQRKYGT+ HGG
Sbjct: 482 RRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPSPYYWYTDQRKYGTSPHGG 541

Query: 530 FGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +GLG+ERFLAWL  R  V+EC LYPRF GRC P
Sbjct: 542 YGLGLERFLAWLCARYTVRECSLYPRFTGRCTP 574



>gi|170115146|ref|XP_001888768.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164636244|gb|EDR00541.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 560

 Score =  578 bits (1489), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 295/560 (52%), Positives = 371/560 (66%), Gaps = 14/560 (2%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRAL---QVKGDNISILVRKTPEEGYKD-ISGTXXX 69
           +YIDE  GSD T  GT  APY++   AL          S L+RK     Y++    +   
Sbjct: 4   IYIDEAVGSDTTGNGTIEAPYQSLGVALFNHPTTTTPASFLIRKDAAGTYEEPTQSSLKK 63

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     IVL++D  LP   KI   
Sbjct: 64  AKKTADGLEKKKKKAEELAEREAKEKGDEKERREKVLVESRKIVLEEDGTLPKPTKIGYL 123

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           +S+  R KRV+V GWVHRLR Q KD+ FIV+RDG+GYLQ +L+G +  TY+AL L+LES+
Sbjct: 124 ESL--RSKRVRVFGWVHRLRQQ-KDIIFIVVRDGTGYLQTVLSGRVAQTYEALTLTLESS 180

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V + G +  +P GKTAP  HEL+ DYW V   APG +DAFTN+LN  +DPSI  + RHLV
Sbjct: 181 VEVVGTLQTVPEGKTAPGGHELVVDYWRVVGPAPGAEDAFTNRLNEKSDPSIQADLRHLV 240

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGETAS+VL+ R+A++ AFRD   ++   EV PPC+VQTQVEGG+TLF+++YYG+ A+L
Sbjct: 241 LRGETASSVLRLRAALLIAFRDSLTAQSLIEVTPPCLVQTQVEGGATLFKLDYYGQPAFL 300

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF         
Sbjct: 301 TQSSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFTDLMDHIEE 360

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK--KENG-SF 426
            IC+TV  +LAN T+  L+  L+P+F+ P RPFLR+ Y DAI++L  H IK  KE+    
Sbjct: 361 IICNTVSILLANPTSASLIKSLNPNFITPSRPFLRLSYVDAIKWLNAHGIKHPKEDAEGN 420

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC----AEDNRVTESVDVLIPG 482
           +E G+DI E  ER MTD I  P+FL  FPAE+KAFYMK+      E    TES D+L+P 
Sbjct: 421 HEVGDDIAEAAERQMTDIIGTPVFLYGFPAELKAFYMKKMPQGEGETTVFTESCDLLMPN 480

Query: 483 VGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLL 542
           VGE+VGGSMRI+DM ELLA YKREGI+P PYYW+TDQRKYGT EHGG+GLGVERFLAWL 
Sbjct: 481 VGEIVGGSMRIADMEELLAAYKREGIDPEPYYWFTDQRKYGTCEHGGYGLGVERFLAWLA 540

Query: 543 HRDNVKECCLYPRFMGRCLP 562
           +R  V+EC LYPR+ GR  P
Sbjct: 541 NRYTVRECSLYPRWPGRATP 560



>gi|157113775|ref|XP_001652096.1| aspartyl-tRNA synthetase [Aedes aegypti]
 gi|108877614|gb|EAT41839.1| AAEL006577-PA [Aedes aegypti]
          Length = 553

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 290/554 (52%), Positives = 372/554 (67%), Gaps = 10/554 (1%)

Query: 12  ETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXX 69
           + +Y  +  GSDE   GT   P+KT ++A++  G     +I V    E   K  S     
Sbjct: 7   QEIYTSDARGSDEIGDGTAEKPFKTILQAMRHAGKEPFPTIYVDAKDE---KAESPFEVA 63

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     IV+K+DP+   A +IKI 
Sbjct: 64  AKSQLKKIQKLWVRDSLKSSEKQKREAEDAKKREQNLEEARKIVIKEDPSWTPAKRIKIV 123

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           +   +R  RVK++GWVHRLR QGK + FI LRDG+G+LQC+L   +C TY+AL+LS ES 
Sbjct: 124 KGSENRDIRVKINGWVHRLRRQGKGLMFITLRDGTGFLQCVLNDLMCQTYNALVLSTESA 183

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAP-GGDDAFTNKLNADADPSILYEQRHL 248
           V ++G + E+P GK+AP  HEL  DYWE+   AP GG D     LN DA P +  + RH+
Sbjct: 184 VQLFGTLKEVPEGKSAPGGHELHVDYWELIGLAPAGGADTI---LNEDAHPDVQLDNRHI 240

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           +IRGE  S +LK R  IM AFR H+  +G++EV PP +VQTQVEGGSTLF++NY+GE+AY
Sbjct: 241 MIRGENTSKILKMRDVIMDAFRAHYHDRGYTEVTPPTLVQTQVEGGSTLFKLNYFGEEAY 300

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDVYCI++SYRAE+S TRRHL+EYSH+EAE  FI+F        
Sbjct: 301 LTQSSQLYLETCLPALGDVYCIAQSYRAEQSRTRRHLAEYSHVEAECPFISFDDLLDRLE 360

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             + D VDRVL +     +V +L+PDFVPP+ PF RM+Y DAI +LK++N+ KE+G+FYE
Sbjct: 361 DLVVDVVDRVLKSPWGH-IVKELNPDFVPPKTPFRRMNYADAIVWLKENNVTKEDGTFYE 419

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FGEDIPE PER MTD IN+PI LCRFPAEIK+FYM +C ED R+TESVDVL+P VGE+VG
Sbjct: 420 FGEDIPEGPERKMTDTINEPIMLCRFPAEIKSFYMAKCPEDRRLTESVDVLLPNVGEIVG 479

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMR  D  EL+ GYKREGI+P PYYWY DQR YG+  HGG+GLG+ERF+ WLL+R +++
Sbjct: 480 GSMRSWDHEELMEGYKREGIDPKPYYWYIDQRVYGSQPHGGYGLGLERFMCWLLNRYHIR 539

Query: 549 ECCLYPRFMGRCLP 562
           E CLYPRF+ RC P
Sbjct: 540 EVCLYPRFLDRCKP 553



>gi|389739353|gb|EIM80546.1| asparaginyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
          Length = 577

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 297/574 (51%), Positives = 372/574 (64%), Gaps = 27/574 (4%)

Query: 15  YIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXXX 74
           +IDE +GSD T  GT   PY T   AL   G +  +LVRK P   Y + + +        
Sbjct: 5   HIDESSGSDATGNGTAETPYATIAFALFTHGQDSKVLVRKDPNTPYDEPTQSALKKAKKG 64

Query: 75  XXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 I L +D +LP ++K K+    A
Sbjct: 65  ADGLEKKKKKAEELAEKEAAAQGAEREKRDKLLEESKNIKLVEDTSLPKSVKAKVVNLTA 124

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            RG RV+V GWVHRLR+Q KD+ FIVLRDG+GYLQ +L+G    TYDAL L+LESTV + 
Sbjct: 125 HRGSRVRVLGWVHRLRSQ-KDIIFIVLRDGTGYLQAVLSGTTAQTYDALTLTLESTVELV 183

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G +  +P GKTAP  HEL+ D+W V   APGG+DAFTN+LN  +DPSI+ + RHLVIRGE
Sbjct: 184 GTLQAVPDGKTAPGGHELVVDFWRVVGLAPGGEDAFTNRLNEKSDPSIMADLRHLVIRGE 243

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
            AS+VL+ RS ++ +FRD  ++    EV PPCMVQTQVEGG+TLF+ +YYG+ A+LTQ+S
Sbjct: 244 NASSVLRLRSLLLSSFRDSLNAHDLMEVTPPCMVQTQVEGGATLFKFDYYGQPAFLTQSS 303

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF          IC+
Sbjct: 304 QLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFDDLMDHIESIICE 363

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE----NGSF--- 426
           TVDR+L N T+  L+ QL+P F PP RPFLR++Y DAI +L +H I+ E    +G+    
Sbjct: 364 TVDRLLKNPTSATLIKQLNPSFTPPSRPFLRLNYVDAITWLNEHKIQHEAEDADGNVIKD 423

Query: 427 ---------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCA---------E 468
                    +  G+DI E  ER MTD I  P+FL  FPAE+KAFYMK+ A          
Sbjct: 424 DSGKPIMVDHAVGDDIAEAAERQMTDIIGTPVFLYGFPAELKAFYMKKMAAPEGKEAQSA 483

Query: 469 DNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHG 528
               TES D+L+PGVGE+VGGSMRI+D+ ELLA YKREG++  PYYWY DQRKYGT EHG
Sbjct: 484 GKMFTESCDLLMPGVGEIVGGSMRIADLEELLAAYKREGMDAAPYYWYADQRKYGTCEHG 543

Query: 529 GFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           G+GLGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 544 GYGLGVERFLAWLANRYTVRECSLYPRWPGRATP 577



>gi|363750097|ref|XP_003645266.1| hypothetical protein Ecym_2750 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888899|gb|AET38449.1| Hypothetical protein Ecym_2750 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 553

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 369/556 (66%), Gaps = 10/556 (1%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRALQVK--GDNISILVRKTPEE---GYKDISGT 66
           +VYI++ +G D+ S +GT+  P+K+   AL V   G    +LV K  E+   GY +IS +
Sbjct: 2   SVYINDSSGKDDISVSGTKEEPFKSGAFALFVNQTGSEPKLLVYKKDEDTDGGYVEISAS 61

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                        I +K+D +LP A  +
Sbjct: 62  ALKKARKGAEGLKKKAAKQEDQDKKKKEQDAKDVAKRLELMN---ITIKEDLSLPKARSM 118

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           KI +  ++  +RVKV GW+HRLR   K + F+VLRDG+GYLQ +L+G+L   Y    L+L
Sbjct: 119 KIGRCYSAVDERVKVCGWIHRLRLS-KSVGFVVLRDGTGYLQAVLSGDLAKAYQTGTLTL 177

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTV +YG + +LP GKTAP   EL  DY+E+   AP GDDAFTN++   ADPS+L +QR
Sbjct: 178 ESTVKLYGTVRKLPDGKTAPGGVELDVDYYEIVGLAPAGDDAFTNRVQEGADPSLLLDQR 237

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL++RGET SAV+K R+A++KAFR  FD +G +EV PPCMVQTQVEGGSTLF+++YYGE+
Sbjct: 238 HLMLRGETLSAVMKVRAALLKAFRRVFDEEGLTEVTPPCMVQTQVEGGSTLFKLDYYGEE 297

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           A+LTQ+SQLYLETCL SLGDVYCI ES+RAEKSHTRRHLSEY+H+E E+AF+ F      
Sbjct: 298 AFLTQSSQLYLETCLSSLGDVYCIQESFRAEKSHTRRHLSEYTHIEGELAFLDFEDLLTH 357

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  TV  VL +     L+ QL+PDF  PQ PF+R++YKDAI +L +H IK E    
Sbjct: 358 IERLITSTVQYVLEDSVAGPLIKQLNPDFKAPQMPFMRLEYKDAITWLNEHGIKNEENEE 417

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           ++FG+DI E  ER MTD I  PI L +FP  IK+FYMKRCA+D RVTESVDVL+P VGE+
Sbjct: 418 FKFGDDIAEAAERKMTDTIGVPILLTKFPVAIKSFYMKRCADDPRVTESVDVLMPTVGEI 477

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMRI    EL+AG+ REGI+ + YYW+ DQR+YGT  HGG+G+G ER LAWL  R  
Sbjct: 478 TGGSMRIESTEELMAGFTREGIDASAYYWFVDQRRYGTCPHGGYGIGTERILAWLCDRFT 537

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 538 VRDCSLYPRFSGRCKP 553



>gi|366997995|ref|XP_003683734.1| hypothetical protein TPHA_0A02180 [Tetrapisispora phaffii CBS 4417]
 gi|357522029|emb|CCE61300.1| hypothetical protein TPHA_0A02180 [Tetrapisispora phaffii CBS 4417]
          Length = 555

 Score =  575 bits (1483), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 270/451 (59%), Positives = 343/451 (76%), Gaps = 1/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I +++D +LP A K KI  S A  G+RVKVSGW+HR R+  K + F+VLRDGSG+LQ +L
Sbjct: 106 IKIEEDKSLPAAQKCKINTSYAKVGERVKVSGWIHRFRSN-KKVVFVVLRDGSGFLQTVL 164

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           +G+L      L L+LESTVT+YGVI+++P GKTAP N EL+ DY+EV   AP GD++FTN
Sbjct: 165 SGDLALAQQTLDLTLESTVTLYGVITKVPEGKTAPGNVELIVDYYEVVGLAPSGDESFTN 224

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
           K+   AD S+L +QRHL +RGET SAV+K RSA++KA R  +  +   EV PPCMVQTQV
Sbjct: 225 KIAEGADASLLLDQRHLTLRGETLSAVMKVRSALLKAIRRFYVEESLLEVTPPCMVQTQV 284

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLF+++YYGE+AYLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+
Sbjct: 285 EGGSTLFKLDYYGEEAYLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHI 344

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE+AFITF          I ++V  VL +     LV QL+PDFV P+ PFLR++YKDAI
Sbjct: 345 EAELAFITFDDLLNHIEKLIINSVKYVLEDPVAGPLVKQLNPDFVAPEGPFLRLEYKDAI 404

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++L +H+IK E+G+ ++FG+DI E  ER MTD I KPI L +FP  IK+FYM+RCA+D  
Sbjct: 405 KWLVEHDIKNEDGAPFKFGDDIAEAAERKMTDTIGKPILLTKFPVAIKSFYMERCADDES 464

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           VTESVDVL+P VGE+ GGSMRI+D + L+   K EG++P  YYW+ DQRKYGT  HGG+G
Sbjct: 465 VTESVDVLMPTVGEITGGSMRITDADVLVERMKSEGLDPAAYYWFIDQRKYGTCPHGGYG 524

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG ER LAWL  R  V++C LYPRF GRC P
Sbjct: 525 LGTERILAWLCDRFTVRDCSLYPRFSGRCKP 555



>gi|219275592|ref|NP_001136421.1| asparaginyl-tRNA synthetase, cytoplasmic isoform 2 [Rattus
           norvegicus]
          Length = 507

 Score =  575 bits (1482), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 258/438 (58%), Positives = 340/438 (77%), Gaps = 3/438 (0%)

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           ++KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L
Sbjct: 73  EVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVL 132

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           S ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +   
Sbjct: 133 STESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLN 190

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RH++IRGE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+G
Sbjct: 191 NRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFG 250

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF    
Sbjct: 251 EEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLL 310

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +CD VDRVL +     +VY L+P+F  P+RPF RM+Y DAI++L++H++KKE+G
Sbjct: 311 SRLEDLVCDVVDRVLKSPVA-SIVYDLNPNFKAPKRPFRRMNYSDAIEWLREHDVKKEDG 369

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           +FYEFG+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VG
Sbjct: 370 TFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVG 429

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R
Sbjct: 430 EIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNR 489

Query: 545 DNVKECCLYPRFMGRCLP 562
            ++++ CLYPRF+ RC P
Sbjct: 490 YHIRDVCLYPRFLQRCRP 507



>gi|367013032|ref|XP_003681016.1| hypothetical protein TDEL_0D02210 [Torulaspora delbrueckii]
 gi|359748676|emb|CCE91805.1| hypothetical protein TDEL_0D02210 [Torulaspora delbrueckii]
          Length = 555

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/558 (50%), Positives = 377/558 (67%), Gaps = 12/558 (2%)

Query: 13  TVYIDEVNGSDETST-GTQNAPYKTAVRALQV----KGDNIS---ILVRKTPEEGYKDIS 64
           ++Y++E  G DET+  G+Q  PY T   AL      +G + +   + V K+ E  Y++IS
Sbjct: 2   SLYVNESVGVDETTACGSQEKPYATPAFALFAYQGQQGQDAAEPKLFVFKSEENEYQEIS 61

Query: 65  GTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAI 124
            +                                             I +++D +LP A 
Sbjct: 62  ASALKKARKGCSGLIKKAVKQKEEQARKEQQDADNAAKQMAALN---IKIEEDKSLPAAK 118

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           K K+ QS    G+RVK+SGW+HRLR+  K + F+VLRDG+G++QC+L G+L      + L
Sbjct: 119 KFKVGQSYEHVGERVKLSGWIHRLRSN-KKVVFVVLRDGTGFIQCVLAGDLAVAQQTVDL 177

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           +LES+V +YG ++++P GK+AP + EL+ DY+E+   AP G++AFTNK+   ADPS+L +
Sbjct: 178 TLESSVVLYGTVTKVPEGKSAPGDVELVVDYYEIVGLAPSGEEAFTNKIAEGADPSLLLD 237

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
           QRHL +RGET SAV+K R+A++K+ R  +D +  +EV PPCMVQTQVEGGSTLF+++YYG
Sbjct: 238 QRHLTLRGETISAVMKVRAALLKSIRRVYDEENITEVTPPCMVQTQVEGGSTLFKLDYYG 297

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+A+LTQ+SQLYLETCL +LGDVY I ES+RAEKSHTRRHLSEY+H+EAE+ F++F    
Sbjct: 298 EEAFLTQSSQLYLETCLAALGDVYTIQESFRAEKSHTRRHLSEYTHIEAELCFLSFDELL 357

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 + ++V  VL +  +  LV QL+P F  P+ PFLR+DYKDAIQ+L DH++K E+G
Sbjct: 358 DHIERLVINSVQYVLEDPVSGPLVKQLNPKFQAPKGPFLRLDYKDAIQWLNDHDVKNEDG 417

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
             ++FG+DI E  ER MTD I  PIFL RFP EIK+FYM+RC +D RVTESVDVL+P VG
Sbjct: 418 EPFKFGDDIAEAAERKMTDTIGVPIFLIRFPVEIKSFYMQRCKDDPRVTESVDVLMPNVG 477

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+ GGSMRI D  EL+ G+KREGI+P  YYW+ DQRKYGT  HGG+G+G ER LAWL  R
Sbjct: 478 EITGGSMRIKDTEELMEGFKREGIDPKAYYWFVDQRKYGTCPHGGYGIGTERILAWLCDR 537

Query: 545 DNVKECCLYPRFMGRCLP 562
             V++C LYPRF GRC P
Sbjct: 538 FTVRDCSLYPRFSGRCKP 555



>gi|37361912|gb|AAQ91069.1| LRRGT00113 [Rattus norvegicus]
          Length = 496

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 258/438 (58%), Positives = 340/438 (77%), Gaps = 3/438 (0%)

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           ++KI      RG+RVKV GWVHRLR QGK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L
Sbjct: 62  EVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVL 121

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           S ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +   
Sbjct: 122 STESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLN 179

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RH++IRGE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+G
Sbjct: 180 NRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFG 239

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           E+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+EAE  F+TF    
Sbjct: 240 EEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLL 299

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +CD VDRVL +     +VY L+P+F  P+RPF RM+Y DAI++L++H++KKE+G
Sbjct: 300 SRLEDLVCDVVDRVLKSPVA-SIVYDLNPNFKAPKRPFRRMNYSDAIEWLREHDVKKEDG 358

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           +FYEFG+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P VG
Sbjct: 359 TFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVG 418

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L+R
Sbjct: 419 EIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNR 478

Query: 545 DNVKECCLYPRFMGRCLP 562
            ++++ CLYPRF+ RC P
Sbjct: 479 YHIRDVCLYPRFLQRCRP 496



>gi|50552310|ref|XP_503565.1| YALI0E05005p [Yarrowia lipolytica]
 gi|49649434|emb|CAG79146.1| YALI0E05005p [Yarrowia lipolytica CLIB122]
          Length = 585

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 285/558 (51%), Positives = 369/558 (66%), Gaps = 10/558 (1%)

Query: 10  SSETVYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRKTPEEG----YKDIS 64
           S   +Y+++  G DE+S +G Q++PYKT   AL    D   I V K   EG    Y+DIS
Sbjct: 33  SGPAIYVNDTKGVDESSASGAQDSPYKTPAFALYSHPD-AQIKVFKAGAEGAEGAYEDIS 91

Query: 65  GTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAI 124
            +                                             I + +D +L    
Sbjct: 92  PSALKKAKKGVDGLVKKAEKAKQLEASKADREAAEAARLEAAKK---ITITEDKSLDKPK 148

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
            IKIR +  +RG RVK+ GWVHRLRTQ K + F+VLRDG+GYLQC+L G+L + +    L
Sbjct: 149 LIKIRDTTENRGPRVKLFGWVHRLRTQ-KGVAFLVLRDGTGYLQCVLQGDLANAFQTQNL 207

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           +LES+V IYG + E+P G  AP  HEL+ D++E+   AP GDDA TNK+   ADPS L +
Sbjct: 208 TLESSVAIYGTLKEVPEGARAPGGHELVVDFYEIIGLAPSGDDAITNKVQEGADPSYLLD 267

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            R+L +RGET SAV+K R++ +++ R  +D  G +E+ PPCMVQTQVEGGSTLF ++YYG
Sbjct: 268 YRYLTVRGETLSAVMKVRASFLRSIRRVYDELGMTEITPPCMVQTQVEGGSTLFALDYYG 327

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           EKAYLTQ+SQLYLET +PS+GD YCI+ES+RAE+SHTRRHLSEY+H+EAE+ F+ F    
Sbjct: 328 EKAYLTQSSQLYLETVIPSVGDAYCIAESFRAERSHTRRHLSEYTHIEAELGFLDFETFL 387

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +C TVD VLA+     LV +L+P F  P+RPF+RM Y DA+++L +HNI  E G
Sbjct: 388 EHIEEVLCRTVDYVLADPVAGPLVQELNPGFKAPERPFMRMPYVDALEWLNEHNIPNEEG 447

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           + + FG+DI E  ER MTD+I KPIFL RFP EIK+FYMK+C +D RVTESVDVL+P VG
Sbjct: 448 NKFTFGDDIAEAAERKMTDEIGKPIFLTRFPLEIKSFYMKKCVDDPRVTESVDVLMPNVG 507

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+ GGSMRI D++EL+AG+KREGI+  PY ++ D RKYGT  HGG+GLG ER LAWL  R
Sbjct: 508 EITGGSMRIDDLDELMAGFKREGIDTAPYDFFIDLRKYGTFPHGGYGLGTERILAWLCDR 567

Query: 545 DNVKECCLYPRFMGRCLP 562
             V+EC LYPRF GRC P
Sbjct: 568 FTVRECSLYPRFTGRCKP 585



>gi|70989689|ref|XP_749694.1| cytoplasmic asparaginyl-tRNA synthetase [Aspergillus fumigatus
           Af293]
 gi|66847325|gb|EAL87656.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Aspergillus
           fumigatus Af293]
 gi|159129102|gb|EDP54216.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Aspergillus
           fumigatus A1163]
          Length = 574

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 290/573 (50%), Positives = 370/573 (64%), Gaps = 24/573 (4%)

Query: 13  TVYIDE-VNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKTPEEGY-KDISGTXX 68
           T+YIDE V   D T+TG+++APYKT V A       +    L+RK+  +   +D+     
Sbjct: 3   TIYIDEDVGRDDSTATGSESAPYKTLVHAYLQHPPAEGNQYLMRKSQTDATGEDVDPAAK 62

Query: 69  --------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
                                                              +V+ +DP+L
Sbjct: 63  LEWKPPTKSATKKALSIVEQRKKKAAKEQELAIREKQEAEKRQKVLEEAKKVVITEDPSL 122

Query: 121 PLAIKIKI-----------RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQC 169
           P  ++I++                + G RV+V G VHRLR Q KD+ F+ L DG GYLQC
Sbjct: 123 PKPVRIRLDVTDPAIVKLGSPETQTAGTRVRVLGRVHRLRVQ-KDVIFLTLSDGYGYLQC 181

Query: 170 LLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAF 229
           +LTG L  TYDA+ L+LE+++ I+G +  +P  + AP++ EL AD++ V   A G  +A 
Sbjct: 182 VLTGNLTKTYDAMTLTLETSMAIHGEMRAVPPKQHAPNDRELHADFFTVIGRAAGDKEAI 241

Query: 230 TNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQT 289
           T ++  DADP  LY+ RHLV+RGE +SAV+K R+A +KAFR  F+ K   EV PP MVQT
Sbjct: 242 TTRVAKDADPQTLYDNRHLVLRGEISSAVMKVRAACLKAFRQVFEEKRMLEVTPPAMVQT 301

Query: 290 QVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYS 349
           QVEGGSTLF+ +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+
Sbjct: 302 QVEGGSTLFKFDYYGEDAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYT 361

Query: 350 HLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKD 409
           H+EAE+ FITF          IC  ++  LAN  T  L+ QL+PDF PP RPF RM Y D
Sbjct: 362 HIEAELDFITFTDLLDHLEEVICRVIELTLANPATAALIKQLNPDFKPPSRPFRRMKYAD 421

Query: 410 AIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAED 469
           AIQ+L +H+I  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  ED
Sbjct: 422 AIQWLVEHDIPNEEGKPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDPED 481

Query: 470 NRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGG 529
            RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++PTPYYWYTDQRKYGT+ HGG
Sbjct: 482 RRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPTPYYWYTDQRKYGTSPHGG 541

Query: 530 FGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +GLG+ERFLAWL  R  V++CCLYPRF GRC P
Sbjct: 542 YGLGLERFLAWLCARYTVRDCCLYPRFTGRCTP 574



>gi|430812049|emb|CCJ30504.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 553

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/541 (51%), Positives = 365/541 (67%), Gaps = 1/541 (0%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +Y+DE  G D+   G+   P +T ++A ++  D   I +RK P++ YK+I+ T       
Sbjct: 14  LYVDETAGVDDKDGGSIENPLRTVLKAFEIGNDYAKIYIRKVPDDEYKEITATGLKKAKK 73

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                  V  ++ +L  ++ IKIRQ+  
Sbjct: 74  AYSIFLKKQQKLEETLCHMKIQESTNKKEHEQWDHVGNSVFDKNKDLDKSVNIKIRQAKD 133

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            R   VKVSGW+HRLR Q KD+ F++LRDG+GYLQC+++G +  T  AL L++E+T+T Y
Sbjct: 134 FRTMFVKVSGWIHRLRHQ-KDLIFVILRDGTGYLQCVISGNMARTSHALTLTVETTLTFY 192

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G I+ LP GKTAPDNHEL   Y+E+   APGGD  FTNKLN +A+  +LY+QRH VIRGE
Sbjct: 193 GTITVLPDGKTAPDNHELHVTYFEIIQKAPGGDLCFTNKLNVEAESQVLYDQRHFVIRGE 252

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
            +S+VLK R+ ++  FR  ++  GF EV PPC+VQTQVEGG+TLF++NYYGEKAYLTQ+S
Sbjct: 253 ISSSVLKVRARLLAVFRAVYEKMGFMEVTPPCLVQTQVEGGATLFDLNYYGEKAYLTQSS 312

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETCLPSLG+VYCI ES+RAE SHTRRHLSE+SH+EAE+AF++F          IC 
Sbjct: 313 QLYLETCLPSLGNVYCIQESFRAELSHTRRHLSEFSHMEAELAFLSFDEFLDHLEEFICL 372

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDI 433
           ++D +L +     L+  L+P+F  PQRPFLRM Y DAI+Y  +H+I   NG  Y FGEDI
Sbjct: 373 SLDLLLEDFIASPLIENLNPNFKKPQRPFLRMKYVDAIKYCNEHDILNSNGEHYIFGEDI 432

Query: 434 PEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRI 493
            EF ER + DQI +PIFL  FPA +K+FYMKR + +   TESVD+L PGVGEVVGGSMRI
Sbjct: 433 TEFAERKIVDQIQQPIFLIEFPATLKSFYMKRISGNTDFTESVDLLFPGVGEVVGGSMRI 492

Query: 494 SDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLY 553
            D +EL+  +KRE I+P+PYYWY D RKYGT  HGG+G+G+ER LAW+ +R+ VKEC LY
Sbjct: 493 FDFDELIEAFKRENIDPSPYYWYLDLRKYGTCPHGGYGVGLERILAWITNRNTVKECSLY 552

Query: 554 P 554
           P
Sbjct: 553 P 553



>gi|390597250|gb|EIN06650.1| asparaginyl-tRNA synthetase [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 577

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 291/575 (50%), Positives = 372/575 (64%), Gaps = 23/575 (4%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+   Y+DE  GSD   TG Q+APY+T   AL   G +  I  RK     Y + + +   
Sbjct: 4   STIVYYVDEAAGSDTAGTGAQDAPYQTLAYALFAHGQDSKIQYRKDSTAAYDEPTKSALK 63

Query: 70  XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      IVL +D +LP A + K+
Sbjct: 64  KAKKDADGIEKKRKKAEELAARAAAAGKEETERRERLLEESKKIVLTEDTSLPQAARAKL 123

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
                 RG+RV+V GWVHR+R Q K + F++LRDG+GYLQ +L+G++  TYDAL L+LES
Sbjct: 124 DSLTPLRGQRVRVFGWVHRVRDQ-KGIIFLILRDGTGYLQTVLSGKVAQTYDALTLTLES 182

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           +V + G +  +P GKTAP  HEL+ D+W V   APG +DAFTN+LN  +DPSIL + RHL
Sbjct: 183 SVELVGTLQAVPEGKTAPGGHELVVDFWRVLGAAPGAEDAFTNRLNEKSDPSILADLRHL 242

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           V+RGETAS+VL+ R+ ++ AFR    S    EV PPC+VQTQVEGG+TLF+++YYG+ A+
Sbjct: 243 VLRGETASSVLRLRAHLLTAFRASLRSHSLLEVTPPCLVQTQVEGGATLFKLDYYGQPAF 302

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF        
Sbjct: 303 LTQSSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFDDLMAHIE 362

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK-------- 420
             IC+TVDR+L +  +  L+ QL+P F  P RPFLRM Y DAI++L +H I+        
Sbjct: 363 AIICETVDRLLQDPVSAALIKQLNPKFAAPSRPFLRMPYVDAIKWLNEHGIQHPEEDADG 422

Query: 421 ----KENGS----FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCA----E 468
               KE+G+     +  G+DI E  ER MTD +  P+FL  FP E+KAFYMK+ +    E
Sbjct: 423 NVVLKEDGTPKMVDHAVGDDIAEAAERQMTDILGVPMFLYGFPKELKAFYMKKMSKKEGE 482

Query: 469 DNRV-TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
           D  V TES D+L+PGVGE+VGGSMRI+D  ELLA YK EGI+P PYYW+TDQRKYGT EH
Sbjct: 483 DGPVFTESCDLLMPGVGEIVGGSMRIADAEELLAAYKHEGIDPEPYYWFTDQRKYGTCEH 542

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAWL  R  V+EC LYPR+ GR  P
Sbjct: 543 GGYGLGVERFLAWLADRYTVRECSLYPRWPGRATP 577



>gi|354548631|emb|CCE45368.1| hypothetical protein CPAR2_703810 [Candida parapsilosis]
          Length = 548

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 282/555 (50%), Positives = 367/555 (66%), Gaps = 14/555 (2%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRKTPEE----GYKDISGTX 67
           T Y++E +G D    +G+++ PY T+  AL +  +    + ++T E+     Y +IS + 
Sbjct: 3   TTYVNEKSGVDSADHSGSESQPYATSAYALFINPEAKIFVYKETDEDKTKFAYTEISPSA 62

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                         +++D +LP A KIK
Sbjct: 63  LKKAKKGAEGLKKKAEKQSKLQTEKESMPKVADLDLTS--------IEEDKSLPAAKKIK 114

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           +R    S G RV+V+GWVHRLR Q K + FI LRDG+G+LQC+LTGEL        L++E
Sbjct: 115 LRSIQDSIGTRVQVNGWVHRLRVQ-KGLAFITLRDGTGFLQCVLTGELAKARQTQELTIE 173

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           STV+I GV+S+LP GKTAP   EL ADY+E+   AP G+DAFTNK+   ADPS+L +QRH
Sbjct: 174 STVSIKGVVSKLPEGKTAPGGVELKADYYEIVGLAPSGEDAFTNKIQEGADPSLLLDQRH 233

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           L +RGE+ SAV++ R+A + A R+ +  +G  EV PPCMVQTQVEGGSTLF+MNYYGE+A
Sbjct: 234 LTLRGESISAVMRVRAAFLHAIREFYREEGLLEVTPPCMVQTQVEGGSTLFKMNYYGEEA 293

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF       
Sbjct: 294 YLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLNHL 353

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              I  TV  VL +    +LV QL+P F  P+ PF RM+Y +A+ +L +  +  + G  Y
Sbjct: 354 EKLISKTVQSVLEDPVAGELVKQLNPKFEAPKLPFKRMEYVEALDWLNERGVLNDEGKPY 413

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
            FG+DI E  ER M D IN+PI L RFP EIK+FYM++C +D RVTESVDVL+P VGE+ 
Sbjct: 414 SFGDDIAEAQERKMVDTINQPILLTRFPVEIKSFYMQKCQDDPRVTESVDVLMPNVGEIT 473

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMR  D +ELLAG+KRE I+P+ YYW+ DQR+YGT EHGG+GLG ER LAWL  R  V
Sbjct: 474 GGSMRTVDYDELLAGFKRENIDPSAYYWFLDQRRYGTCEHGGYGLGTERILAWLCDRFTV 533

Query: 548 KECCLYPRFMGRCLP 562
           ++C LYPRF GRC P
Sbjct: 534 RDCSLYPRFTGRCKP 548



>gi|344299547|gb|EGW29900.1| Asparaginyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 552

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 289/554 (52%), Positives = 362/554 (65%), Gaps = 10/554 (1%)

Query: 14  VYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEE----GYKDISGTXX 68
           V+++E  G D   + GT+  P+ TA  AL V      +LV K  EE     Y +IS +  
Sbjct: 4   VHVNEKTGVDSAEAKGTEQQPFATAAYALYVT-PGAKVLVYKQSEEDETFSYVEISASAL 62

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I +++DP+LP A KIK+
Sbjct: 63  KKAVKGAEGLKKKAEKQAKLEEQRKLKEQEATAKLAELDL---IKIEEDPSLPAAKKIKL 119

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
           R        RV V GW+HRLR Q K + FI LRDG+G++Q +L+G+L        L+LES
Sbjct: 120 RTIQDHLETRVLVQGWIHRLRVQ-KGVAFITLRDGTGFIQAVLSGDLAKARQTQELTLES 178

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TV I GVIS+LP GKTAP   EL ADY+E+   AP GDDAFTNK+  +ADPS+L +QRHL
Sbjct: 179 TVVIKGVISKLPEGKTAPGGVELKADYYEIVGLAPSGDDAFTNKVQENADPSLLLDQRHL 238

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
            +RGE+ SAV+K R+A + A R  F  +G  EV PPCMVQTQVEGGSTLF+M+YYGE+AY
Sbjct: 239 ALRGESLSAVMKVRAAFLGAVRRFFAEEGLLEVTPPCMVQTQVEGGSTLFKMDYYGEEAY 298

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+E+E+AFI F        
Sbjct: 299 LTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIESELAFIEFEDLLSHLE 358

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             I  TV  VL +  T  LV QL+P+F PP+ PFLRM+Y  A+ +L +H +  E+G  ++
Sbjct: 359 RLITKTVQYVLEDPVTAALVKQLNPNFQPPKMPFLRMEYIQALDWLNEHGVLNEDGEKFK 418

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD IN+PI L RFP EIK+FYM++C +D RVTESVDVLIP VGE+ G
Sbjct: 419 FGDDIAEAAERKMTDTINQPILLIRFPVEIKSFYMQKCKDDPRVTESVDVLIPNVGEITG 478

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMR  D +ELLAG KREG++   YYW+ DQRKYGT  HGG+GLG ER LAWL  R  V+
Sbjct: 479 GSMRTYDHDELLAGIKREGLDADAYYWFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVR 538

Query: 549 ECCLYPRFMGRCLP 562
           +C LYPRF GRC P
Sbjct: 539 DCSLYPRFSGRCKP 552



>gi|448536807|ref|XP_003871199.1| Ded81 tRNA-Asn synthetase [Candida orthopsilosis Co 90-125]
 gi|380355555|emb|CCG25074.1| Ded81 tRNA-Asn synthetase [Candida orthopsilosis]
          Length = 548

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 288/556 (51%), Positives = 366/556 (65%), Gaps = 16/556 (2%)

Query: 13  TVYIDEVNGSDETST-GTQNAPYKTAVRALQVKGDNISILVRKTPEE-----GYKDISGT 66
           T Y++E  G D     G+++ PY T   AL V  D   ILV K  EE      Y +IS +
Sbjct: 3   TTYVNEKTGVDSAEQPGSESQPYATPAYALFVNPD-AKILVYKETEEDKTKFAYTEISPS 61

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI 126
                                                          ++++ +LP A KI
Sbjct: 62  ALKKAKKGAEGLKKKAEKQSKLQSEKESLPKVADLDLTS--------IEENKSLPAAKKI 113

Query: 127 KIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSL 186
           K+R    S G RV+V+GWVHRLR Q K + FI LRDG+GYLQC+LTG+L        L++
Sbjct: 114 KLRSIQDSIGSRVQVNGWVHRLRVQ-KGLAFITLRDGTGYLQCVLTGDLAKARQTQELTI 172

Query: 187 ESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQR 246
           ESTV+I GV+S+LP GKTAP   EL ADY+E+   AP G++AFTNK+   ADPS+L +QR
Sbjct: 173 ESTVSIKGVVSKLPEGKTAPGGVELKADYYEIVGLAPSGEEAFTNKIQEGADPSLLLDQR 232

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           HL +RGE+ SAV++ R+A + A R+ +  +G  EV PPCMVQTQVEGGSTLF+M+YYGE+
Sbjct: 233 HLTLRGESISAVMRVRAAFLHAIREFYKEEGLLEVTPPCMVQTQVEGGSTLFKMDYYGEE 292

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF      
Sbjct: 293 AYLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLNH 352

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               I  TV  VL +  T +LV QL+P F  P+ PF RM+Y +A+ +L +  I  + G  
Sbjct: 353 LEKLISKTVQSVLEDPVTGELVKQLNPKFEAPKLPFKRMEYIEALDWLNERGILNDEGKP 412

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           Y FG+DI E  ER M D IN+PI L RFP EIK+FYM++C +D+RVTESVDVL+P VGEV
Sbjct: 413 YSFGDDIAEAQERKMVDTINQPILLTRFPVEIKSFYMQKCQDDSRVTESVDVLMPNVGEV 472

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
            GGSMR  D +ELLAG+KRE I+P+ YYW+ DQR+YGT EHGG+GLG ER LAWL  R  
Sbjct: 473 TGGSMRTIDYDELLAGFKRENIDPSAYYWFLDQRRYGTCEHGGYGLGTERILAWLCDRFT 532

Query: 547 VKECCLYPRFMGRCLP 562
           V++C LYPRF GRC P
Sbjct: 533 VRDCSLYPRFTGRCKP 548



>gi|156849133|ref|XP_001647447.1| hypothetical protein Kpol_1018p126 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156118133|gb|EDO19589.1| hypothetical protein Kpol_1018p126 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 554

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 286/557 (51%), Positives = 369/557 (66%), Gaps = 11/557 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL------QVKGDNISILVRKTPEEGYKDISG 65
           ++YI+E +G DE T  G+Q AP+KT   AL          +   + V KT E  Y +IS 
Sbjct: 2   SLYINEASGIDELTVVGSQEAPFKTPAFALYASQEASATAEEPKLFVFKTEENSYLEISP 61

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
           +                                             I +++D +LP A K
Sbjct: 62  SALKKARKGCDGLKKKLLKQKEQELKKQEQAAANAAKQMAALN---IKVEEDKSLPQAKK 118

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           +KI +S     +RVK+SGW+HR+R+  K + FIVLRDG+GY+Q +L+G+L      L L+
Sbjct: 119 VKIDKSYGLLDQRVKISGWIHRMRSN-KKVVFIVLRDGTGYIQTVLSGDLALAQQTLDLT 177

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
           LESTVT+YG I  +P GK+AP   EL+ DY+EV   AP GD+A TNK+   ADPS+L +Q
Sbjct: 178 LESTVTLYGTIVSVPEGKSAPGGVELVVDYYEVVGLAPSGDEAITNKIAEGADPSLLLDQ 237

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHL +RGET SAV+K R++++KA R  +  +  +EV PPCMVQTQVEGGSTLF+++YYGE
Sbjct: 238 RHLALRGETLSAVMKVRASLLKAIRRVYIEEDITEVTPPCMVQTQVEGGSTLFKLDYYGE 297

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +AYLTQ+SQLYLETCLP+LGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+AFI F     
Sbjct: 298 EAYLTQSSQLYLETCLPALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELAFIDFNDLLQ 357

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                I  ++  VL +     LV QL+P FV P+ PF+R++YKDAI +L++H IK E G+
Sbjct: 358 HIETLIVKSIQYVLEDPIAGPLVKQLNPGFVAPKGPFMRLEYKDAITWLQEHGIKNEEGN 417

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            ++FG+DI E  ER MTD I  PI L RFP EIK+FYMKRC++D RVTESVDVL+P VGE
Sbjct: 418 DFQFGDDIAEAAERKMTDTIGVPILLIRFPVEIKSFYMKRCSDDPRVTESVDVLMPTVGE 477

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           + GGSMRI    EL+AG+ REGI+   YYW+ DQRKYGT  HGG+GLG ER LAWL  R 
Sbjct: 478 ITGGSMRIESTEELMAGFTREGIDSKAYYWFIDQRKYGTCPHGGYGLGTERILAWLCDRF 537

Query: 546 NVKECCLYPRFMGRCLP 562
            V++C LYPRF GRC P
Sbjct: 538 TVRDCSLYPRFSGRCKP 554



>gi|505756698|gb|EOR00839.1| putative asparagine--tRNA ligase, cytoplasmic [Wallemia
           ichthyophaga EXF-994]
          Length = 582

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 288/584 (49%), Positives = 371/584 (63%), Gaps = 34/584 (5%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEG---------- 59
           S   VY+DE+  + E  +GT   PYK+ V  L    D  +I   K PEEG          
Sbjct: 2   SGHPVYVDEL-ATVEQPSGTPVQPYKSVVEILTQTPD-AAIFTVKKPEEGEPSLKPLSQR 59

Query: 60  ----YKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXIVL 114
               Y  ISG                                               +VL
Sbjct: 60  TEADYAPISGAALKKAKKTVEVNAKNAAKKAQNKDRLDKEESDRAQREQKRIEEAKKVVL 119

Query: 115 KQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGE 174
             D +LP   K K+ Q  + R +R+K+SGWVHRLR Q K M FI+LRDG+GYLQ +L+G+
Sbjct: 120 TLDDSLPKPTKAKVYQLESKRDQRIKISGWVHRLRAQ-KGMTFIILRDGTGYLQVVLSGK 178

Query: 175 LCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLN 234
              T+DAL LS+ES++ + G +  +  G++AP NHEL+AD+W+V   AP GD+AFTNK+N
Sbjct: 179 CTETFDALTLSIESSIEVVGTLKAVKEGQSAPGNHELVADFWKVLGKAPAGDEAFTNKVN 238

Query: 235 ADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGG 294
            D+DPSI  + RHL++RGETAS V+KARSA++ AFRD F      EV PPCMVQTQVEGG
Sbjct: 239 KDSDPSIQADLRHLMLRGETASNVMKARSAVLSAFRDVFKDMRVLEVTPPCMVQTQVEGG 298

Query: 295 STLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAE 354
           +TLF+ +YYG  A+LTQ+SQLYLETCL SLGDV+C+ ES+RAEKS TRRHLSEY+HLEAE
Sbjct: 299 ATLFKFDYYGTPAFLTQSSQLYLETCLASLGDVFCVQESFRAEKSLTRRHLSEYTHLEAE 358

Query: 355 MAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYL 414
           +AFI F          IC  +D VLA+     ++ +L+P F  P RPF+R+DYKDAI++L
Sbjct: 359 LAFIDFSDLLDHIEEAICGVIDIVLADPAISAIINELNPGFQKPSRPFMRLDYKDAIKWL 418

Query: 415 KDHNIKKE----NG------------SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEI 458
           +DHNI+K+    NG            S ++ G+DI E  ER M D +N P+FL  FP +I
Sbjct: 419 RDHNIQKQDEDANGDKIFLADGSPQMSDHQVGDDIAEAAERKMVDTLNVPVFLTGFPKDI 478

Query: 459 KAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTD 518
           KAFYMK+   D   TE+VD+L+P VGE+VGGSMRISD +EL+A YK EGI+P PYYWYTD
Sbjct: 479 KAFYMKKVPGDENFTEAVDLLMPNVGEIVGGSMRISDYDELMAAYKHEGIDPAPYYWYTD 538

Query: 519 QRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           QR++GT   GG+GLG ER LAWLL+R  V++C LYPR+ GRC P
Sbjct: 539 QRRFGTPNSGGYGLGCERLLAWLLNRFTVRDCSLYPRYTGRCTP 582



>gi|302681115|ref|XP_003030239.1| hypothetical protein SCHCODRAFT_69166 [Schizophyllum commune H4-8]
 gi|300103930|gb|EFI95336.1| hypothetical protein SCHCODRAFT_69166 [Schizophyllum commune H4-8]
          Length = 569

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 296/569 (52%), Positives = 367/569 (64%), Gaps = 23/569 (4%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           ++IDE  GSD T TG  +APY+T   A+     +   L RK     Y + + +       
Sbjct: 4   IHIDETTGSDATGTGAPDAPYQTLAYAVFKSATDAKFLTRKDASAPYDEPTQSALKKAKK 63

Query: 74  XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  IVL +D  LP AIKI   + +
Sbjct: 64  GAEGLEKKRKKAEELAEKAAAAQGAESEKREKQLEESKKIVLSEDAALPTAIKIGNLEPL 123

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R KRV+VSGWVHRLR Q K +KFI+LRDG+GYLQ +L+G +  TYDAL L+LESTV +
Sbjct: 124 --RTKRVRVSGWVHRLRDQ-KGIKFIILRDGTGYLQAVLSGRVAETYDALTLTLESTVEL 180

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
            G +  LP GKTAP  HEL  DYW+V   APGG+DAFTN++N  +DPSI  + RHLVIRG
Sbjct: 181 VGTLQALPEGKTAPGGHELSVDYWKVLGAAPGGEDAFTNRVNEKSDPSIQADLRHLVIRG 240

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           ETAS  L+ RSA++ A R+ F      EV PPC+VQTQVEGG+TLF+++YY + A+LTQ+
Sbjct: 241 ETASTTLRLRSALLSAMREVFARHHMLEVTPPCLVQTQVEGGATLFKLDYYNQPAFLTQS 300

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETCLPSLGDVYC+ ES+RAE S+TRRHLSEY+HLE E+AFITF          IC
Sbjct: 301 SQLYLETCLPSLGDVYCVQESFRAENSNTRRHLSEYTHLEGELAFITFDELMTHLEAIIC 360

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHN------------IK 420
           +TVD +L N TT  LV QL+P F  P+RPFLRM Y DAI +L +H             IK
Sbjct: 361 ETVDILLDNPTTAALVKQLNPGFKKPERPFLRMPYVDAIAWLNEHGILHPEEDAEGNPIK 420

Query: 421 KENGSF----YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRC-AEDNR--VT 473
            E+G      +  G+DI E  ER MTD I KP+FL  FPAE+KAFYMK+    D +   T
Sbjct: 421 DESGQVKLVPHVVGDDIAEAAERQMTDIIGKPMFLHSFPAELKAFYMKKIPGGDGKHVFT 480

Query: 474 ESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLG 533
           ES D+L+P VGE+VGGSMRI+D++EL AGYKREGI+  PYYWYTDQRKYGT EHGG+G+G
Sbjct: 481 ESCDLLMPNVGEIVGGSMRIADLDELFAGYKREGIDAAPYYWYTDQRKYGTCEHGGYGVG 540

Query: 534 VERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +ER LAWL +R  V+EC LYPR+ GR  P
Sbjct: 541 IERLLAWLGNRYTVRECSLYPRWPGRATP 569



>gi|401885561|gb|EJT49668.1| asparagine-tRNA ligase [Trichosporon asahii var. asahii CBS 2479]
 gi|406693930|gb|EKC97270.1| asparagine-tRNA ligase [Trichosporon asahii var. asahii CBS 8904]
          Length = 568

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 287/565 (50%), Positives = 369/565 (65%), Gaps = 17/565 (3%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRAL-----QVKGDN-----ISILVRKTPE----E 58
           T+Y+DE  GSD T  GT+ AP+ T V A        + D      ++ILVRK  E    E
Sbjct: 6   TLYVDEKKGSDSTGNGTEAAPFATPVAAYLSLNPSTESDKDPLSVVNILVRKPAEGDAPE 65

Query: 59  GYKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDP 118
            + ++SG                                               V   +P
Sbjct: 66  SWSELSGAGKKKLAKGVDVQRKKAAKLAADGERLEKERKEQEARDKKRREEAAQVKIAEP 125

Query: 119 NLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYL-QCLLTGELCH 177
               A  +K  Q     GKRV++ GWVHRLRTQ  +  F++LRDGSG L Q +LTG+L  
Sbjct: 126 E-GKADFVKAYQLPQEIGKRVRLRGWVHRLRTQKTNF-FVILRDGSGPLAQVILTGDLIK 183

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADA 237
           T DAL L++EST+ + G + ++  G+TAP   E++AD+W++   APGGDDAF  +L A+ 
Sbjct: 184 TLDALDLTVESTIEVTGTVQKVKEGQTAPQGLEIIADWWKILGRAPGGDDAFEGRLTAET 243

Query: 238 DPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTL 297
           D SI  + RHL +RGETA+AV++ R+A+++AFR+ F+ +  +EV PPCMVQT VEGGSTL
Sbjct: 244 DASIRADLRHLELRGETATAVMRFRAAMLRAFREAFNQRRITEVTPPCMVQTSVEGGSTL 303

Query: 298 FEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAF 357
           FE NYYG  AYLTQ+SQLYLET LPSLGDVYCI ES+RAEKS TRRHLSEY+HLEAE+AF
Sbjct: 304 FEFNYYGASAYLTQSSQLYLETVLPSLGDVYCIQESFRAEKSLTRRHLSEYTHLEAELAF 363

Query: 358 ITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDH 417
           I F          I   VD ++ +    +++  L+P+FV P++PF+R+DY+DAI+YL +H
Sbjct: 364 IEFKDLLDHLEDMITSVVDTLMKDPVASEIIKTLNPNFVAPKKPFMRLDYRDAIKYLNEH 423

Query: 418 NIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
            IKKE+GS +  G+DI E  ER MTDQI + I L  FP  +K+FYMK    D   TESVD
Sbjct: 424 GIKKEDGSDHVVGDDIAEAAERKMTDQIGQVIMLINFPKTLKSFYMKAIPGDGDFTESVD 483

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           VL+PGVGE+VGGSMRI+D +EL+AGYKREGI P PYYW+TDQRKYGTTEHGG+GLGVER 
Sbjct: 484 VLVPGVGEIVGGSMRIADYDELMAGYKREGIPPEPYYWFTDQRKYGTTEHGGYGLGVERL 543

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           LAW L+R  V+ECCLYPR+MGR  P
Sbjct: 544 LAWFLNRFTVRECCLYPRYMGRARP 568



>gi|392591231|gb|EIW80559.1| asparaginyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
          Length = 573

 Score =  568 bits (1465), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 286/575 (49%), Positives = 361/575 (62%), Gaps = 29/575 (5%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG----DNISILVRKTPEEGYKDISGTXX 68
           T+YID  +GSD    GT + PY+T   A+        D+   L R + E  Y        
Sbjct: 3   TIYIDASSGSDAAGRGTLDQPYQTLGYAIFSTSTDSVDSTKYLFRASAEAEY---DAPTQ 59

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      +++ +D +LP A K KI
Sbjct: 60  SATKKAKKDAQGLEKKRQKAAQEEKQLQEKREKRERMLEESKKVIITEDESLPKATKAKI 119

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
            +    RG+RV+VSGW+HRLR Q +++ FIVLRDG+GYLQ +LTG+L  TYDA  L LE+
Sbjct: 120 VKLEPLRGQRVRVSGWIHRLRIQ-QELTFIVLRDGTGYLQAVLTGQLTKTYDAKTLELEA 178

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
            V + G +  +P GKTAP  HEL  D+W     APG +DAF+N+LN  +DPSI+ + RHL
Sbjct: 179 AVELTGTLQVVPEGKTAPGGHELTVDFWRTLGSAPGAEDAFSNRLNEQSDPSIMADLRHL 238

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
           V+RGETAS VL+ R+A++ AFR  +++    EV PPC+VQT VEGG+TLF++ YYG++AY
Sbjct: 239 VLRGETASGVLRLRAALLSAFRTTYEAHNVLEVTPPCLVQTSVEGGATLFQLPYYGQEAY 298

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF        
Sbjct: 299 LTQSSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFNDLMSHIE 358

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE------ 422
             IC+TVD++LAN     ++ QL+P F  P RPF RM Y +AI +L +H IK E      
Sbjct: 359 AVICETVDKLLANPIAASIIQQLNPGFKAPARPFKRMAYAEAINWLNEHGIKHEAEDAGG 418

Query: 423 --------NGSFYE--FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRV 472
                   N    E   G+DI E  ER MTD I  PIFL  FPAE+KAFYMK+   +   
Sbjct: 419 NVIKDEQGNAKMVEHAIGDDIAEAAERQMTDIIGTPIFLYGFPAELKAFYMKKMPREKGA 478

Query: 473 -----TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
                TES D+L+P VGE+VGGSMRI+DM EL  GYKREGI+P PYYWYTDQRKYGT EH
Sbjct: 479 TGPIFTESCDLLMPNVGEIVGGSMRIADMEELFEGYKREGIDPKPYYWYTDQRKYGTCEH 538

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAWL +R  V+EC LYPR+ GR  P
Sbjct: 539 GGYGLGVERFLAWLANRYTVRECTLYPRWPGRATP 573



>gi|119480319|ref|XP_001260188.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Neosartorya
           fischeri NRRL 181]
 gi|119408342|gb|EAW18291.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Neosartorya
           fischeri NRRL 181]
          Length = 574

 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 339/462 (73%), Gaps = 12/462 (2%)

Query: 112 IVLKQDPNLPLAIKIKI-----------RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVL 160
           +V+ +DP+LP  ++I++                + G RV+V G VHRLR Q KD+ F+ L
Sbjct: 114 VVITEDPSLPKPVRIRLDVTDPAIVKLGSPETQTAGTRVRVLGRVHRLRVQ-KDVIFLTL 172

Query: 161 RDGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNH 220
            DG GYLQC+LTG L  TYDA+ L+LE+++ I+G +  +P  + AP++ EL AD++ V  
Sbjct: 173 SDGYGYLQCVLTGNLTKTYDAMTLTLETSMAIHGEMRAVPPKQHAPNDRELHADFFTVIG 232

Query: 221 HAPGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSE 280
            A G  +A T ++  DADP  LY+ RHLV+RGET+SAV+K R+A +KAFR  F+ K   E
Sbjct: 233 RAAGDKEAITTRVAKDADPQTLYDNRHLVLRGETSSAVMKVRAACLKAFRQVFEEKRMLE 292

Query: 281 VNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSH 340
           V PP MVQTQVEGGSTLF+ +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS 
Sbjct: 293 VTPPAMVQTQVEGGSTLFKFDYYGEDAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSL 352

Query: 341 TRRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQR 400
           TRRHLSEY+H+EAE+ FITF          IC  ++  LA+  T  L+ QL+PDF PP R
Sbjct: 353 TRRHLSEYTHIEAELDFITFTDLLDHLEEVICRVIELTLADPATAALIKQLNPDFKPPSR 412

Query: 401 PFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKA 460
           PF RM Y DAIQ+L +H+I  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKA
Sbjct: 413 PFRRMKYADAIQWLVEHDIPNEEGKPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKA 472

Query: 461 FYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQR 520
           FYMK+  ED RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++PTPYYWYTDQR
Sbjct: 473 FYMKKDPEDRRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPTPYYWYTDQR 532

Query: 521 KYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           KYGT+ HGG+GLG+ERFLAWL  R  V++CCLYPRF GRC P
Sbjct: 533 KYGTSPHGGYGLGLERFLAWLCARYTVRDCCLYPRFTGRCTP 574



>gi|190348970|gb|EDK41531.2| asparaginyl-tRNA synthetase [Meyerozyma guilliermondii ATCC 6260]
          Length = 544

 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/551 (50%), Positives = 368/551 (66%), Gaps = 9/551 (1%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPE-EGYKDISGTXXXXX 71
           +VY++E  G+D    G++  PY+TA  A+  + +    + + T + EGY++IS +     
Sbjct: 2   SVYVNERTGADAEGHGSEEKPYQTAAYAVFSQPETKIFVFKATDDGEGYEEISASALKKA 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+D +LP A KIK+R  
Sbjct: 62  KKGADGLRKKQEKAKAASEKHNETSKKLESLEV-------IDIKEDQSLPPAKKIKLRSI 114

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
             + G RV V GW+HRLR Q K + F+ +RDG+GY+QC+LTG+L        L+LE+++ 
Sbjct: 115 GENIGSRVAVRGWIHRLRLQ-KGLGFVTVRDGTGYVQCVLTGDLAKAKSTHELTLETSIC 173

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           I GVI++LP GK+AP   EL AD++EV   AP G+++F+NK+  +ADPS+L +QRHL +R
Sbjct: 174 IKGVINKLPEGKSAPGGVELKADFYEVVGQAPSGEESFSNKVQENADPSLLLDQRHLTLR 233

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  SAV+K RSA + A R  F+ +G  EV PPCMVQTQVEGGSTLF+MNYYGE AYLTQ
Sbjct: 234 GEALSAVMKVRSAFLYAIRRFFEEEGLLEVTPPCMVQTQVEGGSTLFKMNYYGEDAYLTQ 293

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+H+E E+AFI F          +
Sbjct: 294 SSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHIEGELAFIDFEDLLVHLEKLL 353

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
             TV  VL +     L+ QL+P+FV P+ PFLRM+Y DA+++L +H I  E+G  ++FG+
Sbjct: 354 TQTVKYVLEDPVAGPLIKQLNPNFVAPKGPFLRMEYVDALEWLNEHGIPNEDGEKFKFGD 413

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DI E  ER MTD I KPI L RFP EIK+FYM++CA+D RVTESVDVL+P VGE++GGSM
Sbjct: 414 DIAEAAERKMTDTIGKPILLIRFPVEIKSFYMQKCADDRRVTESVDVLMPNVGEILGGSM 473

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R+ D +EL+A  K+EG++   YYW+TD RKYGT  HGG+GLG ER LAWL  R  V++C 
Sbjct: 474 RMYDYDELVASIKKEGLDLDSYYWFTDLRKYGTCPHGGYGLGTERILAWLCDRFTVRDCS 533

Query: 552 LYPRFMGRCLP 562
           LYPRF GRC P
Sbjct: 534 LYPRFSGRCKP 544



>gi|146413276|ref|XP_001482609.1| asparaginyl-tRNA synthetase [Meyerozyma guilliermondii ATCC 6260]
          Length = 544

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/551 (50%), Positives = 368/551 (66%), Gaps = 9/551 (1%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPE-EGYKDISGTXXXXX 71
           +VY++E  G+D    G++  PY+TA  A+  + +    + + T + EGY++IS +     
Sbjct: 2   SVYVNERTGADAEGHGSEEKPYQTAAYAVFSQPETKIFVFKATDDGEGYEEISASALKKA 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +K+D +LP A KIK+R  
Sbjct: 62  KKGADGLRKKQEKAKAASEKHNETSKKLELLEV-------IDIKEDQSLPPAKKIKLRSI 114

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
             + G RV V GW+HRLR Q K + F+ +RDG+GY+QC+LTG+L        L+LE+++ 
Sbjct: 115 GENIGSRVAVRGWIHRLRLQ-KGLGFVTVRDGTGYVQCVLTGDLAKAKSTHELTLETSIC 173

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           I GVI++LP GK+AP   EL AD++EV   AP G+++F+NK+  +ADPS+L +QRHL +R
Sbjct: 174 IKGVINKLPEGKSAPGGVELKADFYEVVGQAPSGEESFSNKVQENADPSLLLDQRHLTLR 233

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GE  SAV+K RSA + A R  F+ +G  EV PPCMVQTQVEGGSTLF+MNYYGE AYLTQ
Sbjct: 234 GEALSAVMKVRSAFLYAIRRFFEEEGLLEVTPPCMVQTQVEGGSTLFKMNYYGEDAYLTQ 293

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAEKSHTRRHLSEY+H+E E+AFI F          +
Sbjct: 294 SSQLYLETCLPSLGDVFCVQESFRAEKSHTRRHLSEYTHIEGELAFIDFEDLLVHLEKLL 353

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
             TV  VL +     L+ QL+P+FV P+ PFLRM+Y DA+++L +H I  E+G  ++FG+
Sbjct: 354 TQTVKYVLEDPVAGPLIKQLNPNFVAPKGPFLRMEYVDALEWLNEHGIPNEDGEKFKFGD 413

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DI E  ER MTD I KPI L RFP EIK+FYM++CA+D RVTESVDVL+P VGE++GGSM
Sbjct: 414 DIAEAAERKMTDTIGKPILLIRFPVEIKSFYMQKCADDRRVTESVDVLMPNVGEILGGSM 473

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           R+ D +EL+A  K+EG++   YYW+TD RKYGT  HGG+GLG ER LAWL  R  V++C 
Sbjct: 474 RMYDYDELVASIKKEGLDLDSYYWFTDLRKYGTCPHGGYGLGTERILAWLCDRFTVRDCS 533

Query: 552 LYPRFMGRCLP 562
           LYPRF GRC P
Sbjct: 534 LYPRFSGRCKP 544



>gi|388582380|gb|EIM22685.1| asparaginyl-tRNA synthetase [Wallemia sebi CBS 633.66]
          Length = 575

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 290/577 (50%), Positives = 371/577 (64%), Gaps = 34/577 (5%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEG---------- 59
           S + VY+DE+  + E  +GT N PYK+ V  L    D   + V K PEEG          
Sbjct: 2   SGQIVYVDEL-ATVEQPSGTPNQPYKSVVDVLTETPD-AQLYVLKKPEEGQPPVKAVKER 59

Query: 60  ----YKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXIVL 114
               Y  ISG                                               +VL
Sbjct: 60  TNIDYVPISGAALKKAKKTVEVNAKNAAKKAQNKERLEKEEAERAEREAKRIEEAKKVVL 119

Query: 115 KQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGE 174
             D +LP   K+K  Q    R +R+K+SGWVHRLR Q K M FI+LRDG+GYLQ +LTG+
Sbjct: 120 TLDESLPTPTKVKAYQLEKHRDQRIKISGWVHRLRAQ-KGMTFIILRDGTGYLQVVLTGK 178

Query: 175 LCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLN 234
              TYDAL LS+ESTV+I G +  +  G+ AP NHEL+ADYWEV   AP GD+AF NK++
Sbjct: 179 CTETYDALTLSVESTVSIVGTLKAVKEGQQAPGNHELVADYWEVMSKAPSGDEAFNNKVS 238

Query: 235 ADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGG 294
            D+DPSI  + RHLV+RGETAS ++KAR+A++K FR+ FDS+  +EV PPCMVQTQVEGG
Sbjct: 239 KDSDPSIQADLRHLVLRGETASNIMKARAAVLKYFREAFDSQHVTEVTPPCMVQTQVEGG 298

Query: 295 STLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAE 354
           +TLF+ +YYG  A+LTQ+SQLYLETCL S+GDVYCI ES+RAEKS TRRHLSEY+HLEAE
Sbjct: 299 ATLFKFDYYGTPAFLTQSSQLYLETCLASIGDVYCIQESFRAEKSLTRRHLSEYTHLEAE 358

Query: 355 MAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYL 414
           +AFI F          IC  +D++LA+    ++VY+L+P FV P RPF+R+DYKDAI++L
Sbjct: 359 LAFIDFNDLLSHIEEVICMVIDKLLADPKISEIVYKLNPGFVKPSRPFMRLDYKDAIKWL 418

Query: 415 KDHNIKK----ENG------------SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEI 458
           +D+NI K    ENG            S ++ G+DI E  ER M D +N P+FL  FP +I
Sbjct: 419 QDNNILKQNEDENGDKIFNADGTPQMSEHQVGDDIAEAAERRMVDTLNVPVFLTGFPRDI 478

Query: 459 KAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTD 518
           KAFYMK+   D   TE+VD+L+P VGE+VGGSMRI D  EL+  YK EGI+P PYYWYT+
Sbjct: 479 KAFYMKKVPGDEGFTEAVDLLMPNVGEIVGGSMRIDDYQELMEAYKHEGIDPAPYYWYTE 538

Query: 519 QRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPR 555
           QR +G+ + GG+GLGVER LAWLL+R  V++C LYPR
Sbjct: 539 QRLWGSNQSGGYGLGVERLLAWLLNRFTVRDCSLYPR 575



>gi|195164590|ref|XP_002023129.1| GL21125 [Drosophila persimilis]
 gi|194105214|gb|EDW27257.1| GL21125 [Drosophila persimilis]
          Length = 557

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/556 (50%), Positives = 365/556 (65%), Gaps = 16/556 (2%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXX-- 68
            ++  E +GSDE+  G++  PYK+ ++A++  G     +I V        KD + T    
Sbjct: 12  ALFTSEKSGSDESGDGSEAKPYKSILQAMRHAGKEPFPTIYVDS------KDPNATESFE 65

Query: 69  -XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       + + +DP+ P+A KI+
Sbjct: 66  PAAKSQLKKIQKLFVREGHKNAEKHQREAGDAEKRQQNLEEARNVKISEDPSWPVARKIR 125

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I +   +RG RVKV GWVHRLR QGK               C+L  +LC TY+AL LS E
Sbjct: 126 IMEGTENRGSRVKVYGWVHRLRRQGKGPDIHHAEGWHWVPACVLNDQLCQTYEALTLSTE 185

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYEQR 246
           STV ++G +  +P GKTAP  HEL  DYWE +    PGG DA    LN +A P +  + R
Sbjct: 186 STVVLFGTLKLIPEGKTAPGGHELNVDYWELIGLAPPGGADAI---LNEEAQPDVQLDNR 242

Query: 247 HLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEK 306
           H++IRGE  S VLK RS +M+AFR H+ ++G++EV PP +VQTQVEGGSTLF++ Y+ E+
Sbjct: 243 HIMIRGENTSKVLKMRSVVMQAFRAHYLARGYNEVTPPTLVQTQVEGGSTLFKLQYFSEE 302

Query: 307 AYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXX 366
           AYLTQ+SQLYLETCLP+LGDV+ I++SYRAE+S TRRHL+EY+H+EAE  F+TF      
Sbjct: 303 AYLTQSSQLYLETCLPALGDVFTIAQSYRAEQSRTRRHLAEYTHIEAECPFLTFDDLLDR 362

Query: 367 XXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSF 426
               +CD VDRVL +     LV +L+PDF PP +PF RM+Y DAI++LK++N+ K++G+F
Sbjct: 363 LEDLVCDVVDRVLKSPWG-NLVKELNPDFKPPTKPFRRMNYSDAIKWLKENNVTKDDGTF 421

Query: 427 YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEV 486
           YEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM RC ED  +TESVDVL+P VGE+
Sbjct: 422 YEFGEDIPEAPERKMTDAINEPIMLCRFPAEIKSFYMSRCPEDKTLTESVDVLLPNVGEI 481

Query: 487 VGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDN 546
           VGGSMRI D  ELL GY+REGI+P PYYWYTDQR YGT  HGG+GLG+ERFL WLL+R +
Sbjct: 482 VGGSMRIFDSEELLKGYQREGIDPKPYYWYTDQRIYGTLPHGGYGLGLERFLCWLLNRYH 541

Query: 547 VKECCLYPRFMGRCLP 562
           ++E CLYPRF+ RC P
Sbjct: 542 IREVCLYPRFLDRCKP 557



>gi|320583691|gb|EFW97904.1| Cytosolic asparaginyl-tRNA synthetase [Ogataea parapolymorpha DL-1]
          Length = 549

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 286/552 (51%), Positives = 363/552 (65%), Gaps = 8/552 (1%)

Query: 14  VYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEEG--YKDISGTXXXX 70
           V+++E  G+D+  + GT+  P+KT   AL  K     ++V K  E+G  Y DIS +    
Sbjct: 3   VFVNEKIGADDAGAVGTKEKPFKTPAYAL-FKVPEAKLIVAKETEQGEEYVDISPSALKK 61

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    I + +D +LP A KIKI  
Sbjct: 62  AKKGAESLKKKEEKARKQAEEAAAKDAEENAKMLEAMK---ITIVEDKSLPPAKKIKIMS 118

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
                 +RVKV GW+HRLR Q K + FIVLRDG+GY+QC+L+G+L + Y  L L++EST+
Sbjct: 119 IGKHIEERVKVQGWIHRLRLQ-KGLAFIVLRDGTGYVQCVLSGDLANAYQTLSLTIESTL 177

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
           +IYG I +LP GK+AP   EL  DY+EV   AP G ++FTNK+    DPSIL +QRHL +
Sbjct: 178 SIYGTIRKLPEGKSAPGGVELAVDYYEVVGLAPSGKESFTNKIQEGTDPSILMDQRHLTL 237

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGET SAV+K R+A++ A R  +  +  +EV PPCMVQTQVEGGSTLF+M+YYGE+A+LT
Sbjct: 238 RGETLSAVMKVRAALLAAIRRVYIEESVTEVTPPCMVQTQVEGGSTLFKMDYYGEEAFLT 297

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLETCLP+LGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+AF+TF          
Sbjct: 298 QSSQLYLETCLPALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELAFVTFDDLLSHIERV 357

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFG 430
           I  TV  VL + T   LV QL+P FV PQ PF RM Y +A+ +L ++ I  E+G  ++FG
Sbjct: 358 ITKTVQYVLEDPTAGPLVKQLNPGFVAPQLPFKRMQYIEALDWLNENGIPNEDGEKFKFG 417

Query: 431 EDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGS 490
           +DI E  ER MTD I  PI L RFP EIK+FYMK+C +D RVTESVDVL+P VGE+ GGS
Sbjct: 418 DDIAEAAERKMTDTIGVPILLTRFPVEIKSFYMKKCVDDPRVTESVDVLMPTVGEITGGS 477

Query: 491 MRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKEC 550
           MRI D  ELL G+KREGI+   YYW+ DQR YGT  HGG+GLG ER LAWL +R  V++C
Sbjct: 478 MRIEDTQELLEGFKREGIDAKSYYWFVDQRIYGTCPHGGYGLGTERILAWLCNRFTVRDC 537

Query: 551 CLYPRFMGRCLP 562
            LYPRF GRC P
Sbjct: 538 SLYPRFTGRCKP 549



>gi|403416295|emb|CCM02995.1| predicted protein [Fibroporia radiculosa]
          Length = 547

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 290/544 (53%), Positives = 357/544 (65%), Gaps = 23/544 (4%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKD-ISGTXXXXX 71
           TVY+DE +GSDE   GTQ  PY++   AL   G +  +L+RK P   Y++          
Sbjct: 3   TVYVDESSGSDEIGKGTQETPYQSLAFALFTHG-SAQVLIRKDPTGSYEEPTQSALKKAK 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IVL +DP LP A+K KI   
Sbjct: 62  KGADGLEKKRKKAEELAEREAKERSEERDRRQKLLEESKTIVLTEDPALPKAVKSKISSL 121

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              R KRV+ SGWVHRLR Q K + F+VLRDG+GYLQC+L+G +  TYDAL L+LESTV 
Sbjct: 122 TPFRSKRVRTSGWVHRLRDQNK-IIFVVLRDGTGYLQCVLSGRVAQTYDALTLTLESTVE 180

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           + G +  +P GKTAP  HEL+ DYW+V   +PGG+DAFTN+LN  +DPSI  + RHLVIR
Sbjct: 181 LVGTLQSVPEGKTAPGGHELIVDYWKVLGASPGGEDAFTNRLNEKSDPSIQADLRHLVIR 240

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GETASAVLK RSA++ +FR    S+   EV PPCMVQTQVEGG+TLF+ +YYG+ A+LTQ
Sbjct: 241 GETASAVLKLRSALLSSFRTSLTSRDLLEVTPPCMVQTQVEGGATLFKFDYYGQPAFLTQ 300

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HLEAE+AFITF          I
Sbjct: 301 SSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHLEAELAFITFDDLMDHIEGMI 360

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHN------------I 419
           CDTVDR+L +  +  L+ QL+P+F  P RPFLRM Y DAI++L +H             I
Sbjct: 361 CDTVDRLLESPDSAALIKQLNPNFTAPARPFLRMAYADAIKWLNEHGIQHEAEDADGNVI 420

Query: 420 KKENGS----FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKR---CAEDNRV 472
           K E+GS     +  G+DI E  ER MTD +  P+FL  FPAE+KAFYMK+     E   V
Sbjct: 421 KDESGSPKMVDHAVGDDIAEAAERKMTDILGVPMFLYGFPAELKAFYMKKMKGTGEGGPV 480

Query: 473 -TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGE+VGGSMRI+DM ELLA YKREGI+  PYYW+TDQRKYGT EHGG+G
Sbjct: 481 FTESCDLLMPGVGEIVGGSMRIADMEELLAAYKREGIDTAPYYWFTDQRKYGTCEHGGYG 540

Query: 532 LGVE 535
           LGVE
Sbjct: 541 LGVE 544



>gi|238883499|gb|EEQ47137.1| asparaginyl-tRNA synthetase [Candida albicans WO-1]
          Length = 552

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/553 (50%), Positives = 361/553 (65%), Gaps = 3/553 (0%)

Query: 11  SETVYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+++Y++E +G D T + GTQ  PY T   AL    D   + V K  EE  +        
Sbjct: 2   SQSIYVNEKSGVDNTEAKGTQEKPYATPAFALYTHPD-AKVFVYKQSEEDAEKFEYVEIS 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                       +++D +LP A KIKIR
Sbjct: 61  ASALKKAKKGVEGLKKKAEKQAKLEEQKKQQQATAKLAELDLSSIEEDKSLPSAQKIKIR 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q       RV V GWVHRLR Q K + FI LRDG+GYLQC+LTG+L        L++EST
Sbjct: 121 QLKDHLDTRVLVQGWVHRLRVQ-KGLAFITLRDGTGYLQCVLTGDLAKAKQTQELTIEST 179

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V I GVIS+LP GKTAP   EL AD++++   APGGD++FTNK+  +ADP++L +QRHL 
Sbjct: 180 VAIKGVISKLPEGKTAPGGVELKADHYQIIALAPGGDESFTNKVQENADPNLLLDQRHLA 239

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGET SAV+K R+A   A R  F  +G +EV PPCMVQ QVEGGSTLF+++YYGE+AYL
Sbjct: 240 LRGETLSAVMKVRAAYSAAIRRFFAEEGLTEVTPPCMVQNQVEGGSTLFKLDYYGEEAYL 299

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCL SLGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ FITF         
Sbjct: 300 TQSSQLYLETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELVFITFEDLLTHLEK 359

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +  T+  VL +     +V QL+PDF  P+ PF RM+Y +A+ +L +H I  E+G  ++F
Sbjct: 360 LLSKTIQYVLEDPVAGPIVKQLNPDFKAPKAPFKRMEYIEALDWLNEHGIPNEDGEKFKF 419

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DI E  ER MTD IN+PI L RFPAEIK+FYM+RC +D RVTESVDVL+P VGE+ GG
Sbjct: 420 GDDIAEAAERKMTDTINEPILLTRFPAEIKSFYMQRCKDDPRVTESVDVLMPNVGEITGG 479

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI + +EL+A  KRE +N   YYW+TD RKYG+  HGG+G+G+ER LA++L+R  V++
Sbjct: 480 SMRIDNYDELMAALKRENLNLDSYYWFTDVRKYGSAPHGGYGIGLERQLAYMLNRYTVRD 539

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 540 CSLYPRFTGRCKP 552



>gi|68487991|ref|XP_712154.1| hypothetical protein CaO19.6702 [Candida albicans SC5314]
 gi|68488042|ref|XP_712129.1| hypothetical protein CaO19.13994 [Candida albicans SC5314]
 gi|77023058|ref|XP_888973.1| hypothetical protein CaO19_6702 [Candida albicans SC5314]
 gi|46433497|gb|EAK92935.1| hypothetical protein CaO19.13994 [Candida albicans SC5314]
 gi|46433524|gb|EAK92961.1| hypothetical protein CaO19.6702 [Candida albicans SC5314]
 gi|76573786|dbj|BAE44870.1| hypothetical protein [Candida albicans]
          Length = 552

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/553 (50%), Positives = 361/553 (65%), Gaps = 3/553 (0%)

Query: 11  SETVYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+++Y++E +G D T + GTQ  PY T   AL    D   + V K  EE  +        
Sbjct: 2   SQSIYVNEKSGVDTTEAKGTQEKPYATPAFALYTHPD-AKVFVYKQSEEDAEKFEYVEIS 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                       +++D +LP A KIKIR
Sbjct: 61  ASALKKAKKGVEGLKKKAEKQAKLEEQKKQQQATAKLAELDLSSIEEDKSLPSAQKIKIR 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q       RV V GWVHRLR Q K + FI LRDG+GYLQC+LTG+L        L++EST
Sbjct: 121 QLKDHLDTRVLVQGWVHRLRVQ-KGLAFITLRDGTGYLQCVLTGDLAKAKQTQELTIEST 179

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V I GVIS+LP GKTAP   EL AD++++   APGGD++FTNK+  +ADP++L +QRHL 
Sbjct: 180 VAIKGVISKLPEGKTAPGGVELKADHYQIIALAPGGDESFTNKVQENADPNLLLDQRHLA 239

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGE+ SAV+K R+A   A R  F  +G +EV PPCMVQ QVEGGSTLF+++YYGE+AYL
Sbjct: 240 LRGESLSAVMKVRAAYSAAIRRFFTEEGLTEVTPPCMVQNQVEGGSTLFKLDYYGEEAYL 299

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCL SLGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ FITF         
Sbjct: 300 TQSSQLYLETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELVFITFEDLLTHLEK 359

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +  T+  VL +     +V QL+PDF  P+ PF RM+Y +A+ +L +H I  E+G  ++F
Sbjct: 360 LLSKTIQYVLEDPVAGPIVKQLNPDFKAPKAPFKRMEYIEALDWLNEHGIPNEDGEKFKF 419

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DI E  ER MTD IN+PI L RFPAEIK+FYM+RC +D RVTESVDVL+P VGE+ GG
Sbjct: 420 GDDIAEAAERKMTDTINEPILLTRFPAEIKSFYMQRCKDDPRVTESVDVLMPNVGEITGG 479

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI + +EL+A  KRE +N   YYW+TD RKYG+  HGG+G+G+ER LA++L+R  V++
Sbjct: 480 SMRIDNYDELMAALKRENLNLDSYYWFTDVRKYGSAPHGGYGIGLERQLAYMLNRYTVRD 539

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 540 CSLYPRFTGRCKP 552



>gi|354474575|ref|XP_003499506.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic isoform 2
           [Cricetulus griseus]
          Length = 509

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 255/440 (57%), Positives = 339/440 (77%), Gaps = 5/440 (1%)

Query: 125 KIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALIL 184
           ++KI      RG+RVKV GWVHRL  +GK++ F+VLRDG+GYLQC+L+ +LC  Y+ ++L
Sbjct: 73  EVKICALEGYRGQRVKVFGWVHRLLREGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVL 132

Query: 185 SLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYE 244
           S ES+V +YG ++  P GK AP  HEL  D+WE+   AP G     N +N ++D  +   
Sbjct: 133 STESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAG--GADNLINEESDVDVQLN 190

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
            RH++IRGE  S +LKARS I + FRDHF  +G+ EV  P +VQTQVEGG+TLF+++Y+G
Sbjct: 191 NRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFG 250

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLE--AEMAFITFXX 362
           E+A+LTQ+SQLYLETCLP+LGDV+CI++SYRAE+S TRRHL+E++H+E  +E  F+TF  
Sbjct: 251 EEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVETESECPFLTFED 310

Query: 363 XXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKE 422
                   +CD VDRVL +     +VY L+P+F PP+RPF RM+Y DAI++L++H++KKE
Sbjct: 311 LLNRLEDLVCDVVDRVLKSPVA-SIVYDLNPNFKPPKRPFRRMNYSDAIEWLREHDVKKE 369

Query: 423 NGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPG 482
           +G+ YEFG+DIPE PER MTD IN+PI LCRFP EIK+FYM+RC ED R+TESVDVL+P 
Sbjct: 370 DGTLYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPN 429

Query: 483 VGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLL 542
           VGE+VGGSMR  D  E+L GYKREGI+P PYYWYTDQRKYGT  HGG+GLG+ERFL+W+L
Sbjct: 430 VGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWIL 489

Query: 543 HRDNVKECCLYPRFMGRCLP 562
           +R ++++ CLYPRF+ RC P
Sbjct: 490 NRYHIRDVCLYPRFVQRCRP 509



>gi|169769410|ref|XP_001819175.1| asparaginyl-tRNA synthetase, cytoplasmic [Aspergillus oryzae RIB40]
 gi|83767033|dbj|BAE57173.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391863734|gb|EIT73034.1| Asparaginyl-tRNA synthetase [Aspergillus oryzae 3.042]
          Length = 571

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 285/570 (50%), Positives = 366/570 (64%), Gaps = 21/570 (3%)

Query: 13  TVYIDE-VNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKTPEE-GYKDISG--- 65
           T+YIDE V   D T+TGT++APYKT V A       +    L RK+  E   KD+     
Sbjct: 3   TIYIDEDVGRDDSTATGTESAPYKTLVHAFLQHAPSEGFQYLTRKSQTEPADKDVDKLEW 62

Query: 66  --TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLA 123
                                                           I++K+D +LP  
Sbjct: 63  KPATKSAMKKATNLYEQRKKKAAKEQELAIREKQEAEKRRLVLEEAKKIIIKEDTSLPKP 122

Query: 124 IKIKIRQSVAS-----------RGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLT 172
           ++I++  +  +            G RV+V G VHRLR+Q KD+ FI L DG GYLQC+LT
Sbjct: 123 VRIRLDVTDPAVVKLGSPESEGPGTRVRVLGRVHRLRSQ-KDVVFITLTDGYGYLQCILT 181

Query: 173 GELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNK 232
           G++   YD + L+L ++++I+G +  +P  + AP+N EL AD++ +   A G  +A T +
Sbjct: 182 GDMVKAYDIMTLTLGTSMSIHGEMRAVPPKQHAPNNRELHADFFTIIGRAAGDKEAITTR 241

Query: 233 LNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVE 292
           +  D+DP  LY+ RHLV+RGETASAV+K R+A ++AFR  F+     EV PP MVQTQVE
Sbjct: 242 VAPDSDPQTLYDNRHLVLRGETASAVMKVRAATLRAFRKVFEENRMLEVTPPAMVQTQVE 301

Query: 293 GGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLE 352
           GGSTLF+ +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+H+E
Sbjct: 302 GGSTLFKFDYYGENAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYTHIE 361

Query: 353 AEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQ 412
           AE+ FITF          IC  ++ +LA   T   + QL+PDF PP RPF RM Y DAIQ
Sbjct: 362 AELDFITFTDLLDHLEAVICRVIELILAEPETAAFINQLNPDFKPPSRPFRRMKYSDAIQ 421

Query: 413 YLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRV 472
           +L +H I  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  ED RV
Sbjct: 422 WLIEHEIPNEEGKPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDPEDRRV 481

Query: 473 TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGL 532
           TESVDVL+PGVGE+VGGSMR+ D +EL+  YK EG++P+PYYWYTDQRKYGT+ HGG+GL
Sbjct: 482 TESVDVLMPGVGEIVGGSMRMDDWDELMGAYKHEGMDPSPYYWYTDQRKYGTSPHGGYGL 541

Query: 533 GVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           G+ERFLAWL  R  V+EC LYPRF GRC P
Sbjct: 542 GLERFLAWLCARYTVRECSLYPRFTGRCTP 571



>gi|254584945|ref|XP_002498040.1| ZYRO0G00726p [Zygosaccharomyces rouxii]
 gi|238940934|emb|CAR29107.1| ZYRO0G00726p [Zygosaccharomyces rouxii]
          Length = 552

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/555 (49%), Positives = 368/555 (66%), Gaps = 9/555 (1%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRAL----QVKGDNISILVRKTPEEGYKDISGTX 67
           +V+I+E  G D  T+ G+   P++TA  AL    +++     +LV K  + GY++IS + 
Sbjct: 2   SVHINEKGGVDALTTVGSTEKPFQTAAFALYAQEELEHSEPKLLVFKPEDNGYEEISASA 61

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I +++D +LP A ++K
Sbjct: 62  LKKAKKGAESLKKKALKQKELEAKKQQQEADKAAKQLEALD---IKIEEDKSLPQAQRVK 118

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           I ++  S G+RVKV+GW+HR+R   K + F+VLRDG G+LQ +LTG L        L+LE
Sbjct: 119 INKAYESVGQRVKVNGWIHRIRNN-KKLVFVVLRDGYGFLQAVLTGNLALAKQTQELTLE 177

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           S+V +YG +++LP GK+AP   EL  DY+EV   APGG+DAFTNK++ +ADPS+L +QRH
Sbjct: 178 SSVALYGTVNKLPEGKSAPGGVELSVDYYEVVGLAPGGEDAFTNKVSENADPSLLLDQRH 237

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           L +RGET S+++K R+  MK  R  F+++G +EV PPCMVQTQVEGGSTLF++NYYGE+A
Sbjct: 238 LALRGETLSSMMKVRAIWMKCLRRFFENEGLTEVTPPCMVQTQVEGGSTLFKLNYYGEEA 297

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           +LTQ+SQLYLETCL SLGDVYC+ ES+RAEKSHTRRHLSEY+H+E E+ FI F       
Sbjct: 298 FLTQSSQLYLETCLASLGDVYCVQESFRAEKSHTRRHLSEYTHIEGELGFIDFDDLLSHL 357

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
                +TV  ++ +     +V QL+PDF  P  PF R+DYKDA+++L +H +  E+G  +
Sbjct: 358 EKLFVETVGYIMEDPVGSAIVKQLNPDFKAPTYPFKRLDYKDALEWLNEHGVPNEDGEKF 417

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           +FG+DI E  ER M D +  PIFL RFPAEIK+FYM RC +D RVTESVDVL+P VGE+ 
Sbjct: 418 KFGDDIAEAAERKMVDTMGVPIFLIRFPAEIKSFYMPRCKDDPRVTESVDVLMPNVGEIT 477

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMR  +  +LL GY+RE I+ TPYYWY DQRKYG+  HGG+GLG ER LAWL +R  V
Sbjct: 478 GGSMRTWNEADLLEGYQREKIDHTPYYWYLDQRKYGSVPHGGYGLGTERILAWLCNRYTV 537

Query: 548 KECCLYPRFMGRCLP 562
           ++C LYPRF GRC P
Sbjct: 538 RDCSLYPRFTGRCKP 552



>gi|50419493|ref|XP_458273.1| DEHA2C13684p [Debaryomyces hansenii CBS767]
 gi|59798687|sp|Q6BU46.1|SYNC_DEBHA RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|49653939|emb|CAG86350.1| DEHA2C13684p [Debaryomyces hansenii CBS767]
          Length = 552

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 283/554 (51%), Positives = 366/554 (66%), Gaps = 10/554 (1%)

Query: 14  VYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRKTPEE----GYKDISGTXX 68
           VY++E  G+D T  +G++  P++T   AL  K ++  ILV K  E+    GY +IS +  
Sbjct: 4   VYVNEKTGADSTDVSGSEQQPFQTPAFAL-FKNEDAKILVYKQLEDSEEFGYGEISASAL 62

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      I +K+D +LP A KIK+
Sbjct: 63  KKAKKGAEGLKKKQEKQAKLQEEQRKHQDDAAKKFAEMDL---ISIKEDESLPQAKKIKL 119

Query: 129 RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLES 188
           R    + G RV V GW+HRLR Q K + FI LRDG+G++QC+LTG+L        L+LES
Sbjct: 120 RTVQDNIGTRVVVQGWIHRLRLQ-KGLGFITLRDGTGFIQCILTGDLAKCKTTHELTLES 178

Query: 189 TVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHL 248
           TVTI GVI++LP GK+AP   EL  DY+EV   AP G++AF+NK+  +ADPS+L +QRHL
Sbjct: 179 TVTIKGVINKLPEGKSAPGGVELKVDYYEVVGLAPSGEEAFSNKVQENADPSLLLDQRHL 238

Query: 249 VIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAY 308
            +RGE+ SAV+K RS +++A R  F  +G  EV PPCMVQTQVEGGSTLF+M+YYGE+AY
Sbjct: 239 ALRGESLSAVMKVRSTLLQAIRRFFAEEGLLEVTPPCMVQTQVEGGSTLFKMDYYGEEAY 298

Query: 309 LTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXX 368
           LTQ+SQLYLETCLP+LGDV+C+ ES+RAEKSHTRRHLSEY+H+E+E+ FI F        
Sbjct: 299 LTQSSQLYLETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIESELGFIEFDDLLTHLE 358

Query: 369 XXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYE 428
             I   V  V+ +     L+ QL+P+FVPPQ PF RM+Y  A+ +L +H I  E+G  ++
Sbjct: 359 RLITYVVKYVVEDPVAGPLIKQLNPNFVPPQMPFKRMEYIHALDWLNEHGIPNEDGEKFK 418

Query: 429 FGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVG 488
           FG+DI E  ER MTD I  PI L RFP EIK+FYM++CA+D RVTESVDVL+P VGE+ G
Sbjct: 419 FGDDIAEAAERKMTDTIGVPILLIRFPVEIKSFYMQKCADDPRVTESVDVLMPTVGEITG 478

Query: 489 GSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVK 548
           GSMR  D +EL+A  KREG++   YYW+TDQRKYGT  HGG+GLG ER LAWL  R  V+
Sbjct: 479 GSMRTYDNDELVAAIKREGLDLDSYYWFTDQRKYGTCPHGGYGLGTERILAWLCDRFTVR 538

Query: 549 ECCLYPRFMGRCLP 562
           +C LYPRF GRC P
Sbjct: 539 DCSLYPRFTGRCKP 552



>gi|406606064|emb|CCH42537.1| asparaginyl-tRNA synthetase [Wickerhamomyces ciferrii]
          Length = 550

 Score =  562 bits (1448), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 280/553 (50%), Positives = 369/553 (66%), Gaps = 10/553 (1%)

Query: 14  VYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDNISILVRKTPE-EGYKDISGTXXXXX 71
           +YI+E +G D  T++G++ +P++TA  AL VK D    + +K  E +GY +IS +     
Sbjct: 4   LYINETSGVDAVTASGSKESPFQTAAYALYVKEDAKLFVYKKDEETDGYVEISASALKKG 63

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IV+KQD +LP A K KIR  
Sbjct: 64  KKGAESLKKKAEKAKLAEAQKAQKDADEAAKKLEALK---IVIKQDESLPEAKKGKIRDL 120

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
                +R KVSGW+HR R Q K + FIVLRDG+GY+Q +L+G+L + Y    L+LESTVT
Sbjct: 121 KVD--QRFKVSGWIHRFRAQ-KGLAFIVLRDGTGYVQAVLSGDLANAYQTQTLTLESTVT 177

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           ++G + +LP GK A    EL+ DY+EV   AP G+DAFTNK+   ADPS+L +QRHL +R
Sbjct: 178 LFGTVKKLPEGKQAVGGIELVVDYYEVVGLAPSGEDAFTNKIQEGADPSLLLDQRHLALR 237

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GET S V+K R+A+++A R  ++ +G  EV PP MVQTQVEGGSTLF+++YYGE+++LTQ
Sbjct: 238 GETLSGVMKVRAALLRAIRRVYEEEGLIEVTPPAMVQTQVEGGSTLFKVDYYGEESFLTQ 297

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           ++QLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+AF+TF          I
Sbjct: 298 SAQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFDELLKHIEILI 357

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
             +V  VL +     L+ QL+PDFV P+ PF RM+Y  A+ +L +H +  E+G  ++FG+
Sbjct: 358 SRSVKYVLEDPVAGPLIKQLNPDFVAPEAPFKRMEYIHALDWLNEHGVPNEDGEQFKFGD 417

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DI E  ER MTD I  PI L RFPAEIK+FYMKRC++D RVTESVDVL+P VGE+ GGSM
Sbjct: 418 DIAEAAERKMTDDIGVPILLTRFPAEIKSFYMKRCSDDPRVTESVDVLMPTVGEITGGSM 477

Query: 492 RISDMNELLAGYKREGIN--PTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           R   + EL+ G+KREGI      YYW+ DQRKYGT+ HGG+GLG ER LAWL +R  V++
Sbjct: 478 RSEGLEELIEGFKREGIKDYDAYYYWFIDQRKYGTSPHGGYGLGTERILAWLTNRFTVRD 537

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 538 CSLYPRFSGRCKP 550



>gi|308463696|ref|XP_003094120.1| CRE-NARS-1 protein [Caenorhabditis remanei]
 gi|308248532|gb|EFO92484.1| CRE-NARS-1 protein [Caenorhabditis remanei]
          Length = 545

 Score =  561 bits (1447), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/550 (49%), Positives = 360/550 (65%), Gaps = 7/550 (1%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXX 72
           T+YID   GSD+ + GT+  P  T V+A+ +  ++   L++K  +EG             
Sbjct: 3   TLYIDVDAGSDQ-NPGTEQEPLATLVQAMLISQNSAEYLIKKKSDEGV----AWEPAAKA 57

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSV 132
                                                  I   +D  LP A  IKI +SV
Sbjct: 58  AIKKAVKKYEAEVKKAEKAGNQEQAAAEAHAAQLEAARAITFSRDETLPEAKCIKIGESV 117

Query: 133 ASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTI 192
             R +RV +  WVHR+R QGK + F+VLRDG G++QC+L  +LC +YDA+ LS ES++ +
Sbjct: 118 KHREQRVTIKAWVHRIRRQGKSLMFLVLRDGYGFIQCVLNDKLCQSYDAVTLSTESSIQV 177

Query: 193 YGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRG 252
           YGVI  LP GK APD HEL  DYWE+   AP G     N LN DA   ++ + RHLVIRG
Sbjct: 178 YGVIKALPDGKDAPDGHELTVDYWELIGAAPAG--GIDNVLNKDAGVDVMLDNRHLVIRG 235

Query: 253 ETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQT 312
           E AS +L+ R+A  +A RDHF + G++EV PP +VQTQVEGGSTLF ++YYGE AYLTQ+
Sbjct: 236 ENASRILRIRAAATRAMRDHFFAAGYTEVTPPTLVQTQVEGGSTLFGLDYYGEPAYLTQS 295

Query: 313 SQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXIC 372
           SQLYLETC  +LGDVYCI++SYRAEKS TRRHLSEY H+EAE AFITF          +C
Sbjct: 296 SQLYLETCNAALGDVYCIAQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIESLVC 355

Query: 373 DTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGED 432
           DTVDR+LA+  T+ L+  ++P + PP RPF RM YK+AI +L++++++ E+G  + +GED
Sbjct: 356 DTVDRLLADPVTKGLIEFVNPGYKPPSRPFKRMAYKEAIAWLQENDVRNEHGEKFVYGED 415

Query: 433 IPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMR 492
           I E  ER MTD I  PI L RFPA IKAFYM RCA+D  +TESVD+L+PGVGE+VGGSMR
Sbjct: 416 IAEAAERKMTDTIGVPILLNRFPAGIKAFYMPRCADDKELTESVDLLMPGVGEIVGGSMR 475

Query: 493 ISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCL 552
           I   +E+LA ++R GI+P  Y+WY DQRKYG+  HGG+GLG+ERF+ WL    ++++ CL
Sbjct: 476 IWQESEMLAAFERAGIDPKNYFWYMDQRKYGSVPHGGYGLGLERFICWLTDTHHIRDVCL 535

Query: 553 YPRFMGRCLP 562
           YPRF+GRC P
Sbjct: 536 YPRFVGRCAP 545



>gi|149235760|ref|XP_001523758.1| asparaginyl-tRNA synthetase [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452737|gb|EDK46993.1| asparaginyl-tRNA synthetase [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 549

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 280/557 (50%), Positives = 363/557 (65%), Gaps = 17/557 (3%)

Query: 13  TVYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEEG------YKDISG 65
           TVY++E +G D   +TG++ +P+ +   AL    D   +L+ K  EEG      Y +IS 
Sbjct: 3   TVYVNEKSGKDAADATGSEQSPFASPAYALYTNPDA-KVLIYKQVEEGEDSKFEYVEISA 61

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
           +                                               +++D +LP A K
Sbjct: 62  SALKKAKKGAEGLKKKAEKQAKMKEETQNLPKVEALDLNS--------IEEDKSLPEAKK 113

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           IK+ + + +   RV V GW+HRLR Q K + FI LRDG+G+LQC+LTG+L        L+
Sbjct: 114 IKLGKILENVDSRVLVQGWIHRLRVQ-KGLAFITLRDGTGFLQCVLTGDLAKARQTQELT 172

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
           +ESTV I GVIS+LP GKTAP   EL ADY+++   APGG+DAFTNK+   ADPS+L +Q
Sbjct: 173 IESTVAIKGVISKLPEGKTAPGGVELKADYYKILGLAPGGEDAFTNKIQEGADPSLLLDQ 232

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHL +RGE+ SAV+K R+A +K+ R  +  +G  EV PPCMVQTQVEGGSTLF+M+YYGE
Sbjct: 233 RHLTLRGESLSAVMKVRAAFLKSIRRVYVEEGLLEVTPPCMVQTQVEGGSTLFKMDYYGE 292

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +A+LTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+EAE+ F++F     
Sbjct: 293 EAFLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIEAELGFLSFDDLLK 352

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                I  TV  VL +    KL+ QL+P F  PQ PF RM Y DA+ +L +  I  + G 
Sbjct: 353 HIETVIVKTVQYVLEDPVAGKLIEQLNPGFKAPQLPFKRMQYIDALDWLNERGILNDEGK 412

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            + FG+DI E  ER M D IN+PI L RFP EIK+FYM++C +D RVTESVDVL+P VGE
Sbjct: 413 PFSFGDDIAEAQERKMVDTINEPILLTRFPVEIKSFYMQKCKDDPRVTESVDVLMPNVGE 472

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           + GGSMR  +  +LLAG+KRE I+P PYYW+ DQR+YGT EHGG+GLG ER LAWL  R 
Sbjct: 473 ITGGSMRSYEYEDLLAGFKREKIDPAPYYWFLDQRRYGTCEHGGYGLGTERILAWLCDRF 532

Query: 546 NVKECCLYPRFMGRCLP 562
            V++C LYPRF GRC P
Sbjct: 533 TVRDCSLYPRFTGRCKP 549



>gi|241957629|ref|XP_002421534.1| asparagine--tRNA ligase, putative; asparaginyl-tRNA synthetase,
           cytoplasmic, putative [Candida dubliniensis CD36]
 gi|223644878|emb|CAX40876.1| asparagine--tRNA ligase, putative [Candida dubliniensis CD36]
          Length = 552

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/553 (50%), Positives = 359/553 (64%), Gaps = 3/553 (0%)

Query: 11  SETVYIDEVNGSDET-STGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+++Y++E  G D   + GTQ  PY T   AL    D   + V K  EE  +        
Sbjct: 2   SQSIYVNEKTGVDTIEAKGTQEQPYATPAFALYTHPD-AKVFVYKQSEEDAEKFEYVEIS 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                       +++D +LP A KIKIR
Sbjct: 61  ASALKKAKKGVEGLKKKAEKQAKLEEQKKQQQATAKLAELDLSSIEEDKSLPSAQKIKIR 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q       RV V GWVHRLR Q K + FI LRDG+GYLQC+LTG+L        L++EST
Sbjct: 121 QLKDHLDTRVLVQGWVHRLRVQ-KGLAFITLRDGTGYLQCVLTGDLAKAKQTQELTIEST 179

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V+I GVIS+LP GKTAP   EL AD++++   AP GD++FTNK+  +ADP++L +QRHL 
Sbjct: 180 VSIKGVISKLPEGKTAPGGVELKADHYQIIALAPSGDESFTNKVQENADPNLLLDQRHLA 239

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGE+ SAV+K R+A   A R  F  +G +EV PPCMVQ QVEGGSTLF+++YYGE+AYL
Sbjct: 240 LRGESLSAVMKVRAAYSAAIRRFFAEEGLTEVTPPCMVQNQVEGGSTLFKLDYYGEEAYL 299

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCL SLGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ FITF         
Sbjct: 300 TQSSQLYLETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELVFITFEDLLTHLEK 359

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +  T+  VL +     +V QL+PDF  P+ PF RM+Y +A+ +L +H I  E+G  ++F
Sbjct: 360 LLSKTIQYVLEDPVAGPIVKQLNPDFKAPKAPFKRMEYIEALDWLNEHGIPNEDGEKFKF 419

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DI E  ER MTD IN+PI L RFPAEIK+FYM+RC +D RVTESVDVL+P VGE+ GG
Sbjct: 420 GDDIAEAAERKMTDTINEPILLTRFPAEIKSFYMQRCKDDPRVTESVDVLMPNVGEITGG 479

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI + +EL+A  KRE +N   YYW+TD RKYG+  HGG+G+G+ER LA++L+R  V++
Sbjct: 480 SMRIDNYDELMAALKRENLNLDSYYWFTDVRKYGSAPHGGYGIGLERQLAYMLNRYTVRD 539

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 540 CSLYPRFTGRCKP 552



>gi|260947816|ref|XP_002618205.1| asparaginyl-tRNA synthetase [Clavispora lusitaniae ATCC 42720]
 gi|238848077|gb|EEQ37541.1| asparaginyl-tRNA synthetase [Clavispora lusitaniae ATCC 42720]
          Length = 552

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 363/555 (65%), Gaps = 10/555 (1%)

Query: 13  TVYIDEVNGSDETST-GTQNAPYKTAVRALQVKGDNISILVRKTPEEG----YKDISGTX 67
           +VY++E +GSD   T GT+  P++T   AL VK D   +LV K  E+     Y +IS + 
Sbjct: 3   SVYVNEKSGSDSAETAGTEQQPFQTPAFALFVKPD-AKVLVYKQKEDSEDFEYVEISASA 61

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I + +D +LP A +IK
Sbjct: 62  LKKAKKGADGLKKKQEKQLKLAEEQKKKQEEASKKMAELDL---IKIVEDKSLPEAKRIK 118

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           +R    +   RV V GWVHRLR Q K + FI LRDG+G+LQ +L+G+L        L+LE
Sbjct: 119 LRSLQENINSRVTVQGWVHRLRLQ-KGVAFITLRDGTGFLQTVLSGDLAKARITQELTLE 177

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           STV I GVI +LP GKTAP   EL ADY+EV   AP GD+AFTNK+  +ADP++L +QRH
Sbjct: 178 STVLIKGVIEKLPEGKTAPGGVELKADYYEVIGLAPSGDEAFTNKVQENADPALLLDQRH 237

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           L +RGET S+V K R+A++ + R  F  +G +EV PPCMVQTQVEGGSTLF+++YYGE+A
Sbjct: 238 LTMRGETLSSVFKVRAALLTSMRRFFQEEGLTEVTPPCMVQTQVEGGSTLFKLDYYGEEA 297

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+E+E+AF++F       
Sbjct: 298 YLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHIESELAFLSFDDLLNHL 357

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
                  +  VL +     L+ +L+PDF  PQ PF RM Y +A+ +L +H I  E GS +
Sbjct: 358 EKLFTTVMKYVLEDPVAGPLIKKLNPDFQVPQMPFKRMTYVEALDWLNEHGIPNEEGSAF 417

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           +FG+DI E  ER MTD +N PI L RFP EIK+FYMK+CA+D RVTESVDVL+P VGEV 
Sbjct: 418 KFGDDIAEAAERKMTDTLNVPILLTRFPVEIKSFYMKKCADDPRVTESVDVLMPNVGEVT 477

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMRI D +EL+A  KREG++   YYW+ DQRKYGT  HGG+GLG ER LAWL +R  V
Sbjct: 478 GGSMRIDDYDELVAAIKREGLDLDAYYWFVDQRKYGTCPHGGYGLGTERILAWLCNRYTV 537

Query: 548 KECCLYPRFMGRCLP 562
           +EC LYPRF GRC P
Sbjct: 538 RECSLYPRFSGRCRP 552



>gi|268562070|ref|XP_002646595.1| C. briggsae CBR-NRS-1 protein [Caenorhabditis briggsae]
          Length = 551

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/553 (49%), Positives = 358/553 (64%), Gaps = 3/553 (0%)

Query: 10  SSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           +++  YID   GSDE + GT+  P  T V+A+ +  +  S  ++   E G +        
Sbjct: 2   AAQQFYIDVEAGSDE-NPGTEEQPLATLVQAMLISKNTGSYHMKTKAEGGDESWEPVSKA 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     I   +D +LP A  IKI 
Sbjct: 61  ALKKSAKKYEAELKKLEKAAVREKEAEHAQEAHDAAIEAARAITFTRDESLPEAKTIKIG 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
           Q+ A R +RV +  WVHRLR QGK + F++LRDG G+LQC+L  +LC +YDA+ LS ES+
Sbjct: 121 QATAHRDQRVTIKAWVHRLRRQGKSLMFLILRDGYGFLQCVLNDKLCQSYDAVTLSTESS 180

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V +YGVI  +P GK APD HEL  DYWE+   +P G     N LN DA   ++ + RHLV
Sbjct: 181 VQVYGVIRAVPNGKDAPDGHELTVDYWELIGGSPAG--GIDNVLNKDAGVDVMLDNRHLV 238

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           IRGE AS +L+ R+A  +A RDHF +  ++EV PP +VQTQVEGGSTLF ++YYGE AYL
Sbjct: 239 IRGENASRILRIRAAATRAMRDHFFAASYTEVAPPTLVQTQVEGGSTLFGLDYYGEPAYL 298

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETC  +LGDVYCI++SYRAEKS TRRHLSEY H+EAE AFITF         
Sbjct: 299 TQSSQLYLETCNAALGDVYCIAQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIES 358

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +CDTVDR+LA+  T  L+  ++P +  P RPF RM YK+AI +L++++++ ENG  + +
Sbjct: 359 LVCDTVDRLLADPVTAGLIQFVNPGYTAPVRPFRRMQYKEAIAWLQENDVRNENGEKFVY 418

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           GEDI E  ER MTD I  PI L RFPA IKAFYM RC +D  +TESVD+L+PGVGE+VGG
Sbjct: 419 GEDIAEAAERKMTDTIGVPILLNRFPAGIKAFYMPRCEDDKDLTESVDLLMPGVGEIVGG 478

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI   +E+LA ++R G++PT Y+WY DQRKYG+  HGG+GLG+ERF+ WL   +++++
Sbjct: 479 SMRIWKEDEMLAAFERAGLSPTNYFWYMDQRKYGSVPHGGYGLGLERFICWLTGTNHIRD 538

Query: 550 CCLYPRFMGRCLP 562
            CLYPRF+GRC P
Sbjct: 539 VCLYPRFVGRCAP 551



>gi|344231684|gb|EGV63566.1| Asparaginyl-tRNA synthetase, cytoplasmic [Candida tenuis ATCC
           10573]
 gi|344231685|gb|EGV63567.1| hypothetical protein CANTEDRAFT_114485 [Candida tenuis ATCC 10573]
          Length = 551

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 279/555 (50%), Positives = 359/555 (64%), Gaps = 10/555 (1%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRKTPEE----GYKDISGTX 67
           +VY++E  G D    TG+++ P++T   AL VK +   + V K  EE     Y +IS + 
Sbjct: 2   SVYVNEKTGKDAVEITGSEDQPFQTPAFALFVKPE-AKVFVHKQVEESDEFAYSEISASA 60

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIK 127
                                                       I +++D +LP A KIK
Sbjct: 61  LKKAKKGAEGLKKKQEKQLKAQEEQKAKTDEQAKKLAEVEL---ITIEEDESLPTAKKIK 117

Query: 128 IRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLE 187
           +R    +   RV + GWVHRLR Q K   F+ LRDG+G++QC+LTG+L        L+LE
Sbjct: 118 LRHIQENINARVSIQGWVHRLRLQ-KGFAFVTLRDGTGFIQCVLTGDLAKAKVTKELTLE 176

Query: 188 STVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRH 247
           ST+TI GV+ +LP GK+AP   EL  DY+EV   AP GDDAF NK+  +ADPS+L +QRH
Sbjct: 177 STLTIKGVVKKLPEGKSAPGGVELQTDYYEVIGLAPAGDDAFLNKVQENADPSLLLDQRH 236

Query: 248 LVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKA 307
           L +RGET SAV+K R+ ++ AFR  F  +G +EV PPCMVQ QVEGGSTLF+M YYGE+A
Sbjct: 237 LTLRGETLSAVMKVRAVLLTAFRRFFAEEGLTEVTPPCMVQNQVEGGSTLFKMGYYGEEA 296

Query: 308 YLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXX 367
           YLTQ+SQLYLETCL +LGDVYC+ ES+RAEKSHTRRHLSEY+H+E+E+AFI F       
Sbjct: 297 YLTQSSQLYLETCLAALGDVYCVQESFRAEKSHTRRHLSEYTHVESELAFIDFDDLLSHL 356

Query: 368 XXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFY 427
              +  +V  VL +     L+ QL+P+FVPP  PF RM+Y  A+ +L +HNI  E G  +
Sbjct: 357 ERLLTKSVQYVLEDPVAGPLIKQLNPNFVPPTMPFKRMEYIHALDWLNEHNIPNEEGEPF 416

Query: 428 EFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVV 487
           +FG+DI E  ER MTD +  PI L RFPAEIK+FYM+RC +D RVTESVDVL+P VGE+ 
Sbjct: 417 KFGDDIAEAAERKMTDTLGVPILLTRFPAEIKSFYMQRCKDDPRVTESVDVLMPNVGEIT 476

Query: 488 GGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNV 547
           GGSMRI D +EL+A  +RE ++   YYW+TDQRKYGT  HGG+GLG ER LAWL  R  V
Sbjct: 477 GGSMRIYDYDELMAALERENLDKDSYYWFTDQRKYGTCPHGGYGLGTERILAWLCDRFTV 536

Query: 548 KECCLYPRFMGRCLP 562
           ++C LYPRF GRC P
Sbjct: 537 RDCSLYPRFTGRCKP 551



>gi|255731872|ref|XP_002550860.1| asparaginyl-tRNA synthetase [Candida tropicalis MYA-3404]
 gi|240131869|gb|EER31428.1| asparaginyl-tRNA synthetase [Candida tropicalis MYA-3404]
          Length = 552

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 277/553 (50%), Positives = 358/553 (64%), Gaps = 3/553 (0%)

Query: 11  SETVYIDEVNGSDETST-GTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+T+Y++E  G D   T GTQ  PY T   AL  + ++  + V K  EE  +        
Sbjct: 2   SQTIYVNEKTGVDSAETKGTQEQPYATPAFALYSQPES-KLFVYKQSEEDKEKFEYVEIS 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                       +++D +LP A KIK+R
Sbjct: 61  ASALKKAKKGVEGLKKKAEKQAKLEEQKKEQQAAAKLSALDLSSIEEDQSLPQAKKIKLR 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
               +   RV V GWVHRLR Q K + FI LRDG+GYLQC+LTG+L        L++EST
Sbjct: 121 TIQENLDTRVLVQGWVHRLRVQ-KGLAFITLRDGTGYLQCVLTGDLAKARQTQELTIEST 179

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V I GVIS+LP GKTAP   EL AD++E+   AP GDD+FTN++   ADP++L +QRHL 
Sbjct: 180 VAIKGVISKLPEGKTAPGGVELKADFYEIIALAPSGDDSFTNRIQEGADPNLLLDQRHLT 239

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGET SAV+K R+A   A R  +  +G +EV PPCMVQ QVEGGSTLF+++YYGE+AYL
Sbjct: 240 LRGETLSAVMKVRAAYSAAIRRFYAEEGITEVTPPCMVQNQVEGGSTLFKLDYYGEEAYL 299

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCLP+LGDV+CI ES+RAEKSHTRRHLSEY+H+EAE+ FITF         
Sbjct: 300 TQSSQLYLETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELVFITFHDLLDHLER 359

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +  T+  VL +     +V QL+P+F  P  PF RM+Y +A+ +L +H I  E+G  ++F
Sbjct: 360 LLTKTIQYVLEDPVAGPIVKQLNPNFKAPTTPFKRMEYIEALDWLNEHGIPNEDGEKFKF 419

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DI E  ER MTD IN+PI L RFPAEIK+FYM+RC +D RVTESVDVL+P VGE+ GG
Sbjct: 420 GDDIAEAAERKMTDTINEPILLIRFPAEIKSFYMQRCQDDPRVTESVDVLMPNVGEITGG 479

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI   +EL+A  KREG+N   YYW+TD RKYG + HGG+G+G+ER LA++L R  V++
Sbjct: 480 SMRIDKYDELVAAIKREGLNLDSYYWFTDVRKYGGSPHGGYGIGLERMLAYMLDRFTVRD 539

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 540 CSLYPRFSGRCKP 552



>gi|459369066|gb|EMG47574.1| Asparaginyl-tRNA synthetase [Candida maltosa Xu316]
          Length = 552

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/553 (49%), Positives = 359/553 (64%), Gaps = 3/553 (0%)

Query: 11  SETVYIDEVNGSDETST-GTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXX 69
           S+T+Y++E  G+D T   GT+  P+ T   AL    +   +LV K  EE           
Sbjct: 2   SQTIYVNEKTGADSTEVKGTEQQPFATPAYALYTFPE-AKVLVYKQSEEDQDKFEYVEIS 60

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                       +++D +LP A +IK+R
Sbjct: 61  ASALKKAKKGVEGLKKKAEKQAKLEEQKKQQETTAKLSELDLSSIEEDKSLPEAKRIKLR 120

Query: 130 QSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLEST 189
               +   RV V GWVHRLR Q K + F+ LRDG+GYLQC+LTG+L        L++EST
Sbjct: 121 AVPQNLDSRVLVQGWVHRLRVQ-KGLAFVTLRDGTGYLQCVLTGDLAKARQTQELTIEST 179

Query: 190 VTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLV 249
           V I GVIS+LP GKTAP   EL AD+++V   AP GDD+FTN++  +ADP++L +QRHL 
Sbjct: 180 VAIKGVISKLPEGKTAPGGVELKADFYQVVAFAPSGDDSFTNRIQENADPNLLLDQRHLA 239

Query: 250 IRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYL 309
           +RGET S+V+K R+A   A R  +  +G +EV PPCMVQ QVEGGSTLF+++YYGE+AYL
Sbjct: 240 LRGETLSSVMKVRAAYSAAIRRFYAEEGLTEVTPPCMVQNQVEGGSTLFKLDYYGEEAYL 299

Query: 310 TQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXX 369
           TQ+SQLYLETCLP+LGDVYCI ES+RAEKSHTRRHLSEY+H+EAE+ FITF         
Sbjct: 300 TQSSQLYLETCLPALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELVFITFEDLLQHLEK 359

Query: 370 XICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEF 429
            +  TV  VL +     +V QL+PDF PP+ PF RM+Y +A+ +L +H I  E+G  ++F
Sbjct: 360 LLTKTVQYVLEDPIAGPIVKQLNPDFQPPKAPFRRMEYIEALDWLNEHGIPNEDGEKFKF 419

Query: 430 GEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGG 489
           G+DI E  ER MTD IN+PI L RFP EIK+FYM++C +D RVTESVDVL+P VGE+ GG
Sbjct: 420 GDDIAEAAERKMTDTINEPILLTRFPVEIKSFYMQKCQDDPRVTESVDVLMPNVGEITGG 479

Query: 490 SMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKE 549
           SMRI D +EL+A  KRE ++   YYW+TD RKYG   HGG+G+G+ER LA++L+R  V++
Sbjct: 480 SMRIDDHDELVAAIKRENLDLDSYYWFTDVRKYGGAPHGGYGIGLERQLAYMLNRFTVRD 539

Query: 550 CCLYPRFMGRCLP 562
           C LYPRF GRC P
Sbjct: 540 CSLYPRFTGRCKP 552



>gi|212532907|ref|XP_002146610.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Talaromyces
           marneffei ATCC 18224]
 gi|210071974|gb|EEA26063.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Talaromyces
           marneffei ATCC 18224]
          Length = 578

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 284/572 (49%), Positives = 372/572 (65%), Gaps = 24/572 (4%)

Query: 14  VYIDEVNGSDETST-GTQNAPYKTAVRALQVKG---DNISILVRKTP----EEGYK---- 61
           +YIDE  G D+ S  GT+ APYK+ + A+       + I  L RK+     EEG +    
Sbjct: 8   IYIDEDVGKDDASANGTEAAPYKSLLHAMLQHAPTTEGIKYLTRKSVTGPVEEGNEAARL 67

Query: 62  DISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLP 121
           +                                                 +V+K+DP+LP
Sbjct: 68  EWKAPSASAVKKSTRLFEGAQKKAAKAQEIAIREKAEAEKRQVVLEEAKKVVIKEDPSLP 127

Query: 122 LAIKI----------KIRQSVASR-GKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCL 170
             ++I          K+R   +   G RV+V G VHRLR+Q KD+ FI L DG GYLQC+
Sbjct: 128 KPVRIRLDVTDPAIVKLRTPESDEPGTRVRVLGRVHRLRSQ-KDVIFITLTDGYGYLQCI 186

Query: 171 LTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFT 230
           +TG++  TYD + L+LE+++ I+G +  +P  + AP++ EL AD++ +   A G  +A T
Sbjct: 187 MTGDMVKTYDMMTLTLETSIAIHGEMRAVPPKQHAPNDRELHADFFTIIGKAAGDKEAIT 246

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
           +++  DADP  LY+ RHLV+RGET+S+V+K R+A +KAFR  F++    EV PP MVQTQ
Sbjct: 247 SRVAPDADPQTLYDNRHLVLRGETSSSVMKVRAATLKAFRKTFEASRMLEVTPPSMVQTQ 306

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF  +YYGE AYLTQ+SQLYLETCL SLGDV+CI  S+RAEKS TRRHLSEY+H
Sbjct: 307 VEGGSTLFSFDYYGEPAYLTQSSQLYLETCLASLGDVFCICPSFRAEKSLTRRHLSEYTH 366

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE+ FITF          I   ++ +LA+E T KL+ +L+PDF  P RPF RM Y DA
Sbjct: 367 IEAELDFITFDDLLEHLEEVISRVIEELLADEQTAKLIKELNPDFKVPSRPFRRMRYSDA 426

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I +L++H+I  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  +D 
Sbjct: 427 IDWLREHDIPNEEGQPHQFGDDIAEAAERRMTDIINQPIFLTHFPAEIKAFYMKKDPQDP 486

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           RVTESVDVL+PGVGE+VGGS RI D +EL+A YKRE ++P+PYYWYTDQRKYGT+ HGG+
Sbjct: 487 RVTESVDVLMPGVGEIVGGSCRIDDWDELIAAYKREEMDPSPYYWYTDQRKYGTSPHGGY 546

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 547 GLGLERFLAWICGRYTVRECCLYPRFTGRCTP 578



>gi|67900984|ref|XP_680748.1| hypothetical protein AN7479.2 [Aspergillus nidulans FGSC A4]
 gi|40742869|gb|EAA62059.1| hypothetical protein AN7479.2 [Aspergillus nidulans FGSC A4]
 gi|259483785|tpe|CBF79459.1| TPA: cytoplasmic asparaginyl-tRNA synthetase, putative
           (AFU_orthologue; AFUA_2G05650) [Aspergillus nidulans
           FGSC A4]
          Length = 574

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 280/574 (48%), Positives = 368/574 (64%), Gaps = 26/574 (4%)

Query: 13  TVYIDEVNG-SDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKT----------PEEG 59
           ++YIDE  G  D+T+ G+++APYKT + A       +    L RK+          PE  
Sbjct: 3   SIYIDEDAGRDDQTANGSESAPYKTLLHAFLQHDPSEGTQYLTRKSLTEPTGEGADPESK 62

Query: 60  YKDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPN 119
            +    T                                             +V+K+D +
Sbjct: 63  LEWKPATKSAIKKATNLLEQRKKKAAKEQQLAIREKEEAEKRRLVLEEAKK-VVIKEDTS 121

Query: 120 LPLAIKIKI-----------RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQ 168
           LP  ++I++                + G RV+V G VHRLR+Q KDM F+ L DG GYLQ
Sbjct: 122 LPKPVRIRLDVTDPAIVKLGSPESDTPGTRVRVLGRVHRLRSQ-KDMIFLTLSDGYGYLQ 180

Query: 169 CLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDA 228
           C+LTG+L  TYDA+ L+LE+++ ++G +  +P  + AP+N EL  D++ +   A G  +A
Sbjct: 181 CVLTGDLVKTYDAMTLTLETSIALHGEMRAVPPKQHAPNNRELHVDFYTIIGRAAGDKEA 240

Query: 229 FTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQ 288
            T ++  D+DP  LY  RHLV+RGETAS+V+K R+A +KAFR  FD    +EV PP MVQ
Sbjct: 241 ITTRVAHDSDPQTLYNNRHLVLRGETASSVMKVRAATLKAFRQTFDELRMTEVTPPAMVQ 300

Query: 289 TQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEY 348
           TQVEGGSTLF+ +YYGE AYLTQ+SQLYLETC+PSLGDV+C+  S+RAEKS TRRHLSEY
Sbjct: 301 TQVEGGSTLFKFDYYGEDAYLTQSSQLYLETCIPSLGDVFCVCPSFRAEKSLTRRHLSEY 360

Query: 349 SHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYK 408
           +H+E+E+ FI F          IC  ++ VLA+   + ++ QL+P F  P RPFLRM Y 
Sbjct: 361 THIESELDFIEFTDLLDHLEAVICRVLEIVLADPVAKPIIAQLNPGFQMPSRPFLRMKYS 420

Query: 409 DAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAE 468
           DAI++L++H I  E G  +EFG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  E
Sbjct: 421 DAIEWLREHEIPNEEGKPHEFGDDIAEAAERKMTDIINRPIFLTHFPAEIKAFYMKKDPE 480

Query: 469 DNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHG 528
           D RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P+PYYWYTDQRKYGT+ HG
Sbjct: 481 DRRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPSPYYWYTDQRKYGTSPHG 540

Query: 529 GFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           G+GLG+ERFLAWL  R  V++C LYPRF GRC P
Sbjct: 541 GYGLGLERFLAWLCARYTVRDCSLYPRFTGRCTP 574



>gi|121715316|ref|XP_001275267.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Aspergillus
           clavatus NRRL 1]
 gi|119403424|gb|EAW13841.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Aspergillus
           clavatus NRRL 1]
          Length = 574

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 283/573 (49%), Positives = 363/573 (63%), Gaps = 24/573 (4%)

Query: 13  TVYIDE-VNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKTPEE---------GY 60
           ++YIDE V   D T+TG++ APYKT V A   Q   +    L+RK+  E           
Sbjct: 3   SIYIDEDVGLDDSTATGSEAAPYKTLVHAFLQQPPAEGNQYLMRKSQTEPAGENVDPAAK 62

Query: 61  KDISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
            +                                                 +V+ +D +L
Sbjct: 63  LEWKSATKSATKKALSIVEQRKKKAAKEQELAIREKQDAEKRQKVLEDAKKVVITEDASL 122

Query: 121 PLAIKIKI-----------RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQC 169
           P  ++I++                + G RV+V G VHRLR Q KD+ F+ L DG GYLQC
Sbjct: 123 PKPVRIRLDVTDPEIVKLGSPESETPGTRVRVLGRVHRLRAQ-KDVIFLTLTDGYGYLQC 181

Query: 170 LLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAF 229
           +LTG L  TYDAL L++ +++ I+G +  +P  + AP++ EL AD++ V   A G  +A 
Sbjct: 182 ILTGNLTKTYDALTLTIGTSMAIHGEMRAVPPKQHAPNDRELHADFYTVIGRAAGDKEAI 241

Query: 230 TNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQT 289
           T ++  DADP  LY+ RHLV+RGET+SAVLK R+A +KAFR  F+     EV PP MVQT
Sbjct: 242 TTRVAPDADPQTLYDNRHLVLRGETSSAVLKVRAATLKAFRQTFEEHRMLEVTPPAMVQT 301

Query: 290 QVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYS 349
           QVEGGSTLF+ +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+
Sbjct: 302 QVEGGSTLFKFDYYGEDAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYT 361

Query: 350 HLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKD 409
           H+E E+ FITF          IC  ++  LA+  T  L+ QL+PDF  P RPF RM Y D
Sbjct: 362 HIEGELDFITFTDLLDHLENVICRVIELTLADPATAALIKQLNPDFKTPSRPFRRMRYSD 421

Query: 410 AIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAED 469
           AI++L++H+I  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  ED
Sbjct: 422 AIEWLREHDIPNEEGKPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDPED 481

Query: 470 NRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGG 529
            RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P PYYWYTDQRKYGT+ HGG
Sbjct: 482 RRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPAPYYWYTDQRKYGTSPHGG 541

Query: 530 FGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +GLG+ERFLAWL  R  V++C LYPRF GRC P
Sbjct: 542 YGLGLERFLAWLCARYTVRDCSLYPRFTGRCKP 574



>gi|339244857|ref|XP_003378354.1| asparaginyl-tRNA synthetase, cytoplasmic [Trichinella spiralis]
 gi|316972747|gb|EFV56401.1| asparaginyl-tRNA synthetase, cytoplasmic [Trichinella spiralis]
          Length = 852

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 280/558 (50%), Positives = 369/558 (66%), Gaps = 15/558 (2%)

Query: 8   VKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNIS--ILVRKTPEEGYKDISG 65
           V   + +Y+ + NGSDE   G+++ P++T   A+   G+     ++  KT +E +  IS 
Sbjct: 307 VSELKRLYVSDQNGSDEHGDGSESKPFRTV--AMTKVGEPFPEFMVDGKTEDEKWVKISQ 364

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIK 125
           +                                             IV+K+D +LP A  
Sbjct: 365 SQFKKCHRIWLQDQKKLKNQQLKEIEDMKRREENLEAAKN------IVIKEDASLPKAKI 418

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           IKI  +  + G RVK+ GWVHRLR QGK M FIVLRDG+GYLQC+LTG +C  YDALIL+
Sbjct: 419 IKISAARENMGCRVKLFGWVHRLRRQGKQMIFIVLRDGTGYLQCVLTGAMCQIYDALILA 478

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWE-VNHHAPGGDDAFTNKLNADADPSILYE 244
            ES+++I G++++LPAGK AP   EL AD+W  +    PGG +A    LN ++ P +  E
Sbjct: 479 TESSISITGILNDLPAGKEAPGGCELQADFWTLIGRSPPGGVEAV---LNEESHPDVQLE 535

Query: 245 QRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYG 304
           QRH+ +RGE  + +++ R+A+MKAFRDH+  + + EV PP +VQTQVEGGSTLF  NYYG
Sbjct: 536 QRHIALRGEHMTKLMRLRAALMKAFRDHYYDRNYCEVTPPTLVQTQVEGGSTLFSFNYYG 595

Query: 305 EKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXX 364
           + AYLTQ+SQLYLETC+PSLGDVYCI+ SYRAEKS TRRHLSEY+H+EAE  FITF    
Sbjct: 596 QTAYLTQSSQLYLETCIPSLGDVYCIAMSYRAEKSRTRRHLSEYTHVEAECPFITFENLL 655

Query: 365 XXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENG 424
                 +CD VDRV+ +     LV +L+P+F PPQ+PF RM Y +AI++L D+ +KKE+G
Sbjct: 656 ERIEDIVCDVVDRVMKSPFGY-LVKELNPNFKPPQKPFRRMAYLEAIKWLNDNGVKKEDG 714

Query: 425 SFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVG 484
           S +  G+DIPE PER MTD +N+PI L RFP  +K+FYM  CA+D  +TESVD+L+PGVG
Sbjct: 715 SEFVVGDDIPEAPERHMTDTLNEPILLNRFPKTLKSFYMNPCADDPTLTESVDLLLPGVG 774

Query: 485 EVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHR 544
           E+VGGSMRI D  ELL  +KR  IN  PYYWYT+QRKYGT  HGG+GLG+ERFL WL   
Sbjct: 775 EIVGGSMRIWDEKELLDAFKRNSINVEPYYWYTEQRKYGTCPHGGYGLGLERFLTWLAGL 834

Query: 545 DNVKECCLYPRFMGRCLP 562
            +++E  LYPRF+ RC P
Sbjct: 835 HHIRETVLYPRFVDRCTP 852



>gi|47208664|emb|CAF88671.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 460

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 260/457 (56%), Positives = 337/457 (73%), Gaps = 20/457 (4%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           ++++ DP+LP    +KIRQ    RG+RVKV GWVHRLR QGK++ FIVLRDG+G+LQC+L
Sbjct: 18  VIIEDDPSLPSPETVKIRQLETKRGQRVKVFGWVHRLRRQGKNLMFIVLRDGTGFLQCVL 77

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           +            + ESTV +YG ++ +P GK AP  HEL  D+WE+   AP G     N
Sbjct: 78  SD-----------NTESTVALYGTVTPVPEGKQAPGGHELHCDFWELIGLAPAG--GADN 124

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            LN D+D  +    RH++IRGE  S +L+ RS + + FRDHF S+G+ EV P     +  
Sbjct: 125 LLNEDSDVDVQLNNRHMLIRGENVSKILRVRSTVTQCFRDHFFSRGYYEVRPTEHRSSDA 184

Query: 292 EG------GSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHL 345
                   GSTLF +NY+GE+AYLTQ+SQLYLETC+P+LGD +CI++SYRAE+S TRRHL
Sbjct: 185 GADPGGGCGSTLFSLNYFGEQAYLTQSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHL 244

Query: 346 SEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRM 405
           SEYSH+EAE  FI+F          +CD VDRVL +    +L++ ++P F PP+RPF RM
Sbjct: 245 SEYSHVEAECPFISFDDLLNRLEDLVCDVVDRVLKSPAG-ELLHDINPTFKPPKRPFRRM 303

Query: 406 DYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKR 465
           +Y +AI++L++H IKK++G+FYEFGEDIPE PER MTD IN+PI LCRFPAEIK+FYM+R
Sbjct: 304 NYTEAIEWLREHGIKKDDGTFYEFGEDIPEAPERVMTDTINEPILLCRFPAEIKSFYMQR 363

Query: 466 CAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTT 525
           C+ED R+TESVDVL+P VGE+VGGSMRI D  ELL GY+REGI+PTPYYWYTDQRKYGT 
Sbjct: 364 CSEDKRLTESVDVLMPNVGEIVGGSMRIWDSEELLEGYRREGIDPTPYYWYTDQRKYGTC 423

Query: 526 EHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
            HGG+GLG+ERFL WLL+R ++++ CLYPRF+ RC P
Sbjct: 424 PHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRCRP 460



>gi|71984122|ref|NP_001021405.1| Protein NARS-1, isoform a [Caenorhabditis elegans]
 gi|2501037|sp|Q19722.1|SYNC_CAEEL RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName:
           Full=Asparaginyl-tRNA synthetase; Short=AsnRS
 gi|3876241|emb|CAA95808.1| Protein NARS-1, isoform a [Caenorhabditis elegans]
          Length = 545

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/549 (49%), Positives = 356/549 (64%), Gaps = 7/549 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +YID   GSD+   GT+  P  T V+A+ +  ++   L++K  EEG              
Sbjct: 4   LYIDTDAGSDQ-HPGTEAQPLATLVQAMLISKNSGEFLMKKKSEEG----ESWEPAAKAA 58

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 I    D +LP A  IKI +SV 
Sbjct: 59  IKKAVKKYEAEVKKLEKAGCREKEAEEAQHAALEEAKKITFSLDKSLPEAKVIKIGESVQ 118

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
            R +RV +  WVHRLR QGK + F+VLRDG G+LQC+L  +LC +YDA+ LS E++V +Y
Sbjct: 119 HRDQRVSIKAWVHRLRRQGKSLMFLVLRDGYGFLQCVLNDKLCQSYDAVTLSTETSVQVY 178

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           G+I  LP GK+APD HEL  DYWEV   AP G     N LN  A   ++ + RHLVIRGE
Sbjct: 179 GIIKALPDGKSAPDGHELTVDYWEVIGKAPAG--GIDNVLNESAGVDVMLDNRHLVIRGE 236

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
            AS +L+ R+A  +A RDHF + G++EV PP +VQTQVEGGSTLF ++YYGE AYLTQ+S
Sbjct: 237 NASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLFGLDYYGEPAYLTQSS 296

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETC  +LGDVYCIS+SYRAEKS TRRHLSEY H+EAE AFITF          +CD
Sbjct: 297 QLYLETCNAALGDVYCISQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIEALVCD 356

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDI 433
           TVDR+LA+  T+ L+  ++P +  P RPF RM YK+AI++L+ ++++ E G  + +GEDI
Sbjct: 357 TVDRLLADPVTKSLIEFVNPGYKAPARPFKRMPYKEAIEWLQKNDVRNEMGEKFVYGEDI 416

Query: 434 PEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRI 493
            E  ER MTD I  PI L RFP  IKAFYM RCA+DN +TESVD+L+PGVGE+VGGSMRI
Sbjct: 417 AEAAERRMTDTIGVPILLNRFPHGIKAFYMPRCADDNELTESVDLLMPGVGEIVGGSMRI 476

Query: 494 SDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLY 553
              ++LLA +++ G++   YYWY DQRKYG+  HGG+GLG+ERF+ WL   +++++ CLY
Sbjct: 477 WKEDQLLAAFEKGGLDSKNYYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLY 536

Query: 554 PRFMGRCLP 562
           PRF+GRC P
Sbjct: 537 PRFVGRCAP 545



>gi|331220633|ref|XP_003322992.1| asparaginyl-tRNA synthetase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309301982|gb|EFP78573.1| asparaginyl-tRNA synthetase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 576

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 283/565 (50%), Positives = 360/565 (63%), Gaps = 18/565 (3%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDN-ISILVRKTPEEG-----YKDISGT 66
           TV+IDE  GSD    GTQ+APY++ + +   +G   +  +V K  E       Y+  S T
Sbjct: 15  TVHIDESRGSDTDGDGTQSAPYQSILASYIARGTTTLECMVYKQAEPAEQGGCYQPASAT 74

Query: 67  XXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
                                                              I+L++    
Sbjct: 75  ALKRAKKAYDIHIKKAAKQNNNNTLQQQQQQQPSKDQQKLDEEQKLNQARQIILQETEGT 134

Query: 121 PLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYD 180
             A +IKI+ ++ +R  +V++ GWVHRLR Q K + F+VLRDG+G+LQC+LTG+L  TYD
Sbjct: 135 --AKRIKIQHALENRNIKVRLFGWVHRLRQQ-KGLIFVVLRDGTGFLQCVLTGKLAQTYD 191

Query: 181 ALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPS 240
           AL L+ EST+ + G +  LP GK+AP+ HEL  D+W +   APG  +AF+N+++ D+ P 
Sbjct: 192 ALTLTTESTIQLTGKVVALPEGKSAPEGHELQVDWWSIVGRAPGDAEAFSNQISEDSGPD 251

Query: 241 ILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEM 300
            L ++RHLVIRGETAS+VLK RSA++ AFR  +      EV PPCMVQTQVEGGSTLFE 
Sbjct: 252 TLADRRHLVIRGETASSVLKVRSALLDAFRKSYAKISMVEVTPPCMVQTQVEGGSTLFEF 311

Query: 301 NYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITF 360
            YYGEKAYLTQ+SQLYLETCLPSLGD +CI ES+RAEKS TRRHLSEY+HLE E+AF+TF
Sbjct: 312 GYYGEKAYLTQSSQLYLETCLPSLGDCFCIQESFRAEKSKTRRHLSEYTHLEGELAFLTF 371

Query: 361 XXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK 420
                     IC T+  +L +   + LV  L+P F  P RPF RM+Y++AI +L    I+
Sbjct: 372 EDLLAHIEELICSTLSILLEDPKIKGLVESLNPSFQMPIRPFKRMEYREAIDWLNGRGIE 431

Query: 421 K---ENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVD 477
           K   + G  + + +DIPE PER MTD +  PIFL  FP EIKAFYMKR   +   TESVD
Sbjct: 432 KSMEDGGGAFTYADDIPEAPERLMTDTLGVPIFLINFPKEIKAFYMKRIPGNENFTESVD 491

Query: 478 VLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERF 537
           VL+PGVGE+VGGSMR++   ELLA YK  GI   PYYWYTDQRKYGT EHGG+GLGVERF
Sbjct: 492 VLMPGVGEIVGGSMRMTGYEELLAAYKGAGIPADPYYWYTDQRKYGTCEHGGYGLGVERF 551

Query: 538 LAWLLHRDNVKECCLYPRFMGRCLP 562
           LAWLL R +V+EC LYPR+  RC P
Sbjct: 552 LAWLLGRPHVRECSLYPRYTARCTP 576



>gi|258574089|ref|XP_002541226.1| asparaginyl-tRNA synthetase [Uncinocarpus reesii 1704]
 gi|237901492|gb|EEP75893.1| asparaginyl-tRNA synthetase [Uncinocarpus reesii 1704]
          Length = 734

 Score =  555 bits (1431), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/571 (48%), Positives = 367/571 (64%), Gaps = 23/571 (4%)

Query: 14  VYIDE-VNGSDETSTGTQNAPYKTAVRAL---QVKGDNISILVRKT-----PEEGYKDI- 63
           +YIDE V   DE + GT  +PYKT V A+       +NI  L RK+      E+G   + 
Sbjct: 165 IYIDEDVGRDDEAAAGTDLSPYKTLVYAMLQYPPSTENIQYLTRKSETGPVSEDGDPSVR 224

Query: 64  ---SGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
                                                              +V+K+D +L
Sbjct: 225 LEWKPATKSAMKKATSLYEARKRKAAKEHEVVLRQKEEAEKRRLVLEEAKKVVIKEDESL 284

Query: 121 PLAIKIKIRQSVASR---------GKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           P A+K+++ +   ++         G RV+V G +H LR Q KD+ F+ L DG G LQC+ 
Sbjct: 285 PKAVKVRLDEKDPAKVTAGDGETKGTRVRVLGRIHHLRVQ-KDIIFVTLYDGYGLLQCVF 343

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           TG L  +YDA+ L+LE+++ I+G +  +P  + APDN EL AD+++V   A G  +A + 
Sbjct: 344 TGNLIKSYDAMTLTLETSLAIHGEMRAVPPKQHAPDNRELHADFFQVIGKAAGDKEAIST 403

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
           ++  DADP  LY+ RHLV+RGETAS+V+K R+A+++AFR  F+     EV PP MVQTQV
Sbjct: 404 RVAPDADPQTLYDNRHLVLRGETASSVMKVRAAVLRAFRAVFEKSRMLEVTPPAMVQTQV 463

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF  +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+H+
Sbjct: 464 EGGATLFSFDYYGEPAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYTHI 523

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE+ FITF          +C  +D VLA+  T   +  L+P F PP RPF RM Y +AI
Sbjct: 524 EAELDFITFTDLLDHIEAIVCQVIDLVLADPQTAAAIKALNPSFTPPSRPFKRMKYAEAI 583

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++L++HNI  E+G+ + FG+DI E  ER MTD IN+PIFL  FP EIKAFYMK+  ED R
Sbjct: 584 EWLREHNIPNEDGTPHTFGDDIAEAAERKMTDIINQPIFLTHFPVEIKAFYMKKDPEDLR 643

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           VTESVDVL+PGVGE+VGGSMR+ D +EL+  Y R+G++P+PYYWYTDQRKYGT+ HGG+G
Sbjct: 644 VTESVDVLMPGVGEIVGGSMRMDDWDELMDAYARQGMDPSPYYWYTDQRKYGTSPHGGYG 703

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 704 LGLERFLAWMCGRYTVRECCLYPRFTGRCTP 734



>gi|255948264|ref|XP_002564899.1| Pc22g08870 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591916|emb|CAP98175.1| Pc22g08870 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 577

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 284/577 (49%), Positives = 366/577 (63%), Gaps = 25/577 (4%)

Query: 10  SSETVYIDEVNGSDET-STGTQNAPYKTAVRAL---QVKGDNISILVRKTPEEGY-KDIS 64
           +S T+YIDE  G DE+ + GT+ APYKT + A        + I  L RK+  +   +D+ 
Sbjct: 2   ASTTIYIDEDVGRDESPANGTETAPYKTLIHAYVEHPPTTEGIQYLTRKSQTDAAGEDVD 61

Query: 65  GTXXXXXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQ 116
                                                                  +V+K+
Sbjct: 62  PAAKLEWKPATKSAMKKANNLWEQRKKKAAKEHELAIREKAEADKRQKVLEEAKKVVIKE 121

Query: 117 DPNLPLAIKI----------KIRQSVASR-GKRVKVSGWVHRLRTQGKDMKFIVLRDGSG 165
           D +LP  +++          K+R   +   G RV+V G VHR R Q KD+ FI L DG G
Sbjct: 122 DTSLPKPVRVRLDVTDPAIVKLRTPESDEAGTRVRVLGRVHRARAQ-KDVVFITLTDGYG 180

Query: 166 YLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGG 225
           YLQC+LTG++  TYD + L+LE++++I+G +  +P  + AP++ EL AD++E+   A G 
Sbjct: 181 YLQCVLTGDMVKTYDIMTLTLETSMSIHGEMRAVPPKQHAPNDRELHADFFEIIGKAAGD 240

Query: 226 DDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPC 285
            +A T ++  DADP  LY+ RHLV+RGET+S+V+K R+A ++AFR  F+     EV PP 
Sbjct: 241 KEAITTRVAPDADPQTLYDNRHLVLRGETSSSVMKVRAATLRAFRKAFEETRMLEVTPPA 300

Query: 286 MVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHL 345
           MVQTQVEGGSTLF  +YYGE AYLTQ+SQLYLETCLPSLGDVYC+  S+RAEKS TRRHL
Sbjct: 301 MVQTQVEGGSTLFGFDYYGENAYLTQSSQLYLETCLPSLGDVYCVCPSFRAEKSLTRRHL 360

Query: 346 SEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRM 405
           SEY+H+EAE+ FITF          IC  +D  LA       + QL+PDF PP RPF RM
Sbjct: 361 SEYTHIEAELDFITFTDLLDHLEDVICRVIDYTLAEPEIAGYIKQLNPDFKPPSRPFRRM 420

Query: 406 DYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKR 465
            Y DAIQ+L +H I  E G  ++FG+DI E  ER MTD IN+PIFL  FPA IKAFYMK+
Sbjct: 421 KYDDAIQWLIEHEIPNEEGQPHKFGDDIAEAAERRMTDIINQPIFLTHFPANIKAFYMKK 480

Query: 466 CAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTT 525
             ED RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P+PYYWYTDQRKYGT+
Sbjct: 481 APEDRRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPSPYYWYTDQRKYGTS 540

Query: 526 EHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
            HGG+GLG+ERFLAWL  R  V++C LYPRF GRC P
Sbjct: 541 PHGGYGLGLERFLAWLCARYTVRDCSLYPRFTGRCTP 577



>gi|150866122|ref|XP_001385612.2| Asparaginyl-tRNA synthetase, cytoplasmic (Asparagine--tRNA ligase)
           (AsnRS) [Scheffersomyces stipitis CBS 6054]
 gi|149387378|gb|ABN67583.2| Asparaginyl-tRNA synthetase, cytoplasmic (Asparagine--tRNA ligase)
           (AsnRS) [Scheffersomyces stipitis CBS 6054]
          Length = 553

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 262/451 (58%), Positives = 329/451 (72%), Gaps = 1/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           I + +D  LP A KIK+R    +   RV V GWVHRLR Q K + FI LRDG+G++Q +L
Sbjct: 104 IKIVEDEKLPAAKKIKLRAIQENLETRVAVQGWVHRLRLQ-KGVAFITLRDGTGFIQAVL 162

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           +G+L        L++ESTV I GVIS+LP GK+AP   EL ADY+EV   AP GD++FTN
Sbjct: 163 SGDLAKARQTQELTIESTVVIKGVISKLPEGKSAPGGVELKADYYEVVGLAPSGDESFTN 222

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
           K   ++DPS+L +QRHL +RGET SAV+K R+++++A R  F  +G  EV PPCMVQTQV
Sbjct: 223 KAPENSDPSLLLDQRHLTLRGETLSAVMKVRASLLRAIRRFFAEEGLLEVTPPCMVQTQV 282

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLF+M+YYGE+AYLTQ+SQLYLETCLP+LGDVYC+ ES+RAEKSHTRRHLSEY+H+
Sbjct: 283 EGGSTLFKMDYYGEEAYLTQSSQLYLETCLPALGDVYCVQESFRAEKSHTRRHLSEYTHI 342

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           E+E+AFI F          I  TV  VL +E    L+ QL+PDF PP+ PFLRM+Y  A+
Sbjct: 343 ESELAFIEFDDLLSHLERLITKTVQYVLEDEVAGPLIKQLNPDFQPPKTPFLRMEYIHAL 402

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++L +H I  E G  ++FG+DI E  ER MTD I  PI L RFP EIK+FYM++C +D R
Sbjct: 403 EWLNEHGIPNEEGEKFKFGDDIAEAAERKMTDTIGTPILLIRFPVEIKSFYMQKCKDDPR 462

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           VTESVDVL+P VGE+ GGSMR  D +EL+A  KRE ++   YYW+TDQRKYGT  HGG+G
Sbjct: 463 VTESVDVLMPNVGEITGGSMRTYDYDELIAAIKREKLDLDSYYWFTDQRKYGTCPHGGYG 522

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG ER LAWL  R  V++C LYPRF GRC P
Sbjct: 523 LGTERILAWLCDRFTVRDCSLYPRFTGRCKP 553



>gi|303312585|ref|XP_003066304.1| asparaginyl-tRNA synthetase, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|240105966|gb|EER24159.1| asparaginyl-tRNA synthetase, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320033593|gb|EFW15540.1| asparaginyl-tRNA synthetase [Coccidioides posadasii str. Silveira]
          Length = 578

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 281/575 (48%), Positives = 366/575 (63%), Gaps = 23/575 (4%)

Query: 10  SSETVYIDE-VNGSDETSTGTQNAPYKTAVRAL---QVKGDNISILVRKTP-----EEGY 60
           +  T+YIDE V   DE++ GT  +PYKT V A        +NI  L RK+      E+G 
Sbjct: 5   APNTIYIDEDVGRDDESAAGTDLSPYKTLVYAFLQHPPSTENIQYLTRKSETGPVGEDGD 64

Query: 61  KDI----SGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQ 116
             +                                                    +V+K+
Sbjct: 65  PSVRLEWKPATKSALKKATNLFEARKKKAAKEHELALRQKEEAEKRQLVLEAAKKVVIKE 124

Query: 117 DPNLPLAIKIKIRQSVASR---------GKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYL 167
           D +LP  ++I++ +   ++         G RV+V G VHRLR+Q KD+ F+ L DG G+L
Sbjct: 125 DASLPKPVRIRLYEKDPAKVKLRDGDTPGTRVRVLGRVHRLRSQ-KDVIFVTLSDGYGFL 183

Query: 168 QCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDD 227
           QC+ TG+L  TYDA+ L+LE+++ ++G +  +P  + APDN EL AD++ V   A G  +
Sbjct: 184 QCVFTGDLVKTYDAMTLTLETSIAVHGEMCAVPPKQHAPDNRELHADFFTVIGRAAGDKE 243

Query: 228 AFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMV 287
           A T ++  DADP  LY+ RHLV+RGE AS+V+K R+A+++AFR  F+ +   EV PP MV
Sbjct: 244 AITTRVAPDADPQTLYDNRHLVLRGEIASSVMKVRAAVIRAFRSAFEEQRMLEVTPPAMV 303

Query: 288 QTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSE 347
           QTQVEGGSTLF  +YYGE AYLTQ+SQLYLETCLPSLGDV+CI  S+RAEKS TRRHLSE
Sbjct: 304 QTQVEGGSTLFSFDYYGEPAYLTQSSQLYLETCLPSLGDVFCICPSFRAEKSLTRRHLSE 363

Query: 348 YSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDY 407
           Y+H+EAE+ FITF          IC  +D VLA+      +  L+PDF PP RPF RM Y
Sbjct: 364 YTHIEAELDFITFDDLLDHLEVIICRVLDLVLADPQIAGYIKSLNPDFKPPSRPFKRMKY 423

Query: 408 KDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCA 467
            +AI +L++HNI  E G+ + FG+DI E  ER MTD +N+ IFL  FP EIKAFYM++  
Sbjct: 424 AEAIDWLREHNIPNEEGNPHTFGDDIAEAAERKMTDTMNQTIFLTHFPVEIKAFYMRKDP 483

Query: 468 EDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
           ED RVTESVDVL+PGVGE+VGGSMR+ D +EL+  Y   G++PTPYYWYTDQRKYGT+ H
Sbjct: 484 EDLRVTESVDVLMPGVGEIVGGSMRMEDWDELMGAYASRGMDPTPYYWYTDQRKYGTSPH 543

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 544 GGYGLGVERFLAWMCGRYTVRECCLYPRFTGRCTP 578



>gi|242776859|ref|XP_002478916.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218722535|gb|EED21953.1| cytoplasmic asparaginyl-tRNA synthetase, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 578

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 283/572 (49%), Positives = 371/572 (64%), Gaps = 24/572 (4%)

Query: 14  VYIDEVNGSDETST-GTQNAPYKTAVRALQVKG---DNISILVRKTP----EEGYK---- 61
           +YIDE  G D++S  GT+ APYK+ + A+       + I  L RK+     EEG +    
Sbjct: 8   IYIDEDVGKDDSSANGTEAAPYKSLLHAMLQHAPTTEGIKYLTRKSVTGPVEEGNEAERL 67

Query: 62  DISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLP 121
           +                                                 +++K+D +LP
Sbjct: 68  EWKAPSASAMKKSTRLYEGALKKAAKAQEIAIREKADAEKRQVVLEEAKKVIIKEDASLP 127

Query: 122 LAIKI----------KIRQSVASR-GKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCL 170
             ++I          K+R   +   G RV+V G VHRLR+Q KD+ FI L DG GYLQC+
Sbjct: 128 KPVRIRLDVTDPAIVKLRAPESDEPGTRVRVLGRVHRLRSQ-KDVIFITLYDGYGYLQCI 186

Query: 171 LTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFT 230
           +TG++  TYD + L+LE+++ I+G +  +P  + AP++ EL ADY+++   A G  +A T
Sbjct: 187 MTGDMVKTYDMMTLTLETSIAIHGEMRAVPPKQHAPNDRELHADYFKIIGKAAGDKEAIT 246

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
           +++  DADP  LY+ RHLV+RGET+S+V+K R+A ++AFR  F++    EV PP MVQTQ
Sbjct: 247 SRVAPDADPQTLYDNRHLVLRGETSSSVMKVRAATLRAFRRTFEATRMLEVTPPSMVQTQ 306

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF  +YYGE AYLTQ+SQLYLETCL SLGDV+CI  S+RAEKS TRRHLSEY+H
Sbjct: 307 VEGGSTLFSFDYYGEPAYLTQSSQLYLETCLASLGDVFCICPSFRAEKSLTRRHLSEYTH 366

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE+ FITF          I   +  +LA+E T KL+  L+PDF  P RPF RM Y DA
Sbjct: 367 IEAELDFITFDDLLEHLEEVISTVIGELLADEQTAKLIKDLNPDFKVPSRPFKRMRYSDA 426

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I +L++HNI  E G  ++FG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  +D 
Sbjct: 427 IDWLREHNIPNEEGQPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDPQDP 486

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           RVTESVDVL+PGVGE+VGGS RI D +EL+A YKRE ++P+PYYWYTDQRKYGT+ HGG+
Sbjct: 487 RVTESVDVLMPGVGEIVGGSCRIDDWDELIAAYKREEMDPSPYYWYTDQRKYGTSPHGGY 546

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 547 GLGLERFLAWICGRYTVRECCLYPRFTGRCTP 578



>gi|119192776|ref|XP_001246994.1| asparaginyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]
 gi|392863772|gb|EAS35458.2| asparagine-tRNA ligase [Coccidioides immitis RS]
          Length = 578

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 280/575 (48%), Positives = 366/575 (63%), Gaps = 23/575 (4%)

Query: 10  SSETVYIDE-VNGSDETSTGTQNAPYKTAVRAL---QVKGDNISILVRKTP-----EEGY 60
           +  T+YIDE V   DE++ GT  +PYKT V A        ++I  L RK+      E+G 
Sbjct: 5   APNTIYIDEDVGRDDESAAGTDLSPYKTLVYAFLQHPPSTEDIQYLTRKSETGPVGEDGD 64

Query: 61  KDI----SGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQ 116
             +                                                    +V+K+
Sbjct: 65  PSVRLEWKPATKSALKKATNLFEARKKKAAKEHELALRQKEEAEKRQLVLEAAKKVVIKE 124

Query: 117 DPNLPLAIKIKIRQSVASR---------GKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYL 167
           D +LP  ++I++ +   ++         G RV+V G VHRLR+Q KD+ F+ L DG G+L
Sbjct: 125 DASLPKPVRIRLYEKDPAKVKLRDGDTPGTRVRVLGRVHRLRSQ-KDVIFVTLSDGYGFL 183

Query: 168 QCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDD 227
           QC+ TG+L  TYDA+ L+LE+++ ++G +  +P  + APDN EL AD++ V   A G  +
Sbjct: 184 QCVFTGDLVKTYDAMTLTLETSIAVHGEMCAVPPKQHAPDNRELHADFFTVIGRAAGDKE 243

Query: 228 AFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMV 287
           A T ++  DADP  LY+ RHLV+RGE AS+V+K R+A+++AFR  F+ +   EV PP MV
Sbjct: 244 AITTRVAPDADPQTLYDNRHLVLRGEIASSVMKVRAAVIRAFRSAFEEQRMLEVTPPAMV 303

Query: 288 QTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSE 347
           QTQVEGGSTLF  +YYGE AYLTQ+SQLYLETCLPSLGDV+CI  S+RAEKS TRRHLSE
Sbjct: 304 QTQVEGGSTLFSFDYYGEPAYLTQSSQLYLETCLPSLGDVFCICPSFRAEKSLTRRHLSE 363

Query: 348 YSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDY 407
           Y+H+EAE+ FITF          IC  +D VLA+      +  L+PDF PP RPF RM Y
Sbjct: 364 YTHIEAELDFITFDDLLDHLEVIICRVLDLVLADPQIAGYIKSLNPDFKPPSRPFKRMKY 423

Query: 408 KDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCA 467
            +AI +L++HNI  E G+ + FG+DI E  ER MTD +N+ IFL  FP EIKAFYM++  
Sbjct: 424 AEAIDWLREHNIPNEEGNPHTFGDDIAEAAERKMTDTMNQTIFLTHFPVEIKAFYMRKDP 483

Query: 468 EDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEH 527
           ED RVTESVDVL+PGVGE+VGGSMR+ D +EL+  Y   G++PTPYYWYTDQRKYGT+ H
Sbjct: 484 EDLRVTESVDVLMPGVGEIVGGSMRMEDWDELMGAYASRGMDPTPYYWYTDQRKYGTSPH 543

Query: 528 GGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GG+GLGVERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 544 GGYGLGVERFLAWMCGRYTVRECCLYPRFTGRCTP 578



>gi|297702663|ref|XP_002828292.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic, partial [Pongo
           abelii]
          Length = 407

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 248/410 (60%), Positives = 325/410 (79%), Gaps = 3/410 (0%)

Query: 153 KDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELL 212
           K++ F+VLRDG+GYLQC+L  ELC  Y+ ++LS ES+V +YG+++  P GK AP  HEL 
Sbjct: 1   KNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELS 60

Query: 213 ADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDH 272
            D+WE+   AP G     N +N ++D  +    RH++IRGE  S +LKARS + + FRDH
Sbjct: 61  CDFWELIGLAPAG--GADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDH 118

Query: 273 FDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISE 332
           F  +G+ EV PP +VQTQVEGG+TLF+++Y+GE+A+LTQ+SQLYLETCLP+LGDV+CI++
Sbjct: 119 FFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQ 178

Query: 333 SYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLH 392
           SYRAE+S TRRHL+EY+H+EAE  F+TF          +CD VDRVL +     +V++L+
Sbjct: 179 SYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRVLKSPAG-SVVHELN 237

Query: 393 PDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLC 452
           P+F PP+RPF RM+Y DAI +LK+H++KKE+G+FYEFGEDIPE PER MTD IN+PI LC
Sbjct: 238 PNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLC 297

Query: 453 RFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTP 512
           RFP EIK+FYM+RC ED+R+TESVDVL+P VGE+VGGSMRI D  E+LAGYKREGI+PTP
Sbjct: 298 RFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRICDSEEILAGYKREGIDPTP 357

Query: 513 YYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           YYWYTDQRKYGT  HGG+GLG+ERFL W+L+R ++++ CLYPRF+ RC P
Sbjct: 358 YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 407



>gi|358367628|dbj|GAA84246.1| asparaginyl-tRNA synthetase [Aspergillus kawachii IFO 4308]
          Length = 574

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 290/573 (50%), Positives = 367/573 (64%), Gaps = 24/573 (4%)

Query: 13  TVYIDE-VNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKT---PEEGYKDISG- 65
           ++YIDE V   D T+ GT++APYKT + A       D    L RK+   P E   D +  
Sbjct: 3   SIYIDEDVGRDDSTANGTESAPYKTLLHAFLQHAPTDGNQYLTRKSQTEPTEAGADPASK 62

Query: 66  -----TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
                                                              +VL +D +L
Sbjct: 63  LEWKPATKSAVKKATNLYEQRKRKAAKEQELAIREKQEAEKRQAILEEAKKVVLTEDTSL 122

Query: 121 PLAIKIKI-----------RQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQC 169
           P   KI++                + G RV+V G VHRLR Q KD+ F+ L DG GYLQC
Sbjct: 123 PKPTKIRLDVTDPAVVKLGSPESETPGTRVRVVGRVHRLRAQ-KDVIFLTLTDGYGYLQC 181

Query: 170 LLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAF 229
           +LTG LC TYDA+ L+LE+++ I+G +  +P  + AP+N EL AD++ +   A G  +A 
Sbjct: 182 VLTGNLCKTYDAMTLTLETSIAIHGEMRAVPPKQHAPNNRELHADFYTIIGRAAGDKEAI 241

Query: 230 TNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQT 289
           T ++  DADP  LY+ RHLV+RGETAS+V+K R+A ++AFR  F+     EV PP MVQT
Sbjct: 242 TTRVAPDADPQTLYDNRHLVLRGETASSVMKVRAATLRAFRQTFEENRMLEVTPPAMVQT 301

Query: 290 QVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYS 349
           QVEGGSTLF  +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+
Sbjct: 302 QVEGGSTLFGFDYYGENAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYT 361

Query: 350 HLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKD 409
           H+EAE+ FITF          IC  +D  LA   T+ L+ +L+PDF PP RPF RM Y D
Sbjct: 362 HIEAELDFITFNDLLDHLEHVICRVIDLTLAEPATKALIEKLNPDFKPPSRPFKRMKYSD 421

Query: 410 AIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAED 469
           AI++L++H+I  E G  +EFG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+ AED
Sbjct: 422 AIEWLREHDIPNEEGKPHEFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDAED 481

Query: 470 NRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGG 529
            RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P+PYYWYTDQRKYGT+ HGG
Sbjct: 482 RRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPSPYYWYTDQRKYGTSPHGG 541

Query: 530 FGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +GLG+ERFLAWL  R  V++C LYPRF GRC P
Sbjct: 542 YGLGLERFLAWLCARYTVRDCSLYPRFTGRCTP 574



>gi|295669995|ref|XP_002795545.1| asparaginyl-tRNA synthetase [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284630|gb|EEH40196.1| asparaginyl-tRNA synthetase [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 580

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/462 (55%), Positives = 335/462 (72%), Gaps = 12/462 (2%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASR-----------GKRVKVSGWVHRLRTQGKDMKFIVL 160
           +V+K+D +LP  +KI++ ++   +           G RV+V G VH LR+Q KDM F+ L
Sbjct: 120 VVIKEDESLPKPLKIRLNETDPEKIKLRPSDGDTPGTRVRVVGRVHHLRSQ-KDMIFVTL 178

Query: 161 RDGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNH 220
            DG G LQC+ TG+L  TYD + L+LE+++ I+G +  +P    A D+ EL AD++ +  
Sbjct: 179 SDGYGLLQCIFTGDLVKTYDMMTLTLETSIAIHGEMRAVPPKNHAYDDRELHADFFTIIG 238

Query: 221 HAPGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSE 280
            A G  +A T ++  D+DP  LY+ RHLV+RGET+S+V+K R+A ++AFR  F+ KG  E
Sbjct: 239 RAAGDKEAITTRVARDSDPHTLYDNRHLVLRGETSSSVMKVRAATLRAFRKAFEEKGMLE 298

Query: 281 VNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSH 340
           V PP MVQTQVEGGSTLFE +YYGEKA+LTQ+SQLYLETCLPSLGDV+C+  S+RAEKS 
Sbjct: 299 VTPPAMVQTQVEGGSTLFEFDYYGEKAFLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSL 358

Query: 341 TRRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQR 400
           TRRHLSEY+H+EAE+ FI+F          IC  +D VL+     + V  L+P F PP R
Sbjct: 359 TRRHLSEYTHVEAELDFISFTDLLDYLEDMICRVIDLVLSEPLIAQYVKNLNPTFTPPSR 418

Query: 401 PFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKA 460
           PF RM Y +AI++L +HNI  E G  + FG+DI E  ER MTD +N+PIFL  FP EIKA
Sbjct: 419 PFKRMKYAEAIEWLVEHNIPNEEGQPHRFGDDIAEAAERKMTDMLNRPIFLTHFPTEIKA 478

Query: 461 FYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQR 520
           FYMK+  +D RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YKREG++P+PYYWYTDQR
Sbjct: 479 FYMKKDPDDPRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKREGMDPSPYYWYTDQR 538

Query: 521 KYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           KYGT+ HGG+GLG+ERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 539 KYGTSPHGGYGLGLERFLAWMCGRYTVRECCLYPRFTGRCTP 580



>gi|145234338|ref|XP_001400540.1| asparaginyl-tRNA synthetase, cytoplasmic [Aspergillus niger CBS
           513.88]
 gi|134057486|emb|CAK48840.1| unnamed protein product [Aspergillus niger]
 gi|350635220|gb|EHA23582.1| hypothetical protein ASPNIDRAFT_207470 [Aspergillus niger ATCC
           1015]
          Length = 574

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 280/572 (48%), Positives = 358/572 (62%), Gaps = 22/572 (3%)

Query: 13  TVYIDE-VNGSDETSTGTQNAPYKTAVRAL--QVKGDNISILVRKT---PEEGYKDISG- 65
           ++YIDE V   D T+ GT++APYKT + A       D    L RK+   P E   D +  
Sbjct: 3   SIYIDEDVGRDDSTANGTESAPYKTLLHAFMQHAPTDGNQYLTRKSQTEPTEAGADPASK 62

Query: 66  -----TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNL 120
                                                              +VLK+D +L
Sbjct: 63  LEWKPATKSAVKKATNLYEQRKRKAAKEQELAIREKQEAEKRQAILEEAKKVVLKEDTSL 122

Query: 121 PLAIKIKIR---QSVASRGK-------RVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCL 170
           P   KI++     +V + G                       KD+ F+ L DG GYLQC+
Sbjct: 123 PKPTKIRLDVTDPAVVTLGSPESETPGTRVRVVGRVHRLRAQKDVIFLTLTDGYGYLQCV 182

Query: 171 LTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFT 230
           LTG LC TYDA+ L+LE+++ I+G +  +P  + AP+N EL AD++ +   A G  +A T
Sbjct: 183 LTGNLCKTYDAMTLTLETSIAIHGEMRAVPPKQHAPNNRELHADFYTIIGRAAGDKEAIT 242

Query: 231 NKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQ 290
            ++  DADP  LY+ RHLV+RGETAS+V+K R+A ++AFR  F+     EV PP MVQTQ
Sbjct: 243 TRVAPDADPQTLYDNRHLVLRGETASSVMKVRAATLRAFRKTFEENRMLEVTPPAMVQTQ 302

Query: 291 VEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSH 350
           VEGGSTLF  +YYGE AYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TRRHLSEY+H
Sbjct: 303 VEGGSTLFGFDYYGENAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTRRHLSEYTH 362

Query: 351 LEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDA 410
           +EAE+ FITF          IC  +D  LA   T+ L+ +L+PDF PP RPF RM Y +A
Sbjct: 363 IEAELDFITFNDLLDHLENVICRVIDLTLAEPATKALIEKLNPDFKPPSRPFKRMKYSEA 422

Query: 411 IQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDN 470
           I++L++H+I  E G  +EFG+DI E  ER MTD IN+PIFL  FPAEIKAFYMK+  ED 
Sbjct: 423 IEWLREHDIPNEEGKPHEFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDVEDR 482

Query: 471 RVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGF 530
           RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YK EG++P+PYYWYTDQRKYGT+ HGG+
Sbjct: 483 RVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPSPYYWYTDQRKYGTSPHGGY 542

Query: 531 GLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GLG+ERFLAWL  R  V++C LYPRF GRC P
Sbjct: 543 GLGLERFLAWLCARYTVRDCSLYPRFTGRCTP 574



>gi|225684263|gb|EEH22547.1| asparaginyl-tRNA synthetase [Paracoccidioides brasiliensis Pb03]
          Length = 580

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 280/580 (48%), Positives = 369/580 (63%), Gaps = 25/580 (4%)

Query: 7   SVKSSETVYIDE-VNGSDETSTGTQNAPYKTAVRALQVK---GDNISILVRKT---PEEG 59
           +  S+  V+IDE V   D+T+TG ++APYKT V A   +     +I  L RK+   P   
Sbjct: 2   AASSAILVHIDEDVGKDDQTATGGESAPYKTLVHAFLQQPPSTPDIQYLTRKSVTGPVSE 61

Query: 60  YKDIS------GTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIV 113
            +D S                                                     ++
Sbjct: 62  GEDPSVRLEWKAATKSALKKATNLYEQRKKKAAKEQELVIREKEEAEKRRLVLEEAKKVI 121

Query: 114 LKQDPNLPLAIKIKIRQSVASR-----------GKRVKVSGWVHRLRTQGKDMKFIVLRD 162
           +K+D +LP  +KI++ ++   +           G RV+V G VH LR+Q KDM F+ L D
Sbjct: 122 IKEDESLPKPLKIRLNETDPEKIKLRPSDGDTPGTRVRVVGRVHHLRSQ-KDMIFVTLSD 180

Query: 163 GSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHA 222
           G G LQC+ TG+L  TYD + L+LE+++ I+G +  +P    A D+ EL AD++ +   A
Sbjct: 181 GYGLLQCIFTGDLVKTYDMMTLTLETSIAIHGEMRAVPPMNHAYDDRELHADFFTIIGRA 240

Query: 223 PGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVN 282
            G  +A T ++  D+DP  LY+ RHLV+RGET+S+V+K R+A ++AFR  F+ KG  EV 
Sbjct: 241 AGDKEAITTRVARDSDPHTLYDNRHLVLRGETSSSVMKVRAATLRAFRKAFEEKGMLEVT 300

Query: 283 PPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTR 342
           PP MVQTQVEGGSTLFE +YYGEKAYLTQ+SQLYLETCLPSLGDV+C+  S+RAEKS TR
Sbjct: 301 PPAMVQTQVEGGSTLFEFDYYGEKAYLTQSSQLYLETCLPSLGDVFCVCPSFRAEKSLTR 360

Query: 343 RHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPF 402
           RHLSEY+H+EAE+ FI+F          IC  +D VL+     + V  L+P F  P RPF
Sbjct: 361 RHLSEYTHVEAELDFISFTDLLDHLEDMICRVIDLVLSEPLIAQYVKNLNPTFTLPSRPF 420

Query: 403 LRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFY 462
            RM Y +AI++L +HNI  E G  + FG+DI E  ER MTD +++PIFL  FP EIKAFY
Sbjct: 421 KRMKYAEAIEWLVEHNIPNEEGQPHRFGDDIAEAAERKMTDMLSRPIFLTHFPTEIKAFY 480

Query: 463 MKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKY 522
           MK+  +D RVTESVDVL+PGVGE+VGGSMR+ D +EL+A YKREG++P+PYYWYTDQRKY
Sbjct: 481 MKKDPDDPRVTESVDVLMPGVGEIVGGSMRMDDWDELMAAYKREGMDPSPYYWYTDQRKY 540

Query: 523 GTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           GT+ HGG+GLG+ERFLAW+  R  V+ECCLYPRF GRC P
Sbjct: 541 GTSPHGGYGLGLERFLAWMCGRYTVRECCLYPRFTGRCTP 580



>gi|391336358|ref|XP_003742548.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like [Metaseiulus
           occidentalis]
          Length = 550

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/551 (49%), Positives = 361/551 (65%), Gaps = 10/551 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNI--SILVRKTPEEGYKDISGTXXXXX 71
           +Y  E NG+DET  G+Q  P+KT ++A++         I V     +G KD         
Sbjct: 8   IYTSEKNGNDETGDGSQENPFKTVLQAMRSAKQEPFPPIFV-----DGKKDDVKYEPISS 62

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   I +++D +LP A ++KIR+ 
Sbjct: 63  AQLKKIKKAWTREGFKNADREKREAEDAERREKNFEEAKKITIEEDKSLPAAKQVKIREL 122

Query: 132 VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVT 191
              + +RV+V GW+H LR Q K M FIVLRDG+G+LQC++  +LC T DAL L+ EST+ 
Sbjct: 123 QGHKDRRVRVFGWIHHLRRQSKAMFFIVLRDGTGFLQCVMNDKLCLTLDALKLTTESTIL 182

Query: 192 IYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIR 251
           I GV+ ++ AGKTAP   EL ADYWE+   +P G     N LN ++   +L + RHL +R
Sbjct: 183 ITGVVKDVLAGKTAPGGIELTADYWELVGDSPAG--GMDNVLNEESHVDVLLDNRHLALR 240

Query: 252 GETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQ 311
           GET S +++ARS IM+ FRDHF SK + EV PP M+Q QVEGGSTLF+ +Y+GE+AYLTQ
Sbjct: 241 GETLSKIMRARSFIMQCFRDHFFSKYYVEVTPPTMIQCQVEGGSTLFKFDYFGEEAYLTQ 300

Query: 312 TSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXI 371
           +SQLYLET LP LGDV+C+++SYRAE+S TRRHL+EY+H+EAE   I+F          I
Sbjct: 301 SSQLYLETMLPVLGDVFCVAQSYRAEQSRTRRHLAEYTHVEAEFVNISFDDLLDRIEDMI 360

Query: 372 CDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGE 431
            D   R + +     ++ +++P FVPP++PF RM Y +AI+Y + + I KE+G+ +EFG+
Sbjct: 361 VDVSQRAM-DSPAGDIIREINPSFVPPKKPFRRMKYTEAIEYCRQNAIMKEDGTQFEFGD 419

Query: 432 DIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSM 491
           DIPE PER MTDQIN+PI L RFPAEIK+FYM R  EDNRVTESVDVL+PGVGE+VGGSM
Sbjct: 420 DIPEMPERKMTDQINEPIMLNRFPAEIKSFYMPRDVEDNRVTESVDVLMPGVGEIVGGSM 479

Query: 492 RISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECC 551
           RI  ++EL+AG+KRE I+P  Y WY DQR++GT  HGGFGLG ERFL W+L R ++++  
Sbjct: 480 RIWKIDELMAGFKRENIDPANYDWYIDQRRFGTCPHGGFGLGFERFLTWMLGRHHIRDVV 539

Query: 552 LYPRFMGRCLP 562
           LYPRF+GRC P
Sbjct: 540 LYPRFVGRCKP 550



>gi|453084554|gb|EMF12598.1| asparaginyl-tRNA synthetase [Mycosphaerella populorum SO2202]
          Length = 576

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 282/573 (49%), Positives = 360/573 (62%), Gaps = 21/573 (3%)

Query: 10  SSETVYIDEVNGSD-ETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXX 68
           + +T+YIDEV G D   S GT+  PYK+   A  +  D++  LV+K  ++          
Sbjct: 5   TKKTIYIDEVAGQDVAESAGTEAEPYKSLQFAYVLHTDSVEYLVKKAEKDEEPLYKPAAK 64

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKI 128
                                                      +VL +D NLP A KI +
Sbjct: 65  AALKKAVNYADAQKKKAAKEQELAIREKKLEEERQKVLEDSKKVVLAEDKNLPKATKIHL 124

Query: 129 RQ-------------------SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQC 169
            +                   S  +RG RV+V G VHR+R Q K + FI LRDG GYLQC
Sbjct: 125 GETRPEVVKLGSGERSKEVDYSDPNRGTRVRVMGRVHRMRDQ-KSVLFITLRDGHGYLQC 183

Query: 170 LLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAF 229
           +LTG+L  TYDAL L+ ES+V I G + E+P G  APDN EL ADYW V   APGG++A 
Sbjct: 184 VLTGDLVKTYDALTLTRESSVEITGEMWEVPPGAHAPDNRELHADYWRVIGKAPGGEEAI 243

Query: 230 TNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQT 289
           TN + A  D   L ++RHLV+RGE ASAV+  R A+  AF   +   G+ +V+PP +VQT
Sbjct: 244 TNLVQAKGDAQTLLDRRHLVLRGEQASAVMFVRDAVEHAFNVKYHELGYVKVSPPALVQT 303

Query: 290 QVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYS 349
           QVEGGSTLF ++YY EKAYLTQ+SQLYLET +P  G+VYCI +S+RAEKS TRRHLSEY+
Sbjct: 304 QVEGGSTLFSLDYYQEKAYLTQSSQLYLETAIPFAGNVYCIEKSFRAEKSLTRRHLSEYT 363

Query: 350 HLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKD 409
           H+EAE+ FITF          IC  +D VL N    K++ +L+PDF  P+RPF+RM Y D
Sbjct: 364 HVEAELDFITFDDLLEHLEDMICGVIDIVLDNPRYAKMIKELNPDFTKPERPFMRMKYSD 423

Query: 410 AIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAED 469
           A+++L  H I  E G  ++FG+DI E  ER MTD INKPIFL  FP EIKAFYM++   D
Sbjct: 424 AVEWLIKHEIPNEEGEPHKFGDDIAEAAERRMTDIINKPIFLTHFPVEIKAFYMQKDPAD 483

Query: 470 NRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGG 529
            RVTESVD L+PGVGE+VGGSMR+ D +EL+A Y+REGI+P  YYWYTDQR+YGT+ HGG
Sbjct: 484 KRVTESVDCLMPGVGEIVGGSMRMDDYDELMAAYQREGISPDAYYWYTDQRRYGTSPHGG 543

Query: 530 FGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +GLG+ERFLAWL  +  V++ CLYPR+MGRC P
Sbjct: 544 YGLGLERFLAWLCKQHTVRDTCLYPRYMGRCKP 576



>gi|242212694|ref|XP_002472179.1| predicted protein [Postia placenta Mad-698-R]
 gi|220728737|gb|EED82625.1| predicted protein [Postia placenta Mad-698-R]
          Length = 452

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/444 (59%), Positives = 330/444 (74%), Gaps = 21/444 (4%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           IVL +DP+LP AIK KI      R KRV+ SGWVHRLR Q K + F+VLRDG+GYLQC+L
Sbjct: 10  IVLTEDPSLPRAIKAKIGNLAPLRSKRVRTSGWVHRLRDQNK-IIFVVLRDGTGYLQCVL 68

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
           +G++  TY+AL L+LESTV + G + E+P GKTAP  HEL+ DYW V   +PGG+DAFTN
Sbjct: 69  SGQVAQTYEALTLTLESTVELVGTLQEVPEGKTAPGGHELIVDYWRVLGASPGGEDAFTN 128

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
           +LN  +DPSI  + RHLV+RGETASAVLK R+A++ +FR    ++   EV PPCMVQTQV
Sbjct: 129 RLNEKSDPSIQADLRHLVVRGETASAVLKLRAALLSSFRSSLVARDLLEVTPPCMVQTQV 188

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGG+TLF+ +YYG+ A+LTQ+SQLYLETCLPSLGDV+C+ ES+RAE SHTRRHLSEY+HL
Sbjct: 189 EGGATLFKFDYYGQPAFLTQSSQLYLETCLPSLGDVFCVQESFRAENSHTRRHLSEYTHL 248

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE+AFITF          ICDTVDR+L N ++  L+ QL+P+F  P RPF R+ Y DAI
Sbjct: 249 EAELAFITFDDLMDHIEGVICDTVDRLLENPSSAALIKQLNPNFTAPARPFRRLSYVDAI 308

Query: 412 QYLKDHN------------IKKENGSF----YEFGEDIPEFPERTMTDQINKPIFLCRFP 455
           ++L +H             IK E+G+     +  G+DI E  ER MTD +  P+FL  FP
Sbjct: 309 KWLNEHGIQHEAEDADGNVIKDESGNAKMVDHAVGDDIAEAAERRMTDILGTPVFLYGFP 368

Query: 456 AEIKAFYMKRCAEDNR----VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPT 511
           AE+KAFYMK+   +       TES D+L+PGVGE+VGGSMRISDM+ELLA YKREGI+P 
Sbjct: 369 AELKAFYMKKMKREGEEGPVCTESCDLLMPGVGEIVGGSMRISDMDELLAAYKREGIDPA 428

Query: 512 PYYWYTDQRKYGTTEHGGFGLGVE 535
           PYYW+TDQRKYGT+EHGG+GLGVE
Sbjct: 429 PYYWFTDQRKYGTSEHGGYGLGVE 452



>gi|341882902|gb|EGT38837.1| CBN-NARS-1 protein [Caenorhabditis brenneri]
          Length = 545

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/549 (48%), Positives = 353/549 (64%), Gaps = 7/549 (1%)

Query: 14  VYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXXXX 73
           +YID   G DE + GT++ P  T V+A+ +  +    L++K  EEG              
Sbjct: 4   LYIDVDAGKDE-NPGTEDKPLATLVQAMLISKNTGEFLMKKKSEEG----ETWEVAAKAA 58

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQSVA 133
                                                 I    D +LP A  IKI ++  
Sbjct: 59  IKKAQKKYEAELKKAEKAAGREKEAEEAQHVALEEAKKITFTLDKSLPEAKVIKIGEAKD 118

Query: 134 SRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIY 193
              +RV +  W+HRLR QGK + F+VLRDG G+LQC+L  +LC +YDA+ LS E++V +Y
Sbjct: 119 HHDQRVTIKAWIHRLRRQGKSLMFVVLRDGYGFLQCVLNDKLCQSYDAVTLSTETSVQVY 178

Query: 194 GVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGE 253
           GV+  LP  K+AP  HEL+ DYWE    AP G     N LN  A   ++ + RHLVIRGE
Sbjct: 179 GVLKTLPDKKSAPGGHELIVDYWEAIGKAPAG--GIDNVLNESAGVDVMLDNRHLVIRGE 236

Query: 254 TASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTS 313
            AS +L+ R+A  +A RDHF + G++EV PP +VQTQVEGGSTLF ++YYGE AYLTQ+S
Sbjct: 237 NASKILRIRAAATRAMRDHFYAAGYTEVTPPTLVQTQVEGGSTLFGLDYYGEPAYLTQSS 296

Query: 314 QLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICD 373
           QLYLETC  SLGDVYCI++SYRAEKS TRRHLSEY H+EAE AFITF          +CD
Sbjct: 297 QLYLETCNASLGDVYCIAQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIESLVCD 356

Query: 374 TVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDI 433
           TVDR+LA+   ++++  ++P +  PQRPF RM YK+AI +L++++++ E G  + +GEDI
Sbjct: 357 TVDRLLADPVAKEMIESVNPGYKAPQRPFRRMAYKEAIAWLQENDVRNEFGEKFVYGEDI 416

Query: 434 PEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRI 493
            E  ER MTD I  PI L RFPA IKAFYM RC +D  +TESVD+L+PGVGE+VGGSMRI
Sbjct: 417 AEAAERKMTDTIGVPILLNRFPAGIKAFYMPRCQDDTELTESVDLLMPGVGEIVGGSMRI 476

Query: 494 SDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLY 553
              +E+LA + R GI+P  Y+WY DQRKYG+  HGG+GLG+ERF+ WL + +++++ CLY
Sbjct: 477 WKEDEMLAAFARAGIDPKNYFWYMDQRKYGSVPHGGYGLGLERFICWLTNTNHIRDVCLY 536

Query: 554 PRFMGRCLP 562
           PRF+GRC P
Sbjct: 537 PRFVGRCAP 545



>gi|353238960|emb|CCA70889.1| probable DED81-asparaginyl-tRNA-synthetase [Piriformospora indica
           DSM 11827]
          Length = 576

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 280/571 (49%), Positives = 369/571 (64%), Gaps = 29/571 (5%)

Query: 13  TVYIDEVNGSDETSTGTQNAPYKTAVRALQVKGDN--ISILVRKTPEEGYKDISGTXXXX 70
           TVY+DE  GSD+   G+   PY++A +A+   G +  + IL RK+ EE +  I       
Sbjct: 14  TVYVDEKVGSDDAGDGSIQKPYQSAAQAIVNHGPSPPLVILTRKSEEEEWVAIG------ 67

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQ 130
                                                    +VL++D +LP A+K KI+ 
Sbjct: 68  -ISALKKARKGAEGIEKKRQKALAAEAKAAEKAAAQEKAKDVVLEEDLSLPQAVKTKIKY 126

Query: 131 SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTV 190
               RG+RV++SGWVHRLR+QGK M F+VLRDG+G+LQ ++ G+L   +DA +L+ E+T+
Sbjct: 127 LEKYRGQRVRISGWVHRLRSQGK-MIFVVLRDGTGFLQVIIGGKLSQVHDASLLTNEATI 185

Query: 191 TIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVI 250
            + G + E+PA K+AP  HE++ADYW+V  HAP GDD++ ++ N +  PSIL + RHLV+
Sbjct: 186 EVVGNLQEVPAEKSAPGGHEVVADYWKVIGHAPLGDDSYLSRFNEETGPSILADLRHLVL 245

Query: 251 RGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLT 310
           RGET SAVLK R+A++ +FR   D+    EV PPC+VQTQVEGG+TLF   YY E+AYLT
Sbjct: 246 RGETQSAVLKLRTALLSSFRHALDALDLKEVTPPCIVQTQVEGGATLFGFKYYEEEAYLT 305

Query: 311 QTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXX 370
           Q+SQLYLET LP+LGDVYC+ ES+RAEKS TRRHLSE++HLEAE+AFITF          
Sbjct: 306 QSSQLYLETVLPALGDVYCVQESFRAEKSQTRRHLSEFTHLEAELAFITFDDLMTHIENA 365

Query: 371 ICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIK---KENGSF- 426
           ICDT+D +LA     +L+  L+PDF PP RPFLRM Y DAIQ+L DH I+   +E     
Sbjct: 366 ICDTIDHLLATPGVSELMKVLNPDFKPPSRPFLRMSYADAIQWLVDHKIQHVTEETEDLP 425

Query: 427 --------YEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCA-------EDNR 471
                   +  G+DI E  ER MTD+I +PIFL  FP+ +KAFYM++             
Sbjct: 426 DAEKVYVDHVLGDDIAEAAERKMTDEIGRPIFLYGFPSHLKAFYMQKMKGPAGEGPNGMV 485

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
            TES D+L+PGVGEVVGGSMRI D +ELLA +K++GI   PYYWY DQR+YGT EHGG+G
Sbjct: 486 FTESCDLLMPGVGEVVGGSMRIHDADELLAAFKKQGIPAEPYYWYVDQRRYGTCEHGGYG 545

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LGVERFLAW+ +R  V+EC LY R+ GR  P
Sbjct: 546 LGVERFLAWIGNRYTVRECQLYGRWPGRATP 576



>gi|170587862|ref|XP_001898693.1| Asparaginyl-tRNA synthetase, cytoplasmic [Brugia malayi]
 gi|158593963|gb|EDP32557.1| Asparaginyl-tRNA synthetase, cytoplasmic, putative [Brugia malayi]
          Length = 548

 Score =  542 bits (1396), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 252/451 (55%), Positives = 341/451 (75%), Gaps = 2/451 (0%)

Query: 112 IVLKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLL 171
           + ++ D +L     +KIR  V  R +RV + GW+HR+R QGK + F +LRDG+G+LQ LL
Sbjct: 100 VQIELDTSLSYITGVKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLL 159

Query: 172 TGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTN 231
             +LC TYDAL ++ E TV IYG I E+P GK AP+ HEL+AD+W++  +AP G     N
Sbjct: 160 MDKLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPG--GIDN 217

Query: 232 KLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQV 291
            LN +A    + + RHLVIRGE A+A+L+ R+A  +A R+HF + G+ EV PP +VQTQV
Sbjct: 218 VLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYLEVAPPTLVQTQV 277

Query: 292 EGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHL 351
           EGGSTLF ++Y+GE+++LTQ+SQLYLETC+P+LGDV+CI++SYRAEKS TRRHL+EY+H+
Sbjct: 278 EGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHV 337

Query: 352 EAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAI 411
           EAE  FIT           +CDTVDR+LA+E  +KL+  ++P F PP+RPFLRM+YKDAI
Sbjct: 338 EAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAI 397

Query: 412 QYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNR 471
           ++L++HN++ E G+ + +GEDI E  ER MTD INKPI L RFP+EIKAFYM+R A+DN 
Sbjct: 398 KWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNT 457

Query: 472 VTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFG 531
           +TESVD+L+PGVGE+VGGSMRI   +EL   +K   I+P PYYWY DQR YGT  HGG+G
Sbjct: 458 LTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYG 517

Query: 532 LGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           LG+ERF+ WL + +++++ CLYPRF+GRC+P
Sbjct: 518 LGLERFICWLTNTNHIRDVCLYPRFVGRCVP 548



>gi|296815388|ref|XP_002848031.1| asparaginyl-tRNA synthetase [Arthroderma otae CBS 113480]
 gi|238841056|gb|EEQ30718.1| asparaginyl-tRNA synthetase [Arthroderma otae CBS 113480]
          Length = 580

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 328/461 (71%), Gaps = 10/461 (2%)

Query: 112 IVLKQDPNLPLAIKIKIRQS----VASRGKRVKVSG------WVHRLRTQGKDMKFIVLR 161
           +++K+D +LP  +KI++ +     V  R +  +  G               KDM F+ L 
Sbjct: 120 VIIKEDESLPKPVKIRLNEKDPAVVRPRAEGDEQPGTRVRVVGRVHRLRMQKDMIFLTLS 179

Query: 162 DGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHH 221
           DG G LQC+ TG+L  TYDA+ L+LE+++ I+G +  +P  + APDN EL AD+++V   
Sbjct: 180 DGYGLLQCVFTGDLTRTYDAMTLTLETSMAIHGEMRAVPVKQHAPDNRELHADFFQVIGR 239

Query: 222 APGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEV 281
           A G  +A T ++ ADADP  L + RHLV+RGET+S+VLK R+A+++AFR  F+ K   EV
Sbjct: 240 AAGDKEAITTRVAADADPQTLLDNRHLVLRGETSSSVLKVRAAVVRAFRKTFEQKQMLEV 299

Query: 282 NPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHT 341
            PP MVQTQVEGGSTLFE NYYGEKAYLTQ+SQLYLETCL SLGDV+CI  S+RAEKS T
Sbjct: 300 TPPAMVQTQVEGGSTLFEFNYYGEKAYLTQSSQLYLETCLASLGDVFCICPSFRAEKSLT 359

Query: 342 RRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRP 401
           RRHLSEY+H+E+E+ FITF          IC  +D  LA+      V QL+PDF PP RP
Sbjct: 360 RRHLSEYTHIESELDFITFNDLLDHIEEIICSVIDISLADPQIAAFVKQLNPDFQPPARP 419

Query: 402 FLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAF 461
           F RM Y +AI++L +H I  E G  + FG+DI E  ER MTD INKPI L  FPAEIKAF
Sbjct: 420 FRRMRYSEAIEWLTEHGINNEEGKPHSFGDDIAEAAERKMTDIINKPILLTHFPAEIKAF 479

Query: 462 YMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRK 521
           YMK+ AED RVTESVDVL+PGVGE+VGGSMR+ D +EL+  YK+EG++PTPYYWYTDQRK
Sbjct: 480 YMKKDAEDPRVTESVDVLMPGVGEIVGGSMRMDDWDELMGAYKKEGMDPTPYYWYTDQRK 539

Query: 522 YGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           YGT+ HGG+G+G+ERFLAW+  R  V+EC LYPRF GRC P
Sbjct: 540 YGTSPHGGYGIGLERFLAWMCGRYTVRECSLYPRFTGRCRP 580



>gi|358393770|gb|EHK43171.1| hypothetical protein TRIATDRAFT_301084 [Trichoderma atroviride IMI
           206040]
          Length = 568

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 272/567 (47%), Positives = 364/567 (64%), Gaps = 18/567 (3%)

Query: 13  TVYIDEVNGSDETS-TGTQNAPYKTAVRALQVKGDNISILVRK---TPEEGYKDISGTXX 68
           T+YIDE  G DE S TGT+ +PYK+   A   +      L RK   T +E  K+      
Sbjct: 3   TIYIDEDIGKDEVSQTGTEESPYKSLQFAYLQRPAETQYLTRKSQNTEDEAAKEWKPVAK 62

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI-- 126
                                                      IV+ +DP+LP A++I  
Sbjct: 63  AALKKAVNYFDVQKKKAAKEQELVIRRKKEEEERAKALEAAKAIVITEDPSLPAAVRIGL 122

Query: 127 -------KIRQ--SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
                  K+R+     S+G RV+V G VHR R Q KD+ F+ LRDG G++Q +++G+L  
Sbjct: 123 DEVGDHIKLRKLDDTESKGTRVRVFGRVHRERKQ-KDVMFVTLRDGYGFMQVVISGQLAK 181

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHH--APGGDDAFTNKLNA 235
           TYDA+ L+ E+++ I G + E+PAG  AP N EL AD++++  H  APGGDDA TN++ A
Sbjct: 182 TYDAVTLTRETSMEILGEMREVPAGARAPLNRELHADFFKIPKHWKAPGGDDAITNRVQA 241

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
           DA+ ++L +QRHL +RGE AS V+  R A+  AF   +    F +V+PP +VQTQVEGG+
Sbjct: 242 DAEQAMLLDQRHLTLRGEVASGVMIVRDAVEWAFNQAYKELRFRKVSPPALVQTQVEGGA 301

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF+ +YYGE A+LTQ+SQLYLETCLPS+G VYCI +S+RAEKS TRRHLSE++H+EAE+
Sbjct: 302 TLFKFDYYGEDAFLTQSSQLYLETCLPSMGHVYCIEKSFRAEKSLTRRHLSEFTHVEAEL 361

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
            FITF          +C  ++ V+A+      +  ++P+F  P+RPF+RM Y +AI +L 
Sbjct: 362 DFITFDDLLSHIEHIMCRVLEIVMADPVVADKIKTMNPEFKLPERPFMRMKYSEAIDWLV 421

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
            H+I  E G  + FG+DI E  ER MTD IN+PIFL  FPAEIK+FYM +  ED RVTES
Sbjct: 422 KHDIPNEEGQPHAFGDDIAEAAERRMTDIINRPIFLTHFPAEIKSFYMSKAPEDLRVTES 481

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VD L+PGVGE+VGGSMR+ D  EL+A YKREGI+P  YYWYTDQRKYG++ HGG+GLG+E
Sbjct: 482 VDCLMPGVGEIVGGSMRMDDYEELMAAYKREGIDPEAYYWYTDQRKYGSSPHGGYGLGLE 541

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL  +  V++CCLYPR+M RC P
Sbjct: 542 RFLAWLCKQHTVRDCCLYPRYMHRCKP 568



>gi|390336041|ref|XP_003724269.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic-like
           [Strongylocentrotus purpuratus]
          Length = 529

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/561 (47%), Positives = 360/561 (64%), Gaps = 50/561 (8%)

Query: 5   KPSVKSSETVYIDEVNGSDETSTGTQNAPYKTAVRALQVKG-DNISILVRKTPEEG--YK 61
           KP+V     +YI E  G+DE+  G++  P +T +RA+   G +     +  + +EG  ++
Sbjct: 16  KPAV-----MYISEKEGNDESGDGSEQKPLQTLLRAMTASGGEPFPKFMGDSKKEGERWE 70

Query: 62  DISGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLP 121
           ++S                                               I +++D +LP
Sbjct: 71  EVS------QAQRKKITKLFAKEQRKTSEREKKEAEDAEKRQKNLEEAKKITIEEDSSLP 124

Query: 122 LAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDA 181
            A  IKI+   A+RG RVK++GWVHRLR QG+ + FIVLRDG+G+LQ +L  +LC TYDA
Sbjct: 125 AAKLIKIKSGGANRGTRVKINGWVHRLRRQGRSLMFIVLRDGTGFLQSVLNDKLCQTYDA 184

Query: 182 LILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSI 241
           LILS ESTVT+YGV+ E+P GK+AP  HEL  DYW + H AP G     N +N D++  +
Sbjct: 185 LILSTESTVTLYGVLKEVPEGKSAPGGHELHVDYWSLIHAAPAG--GVDNVVNEDSNVDV 242

Query: 242 LYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMN 301
             +QRH+++RGET S +++ RS + + FRDH+ S+ + E+ PP +VQTQVEGGSTLF++ 
Sbjct: 243 QLDQRHMMMRGETLSKIMRVRSTVTQCFRDHYFSQDYDELTPPTLVQTQVEGGSTLFKLG 302

Query: 302 YYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFX 361
           ++GE+AYLTQ+SQLYLET LPS+GDV+CI++SYRAE+S TRRHL+EY+H+EAE  FITF 
Sbjct: 303 FFGEEAYLTQSSQLYLETVLPSMGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFITFD 362

Query: 362 XXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKK 421
                    +CD VDR LA+     L+ +LHP F+                         
Sbjct: 363 DLLDKLEFLVCDVVDRALASPVG-DLIMELHPVFLL------------------------ 397

Query: 422 ENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIP 481
                    +DIPE PER MTDQIN+PI LCRFPA IK+FYM RC ED+R+TESVDVLIP
Sbjct: 398 ---------QDIPEAPERKMTDQINEPILLCRFPAAIKSFYMPRCPEDDRLTESVDVLIP 448

Query: 482 GVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWL 541
            VGE+VGGSMR  + +EL+AGYKREGI+P+PYYWYTDQRKYG+  HGG+GLG+ERFL WL
Sbjct: 449 NVGEIVGGSMRTWNYDELMAGYKREGIDPSPYYWYTDQRKYGSCPHGGYGLGLERFLTWL 508

Query: 542 LHRDNVKECCLYPRFMGRCLP 562
           ++R ++++   YPRFM RC P
Sbjct: 509 MNRHHIRDVAFYPRFMERCKP 529



>gi|326474010|gb|EGD98019.1| asparaginyl-tRNA synthetase [Trichophyton tonsurans CBS 112818]
 gi|326478207|gb|EGE02217.1| asparaginyl-tRNA synthetase [Trichophyton equinum CBS 127.97]
          Length = 580

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 327/461 (70%), Gaps = 10/461 (2%)

Query: 112 IVLKQDPNLPLAIKIKIRQS----VASRGKRVKVSG------WVHRLRTQGKDMKFIVLR 161
           ++LK+D +LP  +KI++ +     V  R +  +  G               KDM F+ L 
Sbjct: 120 VILKEDDSLPKPVKIRLNEKDPAVVRPRAEGDEQPGTRVRVVGRVHRLRVQKDMIFLTLT 179

Query: 162 DGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHH 221
           DG G LQC+ TG+L  TYDA+ L+LE+++ I+G +  +P  + APDN EL AD+++V   
Sbjct: 180 DGYGLLQCVFTGDLTKTYDAMTLTLETSMAIHGEMRAVPVKQHAPDNRELHADFFQVIGR 239

Query: 222 APGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEV 281
           A G  +A T ++ ADADP  L + RHLV+RGET+S+VLK R+A+++AFR  F+ K   EV
Sbjct: 240 AAGDKEAITTRVAADADPQTLLDNRHLVLRGETSSSVLKVRAAVVRAFRKTFEQKQMLEV 299

Query: 282 NPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHT 341
            PP MVQTQVEGGSTLFE +YYGEKAYLTQ+SQLYLETCL SLGDV+CI  S+RAEKS T
Sbjct: 300 TPPAMVQTQVEGGSTLFEFDYYGEKAYLTQSSQLYLETCLASLGDVFCICPSFRAEKSLT 359

Query: 342 RRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRP 401
           RRHLSEY+H+E+E+ FITF          IC  +D  LA+      V QL+PDF PP RP
Sbjct: 360 RRHLSEYTHIESELDFITFNDLLDHIEEIICSVIDISLADPQIAAFVKQLNPDFTPPARP 419

Query: 402 FLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAF 461
           F RM Y +AI++L +H I  E    + FG+DI E  ER MTD INKPI L  FPAEIKAF
Sbjct: 420 FRRMRYSEAIEWLNEHGINNEEDKPHSFGDDIAEAAERKMTDIINKPILLTHFPAEIKAF 479

Query: 462 YMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRK 521
           YMK+ AED RVTESVDVL+PGVGE+VGGSMR+ D +EL+  YK+EG++PTPYYWYTDQRK
Sbjct: 480 YMKKDAEDPRVTESVDVLMPGVGEIVGGSMRMDDWDELMGAYKKEGMDPTPYYWYTDQRK 539

Query: 522 YGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           YGT+ HGG+GLG+ERFLAW+  R  V+EC LYPRF GRC P
Sbjct: 540 YGTSPHGGYGLGLERFLAWMCGRYTVRECSLYPRFTGRCTP 580



>gi|398396612|ref|XP_003851764.1| asparagine--tRNA ligase [Zymoseptoria tritici IPO323]
 gi|339471644|gb|EGP86740.1| hypothetical protein MYCGRDRAFT_109954 [Zymoseptoria tritici
           IPO323]
          Length = 577

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 261/470 (55%), Positives = 333/470 (70%), Gaps = 20/470 (4%)

Query: 112 IVLKQDPNLPLAIKIKIRQS-------------------VASRGKRVKVSGWVHRLRTQG 152
           IVLK+D +LP ++KI + ++                     +RG RV+V G VHR R Q 
Sbjct: 109 IVLKEDTSLPKSVKINLGETRPEKVKLGSGERSKEVDYTSENRGTRVRVMGRVHRFRQQ- 167

Query: 153 KDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELL 212
           K++ F+ LRDG G+LQC+LTG+L  TYDAL L+ ES++ I G + E+P G  APDN EL 
Sbjct: 168 KEVLFVTLRDGHGFLQCVLTGQLVKTYDALTLTRESSMLIVGEMWEVPPGAHAPDNRELH 227

Query: 213 ADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDH 272
           ADY+EV   APGGDDA TN + A  DP  L +QRHLV+RGETAS V+  R A+  AF   
Sbjct: 228 ADYFEVIGKAPGGDDAITNVVQAKGDPQHLLDQRHLVLRGETASGVMFVRDAVEHAFNLK 287

Query: 273 FDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISE 332
           F   G+ +V+PP +VQTQVEGGSTLF  +YYGE AYLTQ+SQLYLET +P  G+VYCI +
Sbjct: 288 FHELGYVKVSPPALVQTQVEGGSTLFGFDYYGENAYLTQSSQLYLETAIPFAGNVYCIEK 347

Query: 333 SYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLH 392
           S+RAEKS TRRHLSEY+H+EAE+ FITF          +C  ++ V+ N     L+ +L+
Sbjct: 348 SFRAEKSLTRRHLSEYTHVEAELDFITFDDLLDHLEEMMCGVLEIVMGNPRIAALIKELN 407

Query: 393 PDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLC 452
           P+F  PQRPF+RM Y DAI +L++H+IK EN   ++FG+DI E  ER MTD INKPIFL 
Sbjct: 408 PEFEMPQRPFMRMKYSDAIDWLREHDIKNENDQPHQFGDDIAEAAERRMTDIINKPIFLT 467

Query: 453 RFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTP 512
            FP EIKAFYM++  ED RVTESVD L+PGVGE+VGGSMR+   +EL+A YKRE ++  P
Sbjct: 468 HFPVEIKAFYMQKDKEDPRVTESVDCLMPGVGEIVGGSMRMDSYDELMAAYKREEMDAGP 527

Query: 513 YYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           YYWYTDQR+YGT+ HGG+GLG+ERFLAWL  +  V++ C YPR+MGRC P
Sbjct: 528 YYWYTDQRRYGTSPHGGYGLGLERFLAWLCKQHTVRDTCFYPRYMGRCKP 577



>gi|407929625|gb|EKG22437.1| Aspartyl/Asparaginyl-tRNA synthetase class IIb [Macrophomina
           phaseolina MS6]
          Length = 564

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 275/564 (48%), Positives = 358/564 (63%), Gaps = 16/564 (2%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDISGTXXXXX 71
           T+YIDE  G DE T  GT+ +P+KT   A   +      L RK   E  K+         
Sbjct: 3   TIYIDEDLGKDEPTQQGTEESPFKTLQFAYLQRPAEAQYLTRKGNAEE-KEWKPAAKAGL 61

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIRQS 131
                                                   IV+++D +LP A+KIK+ ++
Sbjct: 62  KKAVNFYEQQKKKAAREQELAAQRAKEEAERQKVFEEAKKIVIEEDTSLPQAVKIKLDET 121

Query: 132 -----------VASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYD 180
                        S+G RVKV G VHR R Q KD+ F+ LRDG G++Q ++ G+L  TYD
Sbjct: 122 GDHIKLHKSDDAESKGTRVKVLGRVHRERKQ-KDVLFVTLRDGYGFMQVVIAGKLAKTYD 180

Query: 181 ALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEV--NHHAPGGDDAFTNKLNADAD 238
           AL L+ E+++ IYG + E+PAG  AP N EL AD++ +     A GG+DA TN++ A AD
Sbjct: 181 ALTLTRETSMEIYGEMFEVPAGAHAPLNRELHADFYRIPKEWKAAGGEDAITNRVQAKAD 240

Query: 239 PSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLF 298
           PS L + RHL +RGE AS+V+  R AI  AF   +      +V+PP +VQTQVEGG+TLF
Sbjct: 241 PSTLLDLRHLTLRGEVASSVMFVRDAIEYAFHTAYKECRVRKVSPPALVQTQVEGGATLF 300

Query: 299 EMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFI 358
           + +YYGE A+LTQ+SQLYLET LPS+GDVYCI +S+RAEKS TRRHLSEY+H+EAE+ FI
Sbjct: 301 KFDYYGEHAFLTQSSQLYLETVLPSMGDVYCIEKSFRAEKSLTRRHLSEYTHIEAELDFI 360

Query: 359 TFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHN 418
           TF          IC  ++ ++A+      +  L+PDF  P+RPF RM Y DAI++L++H 
Sbjct: 361 TFDDLLTHLEHIICRVLELIMADPVIAGYIKNLNPDFKMPERPFKRMKYSDAIEWLREHE 420

Query: 419 IKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDV 478
           I  E G  ++FG+DI E  ER MTD INKPIFL  FP EIKAFYM+R  ED RVTESVD 
Sbjct: 421 IPNEEGQPHQFGDDIAEAAERRMTDIINKPIFLTHFPVEIKAFYMQRDKEDPRVTESVDC 480

Query: 479 LIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFL 538
           L+PGVGE+VGGSMR+ D   L+A +KRE +NP PYYWYTDQRKYG++ HGG+GLG+ERFL
Sbjct: 481 LMPGVGEIVGGSMRLDDYEALMAAFKRENLNPDPYYWYTDQRKYGSSPHGGYGLGLERFL 540

Query: 539 AWLLHRDNVKECCLYPRFMGRCLP 562
           AWL  +  V++CCLYPR+MGRC P
Sbjct: 541 AWLCKQHTVRDCCLYPRYMGRCTP 564



>gi|321258873|ref|XP_003194157.1| asparagine-tRNA ligase [Cryptococcus gattii WM276]
 gi|317460628|gb|ADV22370.1| Asparagine-tRNA ligase, putative [Cryptococcus gattii WM276]
          Length = 600

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 250/426 (58%), Positives = 314/426 (73%), Gaps = 1/426 (0%)

Query: 137 KRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILSLESTVTIYGVI 196
           KRV++ GWVHR R Q  +  F+VLRDGSG+LQC+LTG+   T DAL LSLE TV + G +
Sbjct: 176 KRVRLQGWVHRFRPQKTNF-FVVLRDGSGFLQCILTGDCIRTVDALDLSLECTVEVVGTV 234

Query: 197 SELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQRHLVIRGETAS 256
            ++  G+TAP   EL  DYW++   AP G +A  ++L  D D SI  + RHL +RGE A+
Sbjct: 235 EKVKEGQTAPGGVELAVDYWKIIGKAPTGAEAIESRLQPDTDASIRADLRHLELRGEIAA 294

Query: 257 AVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLY 316
           +V++ R+  ++A R+ F  +  +EV PPCMVQT VEGGSTLFE +YYG KAYLTQ+SQLY
Sbjct: 295 SVMRFRALFLRALRESFHKRRITEVTPPCMVQTSVEGGSTLFEFDYYGSKAYLTQSSQLY 354

Query: 317 LETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVD 376
           LET LPSLGDVYCI ES+RAEKS TRRHLSEY+HLEAE+AF+ F          IC+ +D
Sbjct: 355 LETVLPSLGDVYCIQESFRAEKSLTRRHLSEYTHLEAELAFVNFKDLLDHIEDLICEVID 414

Query: 377 RVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEF 436
            +LA+    +++  L+P+FVPPQRPF+R+DY DAI+YL +H I +E+G  +  G+DI E 
Sbjct: 415 TLLADPIASEIIKNLNPEFVPPQRPFVRLDYCDAIKYLNEHGIMREDGEDHVVGDDIAEA 474

Query: 437 PERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDM 496
            ER MTDQINKPI L  FP  +K+FYMK   +    TESVDVL+PGVGEV+GGSMRISD+
Sbjct: 475 AERKMTDQINKPIMLINFPKALKSFYMKALEDAPDFTESVDVLVPGVGEVIGGSMRISDL 534

Query: 497 NELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRF 556
            EL+AGYKRE I   PYYW+TDQRKYGT EHGG+GLGVER LAW+L R  V+EC LYPR+
Sbjct: 535 EELMAGYKREDIPADPYYWFTDQRKYGTAEHGGYGLGVERCLAWILKRYTVRECSLYPRY 594

Query: 557 MGRCLP 562
           MGR  P
Sbjct: 595 MGRATP 600



>gi|327299364|ref|XP_003234375.1| asparaginyl-tRNA synthetase [Trichophyton rubrum CBS 118892]
 gi|326463269|gb|EGD88722.1| asparaginyl-tRNA synthetase [Trichophyton rubrum CBS 118892]
          Length = 580

 Score =  539 bits (1388), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/461 (56%), Positives = 327/461 (70%), Gaps = 10/461 (2%)

Query: 112 IVLKQDPNLPLAIKIKIRQS----VASRGKRVKVSG------WVHRLRTQGKDMKFIVLR 161
           +V+K+D +LP  +KI++ +     V  R +  K  G               KDM F+ L 
Sbjct: 120 VVVKEDDSLPKPVKIRLNEKDPAVVRPRAEGDKQPGTRVRVVGRVHRLRVQKDMIFLTLT 179

Query: 162 DGSGYLQCLLTGELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHH 221
           DG G LQC+ TG+L  TYDA+ L+LE+++ I+G +  +P  + APDN EL AD+++V   
Sbjct: 180 DGYGLLQCVFTGDLTKTYDAMTLTLETSMAIHGEMRAVPVKQHAPDNRELHADFFQVIGR 239

Query: 222 APGGDDAFTNKLNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEV 281
           A G  +A T ++ ADADP  L + RHLV+RGET+S+VLK R+A+++AFR  F+ K   EV
Sbjct: 240 AAGDKEAITTRVAADADPQTLLDNRHLVLRGETSSSVLKVRAAVVRAFRKTFEQKQMLEV 299

Query: 282 NPPCMVQTQVEGGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHT 341
            PP MVQTQVEGGSTLFE +YYGEKAYLTQ+SQLYLETCL SLGDV+CI  S+RAEKS T
Sbjct: 300 TPPAMVQTQVEGGSTLFEFDYYGEKAYLTQSSQLYLETCLASLGDVFCICPSFRAEKSLT 359

Query: 342 RRHLSEYSHLEAEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRP 401
           RRHLSEY+H+E+E+ FITF          IC  +D  LA+      V QL+P+F PP RP
Sbjct: 360 RRHLSEYTHIESELDFITFNDLLDHIEEIICSVIDISLADPQIAAFVKQLNPNFTPPARP 419

Query: 402 FLRMDYKDAIQYLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAF 461
           F RM Y +AI++L +H I  E    + FG+DI E  ER MTD INKPI L  FPAEIKAF
Sbjct: 420 FRRMRYSEAIEWLNEHGINNEEDKPHSFGDDIAEAAERKMTDIINKPILLTHFPAEIKAF 479

Query: 462 YMKRCAEDNRVTESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRK 521
           YMK+ AED RVTESVDVL+PGVGE+VGGSMR+ D +EL+  YK+EG++PTPYYWYTDQRK
Sbjct: 480 YMKKDAEDPRVTESVDVLMPGVGEIVGGSMRMDDWDELMGAYKKEGMDPTPYYWYTDQRK 539

Query: 522 YGTTEHGGFGLGVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           YGT+ HGG+GLG+ERFLAW+  R  V+EC LYPRF GRC P
Sbjct: 540 YGTSPHGGYGLGLERFLAWMCGRYTVRECSLYPRFTGRCTP 580



>gi|340521438|gb|EGR51672.1| hypothetical protein TRIREDRAFT_120088 [Trichoderma reesei QM6a]
          Length = 568

 Score =  538 bits (1385), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/567 (48%), Positives = 362/567 (63%), Gaps = 18/567 (3%)

Query: 13  TVYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDNISILVRK---TPEEGYKDISGTXX 68
           T+YIDE  G DE T TGT+ +PYKT   A   +      L RK   T +   K+      
Sbjct: 3   TIYIDEDVGKDEVTQTGTEESPYKTLQFAYLQRPAEGQYLTRKSQNTEDVAAKEWKPVAK 62

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKI-- 126
                                                      IV+ +DP+LP A++I  
Sbjct: 63  AALKKAVNFFEVQKKKAAKEQELVVRRKKEEEERAKALEAAKAIVITEDPSLPAAVRIGL 122

Query: 127 -------KIRQ--SVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCH 177
                  K+R+     S+G RV+V G VHR R Q KD+ F+ LRDG G++Q +++G+L  
Sbjct: 123 DEVGDHIKLRKVDDPESKGTRVRVFGRVHRERKQ-KDVMFVTLRDGYGFMQVVISGQLAK 181

Query: 178 TYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHH--APGGDDAFTNKLNA 235
           TYDA+ L+ E+++ I G + E+PAG  AP N EL AD++++  H  APGGDDA TN++ A
Sbjct: 182 TYDAVTLTRETSMEILGEMREVPAGARAPLNRELHADFFKIPKHWKAPGGDDAITNRVQA 241

Query: 236 DADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGS 295
           DA+ ++L +QRHL +RGE AS V+  R A+  AF   +    F +V+PP +VQTQVEGG+
Sbjct: 242 DAEQAMLLDQRHLTLRGEVASGVMIVRDAVEYAFNQAYKELRFRKVSPPALVQTQVEGGA 301

Query: 296 TLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEM 355
           TLF+ +YYGE AYLTQ+SQLYLETCLPS+G VYCI +S+RAEKS TRRHLSE++H+EAE+
Sbjct: 302 TLFKFDYYGEDAYLTQSSQLYLETCLPSMGHVYCIEKSFRAEKSLTRRHLSEFTHVEAEL 361

Query: 356 AFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLK 415
            FITF          +C  ++ V+A+      +  ++P+F  P+RPF+RM Y +AI +L 
Sbjct: 362 DFITFDDLLSHIEHIMCRVLELVMADPVIADKIKTMNPEFKLPERPFMRMKYSEAIDWLV 421

Query: 416 DHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTES 475
           +H+I  E G  + FG+DI E  ER MTD INKPIFL  FPAEIK+FYM +   D RVTES
Sbjct: 422 EHDIPNEEGKPHAFGDDIAEAAERRMTDIINKPIFLTHFPAEIKSFYMSKDKSDPRVTES 481

Query: 476 VDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVE 535
           VD L+PGVGE+VGGSMR+ D  EL+A YKREGI P  YYWYTDQRKYG++ HGG+GLG+E
Sbjct: 482 VDCLMPGVGEIVGGSMRMDDYEELMAAYKREGIEPEAYYWYTDQRKYGSSPHGGYGLGLE 541

Query: 536 RFLAWLLHRDNVKECCLYPRFMGRCLP 562
           RFLAWL  +  V++CCLYPR+M RC P
Sbjct: 542 RFLAWLCKQHTVRDCCLYPRYMHRCKP 568



>gi|452981270|gb|EME81030.1| hypothetical protein MYCFIDRAFT_27260 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 575

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/570 (47%), Positives = 359/570 (62%), Gaps = 20/570 (3%)

Query: 12  ETVYIDEVNGSDE-TSTGTQNAPYKTAVRALQVKGDNISILVRKTPEEGYKDI-SGTXXX 69
           +T++IDE  G D   + G+Q  PYKT   A     D    LV+K   +    +       
Sbjct: 7   QTIHIDEEVGQDTPEADGSQTKPYKTLQFAYLQHLDQAQYLVKKKENDDEPAVYKPAAKA 66

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKQDPNLPLAIKIKIR 129
                                                     I++ +D +LP A  I + 
Sbjct: 67  AMKKAVNYADQQKKKAGKEKELALRIAKEQEEREKTVAAAKSIIITEDKSLPEAKPIILD 126

Query: 130 QSVAS-RGKRVKVSGW----------------VHRLRTQGKDMKFIVLRDGSGYLQCLLT 172
            +    +  RVKV+G                 VHR R Q K++ FI LRDGSG++QC+LT
Sbjct: 127 DTRPGLKDTRVKVTGMLASKSASRTILTREGRVHRQRQQ-KELLFITLRDGSGFMQCVLT 185

Query: 173 GELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNK 232
           G L  TYDA+ L+ E+++ I+G + ++PAG  AP++ EL ADY+E+   APGG+DA TNK
Sbjct: 186 GNLAKTYDAITLTRETSMAIFGKLKDVPAGAHAPNDRELQADYFEIIGKAPGGEDAITNK 245

Query: 233 LNADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVE 292
           +    D   L +QRHL +RGE  S+V+  R A+ KAF D +D  G+ +V+PP  VQTQVE
Sbjct: 246 VQEKGDAQTLLDQRHLTLRGEERSSVMWVRHAVEKAFNDIYDELGYLKVSPPAFVQTQVE 305

Query: 293 GGSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLE 352
           GG+TLF ++YYGE AYLTQ+SQLYLET LP  G+ YCI +S+RAEKS TRRHLSEY+H+E
Sbjct: 306 GGATLFTLDYYGEPAYLTQSSQLYLETVLPFGGNTYCIEKSFRAEKSLTRRHLSEYTHVE 365

Query: 353 AEMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQ 412
           AE+ FI F          IC  ++RV+A     K++ +L+PDF  P+RPF+RM Y DAI 
Sbjct: 366 AELDFINFNDLLQHLEDMICGVLERVMARPRIAKMIKELNPDFKMPERPFMRMRYSDAID 425

Query: 413 YLKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRV 472
           +L++H I  E G  + FG+DI E  ER MTD IN+PIFL  FP EIK+FYM++  ED RV
Sbjct: 426 WLREHEIPNEEGQPHNFGDDIAEAAERKMTDIINRPIFLTHFPVEIKSFYMQKDKEDPRV 485

Query: 473 TESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGL 532
           TESVDVLIPGVGE+VGGSMR+ D +EL+A YKREG+NP PYYWYTDQR+YGT+EHGG+GL
Sbjct: 486 TESVDVLIPGVGEIVGGSMRMHDYDELMAAYKREGMNPAPYYWYTDQRRYGTSEHGGYGL 545

Query: 533 GVERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           G+ERFLAWL ++  V+ECCLYPR+M RC P
Sbjct: 546 GMERFLAWLCNQFTVRECCLYPRYMERCKP 575



>gi|315113190|pdb|2XGT|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed
           With The Sulphamoyl Analogue Of Asparaginyl-Adenylate
 gi|315113191|pdb|2XGT|B Chain B, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed
           With The Sulphamoyl Analogue Of Asparaginyl-Adenylate
          Length = 435

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 335/437 (76%), Gaps = 2/437 (0%)

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           +KIR  V  R +RV + GW+HR+R QGK + F +LRDG+G+LQ LL  +LC TYDAL ++
Sbjct: 1   VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVN 60

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
            E TV IYG I E+P GK AP+ HEL+AD+W++  +AP G     N LN +A    + + 
Sbjct: 61  TECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPG--GIDNVLNEEASVDKMLDN 118

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHLVIRGE A+A+L+ R+A  +A R+HF + G+ EV PP +VQTQVEGGSTLF ++Y+GE
Sbjct: 119 RHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGE 178

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +++LTQ+SQLYLETC+P+LGDV+CI++SYRAEKS TRRHL+EY+H+EAE  FIT      
Sbjct: 179 QSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLME 238

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CDTVDR+LA+E  +KL+  ++P F PP+RPFLRM+YKDAI++L++HN++ E G+
Sbjct: 239 KIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGN 298

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            + +GEDI E  ER MTD INKPI L RFP+EIKAFYM+R A+DN +TESVD+L+PGVGE
Sbjct: 299 TFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAQDNTLTESVDLLMPGVGE 358

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI   +EL   +K   I+P PYYWY DQR YGT  HGG+GLG+ERF+ WL + +
Sbjct: 359 IVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTN 418

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++ CLYPRF+GRC+P
Sbjct: 419 HIRDVCLYPRFVGRCVP 435



>gi|402589182|gb|EJW83114.1| asparaginyl-tRNA synthetase [Wuchereria bancrofti]
          Length = 532

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/449 (55%), Positives = 340/449 (75%), Gaps = 2/449 (0%)

Query: 114 LKQDPNLPLAIKIKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTG 173
           ++ D +L     +KIR  +  R +RV + GW+HR+R QGK + F +LRDG+G+LQ LL  
Sbjct: 86  IELDTSLSYITGLKIRDLIKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLVD 145

Query: 174 ELCHTYDALILSLESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKL 233
           +LC TYDAL ++ E TV IYG I E+P GK AP+ HEL+AD+W+V  +AP G     N L
Sbjct: 146 KLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKVIGNAPPG--GIDNVL 203

Query: 234 NADADPSILYEQRHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEG 293
           N +A    + + RHLVIRGE A+A+L+ R+A  +A R+HF + G+ EV PP +VQTQVEG
Sbjct: 204 NEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEG 263

Query: 294 GSTLFEMNYYGEKAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEA 353
           GSTLF ++Y+GE+++LTQ+SQLYLETC+PSLGDV+CI++SYRAEKS TRRHL+EY+H+EA
Sbjct: 264 GSTLFNLDYFGEQSFLTQSSQLYLETCIPSLGDVFCIAQSYRAEKSRTRRHLAEYAHVEA 323

Query: 354 EMAFITFXXXXXXXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQY 413
           E  FIT           +CDTV+R+LA+E T+KL+  ++P F  P+RPFLRM+YKDAI++
Sbjct: 324 ECPFITLDDLMEKIEELVCDTVNRLLADEETKKLLEHINPKFQTPKRPFLRMEYKDAIKW 383

Query: 414 LKDHNIKKENGSFYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVT 473
           L++HN++ E G+ + +GEDI E  ER MTD INKPI L RFP+EIKAFYM++ A+DN +T
Sbjct: 384 LQEHNVQNEFGNSFSYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQKDAQDNTLT 443

Query: 474 ESVDVLIPGVGEVVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLG 533
           ESVD+L+PGVGE+VGGSMRI   +EL   +K   I+P PYYWY DQR YG+  HGG+GLG
Sbjct: 444 ESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGSCPHGGYGLG 503

Query: 534 VERFLAWLLHRDNVKECCLYPRFMGRCLP 562
           +ERF+ WL + +++++ CLYPRF+GRC+P
Sbjct: 504 LERFICWLTNTNHIRDVCLYPRFVGRCVP 532



>gi|315113222|pdb|2XTI|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed
           With Atp:mg And L-Asp-Beta-Noh Adenylate:ppi:mg
 gi|315113223|pdb|2XTI|B Chain B, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed
           With Atp:mg And L-Asp-Beta-Noh Adenylate:ppi:mg
          Length = 437

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 335/437 (76%), Gaps = 2/437 (0%)

Query: 126 IKIRQSVASRGKRVKVSGWVHRLRTQGKDMKFIVLRDGSGYLQCLLTGELCHTYDALILS 185
           +KIR  V  R +RV + GW+HR+R QGK + F +LRDG+G+LQ LL  +LC TYDAL ++
Sbjct: 3   VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVN 62

Query: 186 LESTVTIYGVISELPAGKTAPDNHELLADYWEVNHHAPGGDDAFTNKLNADADPSILYEQ 245
            E TV IYG I E+P GK AP+ HEL+AD+W++  +AP G     N LN +A    + + 
Sbjct: 63  TECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPG--GIDNVLNEEASVDKMLDN 120

Query: 246 RHLVIRGETASAVLKARSAIMKAFRDHFDSKGFSEVNPPCMVQTQVEGGSTLFEMNYYGE 305
           RHLVIRGE A+A+L+ R+A  +A R+HF + G+ EV PP +VQTQVEGGSTLF ++Y+GE
Sbjct: 121 RHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGE 180

Query: 306 KAYLTQTSQLYLETCLPSLGDVYCISESYRAEKSHTRRHLSEYSHLEAEMAFITFXXXXX 365
           +++LTQ+SQLYLETC+P+LGDV+CI++SYRAEKS TRRHL+EY+H+EAE  FIT      
Sbjct: 181 QSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLME 240

Query: 366 XXXXXICDTVDRVLANETTRKLVYQLHPDFVPPQRPFLRMDYKDAIQYLKDHNIKKENGS 425
                +CDTVDR+LA+E  +KL+  ++P F PP+RPFLRM+YKDAI++L++HN++ E G+
Sbjct: 241 KIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGN 300

Query: 426 FYEFGEDIPEFPERTMTDQINKPIFLCRFPAEIKAFYMKRCAEDNRVTESVDVLIPGVGE 485
            + +GEDI E  ER MTD INKPI L RFP+EIKAFYM+R A+DN +TESVD+L+PGVGE
Sbjct: 301 TFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGVGE 360

Query: 486 VVGGSMRISDMNELLAGYKREGINPTPYYWYTDQRKYGTTEHGGFGLGVERFLAWLLHRD 545
           +VGGSMRI   +EL   +K   I+P PYYWY DQR YGT  HGG+GLG+ERF+ WL + +
Sbjct: 361 IVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTN 420

Query: 546 NVKECCLYPRFMGRCLP 562
           ++++ CLYPRF+GRC+P
Sbjct: 421 HIRDVCLYPRFVGRCVP 437