BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10121_c0_seq1-m.41 complete 111-1109(+) 333 (+)
         (332 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511004855|gb|EPB86213.1| hypothetical protein HMPREF1544_0702...   327   4e-87   Mucor circinelloides f. circinelloides 1006PhL
gi|344229701|gb|EGV61586.1| mitochondrial carrier [Candida tenui...   314   2e-83   Candida tenuis ATCC 10573
gi|406606333|emb|CCH42324.1| Mitochondrial oxaloacetate transpor...   305   9e-81   Wickerhamomyces ciferrii
gi|328773408|gb|EGF83445.1| hypothetical protein BATDEDRAFT_1855...   303   5e-80   Batrachochytrium dendrobatidis JAM81
gi|384485501|gb|EIE77681.1| hypothetical protein RO3G_02385 [Rhi...   302   1e-79   Rhizopus delemar RA 99-880
gi|190348372|gb|EDK40814.2| hypothetical protein PGUG_04912 [Mey...   300   3e-79   Meyerozyma guilliermondii ATCC 6260
gi|238881020|gb|EEQ44658.1| mitochondrial oxaloacetate transport...   299   6e-79   Candida albicans WO-1
gi|68479814|ref|XP_716076.1| potential mitochondrial oxaloacetat...   299   7e-79   Candida albicans SC5314
gi|344301423|gb|EGW31735.1| mitochondrial oxaloacetate carrier p...   299   7e-79   Spathaspora passalidarum NRRL Y-27907
gi|241953613|ref|XP_002419528.1| mitochondrial inner membrane ox...   299   9e-79   Candida dubliniensis CD36
gi|459371346|gb|EMG49163.1| Mitochondrial oxaloacetate transport...   298   1e-78   Candida maltosa Xu316
gi|336370935|gb|EGN99275.1| hypothetical protein SERLA73DRAFT_18...   298   2e-78   Serpula lacrymans var. lacrymans S7.3
gi|146413973|ref|XP_001482957.1| hypothetical protein PGUG_04912...   298   2e-78   Meyerozyma guilliermondii ATCC 6260
gi|149240559|ref|XP_001526155.1| mitochondrial oxaloacetate tran...   296   5e-78   Lodderomyces elongisporus NRRL YB-4239
gi|19114081|ref|NP_593169.1| mitochondrial anion transporter (pr...   295   1e-77   Schizosaccharomyces pombe 972h-
gi|255726032|ref|XP_002547942.1| mitochondrial oxaloacetate tran...   295   1e-77   Candida tropicalis MYA-3404
gi|50304305|ref|XP_452102.1| hypothetical protein [Kluyveromyces...   294   2e-77   Kluyveromyces lactis NRRL Y-1140
gi|392570952|gb|EIW64124.1| mitochondrial carrier [Trametes vers...   291   2e-76   Trametes versicolor FP-101664 SS1
gi|390604510|gb|EIN13901.1| oxaloacetate carrier [Punctularia st...   290   3e-76   Punctularia strigosozonata HHB-11173 SS5
gi|346320702|gb|EGX90302.1| mitochondrial oxaloacetate transport...   290   4e-76   Cordyceps militaris CM01
gi|378726204|gb|EHY52663.1| MC family mitochondrial carrier prot...   289   6e-76   Exophiala dermatitidis NIH/UT8656
gi|315041981|ref|XP_003170367.1| hypothetical protein MGYG_07611...   289   7e-76   Microsporum gypseum CBS 118893
gi|366987239|ref|XP_003673386.1| hypothetical protein NCAS_0A044...   289   8e-76   Naumovozyma castellii CBS 4309
gi|326472582|gb|EGD96591.1| mitochondrial oxaloacetate transport...   289   8e-76   Trichophyton tonsurans CBS 112818
gi|346972028|gb|EGY15480.1| mitochondrial oxaloacetate transport...   289   9e-76   Verticillium dahliae VdLs.17
gi|327298817|ref|XP_003234102.1| mitochondrial oxaloacetate tran...   289   9e-76   Trichophyton rubrum CBS 118892
gi|213402339|ref|XP_002171942.1| mitochondrial oxaloacetate tran...   288   1e-75   Schizosaccharomyces japonicus yFS275
gi|448522354|ref|XP_003868665.1| Oac1 mitochondrial inner membra...   288   1e-75   Candida orthopsilosis Co 90-125
gi|326483607|gb|EGE07617.1| mitochondrial carrier protein [Trich...   287   2e-75   Trichophyton equinum CBS 127.97
gi|406867402|gb|EKD20440.1| hypothetical protein MBM_01122 [Mars...   287   3e-75   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|354547906|emb|CCE44641.1| hypothetical protein CPAR2_404450 [...   287   3e-75   Candida parapsilosis
gi|512204900|gb|EPE33722.1| Mitochondrial carrier [Glarea lozoye...   287   3e-75   Glarea lozoyensis ATCC 20868
gi|259489744|tpe|CBF90267.1| TPA: mitochondrial oxaloacetate tra...   287   3e-75   Aspergillus nidulans FGSC A4
gi|296420153|ref|XP_002839645.1| hypothetical protein [Tuber mel...   287   3e-75   Tuber melanosporum Mel28
gi|296809812|ref|XP_002845244.1| mitochondrial oxaloacetate tran...   286   4e-75   Arthroderma otae CBS 113480
gi|399166904|emb|CCE32261.1| probable oxaloacetate/sulfate carri...   286   4e-75   Claviceps purpurea 20.1
gi|426201239|gb|EKV51162.1| hypothetical protein AGABI2DRAFT_113...   286   5e-75   Agaricus bisporus var. bisporus H97
gi|302697945|ref|XP_003038651.1| hypothetical protein SCHCODRAFT...   286   6e-75   Schizophyllum commune H4-8
gi|320583856|gb|EFW98069.1| mitochondrial inner membrane oxaloac...   286   7e-75   
gi|477529411|gb|ENH81175.1| mitochondrial oxaloacetate transport...   285   1e-74   Colletotrichum orbiculare MAFF 240422
gi|367026732|ref|XP_003662650.1| hypothetical protein MYCTH_2303...   285   1e-74   Myceliophthora thermophila ATCC 42464
gi|449541678|gb|EMD32661.1| hypothetical protein CERSUDRAFT_1186...   285   1e-74   Gelatoporia subvermispora B
gi|367051110|ref|XP_003655934.1| hypothetical protein THITE_2120...   285   1e-74   Thielavia terrestris NRRL 8126
gi|400598876|gb|EJP66583.1| mitochondrial oxaloacetate transport...   285   1e-74   Beauveria bassiana ARSEF 2860
gi|470298577|ref|XP_004346210.1| solute carrier family 25 member...   284   2e-74   Capsaspora owczarzaki ATCC 30864
gi|395334874|gb|EJF67250.1| mitochondrial carrier [Dichomitus sq...   284   2e-74   Dichomitus squalens LYAD-421 SS1
gi|225684488|gb|EEH22772.1| mitochondrial oxaloacetate transport...   284   3e-74   Paracoccidioides brasiliensis Pb03
gi|365759749|gb|EHN01523.1| Oac1p [Saccharomyces cerevisiae x Sa...   284   3e-74   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|345568473|gb|EGX51367.1| hypothetical protein AOL_s00054g437 ...   283   4e-74   Arthrobotrys oligospora ATCC 24927
gi|225561745|gb|EEH10025.1| mitochondrial carrier protein [Ajell...   283   4e-74   Histoplasma capsulatum G186AR
gi|6322729|ref|NP_012802.1| Oac1p [Saccharomyces cerevisiae S288...   283   4e-74   Saccharomyces cerevisiae S288c
gi|170084397|ref|XP_001873422.1| predicted protein [Laccaria bic...   283   4e-74   Laccaria bicolor S238N-H82
gi|85109231|ref|XP_962817.1| mitochondrial oxaloacetate transpor...   283   7e-74   Neurospora crassa OR74A
gi|340905395|gb|EGS17763.1| putative mitochondrial oxaloacetate ...   282   8e-74   Chaetomium thermophilum var. thermophilum DSM 1495
gi|116191723|ref|XP_001221674.1| conserved hypothetical protein ...   282   1e-73   Chaetomium globosum CBS 148.51
gi|451995320|gb|EMD87788.1| hypothetical protein COCHEDRAFT_1216...   282   1e-73   Bipolaris maydis C5
gi|451851871|gb|EMD65169.1| hypothetical protein COCSADRAFT_3650...   281   1e-73   Bipolaris sorokiniana ND90Pr
gi|482808880|gb|EOA85746.1| hypothetical protein SETTUDRAFT_1700...   281   1e-73   Setosphaeria turcica Et28A
gi|389639062|ref|XP_003717164.1| mitochondrial oxaloacetate tran...   281   2e-73   Magnaporthe oryzae 70-15
gi|303314519|ref|XP_003067268.1| Mitochondrial oxaloacetate tran...   281   2e-73   Coccidioides posadasii C735 delta SOWgp
gi|330919985|ref|XP_003298840.1| hypothetical protein PTT_09667 ...   281   2e-73   Pyrenophora teres f. teres 0-1
gi|392597661|gb|EIW86983.1| mitochondrial carrier [Coniophora pu...   281   2e-73   Coniophora puteana RWD-64-598 SS2
gi|150864378|ref|XP_001383163.2| Mitochondrial oxaloacetate carr...   281   2e-73   Scheffersomyces stipitis CBS 6054
gi|365991503|ref|XP_003672580.1| hypothetical protein NDAI_0K014...   280   3e-73   Naumovozyma dairenensis CBS 421
gi|320037570|gb|EFW19507.1| mitochondrial oxaloacetate transport...   280   3e-73   Coccidioides posadasii str. Silveira
gi|410079018|ref|XP_003957090.1| hypothetical protein KAFR_0D030...   280   3e-73   Kazachstania africana CBS 2517
gi|448097467|ref|XP_004198681.1| Piso0_002065 [Millerozyma farin...   280   4e-73   Millerozyma farinosa CBS 7064
gi|448101309|ref|XP_004199529.1| Piso0_002065 [Millerozyma farin...   280   5e-73   Millerozyma farinosa CBS 7064
gi|402222803|gb|EJU02869.1| mitochondrial carrier [Dacryopinax s...   280   5e-73   Dacryopinax primogenitus
gi|327356920|gb|EGE85777.1| mitochondrial carrier protein [Ajell...   279   7e-73   Blastomyces dermatitidis ATCC 18188
gi|401624919|gb|EJS42956.1| oac1p [Saccharomyces arboricola H-6]      279   7e-73   Saccharomyces arboricola H-6
gi|501751269|emb|CCG84429.1| protein of unknown function [Taphri...   279   8e-73   Taphrina deformans PYCC 5710
gi|189198924|ref|XP_001935799.1| mitochondrial dicarboxylate tra...   279   8e-73   Pyrenophora tritici-repentis Pt-1C-BFP
gi|242777630|ref|XP_002479073.1| mitochondrial oxaloacetate tran...   279   9e-73   Talaromyces stipitatus ATCC 10500
gi|471568228|gb|EMR67945.1| putative mitochondrial oxaloacetate ...   279   9e-73   Eutypa lata UCREL1
gi|212533261|ref|XP_002146787.1| mitochondrial oxaloacetate tran...   278   1e-72   Talaromyces marneffei ATCC 18224
gi|119174778|ref|XP_001239724.1| hypothetical protein CIMG_09345...   278   1e-72   Coccidioides immitis RS
gi|347826872|emb|CCD42569.1| similar to mitochondrial oxaloaceta...   277   2e-72   Botrytis cinerea T4
gi|405123239|gb|AFR98004.1| oxaloacetate carrier [Cryptococcus n...   277   2e-72   Cryptococcus neoformans var. grubii H99
gi|401885777|gb|EJT49865.1| hypothetical protein A1Q1_01017 [Tri...   277   3e-72   Trichosporon asahii var. asahii CBS 2479
gi|440635324|gb|ELR05243.1| hypothetical protein GMDG_01681 [Geo...   277   3e-72   Pseudogymnoascus destructans 20631-21
gi|512187502|gb|EPE03281.1| mitochondrial oxaloacetate transport...   277   4e-72   Ophiostoma piceae UAMH 11346
gi|408392876|gb|EKJ72165.1| hypothetical protein FPSE_07652 [Fus...   276   4e-72   Fusarium pseudograminearum CS3096
gi|46122073|ref|XP_385590.1| hypothetical protein FG05414.1 [Fus...   276   5e-72   
gi|134109639|ref|XP_776498.1| hypothetical protein CNBC4240 [Cry...   276   6e-72   Cryptococcus neoformans var. neoformans B-3501A
gi|171687068|ref|XP_001908475.1| hypothetical protein [Podospora...   276   7e-72   Podospora anserina S mat+
gi|255954085|ref|XP_002567795.1| Pc21g07550 [Penicillium chrysog...   276   7e-72   Penicillium rubens Wisconsin 54-1255
gi|255713308|ref|XP_002552936.1| KLTH0D04928p [Lachancea thermot...   276   8e-72   Lachancea thermotolerans CBS 6340
gi|254565221|ref|XP_002489721.1| Mitochondrial inner membrane tr...   275   1e-71   Komagataella phaffii GS115
gi|50292577|ref|XP_448721.1| hypothetical protein [Candida glabr...   275   1e-71   Candida glabrata CBS 138
gi|260946966|ref|XP_002617780.1| hypothetical protein CLUG_01239...   275   1e-71   Clavispora lusitaniae ATCC 42720
gi|321253695|ref|XP_003192820.1| mitochondrial inner membrane tr...   275   2e-71   Cryptococcus gattii WM276
gi|367008538|ref|XP_003678770.1| hypothetical protein TDEL_0A022...   274   2e-71   Torulaspora delbrueckii
gi|58265578|ref|XP_569945.1| oxaloacetate carrier [Cryptococcus ...   274   3e-71   Cryptococcus neoformans var. neoformans JEC21
gi|402079102|gb|EJT74367.1| mitochondrial oxaloacetate transport...   273   5e-71   Gaeumannomyces graminis var. tritici R3-111a-1
gi|358057236|dbj|GAA96845.1| hypothetical protein E5Q_03518 [Mix...   273   5e-71   Mixia osmundae IAM 14324
gi|325091190|gb|EGC44500.1| mitochondrial carrier protein [Ajell...   273   6e-71   Histoplasma capsulatum H88
gi|475673200|gb|EMT70323.1| Mitochondrial oxaloacetate transport...   273   6e-71   Fusarium oxysporum f. sp. cubense race 4
gi|299756290|ref|XP_001829225.2| oxaloacetate carrier [Coprinops...   273   6e-71   Coprinopsis cinerea okayama7#130
gi|342870148|gb|EGU73445.1| hypothetical protein FOXB_16083 [Fus...   273   6e-71   Fusarium oxysporum Fo5176
gi|240275352|gb|EER38866.1| mitochondrial carrier protein [Ajell...   273   7e-71   Histoplasma capsulatum H143
gi|485917842|gb|EOD44647.1| putative mitochondrial oxaloacetate ...   272   8e-71   Neofusicoccum parvum UCRNP2
gi|363749589|ref|XP_003645012.1| hypothetical protein Ecym_2469 ...   272   9e-71   Eremothecium cymbalariae DBVPG#7215
gi|115387425|ref|XP_001211218.1| mitochondrial oxaloacetate tran...   271   1e-70   Aspergillus terreus NIH2624
gi|261189557|ref|XP_002621189.1| mitochondrial oxaloacetate tran...   271   2e-70   Blastomyces gilchristii SLH14081
gi|328350140|emb|CCA36540.1| Uncharacterized WD repeat-containin...   271   2e-70   Komagataella phaffii CBS 7435
gi|294656293|ref|XP_458551.2| DEHA2D01914p [Debaryomyces hanseni...   270   3e-70   Debaryomyces hansenii CBS767
gi|156849205|ref|XP_001647483.1| hypothetical protein Kpol_1018p...   270   3e-70   Vanderwaltozyma polyspora DSM 70294
gi|449302144|gb|EMC98153.1| hypothetical protein BAUCODRAFT_6740...   270   5e-70   Baudoinia panamericana UAMH 10762
gi|429863481|gb|ELA37932.1| mitochondrial oxaloacetate transport...   270   5e-70   Colletotrichum gloeosporioides Nara gc5
gi|358397916|gb|EHK47284.1| hypothetical protein TRIATDRAFT_1288...   270   5e-70   Trichoderma atroviride IMI 206040
gi|407923325|gb|EKG16398.1| Mitochondrial substrate/solute carri...   269   7e-70   Macrophomina phaseolina MS6
gi|393218320|gb|EJD03808.1| oxaloacetate carrier [Fomitiporia me...   269   8e-70   Fomitiporia mediterranea MF3/22
gi|169779221|ref|XP_001824075.1| oxaloacetate transport protein ...   269   1e-69   Aspergillus oryzae RIB40
gi|50552101|ref|XP_503525.1| YALI0E04048p [Yarrowia lipolytica] ...   268   1e-69   Yarrowia lipolytica CLIB122
gi|494834339|gb|EON69988.1| hypothetical protein W97_09254 [Coni...   268   1e-69   Coniosporium apollinis CBS 100218
gi|302904126|ref|XP_003049008.1| predicted protein [Nectria haem...   268   2e-69   Nectria haematococca mpVI 77-13-4
gi|350639698|gb|EHA28052.1| hypothetical protein ASPNIDRAFT_4199...   268   2e-69   Aspergillus niger ATCC 1015
gi|317034851|ref|XP_001401309.2| oxaloacetate transport protein ...   267   2e-69   Aspergillus niger CBS 513.88
gi|340522217|gb|EGR52450.1| mitochondrial oxaloacetate/sulfate/t...   267   3e-69   Trichoderma reesei QM6a
gi|452846107|gb|EME48040.1| hypothetical protein DOTSEDRAFT_6984...   267   3e-69   Dothistroma septosporum NZE10
gi|70997333|ref|XP_753416.1| mitochondrial oxaloacetate transpor...   267   3e-69   Aspergillus fumigatus Af293
gi|159126857|gb|EDP51973.1| mitochondrial oxaloacetate transport...   267   3e-69   Aspergillus fumigatus A1163
gi|121713830|ref|XP_001274526.1| mitochondrial carrier protein [...   267   4e-69   Aspergillus clavatus NRRL 1
gi|392576958|gb|EIW70088.1| hypothetical protein TREMEDRAFT_3875...   267   4e-69   Tremella mesenterica DSM 1558
gi|358383614|gb|EHK21278.1| hypothetical protein TRIVIDRAFT_7035...   266   4e-69   Trichoderma virens Gv29-8
gi|367003573|ref|XP_003686520.1| hypothetical protein TPHA_0G025...   266   4e-69   Tetrapisispora phaffii CBS 4417
gi|353240749|emb|CCA72603.1| related to OAC1-similarity to mitoc...   266   4e-69   Serendipita indica DSM 11827
gi|254585099|ref|XP_002498117.1| ZYRO0G02640p [Zygosaccharomyces...   266   5e-69   Zygosaccharomyces rouxii CBS 732
gi|358374796|dbj|GAA91385.1| mitochondrial oxaloacetate transpor...   266   6e-69   Aspergillus kawachii IFO 4308
gi|388583393|gb|EIM23695.1| mitochondrial carrier [Wallemia sebi...   264   2e-68   Wallemia mellicola CBS 633.66
gi|398407773|ref|XP_003855352.1| hypothetical protein MYCGRDRAFT...   264   3e-68   Zymoseptoria tritici IPO323
gi|410915630|ref|XP_003971290.1| PREDICTED: solute carrier famil...   263   4e-68   Takifugu rubripes [tiger puffer]
gi|320585799|gb|EFW98478.1| mitochondrial oxaloacetate transport...   263   6e-68   Grosmannia clavigera kw1407
gi|396476075|ref|XP_003839930.1| similar to mitochondrial oxaloa...   262   1e-67   Leptosphaeria maculans JN3
gi|409052124|gb|EKM61600.1| hypothetical protein PHACADRAFT_2047...   261   2e-67   Phanerochaete carnosa HHB-10118-sp
gi|385304626|gb|EIF48636.1| mitochondrial oxaloacetate transport...   260   3e-67   Brettanomyces bruxellensis AWRI1499
gi|389751818|gb|EIM92891.1| oxaloacetate carrier [Stereum hirsut...   260   3e-67   Stereum hirsutum FP-91666 SS1
gi|67515569|ref|XP_657670.1| hypothetical protein AN0066.2 [Aspe...   259   5e-67   Aspergillus nidulans FGSC A4
gi|470443137|ref|XP_004339616.1| solute carrier family protein [...   259   8e-67   Acanthamoeba castellanii str. Neff
gi|150832499|ref|NP_001092917.1| solute carrier family 25 member...   259   8e-67   Danio rerio [leopard danio]
gi|452985895|gb|EME85651.1| hypothetical protein MYCFIDRAFT_6495...   258   1e-66   Cercospora fijiensis CIRAD86
gi|453087039|gb|EMF15080.1| mitochondrial dicarboxylate transpor...   258   2e-66   Sphaerulina musiva SO2202
gi|403213793|emb|CCK68295.1| hypothetical protein KNAG_0A06360 [...   258   2e-66   Kazachstania naganishii CBS 8797
gi|390355037|ref|XP_782823.3| PREDICTED: solute carrier family 2...   256   4e-66   Strongylocentrotus purpuratus [purple urchin]
gi|426237575|ref|XP_004012733.1| PREDICTED: solute carrier famil...   256   6e-66   Ovis aries [domestic sheep]
gi|505755572|gb|EOQ99779.1| hypothetical protein J056_001611 [Wa...   256   8e-66   Wallemia ichthyophaga EXF-994
gi|331212363|ref|XP_003307451.1| hypothetical protein PGTG_00401...   256   9e-66   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|393240380|gb|EJD47906.1| oxaloacetate carrier [Auricularia de...   255   1e-65   Auricularia subglabra TFB-10046 SS5
gi|348560818|ref|XP_003466210.1| PREDICTED: solute carrier famil...   253   5e-65   Cavia porcellus [guinea pig]
gi|472357784|ref|XP_004398518.1| PREDICTED: solute carrier famil...   253   7e-65   Odobenus rosmarus divergens
gi|73955699|ref|XP_546609.2| PREDICTED: solute carrier family 25...   252   8e-65   
gi|310798397|gb|EFQ33290.1| hypothetical protein GLRG_08434 [Glo...   252   1e-64   Colletotrichum graminicola M1.001
gi|410979915|ref|XP_003996326.1| PREDICTED: solute carrier famil...   251   2e-64   
gi|511880734|ref|XP_004760268.1| PREDICTED: solute carrier famil...   251   2e-64   Mustela putorius furo [black ferret]
gi|336371156|gb|EGN99496.1| hypothetical protein SERLA73DRAFT_18...   251   2e-64   Serpula lacrymans var. lacrymans S7.3
gi|322709427|gb|EFZ01003.1| mitochondrial oxaloacetate transport...   251   2e-64   Metarhizium robertsii ARSEF 23
gi|405950433|gb|EKC18423.1| Solute carrier family 25 member 35 [...   251   3e-64   Crassostrea gigas
gi|465992264|ref|XP_004266913.1| PREDICTED: solute carrier famil...   250   4e-64   Orcinus orca [Orca]
gi|507953699|ref|XP_004684669.1| PREDICTED: solute carrier famil...   250   4e-64   Condylura cristata
gi|126309124|ref|XP_001368207.1| PREDICTED: solute carrier famil...   250   4e-64   Monodelphis domestica
gi|507674880|ref|XP_004638510.1| PREDICTED: solute carrier famil...   249   7e-64   Octodon degus
gi|343403810|ref|NP_001230286.1| solute carrier family 25, membe...   249   7e-64   Sus scrofa [pigs]
gi|440486444|gb|ELQ66307.1| mitochondrial oxaloacetate transport...   249   8e-64   Magnaporthe oryzae P131
gi|428178958|gb|EKX47831.1| hypothetical protein GUITHDRAFT_1625...   249   8e-64   Guillardia theta CCMP2712
gi|323354053|gb|EGA85899.1| Oac1p [Saccharomyces cerevisiae VL3]      249   9e-64   Saccharomyces cerevisiae VL3
gi|354469608|ref|XP_003497219.1| PREDICTED: solute carrier famil...   248   2e-63   Cricetulus griseus [Chinese hamsters]
gi|74222819|dbj|BAE42267.1| unnamed protein product [Mus musculus]    248   2e-63   Mus musculus [mouse]
gi|291236157|ref|XP_002737995.1| PREDICTED: solute carrier famil...   248   2e-63   Saccoglossus kowalevskii
gi|21312550|ref|NP_082324.1| solute carrier family 25 member 35 ...   248   2e-63   Mus musculus [mouse]
gi|478517832|ref|XP_004433147.1| PREDICTED: solute carrier famil...   248   2e-63   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|157817424|ref|NP_001102503.1| solute carrier family 25 member...   247   3e-63   Rattus norvegicus [brown rat]
gi|291405075|ref|XP_002719057.1| PREDICTED: solute carrier famil...   247   3e-63   Oryctolagus cuniculus [European rabbit]
gi|395533504|ref|XP_003768798.1| PREDICTED: solute carrier famil...   246   4e-63   
gi|507558954|ref|XP_004663211.1| PREDICTED: solute carrier famil...   246   4e-63   Jaculus jaculus
gi|504170453|ref|XP_004594818.1| PREDICTED: solute carrier famil...   246   4e-63   Ochotona princeps [southern American pika]
gi|328862416|gb|EGG11517.1| hypothetical protein MELLADRAFT_3333...   244   2e-62   Melampsora larici-populina 98AG31
gi|432899448|ref|XP_004076563.1| PREDICTED: solute carrier famil...   244   3e-62   
gi|119478851|ref|XP_001259461.1| mitochondrial carrier protein [...   243   8e-62   Aspergillus fischeri NRRL 181
gi|47222526|emb|CAG02891.1| unnamed protein product [Tetraodon n...   242   1e-61   Tetraodon nigroviridis
gi|196007096|ref|XP_002113414.1| hypothetical protein TRIADDRAFT...   241   1e-61   Trichoplax adhaerens
gi|91091348|ref|XP_972245.1| PREDICTED: similar to predicted pro...   241   2e-61   Tribolium castaneum [rust-red flour beetle]
gi|472588449|gb|EMS25921.1| oxaloacetate carrier [Rhodosporidium...   241   2e-61   Rhodotorula toruloides NP11
gi|431894046|gb|ELK03852.1| Solute carrier family 25 member 35 [...   241   2e-61   Pteropus alecto
gi|134081994|emb|CAK46679.1| unnamed protein product [Aspergillu...   240   5e-61   Aspergillus niger
gi|343424789|emb|CBQ68327.1| related to OAC1-similarity to mitoc...   239   9e-61   Sporisorium reilianum SRZ2
gi|388855924|emb|CCF50499.1| related to OAC1-similarity to mitoc...   238   1e-60   Ustilago hordei
gi|260841807|ref|XP_002614102.1| hypothetical protein BRAFLDRAFT...   238   2e-60   Branchiostoma floridae
gi|170051686|ref|XP_001861878.1| mitochondrial carrier protein [...   237   3e-60   Culex quinquefasciatus
gi|383850008|ref|XP_003700620.1| PREDICTED: solute carrier famil...   237   3e-60   Megachile rotundata
gi|126328973|ref|XP_001377422.1| PREDICTED: solute carrier famil...   237   4e-60   Monodelphis domestica
gi|156379531|ref|XP_001631510.1| predicted protein [Nematostella...   237   4e-60   Nematostella vectensis
gi|321478911|gb|EFX89867.1| hypothetical protein DAPPUDRAFT_1897...   237   4e-60   Daphnia pulex
gi|156545453|ref|XP_001606805.1| PREDICTED: solute carrier famil...   236   6e-60   
gi|322693760|gb|EFY85609.1| mitochondrial oxaloacetate transport...   236   7e-60   Metarhizium acridum CQMa 102
gi|432959025|ref|XP_004086151.1| PREDICTED: solute carrier famil...   236   9e-60   Oryzias latipes [Japanese rice fish]
gi|488541786|ref|XP_004462479.1| PREDICTED: solute carrier famil...   235   1e-59   Dasypus novemcinctus
gi|425772245|gb|EKV10656.1| Mitochondrial oxaloacetate transport...   235   1e-59   Penicillium digitatum Pd1
gi|507690763|ref|XP_004712990.1| PREDICTED: solute carrier famil...   235   2e-59   Echinops telfairi [lesser hedgehog tenrec]
gi|240849523|ref|NP_001155734.1| solute carrier family 25 member...   234   2e-59   Acyrthosiphon pisum
gi|13435410|gb|AAH04569.1| Slc25a35 protein, partial [Mus musculus]   234   2e-59   Mus musculus [mouse]
gi|507547026|ref|XP_004657416.1| PREDICTED: solute carrier famil...   233   4e-59   Jaculus jaculus
gi|325190793|emb|CCA25283.1| Mitochondrial Carrier (MC) Family p...   233   4e-59   Albugo laibachii Nc14
gi|432105643|gb|ELK31837.1| Solute carrier family 25 member 35 [...   233   5e-59   Myotis davidii
gi|149724291|ref|XP_001504869.1| PREDICTED: solute carrier famil...   233   5e-59   Equus caballus [domestic horse]
gi|505787016|ref|XP_004604896.1| PREDICTED: solute carrier famil...   233   5e-59   Sorex araneus [Eurasian shrew]
gi|410966066|ref|XP_003989559.1| PREDICTED: solute carrier famil...   233   5e-59   Felis catus [cat]
gi|312375733|gb|EFR23044.1| hypothetical protein AND_13778 [Anop...   233   6e-59   
gi|501306825|dbj|GAC95824.1| hypothetical protein PHSY_003401 [P...   233   7e-59   Pseudozyma hubeiensis SY62
gi|410919699|ref|XP_003973321.1| PREDICTED: solute carrier famil...   232   1e-58   Takifugu rubripes [tiger puffer]
gi|71019273|ref|XP_759867.1| hypothetical protein UM03720.1 [Ust...   231   2e-58   
gi|471371094|ref|XP_004376055.1| PREDICTED: solute carrier famil...   231   2e-58   Trichechus manatus latirostris
gi|348538736|ref|XP_003456846.1| PREDICTED: solute carrier famil...   231   2e-58   Oreochromis niloticus
gi|443896892|dbj|GAC74235.1| mitochondrial oxaloacetate carrier ...   231   2e-58   Moesziomyces antarcticus T-34
gi|472355008|ref|XP_004397160.1| PREDICTED: solute carrier famil...   231   3e-58   Odobenus rosmarus divergens
gi|157123356|ref|XP_001660132.1| mitochondrial carrier protein [...   231   3e-58   Aedes aegypti
gi|156545451|ref|XP_001606794.1| PREDICTED: solute carrier famil...   230   4e-58   
gi|73950866|ref|XP_852142.1| PREDICTED: solute carrier family 25...   230   5e-58   Canis lupus familiaris [dogs]
gi|444722899|gb|ELW63571.1| Solute carrier family 25 member 35 [...   229   6e-58   Tupaia chinensis
gi|281200634|gb|EFA74852.1| transmembrane protein [Polysphondyli...   229   6e-58   Polysphondylium pallidum PN500
gi|322798634|gb|EFZ20238.1| hypothetical protein SINV_09639 [Sol...   229   6e-58   Solenopsis invicta [imported red fire ant]
gi|507656050|ref|XP_004705222.1| PREDICTED: solute carrier famil...   229   6e-58   Echinops telfairi [lesser hedgehog tenrec]
gi|402898692|ref|XP_003912354.1| PREDICTED: solute carrier famil...   229   7e-58   Papio anubis [Doguera baboon]
gi|307199076|gb|EFN79786.1| Solute carrier family 25 member 35 [...   228   1e-57   Harpegnathos saltator
gi|340721448|ref|XP_003399132.1| PREDICTED: solute carrier famil...   228   1e-57   Bombus terrestris [large earth bumblebee]
gi|332251126|ref|XP_003274698.1| PREDICTED: solute carrier famil...   228   1e-57   Nomascus leucogenys [White-cheeked Gibbon]
gi|213982847|ref|NP_001135591.1| solute carrier family 25, membe...   228   2e-57   Xenopus tropicalis [western clawed frog]
gi|47229661|emb|CAG06857.1| unnamed protein product [Tetraodon n...   227   3e-57   Tetraodon nigroviridis
gi|402853053|ref|XP_003891218.1| PREDICTED: solute carrier famil...   227   4e-57   Papio anubis [Doguera baboon]
gi|443694826|gb|ELT95862.1| hypothetical protein CAPTEDRAFT_1746...   227   4e-57   Capitella teleta
gi|397494497|ref|XP_003818112.1| PREDICTED: solute carrier famil...   226   5e-57   Pan paniscus [bonobo]
gi|108997750|ref|XP_001083788.1| PREDICTED: solute carrier famil...   226   5e-57   
gi|157118162|ref|XP_001659038.1| mitochondrial carrier protein [...   226   5e-57   Aedes aegypti
gi|327285119|ref|XP_003227282.1| PREDICTED: solute carrier famil...   226   5e-57   Anolis carolinensis [Carolina anole]
gi|511833644|ref|XP_004741463.1| PREDICTED: solute carrier famil...   226   7e-57   Mustela putorius furo [black ferret]
gi|426384076|ref|XP_004058602.1| PREDICTED: solute carrier famil...   226   7e-57   Gorilla gorilla gorilla [lowland gorilla]
gi|391339564|ref|XP_003744118.1| PREDICTED: solute carrier famil...   226   8e-57   Metaseiulus occidentalis
gi|471378956|ref|XP_004377279.1| PREDICTED: solute carrier famil...   226   8e-57   Trichechus manatus latirostris
gi|380010913|ref|XP_003689560.1| PREDICTED: solute carrier famil...   226   9e-57   
gi|336271373|ref|XP_003350445.1| hypothetical protein SMAC_02158...   226   9e-57   Sordaria macrospora k-hell
gi|355691876|gb|EHH27061.1| hypothetical protein EGK_17170 [Maca...   226   1e-56   Macaca mulatta [rhesus macaque]
gi|391339566|ref|XP_003744119.1| PREDICTED: solute carrier famil...   225   1e-56   Metaseiulus occidentalis
gi|242021883|ref|XP_002431372.1| mitochondrial 2-oxoglutarate/ma...   225   1e-56   Pediculus humanus corporis [human body lice]
gi|91091346|ref|XP_972193.1| PREDICTED: similar to predicted pro...   225   1e-56   Tribolium castaneum [rust-red flour beetle]
gi|170031030|ref|XP_001843390.1| mitochondrial oxaloacetate tran...   225   1e-56   Culex quinquefasciatus
gi|121942600|sp|Q3KQZ1.1|S2535_HUMAN RecName: Full=Solute carrie...   225   1e-56   Homo sapiens [man]
gi|347963462|ref|XP_310872.5| AGAP000253-PA [Anopheles gambiae s...   225   1e-56   Anopheles gambiae str. PEST
gi|301772098|ref|XP_002921464.1| PREDICTED: solute carrier famil...   225   1e-56   Ailuropoda melanoleuca
gi|500262142|gb|EOO04413.1| putative mitochondrial oxaloacetate ...   224   2e-56   Phaeoacremonium minimum UCRPA7
gi|158285973|ref|XP_308547.4| AGAP007255-PA [Anopheles gambiae s...   224   3e-56   Anopheles gambiae str. PEST
gi|449677069|ref|XP_002162676.2| PREDICTED: solute carrier famil...   224   3e-56   
gi|55586019|ref|XP_524516.1| PREDICTED: solute carrier family 25...   224   3e-56   Pan troglodytes
gi|226294146|gb|EEH49566.1| mitochondrial oxaloacetate transport...   224   4e-56   
gi|167517845|ref|XP_001743263.1| hypothetical protein [Monosiga ...   223   4e-56   Monosiga brevicollis MX1
gi|297666340|ref|XP_002811486.1| PREDICTED: solute carrier famil...   223   5e-56   Pongo abelii [Orang-utan]
gi|344282871|ref|XP_003413196.1| PREDICTED: solute carrier famil...   223   5e-56   Loxodonta africana [African bush elephant]
gi|478502718|ref|XP_004425668.1| PREDICTED: solute carrier famil...   223   6e-56   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|295670493|ref|XP_002795794.1| mitochondrial oxaloacetate tran...   223   7e-56   
gi|332261903|ref|XP_003280005.1| PREDICTED: solute carrier famil...   223   7e-56   Nomascus leucogenys [White-cheeked Gibbon]
gi|426327950|ref|XP_004024771.1| PREDICTED: solute carrier famil...   223   7e-56   Gorilla gorilla gorilla [lowland gorilla]
gi|478249945|gb|ENN70452.1| hypothetical protein YQE_12955, part...   222   1e-55   Dendroctonus ponderosae
gi|195121810|ref|XP_002005411.1| GI19085 [Drosophila mojavensis]...   222   1e-55   Drosophila mojavensis
gi|46409330|ref|NP_997231.1| solute carrier family 25 member 34 ...   222   1e-55   Homo sapiens [man]
gi|380481831|emb|CCF41614.1| hypothetical protein CH063_11843 [C...   221   2e-55   Colletotrichum higginsianum
gi|281346235|gb|EFB21819.1| hypothetical protein PANDA_010356 [A...   221   2e-55   Ailuropoda melanoleuca
gi|444728136|gb|ELW68600.1| Solute carrier family 25 member 34 [...   221   3e-55   Tupaia chinensis
gi|332372800|gb|AEE61542.1| unknown [Dendroctonus ponderosae]         220   3e-55   Dendroctonus ponderosae
gi|150416118|sp|Q5XIF9.2|S2534_RAT RecName: Full=Solute carrier ...   220   4e-55   Rattus norvegicus [brown rat]
gi|348570882|ref|XP_003471225.1| PREDICTED: solute carrier famil...   220   4e-55   
gi|312374832|gb|EFR22310.1| hypothetical protein AND_15449 [Anop...   220   4e-55   
gi|332017876|gb|EGI58536.1| Solute carrier family 25 member 35 [...   220   5e-55   Acromyrmex echinatior
gi|478249944|gb|ENN70451.1| hypothetical protein YQE_12955, part...   220   5e-55   Dendroctonus ponderosae
gi|395821197|ref|XP_003783934.1| PREDICTED: solute carrier famil...   220   5e-55   Otolemur garnettii
gi|194883172|ref|XP_001975677.1| GG20426 [Drosophila erecta] >gi...   220   6e-55   Drosophila erecta
gi|291412221|ref|XP_002722385.1| PREDICTED: solute carrier famil...   219   6e-55   
gi|19922222|ref|NP_610933.1| CG8323 [Drosophila melanogaster] >g...   219   7e-55   Drosophila melanogaster
gi|194208009|ref|XP_001488977.2| PREDICTED: solute carrier famil...   219   8e-55   
gi|440906824|gb|ELR57045.1| Solute carrier family 25 member 35 [...   219   8e-55   Bos mutus
gi|158285957|ref|XP_308539.3| AGAP007266-PA [Anopheles gambiae s...   219   8e-55   Anopheles gambiae str. PEST
gi|195334254|ref|XP_002033799.1| GM21512 [Drosophila sechellia] ...   219   8e-55   
gi|270013073|gb|EFA09521.1| hypothetical protein TcasGA2_TC01162...   219   9e-55   
gi|195583294|ref|XP_002081458.1| GD11023 [Drosophila simulans] >...   219   1e-54   
gi|169613941|ref|XP_001800387.1| hypothetical protein SNOG_10105...   219   1e-54   
gi|501297307|dbj|BAN21130.1| mitochondrial carrier protein [Ript...   219   1e-54   
gi|466022316|ref|XP_004272480.1| PREDICTED: solute carrier famil...   219   1e-54   
gi|195485868|ref|XP_002091267.1| GE13557 [Drosophila yakuba] >gi...   218   2e-54   
gi|488565075|ref|XP_004485242.1| PREDICTED: LOW QUALITY PROTEIN:...   218   2e-54   
gi|302665730|ref|XP_003024473.1| hypothetical protein TRV_01367 ...   218   2e-54   
gi|156040766|ref|XP_001587369.1| hypothetical protein SS1G_11361...   217   3e-54   
gi|403287586|ref|XP_003935024.1| PREDICTED: solute carrier famil...   217   4e-54   
gi|296206796|ref|XP_002750391.1| PREDICTED: solute carrier famil...   217   4e-54   
gi|507936973|ref|XP_004679401.1| PREDICTED: solute carrier famil...   217   5e-54   
gi|302497415|ref|XP_003010708.1| hypothetical protein ARB_03410 ...   216   7e-54   
gi|62078601|ref|NP_001013958.1| solute carrier family 25 member ...   216   8e-54   
gi|195383992|ref|XP_002050708.1| GJ20058 [Drosophila virilis] >g...   216   9e-54   
gi|403275038|ref|XP_003929267.1| PREDICTED: solute carrier famil...   216   1e-53   
gi|198460436|ref|XP_001361714.2| GA20987 [Drosophila pseudoobscu...   215   1e-53   
gi|504164873|ref|XP_004592496.1| PREDICTED: solute carrier famil...   215   1e-53   
gi|154303854|ref|XP_001552333.1| hypothetical protein BC1G_08811...   215   1e-53   
gi|157112773|ref|XP_001651865.1| mitochondrial carrier protein [...   215   1e-53   
gi|440911747|gb|ELR61384.1| Solute carrier family 25 member 34, ...   215   2e-53   
gi|195028867|ref|XP_001987297.1| GH21842 [Drosophila grimshawi] ...   215   2e-53   
gi|195436570|ref|XP_002066240.1| GK22254 [Drosophila willistoni]...   214   2e-53   
gi|119113934|ref|XP_314143.3| AGAP005239-PA [Anopheles gambiae s...   214   2e-53   
gi|311258571|ref|XP_003127686.1| PREDICTED: solute carrier famil...   214   2e-53   
gi|195154226|ref|XP_002018023.1| GL16985 [Drosophila persimilis]...   214   2e-53   
gi|327287156|ref|XP_003228295.1| PREDICTED: solute carrier famil...   214   2e-53   
gi|41053744|ref|NP_956874.1| solute carrier family 25 member 34 ...   214   3e-53   
gi|507670889|ref|XP_004637827.1| PREDICTED: solute carrier famil...   214   3e-53   
gi|354506255|ref|XP_003515180.1| PREDICTED: solute carrier famil...   214   4e-53   
gi|195436568|ref|XP_002066239.1| GK22044 [Drosophila willistoni]...   213   4e-53   
gi|195444266|ref|XP_002069789.1| GK11388 [Drosophila willistoni]...   213   5e-53   
gi|344250248|gb|EGW06352.1| Solute carrier family 25 member 34 [...   213   5e-53   
gi|194754407|ref|XP_001959486.1| GF12030 [Drosophila ananassae] ...   213   7e-53   
gi|390355041|ref|XP_789671.2| PREDICTED: solute carrier family 2...   213   8e-53   
gi|391342814|ref|XP_003745710.1| PREDICTED: solute carrier famil...   213   8e-53   
gi|195334256|ref|XP_002033800.1| GM21513 [Drosophila sechellia] ...   213   9e-53   
gi|194883170|ref|XP_001975676.1| GG20427 [Drosophila erecta] >gi...   212   9e-53   
gi|195485870|ref|XP_002091268.1| GE13558 [Drosophila yakuba] >gi...   212   1e-52   
gi|170067608|ref|XP_001868549.1| mitochondrial oxaloacetate tran...   212   1e-52   
gi|357625560|gb|EHJ75960.1| hypothetical protein KGM_00378 [Dana...   212   1e-52   
gi|470251494|ref|XP_004358844.1| transmembrane protein [Dictyost...   212   1e-52   
gi|24653555|ref|NP_610934.1| CG18327, isoform A [Drosophila mela...   212   1e-52   
gi|66824607|ref|XP_645658.1| transmembrane protein [Dictyosteliu...   212   2e-52   
gi|157118160|ref|XP_001659037.1| mitochondrial carrier protein [...   211   2e-52   
gi|85719318|ref|NP_001013802.1| solute carrier family 25 member ...   211   2e-52   
gi|482683654|ref|XP_001361711.3| GA14890 [Drosophila pseudoobscu...   211   2e-52   
gi|195154224|ref|XP_002018022.1| GL16987 [Drosophila persimilis]...   211   2e-52   
gi|405976633|gb|EKC41133.1| Solute carrier family 25 member 35 [...   211   3e-52   
gi|395836746|ref|XP_003791311.1| PREDICTED: LOW QUALITY PROTEIN:...   211   3e-52   
gi|77735945|ref|NP_001029669.1| solute carrier family 25 member ...   211   3e-52   
gi|344290198|ref|XP_003416825.1| PREDICTED: solute carrier famil...   211   3e-52   
gi|24653557|ref|NP_725361.1| CG18324, isoform B [Drosophila mela...   210   4e-52   
gi|146326948|gb|AAI40666.1| SLC25A35 protein [Bos taurus]             210   4e-52   
gi|194754409|ref|XP_001959487.1| GF12029 [Drosophila ananassae] ...   210   4e-52   
gi|195583298|ref|XP_002081460.1| GD11025 [Drosophila simulans] >...   209   7e-52   
gi|513030408|gb|AGO10433.1| AaceriABL023Wp [Saccharomycetaceae s...   209   9e-52   
gi|156545457|ref|XP_001606823.1| PREDICTED: solute carrier famil...   209   1e-51   
gi|68051325|gb|AAY84926.1| IP09951p [Drosophila melanogaster]         209   1e-51   
gi|195485873|ref|XP_002091269.1| GE13559 [Drosophila yakuba] >gi...   208   1e-51   
gi|391345166|ref|XP_003746862.1| PREDICTED: solute carrier famil...   208   2e-51   
gi|512899332|ref|XP_004898970.1| PREDICTED: solute carrier famil...   208   2e-51   
gi|224079282|ref|XP_002189378.1| PREDICTED: solute carrier famil...   207   3e-51   
gi|512923470|ref|XP_004930361.1| PREDICTED: solute carrier famil...   207   5e-51   
gi|91079436|ref|XP_968348.1| PREDICTED: similar to predicted pro...   206   5e-51   
gi|498943909|ref|XP_004521956.1| PREDICTED: solute carrier famil...   206   9e-51   
gi|194883168|ref|XP_001975675.1| GG20428 [Drosophila erecta] >gi...   206   1e-50   
gi|330790851|ref|XP_003283509.1| hypothetical protein DICPUDRAFT...   205   1e-50   
gi|302306510|ref|NP_982924.2| ABL023Wp [Ashbya gossypii ATCC 108...   204   3e-50   
gi|357625561|gb|EHJ75961.1| hypothetical protein KGM_00377 [Dana...   204   4e-50   
gi|72008109|ref|XP_786980.1| PREDICTED: solute carrier family 25...   204   4e-50   
gi|498957682|ref|XP_004544813.1| PREDICTED: solute carrier famil...   203   4e-50   
gi|348507521|ref|XP_003441304.1| PREDICTED: solute carrier famil...   203   6e-50   
gi|512850991|ref|XP_004921372.1| PREDICTED: LOW QUALITY PROTEIN:...   199   1e-48   
gi|402898694|ref|XP_003912355.1| PREDICTED: solute carrier famil...   192   2e-46   
gi|307106148|gb|EFN54395.1| hypothetical protein CHLNCDRAFT_2498...   191   2e-46   
gi|71680584|gb|AAI01331.1| SLC25A35 protein [Homo sapiens]            191   3e-46   
gi|470244824|ref|XP_004356144.1| mitochondrial substrate carrier...   189   6e-46   
gi|326434195|gb|EGD79765.1| hypothetical protein PTSG_10750 [Sal...   189   1e-45   
gi|291242488|ref|XP_002741136.1| PREDICTED: solute carrier famil...   188   1e-45   
gi|194754405|ref|XP_001959485.1| GF12031 [Drosophila ananassae] ...   188   2e-45   
gi|281343203|gb|EFB18787.1| hypothetical protein PANDA_010060 [A...   187   3e-45   
gi|426239876|ref|XP_004013843.1| PREDICTED: LOW QUALITY PROTEIN:...   187   3e-45   
gi|291242486|ref|XP_002741139.1| PREDICTED: solute carrier famil...   187   5e-45   
gi|395748539|ref|XP_002827051.2| PREDICTED: solute carrier famil...   186   5e-45   
gi|444317148|ref|XP_004179231.1| hypothetical protein TBLA_0B089...   186   8e-45   
gi|196016765|ref|XP_002118233.1| hypothetical protein TRIADDRAFT...   186   8e-45   
gi|357625564|gb|EHJ75964.1| putative mitochondrial 2-oxoglutarat...   186   9e-45   
gi|326427536|gb|EGD73106.1| hypothetical protein PTSG_04820 [Sal...   185   1e-44   
gi|154341597|ref|XP_001566750.1| mitochondrial carrier protein-l...   184   2e-44   
gi|40806493|gb|AAR92153.1| unknown protein [Homo sapiens]             184   3e-44   
gi|119610469|gb|EAW90063.1| solute carrier family 25, member 35,...   184   4e-44   
gi|390341769|ref|XP_785934.3| PREDICTED: mitochondrial substrate...   184   4e-44   
gi|328771710|gb|EGF81749.1| hypothetical protein BATDEDRAFT_2333...   183   6e-44   
gi|157112775|ref|XP_001651866.1| mitochondrial carrier protein [...   182   8e-44   
gi|348542252|ref|XP_003458599.1| PREDICTED: mitochondrial 2-oxog...   182   1e-43   
gi|395522195|ref|XP_003765125.1| PREDICTED: uncharacterized prot...   181   2e-43   
gi|512923459|ref|XP_004930358.1| PREDICTED: solute carrier famil...   181   3e-43   
gi|157872303|ref|XP_001684700.1| mitochondrial carrier protein-l...   181   3e-43   
gi|302792609|ref|XP_002978070.1| hypothetical protein SELMODRAFT...   180   4e-43   
gi|336383900|gb|EGO25049.1| hypothetical protein SERLADRAFT_4087...   180   4e-43   
gi|405952130|gb|EKC19976.1| Mitochondrial 2-oxoglutarate/malate ...   180   6e-43   
gi|403275040|ref|XP_003929268.1| PREDICTED: solute carrier famil...   179   1e-42   
gi|330798886|ref|XP_003287480.1| hypothetical protein DICPUDRAFT...   179   1e-42   
gi|410925070|ref|XP_003976004.1| PREDICTED: mitochondrial 2-oxog...   178   2e-42   
gi|47207195|emb|CAF90256.1| unnamed protein product [Tetraodon n...   177   3e-42   
gi|221106013|ref|XP_002167564.1| PREDICTED: mitochondrial substr...   177   4e-42   
gi|401425543|ref|XP_003877256.1| mitochondrial carrier protein-l...   177   4e-42   
gi|146093688|ref|XP_001466955.1| mitochondrial carrier protein-l...   177   4e-42   
gi|432098079|gb|ELK27966.1| Solute carrier family 25 member 34 [...   177   5e-42   
gi|405974874|gb|EKC39486.1| Mitochondrial substrate carrier fami...   176   9e-42   
gi|403182508|gb|EJY57438.1| AAEL017395-PA [Aedes aegypti]             176   1e-41   
gi|166240406|ref|XP_001733006.1| mitochondrial substrate carrier...   176   1e-41   
gi|323649956|gb|ADX97064.1| mitochondrial 2-oxoglutarate/malate ...   174   4e-41   
gi|330845574|ref|XP_003294655.1| hypothetical protein DICPUDRAFT...   174   5e-41   
gi|270016072|gb|EFA12520.1| hypothetical protein TcasGA2_TC00269...   173   5e-41   
gi|156364583|ref|XP_001626426.1| predicted protein [Nematostella...   173   6e-41   
gi|50344854|ref|NP_001002099.1| mitochondrial 2-oxoglutarate/mal...   173   6e-41   
gi|126309291|ref|XP_001371003.1| PREDICTED: mitochondrial 2-oxog...   173   6e-41   
gi|395533629|ref|XP_003768858.1| PREDICTED: mitochondrial 2-oxog...   173   8e-41   
gi|512908560|ref|XP_004901372.1| PREDICTED: mitochondrial 2-oxog...   173   8e-41   
gi|507674140|ref|XP_004638394.1| PREDICTED: mitochondrial 2-oxog...   172   8e-41   
gi|431893956|gb|ELK03762.1| Mitochondrial 2-oxoglutarate/malate ...   172   8e-41   
gi|395836646|ref|XP_003791264.1| PREDICTED: mitochondrial 2-oxog...   172   1e-40   
gi|452820660|gb|EME27699.1| mitochondrial carrier, oxoglutarate:...   172   1e-40   
gi|1580888|prf||2116232A 2-oxoglutarate carrier protein               172   1e-40
gi|318056060|ref|NP_001188019.1| mitochondrial 2-oxoglutarate/ma...   172   1e-40   
gi|149053212|gb|EDM05029.1| solute carrier family 25 (mitochondr...   172   1e-40   
gi|471371274|ref|XP_004376145.1| PREDICTED: mitochondrial 2-oxog...   172   1e-40   
gi|472358016|ref|XP_004398634.1| PREDICTED: mitochondrial 2-oxog...   172   1e-40   
gi|465992904|ref|XP_004267027.1| PREDICTED: mitochondrial 2-oxog...   172   2e-40   
gi|291405215|ref|XP_002718874.1| PREDICTED: solute carrier famil...   172   2e-40   
gi|507566641|ref|XP_004666963.1| PREDICTED: mitochondrial 2-oxog...   171   2e-40   
gi|21312994|ref|NP_077173.1| mitochondrial 2-oxoglutarate/malate...   171   2e-40   
gi|71895777|ref|NP_001025683.1| solute carrier family 25 (mitoch...   171   2e-40   
gi|504170634|ref|XP_004594908.1| PREDICTED: mitochondrial 2-oxog...   171   2e-40   
gi|351701600|gb|EHB04519.1| Solute carrier family 25 member 35 [...   171   2e-40   
gi|149724223|ref|XP_001504800.1| PREDICTED: mitochondrial 2-oxog...   171   2e-40   
gi|488510391|ref|XP_004447283.1| PREDICTED: mitochondrial 2-oxog...   171   3e-40   
gi|388454450|ref|NP_001252852.1| mitochondrial 2-oxoglutarate/ma...   171   3e-40   
gi|328767458|gb|EGF77508.1| hypothetical protein BATDEDRAFT_1400...   171   3e-40   
gi|154283237|ref|XP_001542414.1| mitochondrial oxaloacetate tran...   171   3e-40   
gi|355568124|gb|EHH24405.1| Mitochondrial 2-oxoglutarate/malate ...   171   3e-40   
gi|187936969|ref|NP_001120745.1| mitochondrial 2-oxoglutarate/ma...   171   3e-40   
gi|507954010|ref|XP_004684778.1| PREDICTED: mitochondrial 2-oxog...   171   4e-40   
gi|253735932|gb|ACT34187.1| SLC25A11 [Ovis aries]                     170   4e-40   
gi|335298430|ref|XP_003131953.2| PREDICTED: LOW QUALITY PROTEIN:...   170   4e-40   
gi|66809869|ref|XP_638658.1| mitochondrial substrate carrier fam...   170   5e-40   
gi|511881194|ref|XP_004760493.1| PREDICTED: mitochondrial 2-oxog...   170   6e-40   
gi|57086345|ref|XP_536607.1| PREDICTED: mitochondrial 2-oxogluta...   170   6e-40   
gi|348561075|ref|XP_003466338.1| PREDICTED: mitochondrial 2-oxog...   170   6e-40   
gi|452819710|gb|EME26764.1| mitochondrial carrier, oxoglutarate:...   169   7e-40   
gi|443914768|gb|ELU36520.1| oxaloacetate carrier [Rhizoctonia so...   169   7e-40   
gi|498986938|ref|XP_004530981.1| PREDICTED: mitochondrial 2-oxog...   169   8e-40   
gi|27807211|ref|NP_777096.1| mitochondrial 2-oxoglutarate/malate...   169   9e-40   
gi|432090752|gb|ELK24082.1| Mitochondrial 2-oxoglutarate/malate ...   169   9e-40   
gi|470516435|ref|XP_004353082.1| carrier superfamily protein [Ac...   169   1e-39   
gi|505787426|ref|XP_004604986.1| PREDICTED: mitochondrial 2-oxog...   169   1e-39   
gi|296202300|ref|XP_002748334.1| PREDICTED: mitochondrial 2-oxog...   169   1e-39   
gi|146231676|gb|ABQ12913.1| solute carrier family 25 (mitochondr...   169   1e-39   
gi|290970849|ref|XP_002668280.1| predicted protein [Naegleria gr...   169   1e-39   
gi|332257665|ref|XP_003277925.1| PREDICTED: mitochondrial 2-oxog...   169   1e-39   
gi|21361114|ref|NP_003553.2| mitochondrial 2-oxoglutarate/malate...   169   1e-39   
gi|301787347|ref|XP_002929082.1| PREDICTED: mitochondrial 2-oxog...   168   2e-39   
gi|147905724|ref|NP_001090497.1| solute carrier family 25 member...   168   2e-39   
gi|197101986|ref|NP_001124629.1| mitochondrial 2-oxoglutarate/ma...   168   2e-39   
gi|345482038|ref|XP_003424515.1| PREDICTED: solute carrier famil...   168   2e-39   
gi|299117351|emb|CBN75307.1| conserved unknown protein [Ectocarp...   168   2e-39   
gi|241753783|ref|XP_002401160.1| secreted salivary gland peptide...   167   3e-39   
gi|149053009|gb|EDM04826.1| similar to solute carrier family 25,...   167   3e-39   
gi|168042649|ref|XP_001773800.1| predicted protein [Physcomitrel...   167   3e-39   
gi|507704759|ref|XP_004716187.1| PREDICTED: mitochondrial 2-oxog...   167   3e-39   
gi|11693170|ref|NP_071793.1| mitochondrial 2-oxoglutarate/malate...   167   3e-39   
gi|482564806|gb|EOA28996.1| hypothetical protein CARUB_v10025249...   167   3e-39   
gi|224099879|ref|XP_002334433.1| predicted protein [Populus tric...   167   4e-39   
gi|478518063|ref|XP_004433262.1| PREDICTED: mitochondrial 2-oxog...   167   5e-39   
gi|118487428|gb|ABK95542.1| unknown [Populus trichocarpa]             167   5e-39   
gi|170041174|ref|XP_001848348.1| mitochondrial 2-oxoglutarate/ma...   166   6e-39   
gi|170064917|ref|XP_001867726.1| mitochondrial 2-oxoglutarate/ma...   166   6e-39   
gi|224141165|ref|XP_002323945.1| predicted protein [Populus tric...   166   7e-39   
gi|195036348|ref|XP_001989632.1| GH18903 [Drosophila grimshawi] ...   166   8e-39   
gi|209738230|gb|ACI69984.1| Mitochondrial 2-oxoglutarate/malate ...   166   9e-39   
gi|260831816|ref|XP_002610854.1| hypothetical protein BRAFLDRAFT...   166   1e-38   
gi|148225841|ref|NP_001085186.1| uncharacterized protein LOC4322...   166   1e-38   
gi|507674146|ref|XP_004638395.1| PREDICTED: mitochondrial 2-oxog...   165   2e-38   
gi|443724781|gb|ELU12634.1| hypothetical protein CAPTEDRAFT_1666...   165   2e-38   
gi|512908564|ref|XP_004901373.1| PREDICTED: mitochondrial 2-oxog...   165   2e-38   
gi|224093316|ref|XP_002309878.1| predicted protein [Populus tric...   165   2e-38   
gi|198463020|ref|XP_001352656.2| GA20405 [Drosophila pseudoobscu...   165   2e-38   
gi|55736033|gb|AAV63543.1| fed tick salivary protein 9 [Ixodes s...   164   2e-38   
gi|221112229|ref|XP_002164719.1| PREDICTED: kidney mitochondrial...   164   2e-38   
gi|195167952|ref|XP_002024796.1| GL17935 [Drosophila persimilis]...   164   3e-38   
gi|470307945|ref|XP_004363712.1| solute carrier family 25 [Capsa...   164   3e-38   
gi|355568226|gb|EHH24507.1| hypothetical protein EGK_08170 [Maca...   164   3e-38   
gi|395836648|ref|XP_003791265.1| PREDICTED: mitochondrial 2-oxog...   164   3e-38   
gi|444722981|gb|ELW63653.1| Mitochondrial 2-oxoglutarate/malate ...   164   3e-38   
gi|403348944|gb|EJY73918.1| hypothetical protein OXYTRI_04828 [O...   164   3e-38   
gi|209731776|gb|ACI66757.1| Mitochondrial 2-oxoglutarate/malate ...   164   3e-38   
gi|472358018|ref|XP_004398635.1| PREDICTED: mitochondrial 2-oxog...   164   3e-38   
gi|471371276|ref|XP_004376146.1| PREDICTED: mitochondrial 2-oxog...   164   4e-38   
gi|507566643|ref|XP_004666964.1| PREDICTED: mitochondrial 2-oxog...   164   4e-38   
gi|149053213|gb|EDM05030.1| solute carrier family 25 (mitochondr...   164   4e-38   
gi|357465309|ref|XP_003602936.1| Mitochondrial 2-oxoglutarate/ma...   164   4e-38   
gi|465992909|ref|XP_004267028.1| PREDICTED: mitochondrial 2-oxog...   164   4e-38   
gi|291405217|ref|XP_002718875.1| PREDICTED: solute carrier famil...   164   4e-38   
gi|504170636|ref|XP_004594909.1| PREDICTED: mitochondrial 2-oxog...   164   5e-38   
gi|462401176|gb|EMJ06733.1| hypothetical protein PRUPE_ppa008525...   163   5e-38   
gi|397494499|ref|XP_003818113.1| PREDICTED: solute carrier famil...   163   5e-38   
gi|426384074|ref|XP_004058601.1| PREDICTED: solute carrier famil...   163   5e-38   
gi|225707854|gb|ACO09773.1| Mitochondrial uncoupling protein 2 [...   163   5e-38   
gi|156547719|ref|XP_001605273.1| PREDICTED: mitochondrial 2-oxog...   163   6e-38   
gi|402898696|ref|XP_003912356.1| PREDICTED: solute carrier famil...   163   6e-38   
gi|488510393|ref|XP_004447284.1| PREDICTED: mitochondrial 2-oxog...   163   6e-38   
gi|449689505|ref|XP_002167570.2| PREDICTED: mitochondrial substr...   163   6e-38   
gi|240952178|ref|XP_002399340.1| oxoglutarate/malate carrier pro...   163   7e-38   
gi|507954012|ref|XP_004684779.1| PREDICTED: mitochondrial 2-oxog...   163   8e-38   
gi|302766491|ref|XP_002966666.1| hypothetical protein SELMODRAFT...   163   8e-38   
gi|402898394|ref|XP_003912208.1| PREDICTED: mitochondrial 2-oxog...   163   8e-38   
gi|148680641|gb|EDL12588.1| solute carrier family 25 (mitochondr...   162   8e-38   
gi|460388749|ref|XP_004240027.1| PREDICTED: mitochondrial uncoup...   162   9e-38   


>gi|511004855|gb|EPB86213.1| hypothetical protein HMPREF1544_07025 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 336

 Score =  327 bits (837), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 169/318 (53%), Positives = 214/318 (67%), Gaps = 11/318 (3%)

Query: 18  TANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN--SNYVKPY 75
           T  K +AKET     GF+IGG AAC AVTFTNPWEVVKTRLQLQGEL R+   S   +PY
Sbjct: 21  TVPKNKAKETAV---GFVIGGLAACGAVTFTNPWEVVKTRLQLQGELVRAGALSEAARPY 77

Query: 76  RNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP 135
            N FQA  V+ ++EG+RG Q+GL  AY YQ+ +NG+RLG Y+P++ ++ K  N  S    
Sbjct: 78  HNSFQALKVVFQHEGIRGAQRGLSVAYFYQICLNGSRLGLYEPVQTNMIKALNLKSEGSI 137

Query: 136 IS--MLSGFLAGSFGAAIGSPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEER 192
           ++  + SG LAG  GA +GSPLYL+KTR QS+S  F  IGHQH   +   AL +I + E 
Sbjct: 138 LASGIFSGALAGVVGAVLGSPLYLIKTRRQSFSPVFKNIGHQHEMGSALSALGQIYRTEG 197

Query: 193 YFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVC 252
             +GL+RG DAAM+R GVGS  Q+ +Y   K  ++K  G  DD    H  +S+ +G  VC
Sbjct: 198 -IRGLYRGADAAMVRAGVGSAVQMPTYMIGKDILVKKFGFPDD-FSTHFATSMFTGVLVC 255

Query: 253 FTMNPFDVISTRMYNQKADQ-SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
             MNPFDVISTRMYNQ  D  +GKG LYK+ +DCF+K  + EG+ G YKGF AHYLRIGP
Sbjct: 256 LAMNPFDVISTRMYNQGVDPVTGKGVLYKSPVDCFVKMTKIEGVRGLYKGFLAHYLRIGP 315

Query: 312 HTILTFVFLEQYRGLYIK 329
           HT L FVF+EQ + +Y K
Sbjct: 316 HTTLMFVFMEQLKKIYNK 333



>gi|344229701|gb|EGV61586.1| mitochondrial carrier [Candida tenuis ATCC 10573]
          Length = 324

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/318 (51%), Positives = 215/318 (67%), Gaps = 24/318 (7%)

Query: 22  ARAKET--IKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
           ++ KET  +    GF+ G  AAC AVTFTNP E++KTR+QLQGELT+ + N VK Y+N F
Sbjct: 2   SKHKETPQVSTAGGFVAGALAACGAVTFTNPIELIKTRMQLQGELTKVDKNAVKIYKNPF 61

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS-------- 131
           QAF VI KNEG+RG+QKGL A Y YQ+ +NG R GFY+P R +L K FN ++        
Sbjct: 62  QAFGVIYKNEGLRGLQKGLVAGYFYQIGLNGCRFGFYEPARYNLTKLFNPTALKEGEKAP 121

Query: 132 TSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF-------AAIGHQHNYKNTFDAL 184
            S+ I++ +GF++G+ GA I +PL+LVKTRMQSYS          A+G Q  Y++ F+ L
Sbjct: 122 QSLGINVAAGFISGTAGATIANPLFLVKTRMQSYSAVKNASGQSVAVGQQTFYRSPFEGL 181

Query: 185 HKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSS 244
            KI K E   KGLFRGVDAA++RTG GS TQL SYF+ K  VI    +++D+ILVH ++S
Sbjct: 182 KKIFKAEG-IKGLFRGVDAAILRTGAGSSTQLPSYFYAKSLVIDNHIVAEDSILVHLIAS 240

Query: 245 LVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGA 304
            V+G  V   MNP+DV+ TR+YNQK D      LY    DC +KT++ EGI  FYKGF A
Sbjct: 241 SVAGLAVAVMMNPWDVVLTRVYNQKGD------LYSGVGDCIVKTVKTEGITAFYKGFWA 294

Query: 305 HYLRIGPHTILTFVFLEQ 322
              RIGPH+IL+ +F+EQ
Sbjct: 295 QLFRIGPHSILSLMFMEQ 312



>gi|406606333|emb|CCH42324.1| Mitochondrial oxaloacetate transport protein [Wickerhamomyces
           ciferrii]
          Length = 323

 Score =  305 bits (782), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 207/313 (66%), Gaps = 15/313 (4%)

Query: 15  QQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP 74
           ++  A K+ A + I    GF+ GG AAC AVTFTNP E+VKTR+QLQGEL  S+SN  K 
Sbjct: 7   KEVKAEKS-ASQKISTAGGFIAGGLAACGAVTFTNPIELVKTRMQLQGEL--SHSNQAKV 63

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST-- 132
           Y+N  QA   I  NEG++G+QKGL  AY YQ+ +NG RLG Y+P RN L   F  S    
Sbjct: 64  YKNPIQALGKIYSNEGIKGVQKGLVCAYIYQIGLNGCRLGLYEPSRNILNSVFYPSQDPH 123

Query: 133 ---SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISK 189
              ++PI++ +G L+G  GA IGSPL+L+KTRMQSYST  AIG Q +YKN  D L  I  
Sbjct: 124 SVQNVPINVAAGALSGIAGAIIGSPLFLIKTRMQSYSTKIAIGEQTHYKNFLDGLVSIYS 183

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
           +E    GLFRGVDAA+IRTG+GS  QL  Y ++K+ + K   +S+   L H +SS  +GF
Sbjct: 184 KEGGIPGLFRGVDAAIIRTGMGSSVQLPIYNYLKQFLQKNEIVSEGAGL-HLISSTFAGF 242

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   MNP DV+ TRMYNQK D      LYK  +DCFIKT++ EG+F  YKGFGA  LRI
Sbjct: 243 GVGIVMNPGDVVLTRMYNQKGD------LYKGPIDCFIKTIKYEGVFALYKGFGAQLLRI 296

Query: 310 GPHTILTFVFLEQ 322
            PHTILT  F+EQ
Sbjct: 297 APHTILTLTFMEQ 309



>gi|328773408|gb|EGF83445.1| hypothetical protein BATDEDRAFT_18559 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 349

 Score =  303 bits (776), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 213/326 (65%), Gaps = 28/326 (8%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGEL----TRSNSNYVKPYRNIFQAFYVIV 86
           L GF+ G  AAC AVTFTNPWEVVKTRLQLQGEL     +  +   K Y N F AF  I 
Sbjct: 19  LKGFVAGALAACGAVTFTNPWEVVKTRLQLQGELQARLAKGTNAPPKQYPNAFSAFGRIF 78

Query: 87  KNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM--------PIS- 137
           K EG +GIQKGL  AY YQ ++NG RLG YDP++  ++   + ++ S+        PI+ 
Sbjct: 79  KAEGFKGIQKGLAPAYIYQTLLNGTRLGLYDPLKAVIQSSVDYAALSLSNGEKVNTPIAP 138

Query: 138 ----MLSGFLAGSFGAAIGSPLYLVKTRMQSYS--TFAAIGHQHNY--KNTFDALHKISK 189
               + SG ++G  GA I SPL+L+KTRMQSY+  +  A+GHQH+Y  K T  +L  + +
Sbjct: 139 AFAMVTSGAMSGVLGAFIASPLFLIKTRMQSYTKGSILAVGHQHSYVTKGTLHSLATVYR 198

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIK---YSGMSDDN--ILVHALSS 244
           +    KGL+RGVDA+M+RTGVGS  QLSSY   K+++++   +  + D +  I +H ++S
Sbjct: 199 QGG-IKGLWRGVDASMMRTGVGSAVQLSSYDGCKQALLQSGWFDAVHDGHGGIALHFMAS 257

Query: 245 LVSGFCVCFTMNPFDVISTRMYNQKADQSGK-GSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           L +   VC  MNPFDV STRMYNQ +   GK GSLYK+  DC +KT+RAEG+   YKGF 
Sbjct: 258 LATSLLVCIAMNPFDVASTRMYNQHSTADGKTGSLYKSGFDCLVKTVRAEGVSALYKGFF 317

Query: 304 AHYLRIGPHTILTFVFLEQYRGLYIK 329
           AHYLRIGPHTI TFVFLEQ R    K
Sbjct: 318 AHYLRIGPHTIFTFVFLEQLRAAAAK 343



>gi|384485501|gb|EIE77681.1| hypothetical protein RO3G_02385 [Rhizopus delemar RA 99-880]
          Length = 304

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 204/306 (66%), Gaps = 9/306 (2%)

Query: 11  TSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNS- 69
           +++ QQ    K   K T   + GF+IGG AAC AVTFTNPWEVVKTRLQLQGEL R+ + 
Sbjct: 2   SALTQQKEIKKIENK-TRDTMIGFVIGGLAACGAVTFTNPWEVVKTRLQLQGELVRAGTL 60

Query: 70  -NYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN 128
               +PY N FQA  V+ ++EG+RG Q+GL  AY YQ+ +NG+RLG YDP+ N+++K F+
Sbjct: 61  TESARPYHNSFQALKVVFEHEGIRGAQRGLSVAYIYQVCLNGSRLGLYDPVFNNIKKTFH 120

Query: 129 TSSTS--MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYST-FAAIGHQHNYKNTFDALH 185
             S +  +   + SG  AG  GA +GSPLYL+KTR QSYS  F  IG+QH   ++F AL 
Sbjct: 121 LQSHASLLAAGVFSGAFAGVVGAVLGSPLYLIKTRRQSYSPIFKNIGYQHQMGSSFSALT 180

Query: 186 KISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSL 245
           +I + E   KGL+RG DAAM R GVGS  Q+ +Y   K  +IK  G   D++  H  +S+
Sbjct: 181 QIYRTEG-IKGLYRGADAAMARAGVGSAVQMPTYMLGKDLLIKRFGFP-DSVGTHFATSM 238

Query: 246 VSGFCVCFTMNPFDVISTRMYNQKADQ-SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGA 304
            +G  VC  MNPFDVISTRMYNQ  D  +GKG LYK   DCF+K ++ EG+ G YKGF A
Sbjct: 239 FTGVLVCLAMNPFDVISTRMYNQGVDPLTGKGLLYKGPTDCFVKIVKIEGVRGLYKGFLA 298

Query: 305 HYLRIG 310
           HYLRIG
Sbjct: 299 HYLRIG 304



>gi|190348372|gb|EDK40814.2| hypothetical protein PGUG_04912 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 326

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 200/316 (63%), Gaps = 24/316 (7%)

Query: 22  ARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQA 81
           A     +  L GFL GG AAC AVTFTNP E+VKTR+QLQGEL  + +  VK YRN  QA
Sbjct: 2   AHDSAPVSTLGGFLAGGIAACGAVTFTNPIELVKTRMQLQGELAANQA--VKMYRNPIQA 59

Query: 82  FYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--------S 133
           F VI +NEG+RG+Q+GL   Y  QL +NG R+G Y+P R  L K  N  S         +
Sbjct: 60  FAVIYRNEGIRGLQQGLVCGYLNQLCLNGCRIGLYEPCRYQLTKVLNPDSIVEGQKVPQA 119

Query: 134 MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHN-------YKNTFDALHK 186
           + I+++SGFLAGS GA + SP +L+KTRMQSYS+ AA G  H        YKNT D L K
Sbjct: 120 VSINIVSGFLAGSAGAVLASPFFLIKTRMQSYSSAAATGKIHTSTGQQTYYKNTADGLRK 179

Query: 187 ISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLV 246
           I   E  FKGLFRGVDAA+ RTG GS  QL  Y+F K+   K++ +       H LSSLV
Sbjct: 180 IYGSEG-FKGLFRGVDAAIFRTGAGSAAQLPLYYFTKQQFEKHTSIDPSAPSTHFLSSLV 238

Query: 247 SGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHY 306
           +G  V   MNP DV+ TR+YNQ      KG+LY+  +DC +KT+  EG+   YKGF A  
Sbjct: 239 AGVGVAIVMNPGDVVLTRVYNQ------KGNLYRGPIDCLVKTVTTEGVAALYKGFWAQL 292

Query: 307 LRIGPHTILTFVFLEQ 322
           LRIGPHTILT +F+EQ
Sbjct: 293 LRIGPHTILTLMFMEQ 308



>gi|238881020|gb|EEQ44658.1| mitochondrial oxaloacetate transport protein [Candida albicans
           WO-1]
          Length = 350

 Score =  299 bits (766), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 212/327 (64%), Gaps = 19/327 (5%)

Query: 8   GISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRS 67
           G + ++ Q+   +     + +  L GFL GG AAC AVTFTNP E++KTR+QLQGEL + 
Sbjct: 15  GAAANMKQKEIPSTKNDAQKVSTLGGFLAGGVAACMAVTFTNPIELIKTRMQLQGELVKK 74

Query: 68  NSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF 127
           + + V  Y+N  QAF VI +NEG+RG+Q+GL   Y YQL +NG R+GFY+P R  L K F
Sbjct: 75  SKDAVVLYKNPLQAFAVIYRNEGIRGLQQGLACGYYYQLALNGCRIGFYEPSRFYLSKAF 134

Query: 128 NTS--------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF----AAIGHQH 175
             S          S+ I++L+GF++G+ GA + SP++L+KTRMQS+S      AA+G Q 
Sbjct: 135 APSHISPDGQVKQSLSINVLAGFVSGASGAVLASPMFLIKTRMQSFSASNTGGAAVGQQT 194

Query: 176 NYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDD 235
            YKNT+D   +I   E   KGL+RGVDAA++RTG GS  QL +Y+  K  ++K+    ++
Sbjct: 195 FYKNTWDGFSQIYHSEG-IKGLYRGVDAAILRTGAGSAAQLPTYYLTKSFLLKHGLAKEN 253

Query: 236 NILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGI 295
           +  ++ +SS+++G  V   MNP+DV+ TRMYNQ      KG+LY   +DCF KT+ AEG 
Sbjct: 254 SFSLNFISSIMAGLGVAIVMNPWDVVLTRMYNQ------KGNLYSGPIDCFKKTIAAEGA 307

Query: 296 FGFYKGFGAHYLRIGPHTILTFVFLEQ 322
              YKGF A   RIGPHTILT +F+EQ
Sbjct: 308 MALYKGFWAQLFRIGPHTILTLLFMEQ 334



>gi|68479814|ref|XP_716076.1| potential mitochondrial oxaloacetate, sulfate, and thiosulfate
           transporter [Candida albicans SC5314]
 gi|46437727|gb|EAK97068.1| potential mitochondrial oxaloacetate, sulfate, and thiosulfate
           transporter [Candida albicans SC5314]
          Length = 350

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 212/327 (64%), Gaps = 19/327 (5%)

Query: 8   GISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRS 67
           G + ++ Q+   +     + +  L GFL GG AAC AVTFTNP E++KTR+QLQGEL + 
Sbjct: 15  GAAANMKQKEIPSTKNDAQKVSTLGGFLAGGVAACMAVTFTNPIELIKTRMQLQGELVKK 74

Query: 68  NSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF 127
           + + V  Y+N  QAF VI +NEG+RG+Q+GL   Y YQL +NG R+GFY+P R  L K F
Sbjct: 75  SKDAVVLYKNPLQAFAVIYRNEGIRGLQQGLACGYYYQLALNGCRIGFYEPSRFYLSKAF 134

Query: 128 NTS--------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF----AAIGHQH 175
             S          S+ I++L+GF++G+ GA + SP++L+KTRMQS+S      AA+G Q 
Sbjct: 135 APSHIMPDGQVKQSLSINVLAGFVSGASGAVLASPMFLIKTRMQSFSASNTGGAAVGQQT 194

Query: 176 NYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDD 235
            YKNT+D   +I   E   KGL+RGVDAA++RTG GS  QL +Y+  K  ++K+    ++
Sbjct: 195 FYKNTWDGFSQIYHSEG-IKGLYRGVDAAILRTGAGSAAQLPTYYLTKSFLLKHGLAKEN 253

Query: 236 NILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGI 295
           +  ++ +SS+++G  V   MNP+DV+ TRMYNQ      KG+LY   +DCF KT+ AEG 
Sbjct: 254 SFSLNFISSIMAGLGVAIVMNPWDVVLTRMYNQ------KGNLYSGPIDCFKKTIAAEGA 307

Query: 296 FGFYKGFGAHYLRIGPHTILTFVFLEQ 322
              YKGF A   RIGPHTILT +F+EQ
Sbjct: 308 MALYKGFWAQLFRIGPHTILTLLFMEQ 334



>gi|344301423|gb|EGW31735.1| mitochondrial oxaloacetate carrier protein [Spathaspora
           passalidarum NRRL Y-27907]
          Length = 347

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 207/315 (65%), Gaps = 20/315 (6%)

Query: 21  KARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQ 80
           K  A+E +    GFL GG AAC AVTFTNP E++KTR+QLQGEL+++++N V+ Y+N FQ
Sbjct: 26  KKTAQEKVSTFGGFLAGGLAACGAVTFTNPIELIKTRMQLQGELSKTSANAVRLYKNPFQ 85

Query: 81  AFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS--------ST 132
           AF VI KNEG+RG+Q+GL   Y YQL +NG R+G Y+P R  L ++   S          
Sbjct: 86  AFLVIYKNEGIRGLQQGLMCGYYYQLGLNGCRIGLYEPSRKFLTQYLTPSKYVENGIIPQ 145

Query: 133 SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF-----AAIGHQHNYKNTFDALHKI 187
           ++ I++L+GF++GS GA + SP +L+KTRMQSY+       A +G Q  YK  +D + KI
Sbjct: 146 NLSINVLAGFISGSAGAVLASPFFLIKTRMQSYTKASNLQGATVGQQTYYKGAWDGIAKI 205

Query: 188 SKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVS 247
              E  FKGL+RGVDAA++RTG GS  QL  Y   K  ++K+  ++D +I +H +SS ++
Sbjct: 206 YTSEG-FKGLYRGVDAAILRTGAGSAAQLPVYNLTKNFLLKHDIVADHSIGLHFISSSMA 264

Query: 248 GFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYL 307
           G  V   MNP+DVI TRMYNQ      KG+LY   LDCF KT+  EG    YKGF A   
Sbjct: 265 GLGVAIVMNPWDVILTRMYNQ------KGNLYTGPLDCFRKTISIEGPAALYKGFWAQLF 318

Query: 308 RIGPHTILTFVFLEQ 322
           RIGPH+ILT +F+EQ
Sbjct: 319 RIGPHSILTLMFMEQ 333



>gi|241953613|ref|XP_002419528.1| mitochondrial inner membrane oxaloacetate transporter, putative
           [Candida dubliniensis CD36]
 gi|223642868|emb|CAX43123.1| mitochondrial inner membrane oxaloacetate transporter, putative
           [Candida dubliniensis CD36]
          Length = 350

 Score =  299 bits (765), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 216/331 (65%), Gaps = 19/331 (5%)

Query: 4   QKVSGISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGE 63
           + V G +  + Q+  ++     + +  L GFL GG AAC AVTFTNP E++KTR+QLQGE
Sbjct: 11  KTVGGPTIDMRQKEISSTKNDAQKVSTLGGFLAGGVAACMAVTFTNPIELIKTRMQLQGE 70

Query: 64  LTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSL 123
           L + +++ V  Y+N  QAF VI +NEG+RG+Q+GL   Y YQL +NG R+GFY+P R  L
Sbjct: 71  LVKKSNDAVVLYKNPLQAFAVIYRNEGLRGLQQGLACGYYYQLALNGCRIGFYEPSRFYL 130

Query: 124 EKFFNTS--------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF----AAI 171
            K F  S          S+ I++L+GF++G+ GA + SP++L+KTRMQS+S      AA+
Sbjct: 131 SKAFAPSHIMPDGQVKQSLFINVLAGFVSGASGAVLASPMFLIKTRMQSFSNSNTGGAAV 190

Query: 172 GHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSG 231
           G Q  YKNT+D   +I   E   KGL+RGVDAA++RTG GS  QL +Y+  K  ++K+  
Sbjct: 191 GQQTFYKNTWDGFTQIYHSEG-IKGLYRGVDAAILRTGAGSAAQLPTYYLTKSFLLKHGL 249

Query: 232 MSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLR 291
           + +++  ++ +SS+++G  V   MNP+DV+ TRMYNQ      KG+LY   +DCF KT+ 
Sbjct: 250 VKENSFSLNFISSIMAGLGVAIVMNPWDVVLTRMYNQ------KGNLYSGPIDCFKKTIA 303

Query: 292 AEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           AEG    YKGF A   RIGPHTILT +F+EQ
Sbjct: 304 AEGAMALYKGFWAQLFRIGPHTILTLLFMEQ 334



>gi|459371346|gb|EMG49163.1| Mitochondrial oxaloacetate transport protein [Candida maltosa
           Xu316]
          Length = 346

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 206/307 (67%), Gaps = 17/307 (5%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           + +  L GF+ GG AAC AVTFTNP E++KTR+QLQGEL + + + V  Y+N  QAF VI
Sbjct: 31  QQVSTLGGFIAGGVAACMAVTFTNPIELIKTRMQLQGELAKKSKDAVLLYKNPLQAFGVI 90

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--------SMPIS 137
            KNEG++G+Q+GL + Y YQL +NG+R+GFY+P R  L K    S          S+ I+
Sbjct: 91  YKNEGIKGLQQGLVSGYYYQLCLNGSRIGFYEPSRYYLTKILAPSKVLENGTLKPSLSIN 150

Query: 138 MLSGFLAGSFGAAIGSPLYLVKTRMQSY--STFAAIGHQHNYKNTFDALHKISKEERYFK 195
           +L+GF +G+ GAA+ SPL+L+KTRMQS+  S    +G Q  YKNT+D + KI   E   K
Sbjct: 151 VLAGFTSGAIGAALASPLFLIKTRMQSFNKSHTGTVGEQTYYKNTWDGISKIFNSEG-VK 209

Query: 196 GLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTM 255
           GL+RGVDAA++RTG GS  QL +Y+  K  ++K++ + +++ +++ +SS+V+G  V   M
Sbjct: 210 GLYRGVDAAILRTGAGSAAQLPTYYLTKSYLLKHNLVEENSFMMNFISSVVAGLGVAIVM 269

Query: 256 NPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTIL 315
           NP+DV+ TRMYNQK D      LYK  +DCF KT+  EG    YKGF A   RI PHTIL
Sbjct: 270 NPWDVVLTRMYNQKGD------LYKGPIDCFKKTISIEGPMALYKGFWAQLFRIAPHTIL 323

Query: 316 TFVFLEQ 322
           T +F+EQ
Sbjct: 324 TLLFMEQ 330



>gi|336370935|gb|EGN99275.1| hypothetical protein SERLA73DRAFT_182207 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336383691|gb|EGO24840.1| hypothetical protein SERLADRAFT_468747 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 325

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 205/314 (65%), Gaps = 11/314 (3%)

Query: 25  KETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYV 84
           + T+    GFL GG AAC+AVT +NP EV KTR+QLQGELT+     V  Y+N       
Sbjct: 8   ERTVSTAEGFLCGGIAACTAVTVSNPAEVAKTRMQLQGELTKGGGQKV--YKNALDVLAK 65

Query: 85  IVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MPI-SMLSGF 142
             +NEG+RG+Q+GLG AY YQ+++NG+RLGFY+P R +L +F   S T  +P+ S+ +G 
Sbjct: 66  TWRNEGIRGLQRGLGPAYTYQILLNGSRLGFYEPFRRTLNRFIGKSPTDQLPLTSITAGA 125

Query: 143 LAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVD 202
           ++G+ GA++G+PL+L+K RMQ+YS    +G QH YK++FDAL  I K E+ F+GL RG+D
Sbjct: 126 VSGAVGASLGNPLFLIKARMQAYSPALPVGTQHYYKSSFDALSTIWKAEK-FRGLIRGID 184

Query: 203 AAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVIS 262
           AA++RT +GS  QL +Y + K  ++    +  ++I     SS VSG CVC  M P D   
Sbjct: 185 AAVLRTTMGSSVQLPTYHWTKNQIVSNGLLPANSIWTFLASSSVSGICVCIVMQPADTTL 244

Query: 263 TRMYNQKADQSGK----GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           TRMYNQ   +       G+LYKN +DC +KT +AEG+ G+YKG  AH+LRI PHTI+T  
Sbjct: 245 TRMYNQPTKRLPNGNLVGALYKNPIDCLLKTAKAEGVLGWYKGSTAHFLRIAPHTIITLT 304

Query: 319 FLEQYRGLY--IKY 330
             +    LY  +KY
Sbjct: 305 ANDIITNLYKDLKY 318



>gi|146413973|ref|XP_001482957.1| hypothetical protein PGUG_04912 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 326

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 161/316 (50%), Positives = 199/316 (62%), Gaps = 24/316 (7%)

Query: 22  ARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQA 81
           A     +  L GFL GG AAC AVTFTNP E+VKTR+QLQGEL  + +  VK YRN  QA
Sbjct: 2   AHDSAPVSTLGGFLAGGIAACGAVTFTNPIELVKTRMQLQGELAANQA--VKMYRNPIQA 59

Query: 82  FYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--------S 133
           F VI +NEG+RG+Q+GL   Y  QL +NG R+G Y+P R  L K  N  S         +
Sbjct: 60  FAVIYRNEGIRGLQQGLVCGYLNQLCLNGCRIGLYEPCRYQLTKVLNPDSIVEGQKVPQA 119

Query: 134 MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHN-------YKNTFDALHK 186
           + I+++SGFLAGS GA + SP +L+KTRMQSYS+ AA G  H        YKNT D L K
Sbjct: 120 VSINIVSGFLAGSAGAVLASPFFLIKTRMQSYSSAAATGKIHTSTGQQTYYKNTADGLRK 179

Query: 187 ISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLV 246
           I   E  FKGLFRGVDAA+ RTG GS  QL  Y+F K+   K++ +       H L SLV
Sbjct: 180 IYGSEG-FKGLFRGVDAAIFRTGAGSAAQLPLYYFTKQQFEKHTSIDPSAPSTHFLLSLV 238

Query: 247 SGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHY 306
           +G  V   MNP DV+ TR+YNQ      KG+LY+  +DC +KT+  EG+   YKGF A  
Sbjct: 239 AGVGVAIVMNPGDVVLTRVYNQ------KGNLYRGPIDCLVKTVTTEGVAALYKGFWAQL 292

Query: 307 LRIGPHTILTFVFLEQ 322
           LRIGPHTILT +F+EQ
Sbjct: 293 LRIGPHTILTLMFMEQ 308



>gi|149240559|ref|XP_001526155.1| mitochondrial oxaloacetate transport protein [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146450278|gb|EDK44534.1| mitochondrial oxaloacetate transport protein [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 350

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 214/330 (64%), Gaps = 14/330 (4%)

Query: 7   SGISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTR 66
           SG+  S +    +      + +  + GF+ GG AAC AVTFTNP E++KTR+QLQGEL+R
Sbjct: 19  SGLKKSDDIIKNSTPVNNAQKVSLVGGFIAGGLAACGAVTFTNPIELIKTRMQLQGELSR 78

Query: 67  SNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF 126
           +    VK Y+N FQAF VI ++EG+RG+Q+GL   Y YQL +NG R+G Y+P R    K 
Sbjct: 79  TEKGQVKLYKNPFQAFKVIYQHEGIRGLQQGLLCGYYYQLGLNGCRIGLYEPSRYYFTKL 138

Query: 127 FNTS-------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKN 179
              S       S +M I++LSGF +G+ GA + SP +L+KTRMQS+S   A+G Q +Y++
Sbjct: 139 LYPSNIKNGVVSENMLINVLSGFTSGAAGAVLASPFFLIKTRMQSFSKTGAVGQQTHYES 198

Query: 180 TFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILV 239
            +D + +I + E  FKGL+RGVDAA++RTG GS  QL  Y++ K  V+K+  + D+++++
Sbjct: 199 AWDGIKQIYRHEG-FKGLYRGVDAAILRTGAGSSAQLPIYYYTKNFVLKHDIVKDNSLML 257

Query: 240 HALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFY 299
           H LS+ ++G  V   MNP+DV+ TRMYNQ      KG+LY + LDCF K +  EG    Y
Sbjct: 258 HFLSASMAGLGVSIVMNPWDVVLTRMYNQ------KGNLYTSPLDCFKKIIAIEGPLALY 311

Query: 300 KGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
           KGF A   R+ PH+ILT +F+EQ   + +K
Sbjct: 312 KGFWAQLFRVAPHSILTLMFMEQCMKVMVK 341



>gi|19114081|ref|NP_593169.1| mitochondrial anion transporter (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74665575|sp|Q9UTN1.1|OAC1_SCHPO RecName: Full=Mitochondrial oxaloacetate transport protein
 gi|6137065|emb|CAB59616.1| mitochondrial anion transporter (predicted) [Schizosaccharomyces
           pombe]
          Length = 320

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 211/322 (65%), Gaps = 24/322 (7%)

Query: 25  KETIKALP--------------GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSN 70
           K+TIKALP              GFL GG AAC AVT TNP+EV+KTR QLQG+LT+ + +
Sbjct: 4   KQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDPS 63

Query: 71  YVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--N 128
             + Y+++ QAF +I ++EG+RG+Q+GLG AY YQ+ +NG RLGFY+PIR +L  +F  +
Sbjct: 64  K-RIYKSVGQAFSLIARHEGIRGLQRGLGTAYVYQICLNGCRLGFYEPIRRTLNTWFLDD 122

Query: 129 TSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKIS 188
                + I++ SG  +G  GA  GSP +LVKTRMQSYS    +G Q+ YK+ F+A  +I 
Sbjct: 123 PKGNKLAINVASGAGSGLCGALFGSPFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSRII 182

Query: 189 KEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSG 248
           KE    KGLF G DAA++RT  GS  QL  Y + KR +I++  + ++ ++ H  +S VSG
Sbjct: 183 KENG-VKGLFVGADAAILRTVSGSSVQLPIYNWAKR-MIEHYNLLEEGMIKHLTASAVSG 240

Query: 249 FCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLR 308
           F VC TM  FD + TRMYNQK  +     LYKN +DC +KT+R+EG F  YKGFGAH  R
Sbjct: 241 FGVCCTMQIFDTVMTRMYNQKNKE-----LYKNPIDCILKTIRSEGFFALYKGFGAHLAR 295

Query: 309 IGPHTILTFVFLEQYRGLYIKY 330
           I PHTI    F+EQ   L++K+
Sbjct: 296 IAPHTIFCLTFVEQTNKLFLKF 317



>gi|255726032|ref|XP_002547942.1| mitochondrial oxaloacetate transport protein [Candida tropicalis
           MYA-3404]
 gi|240133866|gb|EER33421.1| mitochondrial oxaloacetate transport protein [Candida tropicalis
           MYA-3404]
          Length = 355

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 206/310 (66%), Gaps = 20/310 (6%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           + +  L GF+ GG AAC AVTFTNP E++KTR+QLQGEL +++ + V  Y+N  QAF VI
Sbjct: 37  QKVSTLGGFIAGGVAACMAVTFTNPIELIKTRMQLQGELAKTSKDAVMLYKNPIQAFGVI 96

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS---------MPI 136
            KNEG+RG+Q+GL + Y YQ+ +NG RLGFY+P R  + K    S+ S         + +
Sbjct: 97  YKNEGIRGLQQGLVSGYYYQIGLNGCRLGFYEPSRYYITKVVAPSTISDDGHITKPNLMV 156

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF----AAIGHQHNYKNTFDALHKISKEER 192
           ++ +GF++G+ GA + SPL+L+KTRMQSYS      AA+G Q  YKNT+D + KI   E 
Sbjct: 157 NVAAGFVSGAAGAVLASPLFLIKTRMQSYSKSHTGGAAVGEQTYYKNTWDGISKIFHSEG 216

Query: 193 YFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVC 252
            FKGL+RGVDAA++RTG GS  QL +Y+  K  ++K++   ++   ++ +SS+++G  V 
Sbjct: 217 -FKGLYRGVDAAILRTGAGSAAQLPTYYLTKSFLLKHNLAKENTFTLNFISSIMAGLGVA 275

Query: 253 FTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPH 312
             MNP+DV+ TRMYNQK D      LY   LDCF KT+  EG    YKGF A   RIGPH
Sbjct: 276 IVMNPWDVVLTRMYNQKGD------LYNGPLDCFKKTISTEGPMALYKGFWAQLFRIGPH 329

Query: 313 TILTFVFLEQ 322
           TILT +F+EQ
Sbjct: 330 TILTLLFMEQ 339



>gi|50304305|ref|XP_452102.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641234|emb|CAH02495.1| KLLA0B12826p [Kluyveromyces lactis]
          Length = 319

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 159/313 (50%), Positives = 203/313 (64%), Gaps = 16/313 (5%)

Query: 15  QQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP 74
           Q+   N+  A   +     F+ GG AAC AVT TNP++ VKTR+QLQGEL   ++N  K 
Sbjct: 5   QEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGEL---HANAAKV 61

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS- 133
           Y N  QAF VI KNEG+ G+QKGL +AY YQ+ +NG+RLGFY+PIR  L   F  +  S 
Sbjct: 62  YTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESH 121

Query: 134 ----MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISK 189
               + I++ +G  +G  GA IGSPL+LVKTRMQSYS    IG Q +Y + F+ L  I +
Sbjct: 122 KVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFR 181

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
            E   KGLFRGVDAAM+RTG+GS  QL  Y   K  ++K+  M+D   L H LSS ++GF
Sbjct: 182 SEG-IKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGL-HLLSSTIAGF 239

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   MNP+DV+ TR+YNQ      KG+LY   +DCFIKT+R EG+   YKGFGA  LRI
Sbjct: 240 GVGVAMNPWDVVLTRVYNQ------KGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRI 293

Query: 310 GPHTILTFVFLEQ 322
           GPHT+L   F+EQ
Sbjct: 294 GPHTVLCLTFMEQ 306



>gi|392570952|gb|EIW64124.1| mitochondrial carrier [Trametes versicolor FP-101664 SS1]
          Length = 321

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 200/317 (63%), Gaps = 12/317 (3%)

Query: 17  TTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYR 76
           T A  +R   T++   GFL GG AAC AVT +NP EV KTR+QLQGEL +     V  Y+
Sbjct: 3   TPAAPSRPLSTVE---GFLCGGLAACMAVTVSNPAEVAKTRMQLQGELAKQGGTKV--YK 57

Query: 77  NIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MP 135
           N         +NEG+RGIQ+GLG AY YQ++MNG+RLGFY+PIR    KF   + T  +P
Sbjct: 58  NALDVIAKTWRNEGIRGIQRGLGPAYIYQILMNGSRLGFYEPIRRQCNKFIGANPTDQIP 117

Query: 136 I-SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYF 194
           + S+ SG  +G  GA++G+P +L+K RMQ+YS    +G QH YKN+FDA   +   ER F
Sbjct: 118 LTSVFSGAASGMIGASLGNPFFLIKARMQAYSPVLPVGAQHYYKNSFDAFRNVWHAER-F 176

Query: 195 KGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFT 254
           +GL RG+DAA +RT +GS  QL +Y + K  ++    +  D+I    +SS VSG CV   
Sbjct: 177 RGLVRGIDAAALRTAMGSSVQLPTYNWTKNQLVSRGILRSDSIWTFLVSSSVSGLCVLAM 236

Query: 255 MNPFDVISTRMYNQKADQSGK----GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIG 310
           M P D + TRMYNQ   ++ +    G+LYKN +DC  KTL+AEG  G+YKG  AH+LRI 
Sbjct: 237 MQPTDTVLTRMYNQPTVRTPEGRHIGTLYKNPIDCLWKTLKAEGPLGWYKGSTAHFLRIV 296

Query: 311 PHTILTFVFLEQYRGLY 327
           PHTI+T    +   GLY
Sbjct: 297 PHTIVTLTANDLIVGLY 313



>gi|390604510|gb|EIN13901.1| oxaloacetate carrier [Punctularia strigosozonata HHB-11173 SS5]
          Length = 322

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 215/319 (67%), Gaps = 9/319 (2%)

Query: 18  TANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRN 77
           TA    A + +    GF++GG AAC AVTF+NP EV KTRLQLQGEL +    + K YRN
Sbjct: 2   TAPPPSAPKPLSTAEGFVLGGIAACIAVTFSNPAEVAKTRLQLQGELMKGG--FEKVYRN 59

Query: 78  IFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MPI 136
            F  +    +NEGVRG+Q+GL  AYAYQ+++NG+RLGFY+PIR+S+ +    S T  +PI
Sbjct: 60  AFDVWGKTWRNEGVRGLQRGLAPAYAYQILLNGSRLGFYEPIRHSINRLLGWSPTEQVPI 119

Query: 137 -SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFK 195
            S+L+G  +G+ GA++G+PL+L+K RMQ+YS    +G QH+YK++FDAL  I K +++ +
Sbjct: 120 TSLLAGAASGAVGASLGNPLFLIKARMQAYSPALPVGAQHHYKSSFDALATIFKAQKW-R 178

Query: 196 GLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTM 255
           GL  G+DAA++RT +GS  QL SY + K  ++    +  +++  + LSS VSG CVC  M
Sbjct: 179 GLVNGIDAAILRTSMGSSVQLPSYNWTKNQLVSRGILPSNSVWTYLLSSTVSGMCVCIAM 238

Query: 256 NPFDVISTRMYNQKADQ--SGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
            P D   TRMYNQ   +  +G+  G+LYKN +DC  KT++ EG+FG+YKG  AH+LRI P
Sbjct: 239 QPADTALTRMYNQPMVKLPNGRYAGTLYKNPIDCLWKTVKTEGVFGWYKGSTAHFLRIAP 298

Query: 312 HTILTFVFLEQYRGLYIKY 330
           HTI+T    +    LY ++
Sbjct: 299 HTIITLTANDLLINLYRRF 317



>gi|346320702|gb|EGX90302.1| mitochondrial oxaloacetate transport protein [Cordyceps militaris
           CM01]
          Length = 312

 Score =  290 bits (742), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 150/291 (51%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL     N    YR       VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGELQTKGHN-PHHYRGPVHGVRVIVRNEGIRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFYDP+R +L   F  + ++ ++ I+ML G  +G  GAA 
Sbjct: 67  IYRGIGCAYVYQILLNGCRLGFYDPMRQALASMFLHDGAAQNLGINMLCGAGSGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH YKN  D L +I + E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHTYKNALDGLSQIYRGEG-IRGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +++++GM +   L H  SS VSGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHAGMEEGPAL-HLASSAVSGFVVCCFMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK  LDC  KT+R EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYKGVLDCLGKTIRTEGVFAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|378726204|gb|EHY52663.1| MC family mitochondrial carrier protein [Exophiala dermatitidis
           NIH/UT8656]
          Length = 310

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK RLQLQGEL +S    VK YR +F    VI+KNEGVRG
Sbjct: 8   FIAGGLAACGAVTATHPFETVKIRLQLQGEL-QSKDVAVKSYRGVFHGVGVILKNEGVRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G+AY YQ+++NG RLGFY+P+R +  K  F + +  S+ +++ SG  +G  GA  
Sbjct: 67  IYRGIGSAYIYQILLNGCRLGFYEPLRAACTKLIFKDPNVQSLGVNIFSGAASGILGAMA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N+ D L +I K E    GL+RG+ A+M+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHKYRNSIDGLTQIYKSEG-ITGLYRGMGASMVRTGAG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +I+++GM D   L H LSS  SGF VC  M+P D +  R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIRHAGMEDGPAL-HLLSSTASGFVVCCVMHPPDTVMARLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT+  EG+   YKGF AH  RI PHTILT    EQ
Sbjct: 242 ---HGNLYSGIFDCLWKTISTEGVLSVYKGFTAHLARILPHTILTLTLAEQ 289



>gi|315041981|ref|XP_003170367.1| hypothetical protein MGYG_07611 [Arthroderma gypseum CBS 118893]
 gi|311345401|gb|EFR04604.1| hypothetical protein MGYG_07611 [Arthroderma gypseum CBS 118893]
          Length = 310

 Score =  289 bits (740), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+ +E VK RLQLQGEL ++  N  + Y+ +F    VI+KNEG RG
Sbjct: 8   FLAGGLAACGAVTLTHSFETVKIRLQLQGEL-QAKQNVARQYKGVFHGITVILKNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL AAY YQL++NG RL FY+PIR SL   F  +  + SM I++ SG  +G  GAA+
Sbjct: 67  LLRGLDAAYTYQLLLNGCRLSFYEPIRKSLTTSFYDDPKTQSMAINVFSGATSGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS    +G QHNYK + D L KI   E    GL+RG  A+MIRTG G
Sbjct: 127 ASPFFLVKTRLQSYSPILPVGTQHNYKGSTDGLRKIFASEG-VPGLYRGAMASMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR++I++ GM ++ + +H  SS VSG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRNLIRHLGM-EEGLPLHLASSAVSGVVVCIAMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT++AEG+F  YKG  AH  R+ PHT+LT  F+EQ
Sbjct: 242 ---TGNLYNGVFDCVKKTIKAEGLFAIYKGVSAHLARVVPHTVLTLTFMEQ 289



>gi|366987239|ref|XP_003673386.1| hypothetical protein NCAS_0A04410 [Naumovozyma castellii CBS 4309]
 gi|342299249|emb|CCC66999.1| hypothetical protein NCAS_0A04410 [Naumovozyma castellii CBS 4309]
          Length = 323

 Score =  289 bits (739), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 155/304 (50%), Positives = 196/304 (64%), Gaps = 16/304 (5%)

Query: 24  AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFY 83
           A + +     F+ GG AAC AVTFTNP E+VK R+QLQGEL        K YRN  Q   
Sbjct: 15  AAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQ---KVYRNPIQGMG 71

Query: 84  VIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-----MPISM 138
           VI +NEG+RG+QKGL AAY YQ+ +NG+RLGFY+PIRN+L   F  +  S     + I++
Sbjct: 72  VIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINV 131

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
            +G  +G  GA IGSPL+LVKTRMQSYS    IG Q +Y+N ++ L  I++ E  FKGLF
Sbjct: 132 AAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEG-FKGLF 190

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RG+DAA++RTG GS  QL  Y   K  ++K   M D   L H  +S +SG  V   MNP+
Sbjct: 191 RGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGL-HLTASTISGLGVAVVMNPW 249

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           DVI TR+YNQ      KG+LYK  +DCF+KT+R EGI   YKGF A  LRI PHTI+   
Sbjct: 250 DVILTRIYNQ------KGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLT 303

Query: 319 FLEQ 322
           F+EQ
Sbjct: 304 FMEQ 307



>gi|326472582|gb|EGD96591.1| mitochondrial oxaloacetate transporter [Trichophyton tonsurans CBS
           112818]
          Length = 310

 Score =  289 bits (739), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+ +E VK RLQLQGEL   N N  + Y+ +F    VI++NEG RG
Sbjct: 8   FLAGGLAACGAVTLTHSFETVKIRLQLQGELQAKN-NVARQYKGVFHGITVILRNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL AAY YQL++NG RL FY+PIR SL   F  +  + SM I++ SG  +G  GAA+
Sbjct: 67  LLRGLDAAYTYQLLLNGCRLSFYEPIRKSLSTSFYDDPKTQSMAINVFSGATSGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS    +G QHNYK + D L KI   E    GL+RG  A+MIRTG G
Sbjct: 127 ASPFFLVKTRLQSYSPILPVGTQHNYKGSTDGLRKIFASEG-VPGLYRGAMASMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR++I++ GM ++ + +H  SS VSG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRNLIRHLGM-EEGLPLHLTSSAVSGVVVCIAMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT++AEG+F  YKG  AH  R+ PHT+LT  F+EQ
Sbjct: 242 ---SGNLYNGVFDCVKKTIKAEGLFAIYKGVSAHLARVVPHTVLTLTFMEQ 289



>gi|346972028|gb|EGY15480.1| mitochondrial oxaloacetate transporter [Verticillium dahliae
           VdLs.17]
          Length = 310

 Score =  289 bits (739), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 194/294 (65%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  FL GG AAC AVT T+P+E VK R+QLQGEL        K YR   Q   VIV+NEG
Sbjct: 5   LGAFLAGGIAACGAVTATHPFETVKIRMQLQGELQDKGHQPHK-YRGPLQGVSVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFG 148
           V+GI +G+G+AY YQ+++NG RLGFY+P+R +L K  F ++   S+ ++M+ G  +G  G
Sbjct: 64  VKGIYRGIGSAYIYQILLNGCRLGFYEPMRGTLTKLVFDDSKVQSLGVNMICGAGSGIIG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA+GSP +LVKTR+QS+S F  +G QHNYKN ++    I K E   +GL+RGV AAMIRT
Sbjct: 124 AAMGSPFFLVKTRLQSFSPFLPVGTQHNYKNAWNGFTSIYKAEGG-RGLYRGVGAAMIRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++++ GM +   L H  SS VSGF VC  M+P D I +R+YNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVRHFGMEEGPAL-HLASSTVSGFVVCCVMHPPDTIMSRLYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LYK   DC +KT+R EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ------NGNLYKGVFDCLLKTIRTEGLFAIYKGFVPHLARILPHTILTLSLAEQ 289



>gi|327298817|ref|XP_003234102.1| mitochondrial oxaloacetate transporter [Trichophyton rubrum CBS
           118892]
 gi|326464280|gb|EGD89733.1| mitochondrial oxaloacetate transporter [Trichophyton rubrum CBS
           118892]
          Length = 310

 Score =  289 bits (739), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+ +E VK RLQLQGEL   N N  + Y+ +F    VI++NEG RG
Sbjct: 8   FLAGGLAACGAVTLTHSFETVKIRLQLQGELQAKN-NVARQYKGVFHGITVILRNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL AAY YQL++NG RL FY+PIR SL   F  +  + SM I++ SG  +G  GAA+
Sbjct: 67  LLRGLDAAYTYQLLLNGCRLSFYEPIRKSLTTSFYDDPKTQSMAINVFSGATSGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS    +G QHNYK + D L KI   E    GL+RG  A+MIRTG G
Sbjct: 127 ASPFFLVKTRLQSYSPILPVGTQHNYKGSTDGLRKIFASEG-VPGLYRGAMASMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR++I++ GM ++ + +H  SS VSG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRNLIRHLGM-EEGLPLHLTSSAVSGVVVCIAMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT++AEG+F  YKG  AH  R+ PHT+LT  F+EQ
Sbjct: 242 ---SGNLYNGVFDCVKKTIKAEGLFAIYKGVSAHLARVVPHTVLTLTFMEQ 289



>gi|213402339|ref|XP_002171942.1| mitochondrial oxaloacetate transport protein [Schizosaccharomyces
           japonicus yFS275]
 gi|211999989|gb|EEB05649.1| mitochondrial oxaloacetate transport protein [Schizosaccharomyces
           japonicus yFS275]
          Length = 323

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 206/307 (67%), Gaps = 10/307 (3%)

Query: 25  KETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYV 84
           ++ +  L  FL GG AAC AV  TNP+E++KTR+QLQG+LT+  ++  + Y+ + Q+F +
Sbjct: 18  QQKLTTLNAFLSGGVAACGAVCVTNPFELIKTRMQLQGQLTKL-TDAQRVYKGVGQSFAM 76

Query: 85  IVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGF 142
           I ++EGVRG+Q+GLG A+ YQ+ +NG RLGFYDPIR+ L ++   +    +M I+M+SG 
Sbjct: 77  IARHEGVRGLQRGLGTAFVYQVCLNGCRLGFYDPIRSRLNRWILRDPKKNNMIINMISGA 136

Query: 143 LAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVD 202
            +G  GA +GSP +L+KTRMQS+S    +G Q+ YK+  DA+ +I K     +GL+ G D
Sbjct: 137 GSGFAGALVGSPFFLIKTRMQSFSPKFPVGEQYGYKHMVDAMRRIVKANG-VRGLYAGAD 195

Query: 203 AAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVIS 262
           AA++RT  GS  QL  YF+ KR + +Y+ +S+  I  H  +S  SGF VC  M  FD + 
Sbjct: 196 AAILRTISGSSVQLPIYFWAKRIIERYNLLSEGPI-KHLTASATSGFGVCCVMQIFDTVM 254

Query: 263 TRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           TRMYNQK  +     LYKN +DC +KT+R+EG F  YKGFGAH  RIGPHT+LT  F EQ
Sbjct: 255 TRMYNQKNKE-----LYKNPIDCIVKTIRSEGFFALYKGFGAHLARIGPHTVLTLTFAEQ 309

Query: 323 YRGLYIK 329
              +++K
Sbjct: 310 TNKIFLK 316



>gi|448522354|ref|XP_003868665.1| Oac1 mitochondrial inner membrane transporter [Candida
           orthopsilosis Co 90-125]
 gi|380353005|emb|CCG25761.1| Oac1 mitochondrial inner membrane transporter [Candida
           orthopsilosis]
          Length = 342

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 205/328 (62%), Gaps = 18/328 (5%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN 68
           +   + ++T  N A   + +  L GF+ GG AAC AVTFTNP E+VKTR+QLQGEL++S 
Sbjct: 16  LKKPIVRETPKNNA---QKVTTLGGFIAGGVAACGAVTFTNPIELVKTRMQLQGELSKST 72

Query: 69  SNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN 128
               K Y+N  QAF  I K+EG+RG+Q+GL   Y YQL +NG R+G Y+P R  + +   
Sbjct: 73  GQ-AKLYKNPLQAFSTIYKHEGIRGLQQGLLCGYFYQLGLNGCRIGLYEPSRYYITRLLT 131

Query: 129 TSSTS---MP----ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTF 181
            S      +P    I++++GF++GS GA + SP +LVKTRMQSYS   A+G Q  Y   +
Sbjct: 132 PSKIQDGHVPQNLFINVIAGFVSGSAGAVLASPFFLVKTRMQSYSKTGAVGQQTYYSGAW 191

Query: 182 DALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHA 241
           D L  I K E  FKGL+RGVDAA++RTG GS  QL  Y   K  V+K+    D+ +L+H 
Sbjct: 192 DGLSSIYKTEG-FKGLYRGVDAAILRTGAGSAAQLPVYNLTKNFVLKHDLAKDNTLLLHF 250

Query: 242 LSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKG 301
           +S+ ++G  V   MNP+DV+ TRMYNQ      KG+LYK  LDCF KT+  EG    YKG
Sbjct: 251 ISASMAGLGVAIVMNPWDVVLTRMYNQ------KGNLYKGPLDCFRKTIAIEGPMALYKG 304

Query: 302 FGAHYLRIGPHTILTFVFLEQYRGLYIK 329
           F A   R+GPH+ILT +F+E      +K
Sbjct: 305 FWAQLFRVGPHSILTLIFMEHCMNAMVK 332



>gi|326483607|gb|EGE07617.1| mitochondrial carrier protein [Trichophyton equinum CBS 127.97]
          Length = 310

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+ +E VK RLQLQGEL   N N  + Y+ +F    VI++NEG RG
Sbjct: 8   FLAGGLAACGAVTLTHSFETVKIRLQLQGELQAKN-NVARQYKGVFHGITVILRNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL AAY YQL++NG RL FY+PIR SL   F  +  + SM I++ SG  +G  GAA+
Sbjct: 67  LLRGLDAAYTYQLLLNGCRLSFYEPIRKSLSTSFYDDPKTQSMAINVFSGATSGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS    +G QHNYK + D L KI   E    GL+RG  A+MIRTG G
Sbjct: 127 ASPFFLVKTRLQSYSPILPVGTQHNYKGSTDGLRKIFASEG-VPGLYRGAMASMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR++I++ GM ++ + +H  SS VSG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRNLIRHLGM-EEGLPLHLTSSAVSGVVVCIAMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+L+    DC  KT++AEG+F  YKG  AH  R+ PHT+LT  F+EQ
Sbjct: 242 ---SGNLHNGVFDCVKKTIKAEGLFAIYKGVSAHLARVVPHTVLTLTFMEQ 289



>gi|406867402|gb|EKD20440.1| hypothetical protein MBM_01122 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 311

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 193/301 (64%), Gaps = 11/301 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL +  S   + Y+       VIV+NEG
Sbjct: 5   LGAFVAGGIAACGAVTATHPFETVKIRMQLQGEL-QEKSLQPRMYKGPLHGVSVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFG 148
           VRGI +G+G AY YQ+++NG RLGFY+PIR+++     + ST  S+ I++ SG  +G  G
Sbjct: 64  VRGIYRGIGTAYIYQMILNGCRLGFYEPIRHTITSAICSDSTTQSLGINIFSGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QS+S FA +G QHNYKN  D + +I K E    GL+RGV AAM+RT
Sbjct: 124 AAAGSPFFLVKTRLQSFSPFAPVGTQHNYKNAVDGMMQIYKGEG-VNGLYRGVGAAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR + K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLQKHLGMEDGPAL-HLASSSASGFVVCCVMHPPDTIMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYI 328
                  G+LY+  LDC  KT++ EG+   YKGF  H  RI PHTILT    EQ   L  
Sbjct: 242 ------NGNLYQGVLDCLAKTVKTEGVLAIYKGFLPHLARILPHTILTLSLAEQTNKLMR 295

Query: 329 K 329
           K
Sbjct: 296 K 296



>gi|354547906|emb|CCE44641.1| hypothetical protein CPAR2_404450 [Candida parapsilosis]
          Length = 342

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 196/304 (64%), Gaps = 15/304 (4%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           + +  L GF+ GG AAC AVTFTNP E+VKTR+QLQGEL++S     K Y+N  QAF  I
Sbjct: 30  QKVTTLGGFIAGGVAACGAVTFTNPIELVKTRMQLQGELSKSKGQ-AKLYKNPLQAFATI 88

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-------STSMPISM 138
            K+EG++G+Q+GL   Y YQL +NG R+G Y+P R  L K F  S         ++ I++
Sbjct: 89  YKHEGIKGLQQGLMCGYFYQLGLNGCRIGLYEPSRYYLTKMFAPSKIQNGHVPQNLLINV 148

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
           ++GF++GS GA + SP +LVKTRMQSYS   A+G Q  Y    D L  I + E  FKGL+
Sbjct: 149 VAGFVSGSAGAVLASPFFLVKTRMQSYSKTGAVGQQTYYSGALDGLTSIYRAEG-FKGLY 207

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RGVDAA++RTG GS  QL  Y   K  V+K+    D+ +L+H +S+ ++G  V   MNP+
Sbjct: 208 RGVDAAILRTGAGSAAQLPVYNLTKNFVLKHHIAKDNTLLLHFISASMAGLGVAIVMNPW 267

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           DV+ TRMYNQ      KG+LYK  LDCF KT+  EG    YKGF A   R+GPH+ILT +
Sbjct: 268 DVVLTRMYNQ------KGNLYKGPLDCFRKTISIEGPMALYKGFWAQLFRVGPHSILTLI 321

Query: 319 FLEQ 322
           F+E 
Sbjct: 322 FMEH 325



>gi|512204900|gb|EPE33722.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868]
          Length = 310

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 196/304 (64%), Gaps = 15/304 (4%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP--YRNIFQAFYVIVKN 88
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL       ++P  YR       VIV+N
Sbjct: 5   LGAFVAGGIAACGAVTATHPFETVKIRMQLQGELQEKG---LQPRMYRGPIHGVSVIVRN 61

Query: 89  EGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGS 146
           EGVRGI +G+GAAY YQ+++NG RLGFY+PIR ++    F + ++ S+ +++ +G  +G 
Sbjct: 62  EGVRGIYRGIGAAYIYQMILNGCRLGFYEPIRQTITSSIFTDKTTQSLGVNIFAGASSGI 121

Query: 147 FGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMI 206
            GAA GSP +LVKTR+QS+S FA +G QH YKN  D + +I K E   KGL+RGV AAM+
Sbjct: 122 LGAAAGSPFFLVKTRLQSFSPFAPVGTQHAYKNAVDGMRQIYKGEGA-KGLYRGVGAAMV 180

Query: 207 RTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMY 266
           RTG GS  QL +YFF KR ++K+ GM D+   +H  SS  SGF VC  M+P D I +RMY
Sbjct: 181 RTGFGSSVQLPTYFFAKRRLVKHLGM-DEGPALHLASSTASGFVVCCVMHPPDTIMSRMY 239

Query: 267 NQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
           NQ       G+LY+   DC  KT++ EG+   YKGF  H  RI PHTILT    EQ   L
Sbjct: 240 NQ------NGNLYQGVFDCLAKTVKTEGLLAIYKGFLPHLARILPHTILTLSLAEQTNKL 293

Query: 327 YIKY 330
             K+
Sbjct: 294 MRKF 297



>gi|259489744|tpe|CBF90267.1| TPA: mitochondrial oxaloacetate transporter (Oac), putative
           (AFU_orthologue; AFUA_5G12360) [Aspergillus nidulans
           FGSC A4]
          Length = 310

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 192/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S  VK Y+ +     VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKSEAVKKYKGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSL-EKFFNTSST-SMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+PIRN L    +N S   S+ I++ +G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPIRNGLTTAVYNDSHVQSLGINVFAGASSGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHQYRNSFDGLRKIFASEG-VGGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGMEDGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+R EG+F  YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLAKTIRTEGLFAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|296420153|ref|XP_002839645.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635828|emb|CAZ83836.1| unnamed protein product [Tuber melanosporum]
          Length = 304

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 193/294 (65%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L GF+ GG AAC AVT T+ +E VKTRLQLQGEL+ + S   + Y  +FQ   VI+ NEG
Sbjct: 5   LGGFIAGGIAACGAVTVTHGFETVKTRLQLQGELS-AKSQTKRVYTGVFQGVRVILVNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS--TSMPISMLSGFLAGSFG 148
            RG+  GLGAAY YQ ++NG RLGFY+PIR+S  +  ++     S+ +++ +G  +G  G
Sbjct: 64  PRGLMAGLGAAYCYQTMLNGCRLGFYEPIRSSATRLVHSDPHHQSIGVNVFAGATSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           A +GSP +LVKTR+QSYS    +G QHNY+N  D    IS+ E  FKGL+RGV +AM+RT
Sbjct: 124 AMVGSPFFLVKTRLQSYSPSLPVGTQHNYRNALDGFRTISRTEG-FKGLYRGVGSAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR + KY G+  + + +H  SS VSGF VC  M+P D + +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLQKYLGL-REGVGLHLASSAVSGFVVCCVMHPPDTVMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY N  DC +KT+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ------SGNLYTNAFDCLMKTVRTEGLLAIYKGYFAHLARILPHTILTLTLAEQ 289



>gi|296809812|ref|XP_002845244.1| mitochondrial oxaloacetate transport protein [Arthroderma otae CBS
           113480]
 gi|238842632|gb|EEQ32294.1| mitochondrial oxaloacetate transport protein [Arthroderma otae CBS
           113480]
          Length = 310

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+ +E VK RLQLQGEL   N N  + Y+ +F    VI+KNEG RG
Sbjct: 8   FLAGGLAACGAVTLTHSFETVKIRLQLQGELQAKN-NVARQYKGVFHGITVILKNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL AAY YQL++NG RL FY+PIR SL    + +  + SM I++ SG  +G  GAA+
Sbjct: 67  LLRGLDAAYTYQLLLNGCRLSFYEPIRKSLTTSIYDDPKTQSMAINVFSGATSGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS    +G QH+YK + D L KI   E    GL+RG  A+MIRTG G
Sbjct: 127 ASPFFLVKTRLQSYSPILPVGTQHHYKGSTDGLRKIFASEG-VPGLYRGAMASMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR++I++ GM ++ + +H  SS VSG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRNLIRHLGM-EEGLPLHLTSSAVSGVVVCIAMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT++AEG+F  YKG  AH  R+ PHT+LT  F+EQ
Sbjct: 242 ---SGNLYNGVFDCVKKTIKAEGLFAIYKGVSAHLARVVPHTVLTLTFMEQ 289



>gi|399166904|emb|CCE32261.1| probable oxaloacetate/sulfate carrier [Claviceps purpurea 20.1]
          Length = 307

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 189/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+P+E+VK R+QLQGEL +S  +    YR       VI++NEG+RG
Sbjct: 8   FLAGGLAACGAVTATHPFEIVKIRMQLQGEL-QSKGHQPHHYRGPVHGVGVILRNEGIRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +GLG AY YQ+++NG RLGFYDP+R +L   F  N  + ++ I+M  G  +G  GAA 
Sbjct: 67  LYRGLGTAYIYQILLNGCRLGFYDPMRKALGSVFLHNEKAQNLGINMFCGAFSGMMGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N  D L +I + E    GL+RG+ AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHQYRNAVDGLTRIHRTEGVL-GLYRGIGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +++++GM +   L H  SS VSGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHAGMEEGPAL-HLTSSAVSGFVVCCVMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY+   DC  KT+R EG F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYRGVFDCLGKTIRTEGFFAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|426201239|gb|EKV51162.1| hypothetical protein AGABI2DRAFT_113903 [Agaricus bisporus var.
           bisporus H97]
          Length = 314

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 196/303 (64%), Gaps = 9/303 (2%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVR 92
           GF+ G  AA +AVT +NP EV KTRLQLQGEL +     V  Y++ F  +    +NEG+R
Sbjct: 9   GFVCGAIAASTAVTVSNPAEVAKTRLQLQGELAKGGGKRV--YKHTFDVWAKTWRNEGIR 66

Query: 93  GIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF--FNTSSTSMPISMLSGFLAGSFGAA 150
           G+Q+GL  AYAYQ+++NG+RLGFY+P R S  +F  +N        S+L+G ++G+ GA+
Sbjct: 67  GLQRGLPPAYAYQILLNGSRLGFYEPFRKSFNRFLGWNPEEVIPLTSVLAGAVSGAVGAS 126

Query: 151 IGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           +G+PL+L+K RMQ+YS    +G Q++YK++FDAL  I + E   +GL RG+DAA++RT +
Sbjct: 127 MGNPLFLIKARMQAYSAALPVGAQYHYKSSFDALRTILRAEGP-RGLIRGIDAAILRTSM 185

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQK- 269
           GS  QL SY F K  ++K+  +  D+     LSS VSG CVC  M P D   TRMYNQ  
Sbjct: 186 GSSVQLPSYNFTKSQIVKHGILPADSTWTFFLSSTVSGACVCVVMQPADTALTRMYNQPT 245

Query: 270 ---ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
               D   +G+LYKN +DC  KT R EGI G YKG  AH++RI PHTI+T    +   GL
Sbjct: 246 IVGPDGKARGTLYKNPIDCLWKTFRIEGIRGLYKGSTAHFMRIAPHTIITLTVNDLIVGL 305

Query: 327 YIK 329
           Y +
Sbjct: 306 YTR 308



>gi|302697945|ref|XP_003038651.1| hypothetical protein SCHCODRAFT_47868 [Schizophyllum commune H4-8]
 gi|300112348|gb|EFJ03749.1| hypothetical protein SCHCODRAFT_47868 [Schizophyllum commune H4-8]
          Length = 318

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 200/302 (66%), Gaps = 11/302 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT +NP EV KTRLQLQGEL  S     + Y N+F  F    +NEG+RG
Sbjct: 16  FICGGIAACVAVTISNPAEVAKTRLQLQGELGASQ----RVYNNVFDVFTKTWRNEGIRG 71

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF-NTSSTSMPI-SMLSGFLAGSFGAAI 151
           +Q+GLG AY YQ+++NG+RLGFY+P R++L K     +S  +PI S+++G  +G+ GA +
Sbjct: 72  LQRGLGPAYVYQILLNGSRLGFYEPFRHNLNKLIGRDASEQIPITSVIAGASSGAVGATL 131

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           G+ LYLVK RMQ+YS    +G QH+YKN+FDAL  I +++   +GL RG+DAA++RT +G
Sbjct: 132 GNSLYLVKARMQAYSPSLPVGTQHHYKNSFDALSTIVRKDG-VRGLARGIDAAILRTSMG 190

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL SY F K  ++K+  +  D+      SS VSG CVC  M P D   TR+YNQ   
Sbjct: 191 SSVQLPSYNFTKTQLVKHGLLPADSTWTFLASSTVSGICVCIVMQPADTALTRVYNQPTV 250

Query: 272 Q--SGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
           +  +G+  G+LYKN +DC  KT +AEG+ G+YKG  AH+ RI PHTI+T    +   GLY
Sbjct: 251 KLPNGRSVGALYKNPIDCLWKTFKAEGLKGWYKGSTAHFFRIAPHTIVTLTANDIILGLY 310

Query: 328 IK 329
            K
Sbjct: 311 KK 312



>gi|320583856|gb|EFW98069.1| mitochondrial inner membrane oxaloacetate transporter, putative
           [Ogataea parapolymorpha DL-1]
          Length = 314

 Score =  286 bits (731), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 204/309 (66%), Gaps = 24/309 (7%)

Query: 24  AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFY 83
           A + +  + GF+ GG AAC AVT TNP E+VKTR+QL+GEL+ S +N  + Y+N FQA  
Sbjct: 6   ASQKVSTVGGFIAGGLAACGAVTVTNPIELVKTRMQLEGELS-SATNTPRVYKNPFQALG 64

Query: 84  VIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNT---------SSTSM 134
           +I KNEG+RG QKGL  AY YQL +NG RLG Y+P+RN    F N+         S  S+
Sbjct: 65  LIFKNEGIRGCQKGLFCAYIYQLGLNGCRLGLYEPVRN----FINSVIFPSKDAHSVQSI 120

Query: 135 PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISK-EERY 193
           P+++ +G L+G  GA +GSP YL+KTRMQSYS    IG Q +Y +T++ L  +S+  +  
Sbjct: 121 PVNVAAGALSGIAGAIVGSPFYLIKTRMQSYSPSIKIGEQTHYTSTWNGL--VSQYRQGG 178

Query: 194 FKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCF 253
             GLFRGVDAA+IRTG+GS  QL  Y F K  ++K +G+ ++   +H LSS +SG  V  
Sbjct: 179 LSGLFRGVDAAIIRTGMGSSVQLPIYNFAKHELLK-TGLIEEGPHLHLLSSTISGLGVGV 237

Query: 254 TMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
            MNP DVI TR+YNQK ++      Y   +DC IKT+++EGI   YKGFGA  LRI PHT
Sbjct: 238 VMNPGDVILTRVYNQKGNK------YSGPIDCLIKTVKSEGIGALYKGFGAQLLRIAPHT 291

Query: 314 ILTFVFLEQ 322
           +LT  F+EQ
Sbjct: 292 VLTLTFMEQ 300



>gi|477529411|gb|ENH81175.1| mitochondrial oxaloacetate transporter [Colletotrichum orbiculare
           MAFF 240422]
          Length = 310

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 192/294 (65%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL +   +    YR   Q   VIV+NEG
Sbjct: 5   LGAFIAGGIAACGAVTATHPFETVKIRMQLQGEL-KDKGHQPHQYRGPLQGVSVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFG 148
           V+GI +G+G AY YQ+++NG RLGFY+P+RN+L      +  + S+ I+ML G  +G  G
Sbjct: 64  VKGIYRGIGCAYVYQVLLNGCRLGFYEPMRNTLATLIYKDGKTQSLGINMLCGAGSGIMG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QS+S F  +G QH Y+N ++ L  I   E   +GL+RGV AAMIRT
Sbjct: 124 AAAGSPFFLVKTRLQSFSPFLPVGTQHKYRNAWNGLSTIYGTEG-IRGLYRGVGAAMIRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++++ GM ++ + +H  SS VSGF VC  M+P D I +R+YNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVRHLGM-EEGLPLHLASSTVSGFVVCCVMHPPDTIMSRLYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LYK   DC  KT+R EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ------NGNLYKGVFDCLSKTVRTEGLFAIYKGFLPHLARILPHTILTLTLAEQ 289



>gi|367026732|ref|XP_003662650.1| hypothetical protein MYCTH_2303534 [Myceliophthora thermophila ATCC
           42464]
 gi|347009919|gb|AEO57405.1| hypothetical protein MYCTH_2303534 [Myceliophthora thermophila ATCC
           42464]
          Length = 310

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +   +    YR       VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QDKGHQPHHYRGPIHGVSVIVRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFY+P+RN+L    F +  + S+ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGCAYIYQILLNGCRLGFYEPMRNALSTLIFKDGKTQSLGINMFCGAASGVMGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N  D + +I + E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHRYRNALDGMTQIYRTEG-VRGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS VSGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHLGMEEGAPL-HLTSSTVSGFVVCVVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT+R EGIF  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYAGVFDCLAKTIRTEGIFAIYKGFLPHLARILPHTILTLTLAEQ 289



>gi|449541678|gb|EMD32661.1| hypothetical protein CERSUDRAFT_118687 [Ceriporiopsis subvermispora
           B]
          Length = 323

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 144/301 (47%), Positives = 189/301 (62%), Gaps = 9/301 (2%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVR 92
           GF+ GGAAAC AVT +NP EV KTRLQLQGEL + N   V  Y+N         KNEG+R
Sbjct: 16  GFVCGGAAACVAVTISNPAEVAKTRLQLQGELAKGNVPKV--YKNTLDVMAKTWKNEGIR 73

Query: 93  GIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM--PISMLSGFLAGSFGAA 150
           G+Q+GLG AY YQ+++NG+RLGFY+PIR    +    S        S+ +G  +G+ GA 
Sbjct: 74  GVQRGLGPAYVYQILLNGSRLGFYEPIRRGTNQLLGISPDEQRPATSVFAGAFSGTIGAC 133

Query: 151 IGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           +G+PL+L+K RMQ+YS    +G QH+YK++ +AL  I + ER F+GL RG+DAA++RT +
Sbjct: 134 LGNPLFLIKARMQAYSPALPVGTQHHYKSSLNALATIWRAER-FRGLVRGIDAAILRTSM 192

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQK- 269
           GS  QL SY + K  ++    M  D+IL    SS VSG CV   M P D   TR+YNQ  
Sbjct: 193 GSSVQLPSYNWTKNQLVSRGIMPADSILTFLASSSVSGLCVLAMMQPADTALTRVYNQPV 252

Query: 270 ---ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
               D    G+LYKN +DC  KTL+ EG  G+YKG  AH+ RI PHTI+T    +   GL
Sbjct: 253 VRLPDGRHVGTLYKNPIDCLWKTLKTEGPLGWYKGSTAHFFRIAPHTIVTLTANDIIVGL 312

Query: 327 Y 327
           Y
Sbjct: 313 Y 313



>gi|367051110|ref|XP_003655934.1| hypothetical protein THITE_2120241 [Thielavia terrestris NRRL 8126]
 gi|347003198|gb|AEO69598.1| hypothetical protein THITE_2120241 [Thielavia terrestris NRRL 8126]
          Length = 310

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +   +    YR  F    VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QDKGHQPHHYRGPFHGVSVIVRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           I +GLG AY YQ+++NG RLGFY+P+RN+L    F +  + S+ I+M  G  +G  GAA 
Sbjct: 67  IYRGLGCAYVYQVLLNGCRLGFYEPMRNALATLIFKDGKTQSLGINMFCGAASGIMGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N +D L +I   E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHRYRNAWDGLRQIYGSEG-VRGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS VSGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHLGMEEGPAL-HLTSSTVSGFAVCVVMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT+R EG F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYAGVFDCLAKTVRTEGFFAIYKGFLPHLARILPHTILTLTLAEQ 289



>gi|400598876|gb|EJP66583.1| mitochondrial oxaloacetate transport protein [Beauveria bassiana
           ARSEF 2860]
          Length = 360

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++       YR       VIV+NEGV G
Sbjct: 56  FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QTKGRQPHHYRGPLHGVGVIVRNEGVGG 114

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G AY YQ+++NG RLGFYDP+R +L   F  + ++ ++ ++M  G  +G  GAA 
Sbjct: 115 LYRGIGCAYVYQILLNGCRLGFYDPMRQALASLFLRDGNAQNLGVNMFCGAASGVIGAAA 174

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH YKN FD + +I + E   +GL+RGV AAMIRTG G
Sbjct: 175 GSPFFLVKTRLQSFSPFLPVGTQHTYKNAFDGMAQIYRAEG-LRGLYRGVGAAMIRTGFG 233

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +++++GM +   L H  SS VSGF VC  M+P D I +R+YNQ   
Sbjct: 234 SSVQLPTYFFAKRRLMRHAGMEEGPAL-HLASSAVSGFVVCCFMHPPDTIMSRLYNQ--- 289

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK  LDC  KT+R EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 290 ---NGNLYKGVLDCLGKTIRTEGVFAIYKGFLPHLARILPHTILTLSLAEQ 337



>gi|470298577|ref|XP_004346210.1| solute carrier family 25 member 34 [Capsaspora owczarzaki ATCC
           30864]
 gi|320170700|gb|EFW47599.1| solute carrier family 25 member 34 [Capsaspora owczarzaki ATCC
           30864]
          Length = 337

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 198/298 (66%), Gaps = 9/298 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           + +GG A+  A  F+NP+EVVKTRLQLQGEL  +  NYVK Y N   AF  I + EG+R 
Sbjct: 34  YFLGGMASLMACLFSNPFEVVKTRLQLQGELL-ARGNYVKAYNNAGHAFITIARQEGLRA 92

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS---MPISMLSGFLAGSFGAA 150
           +Q+GL  A AYQL MNG RLG +DPIR +L    +  ++    +  ++ SG ++G+ GA+
Sbjct: 93  LQRGLSPALAYQLFMNGTRLGVFDPIRRNLIALTHEPTSQRQLIAFNVASGAISGAIGAS 152

Query: 151 IGSPLYLVKTRMQSYSTF--AAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           IGSP +L+K+R+Q+ ++    A GHQHNYK   DA  +I  +E    G FRGV+ A+ R 
Sbjct: 153 IGSPFFLIKSRIQAQTSAKGVAFGHQHNYKGVVDAFRQIYAQEGLL-GFFRGVNGAVPRV 211

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
            VGS  QLSSY FIKR V++ +G  D++   H LSS  +GF V   MNPFDV+STR+YNQ
Sbjct: 212 MVGSAVQLSSYDFIKRLVMRETGW-DNSFPTHLLSSFGAGFVVTVFMNPFDVVSTRLYNQ 270

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
           +    GKG++Y   +DCF K   +EG+ GFYKGF AHY R+ PHT+LTF+F EQ + L
Sbjct: 271 QV-VDGKGAMYNGLIDCFRKVRASEGVRGFYKGFSAHYFRLAPHTVLTFIFWEQLKKL 327



>gi|395334874|gb|EJF67250.1| mitochondrial carrier [Dichomitus squalens LYAD-421 SS1]
          Length = 321

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 195/312 (62%), Gaps = 9/312 (2%)

Query: 22  ARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQA 81
           A   + + +  GF+ GG AAC AVT +NP EV KTR+QLQGEL +  +  V  Y+N    
Sbjct: 5   APGTKPLSSAEGFVCGGTAACVAVTVSNPAEVAKTRMQLQGELAKRGAPKV--YKNALDV 62

Query: 82  FYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MPI-SML 139
                +NEG+RG+Q+GLG AY YQ++MNG+RLGFY+PIR ++ K      T  +P+ S+ 
Sbjct: 63  IAKTWQNEGIRGVQRGLGPAYVYQILMNGSRLGFYEPIRRNVNKLVGAKPTDQIPLTSLF 122

Query: 140 SGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFR 199
           SG  +G  GA++G+P +L+K RMQ+YS    +G QH YK+++DAL  I K E+ F+GL R
Sbjct: 123 SGAASGIIGASVGNPFFLIKARMQAYSPVLPVGAQHYYKSSWDALKSIWKAEK-FRGLVR 181

Query: 200 GVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFD 259
           G+DAA +RT +GS  QL +Y + K  +I       D++     SS VSG CV   M P D
Sbjct: 182 GIDAAALRTAMGSSVQLPTYNWTKNQLISRGISRGDSVWTFLASSSVSGLCVLMMMQPTD 241

Query: 260 VISTRMYNQK----ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTIL 315
            + TRMYNQ      D    G+LYKN LDC  KT +AEG  G+YKG  AH+LRI PHTI+
Sbjct: 242 TVLTRMYNQPTIPTPDGRHIGALYKNPLDCLWKTFKAEGPLGWYKGSTAHFLRIVPHTIV 301

Query: 316 TFVFLEQYRGLY 327
           T    +   G+Y
Sbjct: 302 TLTANDIIVGIY 313



>gi|225684488|gb|EEH22772.1| mitochondrial oxaloacetate transport protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 310

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 192/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ Y+ +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKQEAVRKYKGVFHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  + +  + ++S  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQILLNGCRLGFYEPLRVGITRAIYKDSSRQSLGINVFSGAASGVLGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N++D L +I   E   KGL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHMYRNSWDGLRQIHAAEG-VKGLYRGVTAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLTSSSCSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTITKEGILAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|365759749|gb|EHN01523.1| Oac1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|401841739|gb|EJT44080.1| OAC1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 324

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 201/319 (63%), Gaps = 16/319 (5%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN 68
           +S++ ++Q    +  A + I     F+ GG AAC AVT TNP E++K R+QLQGE++ S 
Sbjct: 1   MSSADSKQEKEVEKTAAQKISKFGSFMAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60

Query: 69  SNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF- 127
           +   K Y+N  Q   VI KNEG++G+QKGL AAY YQ+ +NG+RLGFY+PIR+SL + F 
Sbjct: 61  A---KVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF 117

Query: 128 ----NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
               +    S+ +++ SG  +G  GA +GSPL+LVKTR+QSYS F  IG Q +Y   ++ 
Sbjct: 118 PGQESHKVQSVGVNVFSGAASGIIGAVVGSPLFLVKTRLQSYSEFIKIGEQTHYSGVWNG 177

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L  I K E   KGLFRG+DAA++RTG GS  QL  Y   K  ++K   M D   L H  +
Sbjct: 178 LVTIFKTEG-VKGLFRGIDAAILRTGAGSSVQLPIYNTAKSILVKNDLMKDGPAL-HLTA 235

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S +SG  V   MNP+DVI TR+YNQK D      LYK  +DC +KT++ EG+   YKGF 
Sbjct: 236 STISGLGVAVVMNPWDVILTRIYNQKGD------LYKGPIDCLVKTVKIEGVTALYKGFA 289

Query: 304 AHYLRIGPHTILTFVFLEQ 322
           A   RI PHTI+   F+EQ
Sbjct: 290 AQVFRIAPHTIMCLTFMEQ 308



>gi|345568473|gb|EGX51367.1| hypothetical protein AOL_s00054g437 [Arthrobotrys oligospora ATCC
           24927]
          Length = 303

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 191/292 (65%), Gaps = 11/292 (3%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVR 92
           GF+ GG AAC AVT TNP+EVVKTRLQLQGEL  S ++  K Y  IFQA ++I K EGVR
Sbjct: 8   GFIAGGLAACGAVTVTNPFEVVKTRLQLQGELA-SRAHVKKIYTGIFQALHLIYKTEGVR 66

Query: 93  GIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST-SMP-ISMLSGFLAGSFGAA 150
           G QKGLG AY YQ+++NG RLGFY+PIR++  + F   S   +P I++ +G  +G  G  
Sbjct: 67  GTQKGLGCAYIYQILLNGCRLGFYEPIRSTATRLFTGDSRHQIPYINVFAGATSGIIGGI 126

Query: 151 IGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
            GSP +L KTR+QSYS    +G QH YKN  +A   I   E  FKGL+RGV +A++RTG 
Sbjct: 127 AGSPFFLFKTRLQSYSPAFPVGTQHPYKNFVEAGRTIYSAEG-FKGLYRGVTSAIVRTGA 185

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKA 270
           GS  QL +YFF KR + KY G+ ++  L H  +S  SG  VC  M+P D + +RMYNQ  
Sbjct: 186 GSSVQLPTYFFAKRQIEKY-GLLEEGPLKHIAASSCSGVAVCIVMHPPDTVMSRMYNQ-- 242

Query: 271 DQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                G+LY +  DCF+KT++ EG+F  YKG  AH  RI PHT+LT    EQ
Sbjct: 243 ----NGNLYSSLADCFVKTIKTEGVFALYKGVTAHLARILPHTVLTLSLAEQ 290



>gi|225561745|gb|EEH10025.1| mitochondrial carrier protein [Ajellomyces capsulatus G186AR]
          Length = 310

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKREAVRKYRGVFHGVKVILQNEGARG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R ++ +     ST  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRVNITQAIYKDSTHQSLGINVFSGAASGVLGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+FD L +I   E   KGL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHKYRNSFDGLRQIYMGEG-VKGLYRGVYAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLASSTCSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTISTEGVLAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|6322729|ref|NP_012802.1| Oac1p [Saccharomyces cerevisiae S288c]
 gi|417500|sp|P32332.1|OAC1_YEAST RecName: Full=Mitochondrial oxaloacetate transport protein;
           AltName: Full=Mitochondrial carrier protein PMT
 gi|172205|gb|AAA34886.1| mitochondrial transporter protein [Saccharomyces cerevisiae]
 gi|486202|emb|CAA81961.1| PMT [Saccharomyces cerevisiae]
 gi|5701943|emb|CAB52216.1| mitochondrial oxaloacetate transport protein [Saccharomyces
           cerevisiae]
 gi|7580478|gb|AAB23071.2| YKL522 [Saccharomyces cerevisiae]
 gi|151941685|gb|EDN60047.1| oxaloacetate transporter [Saccharomyces cerevisiae YJM789]
 gi|190409716|gb|EDV12981.1| oxaloacetate transport protein [Saccharomyces cerevisiae RM11-1a]
 gi|207343569|gb|EDZ70996.1| YKL120Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256269917|gb|EEU05175.1| Oac1p [Saccharomyces cerevisiae JAY291]
 gi|259147721|emb|CAY80971.1| Oac1p [Saccharomyces cerevisiae EC1118]
 gi|285813143|tpg|DAA09040.1| TPA: Oac1p [Saccharomyces cerevisiae S288c]
 gi|323304171|gb|EGA57948.1| Oac1p [Saccharomyces cerevisiae FostersB]
 gi|323308354|gb|EGA61600.1| Oac1p [Saccharomyces cerevisiae FostersO]
 gi|323332736|gb|EGA74141.1| Oac1p [Saccharomyces cerevisiae AWRI796]
 gi|323336676|gb|EGA77940.1| Oac1p [Saccharomyces cerevisiae Vin13]
 gi|323347746|gb|EGA82010.1| Oac1p [Saccharomyces cerevisiae Lalvin QA23]
 gi|349579447|dbj|GAA24609.1| K7_Oac1p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365764558|gb|EHN06080.1| Oac1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392298319|gb|EIW09417.1| Oac1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 324

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 199/319 (62%), Gaps = 16/319 (5%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN 68
           +S+  ++Q    +  A + I     F+ GG AAC AVT TNP E++K R+QLQGE++ S 
Sbjct: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60

Query: 69  SNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN 128
           +   K Y+N  Q   VI KNEG++G+QKGL AAY YQ+ +NG+RLGFY+PIR+SL + F 
Sbjct: 61  A---KVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF 117

Query: 129 TSST-----SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
                    S+ +++ SG  +G  GA IGSPL+LVKTR+QSYS F  IG Q +Y   ++ 
Sbjct: 118 PDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNG 177

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L  I K E   KGLFRG+DAA++RTG GS  QL  Y   K  ++K   M D   L H  +
Sbjct: 178 LVTIFKTEG-VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPAL-HLTA 235

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S +SG  V   MNP+DVI TR+YNQK D      LYK  +DC +KT+R EG+   YKGF 
Sbjct: 236 STISGLGVAVVMNPWDVILTRIYNQKGD------LYKGPIDCLVKTVRIEGVTALYKGFA 289

Query: 304 AHYLRIGPHTILTFVFLEQ 322
           A   RI PHTI+   F+EQ
Sbjct: 290 AQVFRIAPHTIMCLTFMEQ 308



>gi|170084397|ref|XP_001873422.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650974|gb|EDR15214.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 326

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/311 (46%), Positives = 198/311 (63%), Gaps = 9/311 (2%)

Query: 23  RAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAF 82
           R   +I    GFL GG AAC AVT +NP EV KTRLQLQGEL +     V  Y N    F
Sbjct: 8   RDARSISTAEGFLCGGLAACMAVTVSNPAEVAKTRLQLQGELAKEGVKKV--YNNALDVF 65

Query: 83  YVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MPI-SMLS 140
               KNEG++G+Q+GLG AYAYQ+++NG+RLGFY+P R++L +F   S+   +P  S+++
Sbjct: 66  GKTWKNEGIKGLQRGLGPAYAYQILLNGSRLGFYEPFRHALNRFIGRSAEDQIPFTSVIA 125

Query: 141 GFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRG 200
           G  +G+ GA++G+PL+L+K RMQ++S    +G QH YK++F AL  I   E   +GL RG
Sbjct: 126 GASSGAVGASLGNPLFLIKARMQAFSPALPVGAQHFYKSSFHALATIFHAEG-VRGLVRG 184

Query: 201 VDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDV 260
           +DAA++RT +GS  QL SY F K  ++K+  +  ++      SS +SG CVC  M P D 
Sbjct: 185 IDAAILRTSMGSSVQLPSYIFAKNQLVKHDILPANSTWTFLASSSISGACVCVVMQPADT 244

Query: 261 ISTRMYNQK----ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILT 316
             TRMYNQ      D   +G+LYKN +DC  KT +AEG+ G+YKG  AH+LRI PHTI+T
Sbjct: 245 ALTRMYNQPTILGPDGKTRGALYKNPIDCLWKTFKAEGVRGWYKGSTAHFLRIAPHTIIT 304

Query: 317 FVFLEQYRGLY 327
               +    LY
Sbjct: 305 LTMNDIIIDLY 315



>gi|85109231|ref|XP_962817.1| mitochondrial oxaloacetate transport protein [Neurospora crassa
           OR74A]
 gi|28924453|gb|EAA33581.1| mitochondrial oxaloacetate transport protein [Neurospora crassa
           OR74A]
 gi|336469282|gb|EGO57444.1| mitochondrial oxaloacetate transport protein [Neurospora
           tetrasperma FGSC 2508]
 gi|350291084|gb|EGZ72298.1| mitochondrial oxaloacetate transport protein [Neurospora
           tetrasperma FGSC 2509]
          Length = 309

 Score =  283 bits (723), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 152/293 (51%), Positives = 189/293 (64%), Gaps = 15/293 (5%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP--YRNIFQAFYVIVKNEGV 91
           F+ GG AAC AVT T+P+E VK R+QLQGEL  S S+   P  YR       VIV+NEG+
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGELQSSTSS---PHFYRGPIHGVSVIVRNEGL 64

Query: 92  RGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK-FFNTSST-SMPISMLSGFLAGSFGA 149
            GI +G+G AY YQ+++NG RLGFY+P+R++L    FN + T ++ I+M +G  +G  GA
Sbjct: 65  GGIYRGIGCAYIYQILLNGCRLGFYEPMRHALATTLFNDAKTQNLGINMFAGAASGIMGA 124

Query: 150 AIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTG 209
             GSP +L KTR+QSYS F  +G QH YKN +D L KI K E   KGL+RGV AAMIRTG
Sbjct: 125 MAGSPFFLAKTRLQSYSPFLPVGTQHQYKNAWDGLTKIYKGEG-VKGLYRGVGAAMIRTG 183

Query: 210 VGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQK 269
            GS  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D I +R+YNQ 
Sbjct: 184 FGSSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTASGFVVCVVMHPPDTIMSRLYNQ- 241

Query: 270 ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                 G+LYK   DC  KT+RAEG F  YKG   H  RI PHTILT    EQ
Sbjct: 242 -----NGNLYKGVFDCLAKTIRAEGFFAIYKGVIPHLTRILPHTILTLSLAEQ 289



>gi|340905395|gb|EGS17763.1| putative mitochondrial oxaloacetate protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 310

 Score =  282 bits (722), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 146/298 (48%), Positives = 192/298 (64%), Gaps = 11/298 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++       YR       VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QTKGAQPHHYRGPLHGVSVIVRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFY+P+R +L + F  +TS  ++ +++ SG  +G  GAA+
Sbjct: 67  IYRGIGTAYVYQVLLNGCRLGFYEPMRTTLAQLFFQDTSVQNLGVNLFSGAASGVIGAAV 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N  D L +I K +    GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHRYRNAVDGLSQIYKSDGVV-GLWRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS  SGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHLGMEEGPSL-HLASSTASGFVVCCVMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
               G+LY+   DC  KT+R EG F  YKGF  H  RI PHT+LT  F EQ   L  K
Sbjct: 242 ---NGNLYQGIFDCLAKTIRTEGFFAIYKGFLPHLARILPHTVLTLTFAEQTNKLVRK 296



>gi|116191723|ref|XP_001221674.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88181492|gb|EAQ88960.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 310

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+P+E VK R+QLQGEL +   +    YR       VIV+NEG+RG
Sbjct: 8   FLAGGIAACGAVTATHPFETVKIRMQLQGEL-QDKGHQPHHYRGPVHGVSVIVRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFY+P+R+ L    F + +  S+ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGCAYIYQVLLNGCRLGFYEPMRHGLSTLIFKDGNKQSLGINMFCGAGSGIMGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N +D + +I + E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHRYRNAWDGMSQIFRTEG-VRGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMRHLGMEEGAPL-HLASSTASGFVVCVVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+RAEG F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYKGVFDCLGKTIRAEGFFAIYKGFLPHLARILPHTILTLTLAEQ 289



>gi|451995320|gb|EMD87788.1| hypothetical protein COCHEDRAFT_1216912 [Bipolaris maydis C5]
 gi|477586216|gb|ENI03301.1| hypothetical protein COCC4DRAFT_199883 [Bipolaris maydis ATCC
           48331]
          Length = 310

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 189/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S+  + YR +F    VI+KNEG RG
Sbjct: 8   FIAGGIAACGAVTVTHGFETVKIRLQLQGEL-KAKSDAPRLYRGVFHGVGVILKNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +GLG AY YQ+ +NG RLGFY+PIR +L    + + +  S  I++ +G  +G  GAA 
Sbjct: 67  LLRGLGCAYIYQMTLNGCRLGFYEPIRKTLTTTLYHDPTIQSFSINLFAGASSGVLGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH+Y+N  D + +I   E   KGL+RGV  AM+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHHYRNALDGMRQIYSAEG-IKGLYRGVGPAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM  + + +H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGM-QEGMPLHVASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DC  +T+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYTSAFDCLARTVRTEGVLALYKGYFAHLARILPHTILTLTLAEQ 289



>gi|451851871|gb|EMD65169.1| hypothetical protein COCSADRAFT_36505 [Bipolaris sorokiniana
           ND90Pr]
          Length = 310

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/294 (48%), Positives = 191/294 (64%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S+  + YR +F    VI+KNEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHGFETVKIRLQLQGEL-KAKSDAPRLYRGVFHGVSVILKNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFG 148
            RG+ +GLG AY YQ+ +NG RLGFY+P+R +L    + + +  S  I++ +G  +G  G
Sbjct: 64  PRGLLRGLGCAYIYQMTLNGCRLGFYEPVRKTLTTTLYHDPNLQSFLINLFAGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QSYS F  +G QH+Y+N  D + +I   E   KGL+RGV  AM+RT
Sbjct: 124 AAAGSPFFLVKTRLQSYSPFLPVGTQHHYRNALDGMRQIYSSEG-IKGLYRGVGPAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM  + + +H  SS  SGF VC  M+P D + +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGM-QEGMPLHIASSTASGFVVCCVMHPPDTVMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LYK+  DC  +T+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ------TGNLYKSAFDCLARTVRTEGVLALYKGYFAHLARILPHTILTLTLAEQ 289



>gi|482808880|gb|EOA85746.1| hypothetical protein SETTUDRAFT_170091 [Setosphaeria turcica Et28A]
          Length = 310

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S+  + Y+ +F    VI+KNEG RG
Sbjct: 8   FIAGGVAACGAVTVTHGFETVKIRLQLQGEL-KAKSDAPRLYKGVFHGVSVILKNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFGAAI 151
           + +GLG AY YQ+ +NG RLGFY+PIR +L     +  T  S  I++ +G  +G  GAA 
Sbjct: 67  LLRGLGCAYVYQMTLNGCRLGFYEPIRKTLTNVVYSDPTVQSFGINLFAGASSGILGAAT 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH+Y+N  D + +I   E   KGL+RGV  AM+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHHYRNALDGMRQIYGGEG-VKGLYRGVGPAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF+KR ++K+ GM  + + +H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFVKRRLVKHLGM-QEGMPLHVASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DC  +T++ EG+F  YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYSSAFDCLSRTIKTEGLFALYKGYFAHLARILPHTILTLTLAEQ 289



>gi|389639062|ref|XP_003717164.1| mitochondrial oxaloacetate transporter [Magnaporthe oryzae 70-15]
 gi|351642983|gb|EHA50845.1| mitochondrial oxaloacetate transporter [Magnaporthe oryzae 70-15]
 gi|440475732|gb|ELQ44395.1| mitochondrial oxaloacetate transport protein [Magnaporthe oryzae
           Y34]
          Length = 307

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 188/294 (63%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL R   +    YR  F    VIV+NEG
Sbjct: 5   LGAFIAGGIAACGAVTATHPFETVKIRMQLQGEL-RDKGHQPHFYRGPFHGVSVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFG 148
           + GI +G+  AY YQ+++NG RLGFY+P+R +L   F  + +  ++ I++  G  +G  G
Sbjct: 64  LGGIYRGISCAYVYQILLNGCRLGFYEPMRQTLTGLFYNDKNQQNLGINIFCGASSGIIG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QSYS F  +G QH YKN  D + +I   E   KG++RGV AAMIRT
Sbjct: 124 AAAGSPFFLVKTRLQSYSPFLPVGTQHEYKNALDGMRQIYGAEGA-KGMYRGVGAAMIRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM +   L H  SS VSGF VC  M+P D I +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTVSGFVVCCVMHPPDTIMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY   LDCF KT++ EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ------SGNLYSGVLDCFAKTVKTEGVFAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|303314519|ref|XP_003067268.1| Mitochondrial oxaloacetate transport protein , putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240106936|gb|EER25123.1| Mitochondrial oxaloacetate transport protein , putative
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 310

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +     VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QSKKEAVRKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L      +++  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYVYQILLNGCRLGFYEPLRQGLTSVLYKDSAYQSLGINIFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH YKN+FD L +I   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHQYKNSFDGLRQIHGNEG-ITGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +I++ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIRHLGMEDGPGL-HLASSACSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTVTTEGVLAIYKGYFAHLARILPHTILTLTLAEQ 289



>gi|330919985|ref|XP_003298840.1| hypothetical protein PTT_09667 [Pyrenophora teres f. teres 0-1]
 gi|311327771|gb|EFQ93055.1| hypothetical protein PTT_09667 [Pyrenophora teres f. teres 0-1]
          Length = 310

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 190/294 (64%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++ ++  + Y+ +F    VI+KNEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHGFETVKIRLQLQGEL-KAKTDAPRLYKGVFHGVSVILKNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFG 148
            RG+ +GLG AY YQ+ +NG RLGFY+PIR +L K   T  T  S  I++ +G  +G  G
Sbjct: 64  PRGLLRGLGCAYIYQMTLNGCRLGFYEPIRKTLTKVVYTDGTIQSFGINLFAGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QSYS F  +G QH+YKN  D + +I   E   KGL+RGV  AM+RT
Sbjct: 124 AACGSPFFLVKTRLQSYSPFLPVGTQHHYKNAVDGMRQIYTHEGA-KGLYRGVGPAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM  + + +H  SS  SGF VC  M+P D I +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGM-QEGMPLHIASSTASGFVVCCVMHPPDTIMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY +  DC  +T++ EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ------TGNLYSSAYDCLSRTIKTEGILALYKGYFAHLARILPHTILTLTLAEQ 289



>gi|392597661|gb|EIW86983.1| mitochondrial carrier [Coniophora puteana RWD-64-598 SS2]
          Length = 319

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 192/300 (64%), Gaps = 9/300 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT +NP EV KTR+QLQGEL +     V  Y+N         K+EGVRG
Sbjct: 16  FLCGGLAACLAVTVSNPAEVAKTRMQLQGELAKGGGKKV--YKNAIDVLTKTWKHEGVRG 73

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-STSMP-ISMLSGFLAGSFGAAI 151
           IQ+GLG AY YQ+++NG+RLGFY+P+R +         S  +P  S+ +G  +G+ GAA+
Sbjct: 74  IQRGLGMAYMYQILLNGSRLGFYEPVRQTFNSMIGRPVSELIPFTSIAAGATSGAVGAAL 133

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           G+PL+L+K RMQ+YS    +G QH Y+N+F+AL  + + E  F+GL RG+DAA++RT +G
Sbjct: 134 GNPLFLIKARMQAYSPAFPVGTQHYYRNSFNALSTVWRTEG-FRGLVRGIDAAILRTSMG 192

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQK-- 269
           S  QL +Y + K  ++    + D +I  +  SS VSG CVC  M P D   TRMYNQ   
Sbjct: 193 SSVQLPTYNWTKNQLVTNGVLPDKSIWTYLASSSVSGICVCIVMQPADTALTRMYNQPTI 252

Query: 270 --ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
              D    G+LYKN +DC  KT++ EG+FG+YKG  AH+LRI PHTI+T    +   GLY
Sbjct: 253 KGPDGRLIGTLYKNPIDCLWKTVKTEGVFGWYKGSTAHFLRIAPHTIITLTANDIILGLY 312



>gi|150864378|ref|XP_001383163.2| Mitochondrial oxaloacetate carrier protein [Scheffersomyces
           stipitis CBS 6054]
 gi|149385634|gb|ABN65134.2| Mitochondrial oxaloacetate carrier protein [Scheffersomyces
           stipitis CBS 6054]
          Length = 342

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 202/321 (62%), Gaps = 21/321 (6%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           E +  L GF+ GG AAC AVTFTNP E++KTR+QLQGEL +S  + V  Y+N FQAF +I
Sbjct: 25  EKVSTLGGFIAGGLAACGAVTFTNPIELIKTRMQLQGELAKSAKDAVILYKNPFQAFGII 84

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS--------MPIS 137
            +NEG+RG+Q+GL   Y YQL +NG R+G Y+P R  + K+ + S+ S        + I+
Sbjct: 85  YRNEGIRGLQQGLMCGYYYQLGLNGCRIGLYEPSRYIITKYLSPSTFSENEKIPQNLLIN 144

Query: 138 MLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA------IGHQHNYKNTFDALHKISKEE 191
           + +GF++GS GA + SP +L+KTRMQSYS          IG Q  YK  +D L KI   E
Sbjct: 145 VAAGFVSGSAGAVLASPFFLIKTRMQSYSKSTTSEAAHHIGQQTYYKGAWDGLSKIYSAE 204

Query: 192 RYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCV 251
              +GL+RGVDAA++RTG GS  QL  Y   K  ++      + ++ +H +SS ++G  V
Sbjct: 205 G-VRGLYRGVDAAILRTGAGSAAQLPVYNLTKNFLLNNQLAEEHSLGLHFMSSSMAGLGV 263

Query: 252 CFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
              MNP+DVI TR+YNQ      KG+LYK  +DCF KT+R EG    YKGF A   RIGP
Sbjct: 264 AIVMNPWDVILTRVYNQ------KGNLYKGPIDCFQKTIRTEGPSALYKGFWAQLFRIGP 317

Query: 312 HTILTFVFLEQYRGLYIKYTT 332
           H+ILT +F+EQ   + +K  T
Sbjct: 318 HSILTLMFMEQCMKVMVKVET 338



>gi|365991503|ref|XP_003672580.1| hypothetical protein NDAI_0K01460 [Naumovozyma dairenensis CBS 421]
 gi|343771356|emb|CCD27337.1| hypothetical protein NDAI_0K01460 [Naumovozyma dairenensis CBS 421]
          Length = 323

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/314 (48%), Positives = 194/314 (61%), Gaps = 16/314 (5%)

Query: 14  NQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVK 73
           N++T   +  A + +     F  GG AAC AVT TNP E+VK R+QLQGE++       +
Sbjct: 5   NKETKHLEKTAAQKVSKFGSFTAGGLAACIAVTVTNPIELVKIRMQLQGEMSALTQ---R 61

Query: 74  PYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS 133
            Y+N  Q   VI KNEG+RG+QKGL AAY YQ+ +NG+RLGFY+PIR++L  FF     S
Sbjct: 62  IYKNPIQGMGVIFKNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRSTLNSFFFPDVES 121

Query: 134 -----MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKIS 188
                + ++++SG  +G  GA IGSPL+LVKTRMQSYS    IG Q +Y   ++ L  I 
Sbjct: 122 HKVQNVGVNVVSGAASGIIGAVIGSPLFLVKTRMQSYSDVIKIGEQTHYTGVWNGLSTIF 181

Query: 189 KEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSG 248
           K E   KGLFRG+DAA++RTG GS  QL  Y   K  ++K   M D   L H  +S +SG
Sbjct: 182 KNEG-LKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLVKNDIMKDGPAL-HLTASTISG 239

Query: 249 FCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLR 308
             V   MNP+DVI TR+YNQK D      LYK  LDC IKT+R EGI   YKGF A   R
Sbjct: 240 LGVGVVMNPWDVILTRIYNQKGD------LYKGPLDCLIKTVRIEGITALYKGFEAQLFR 293

Query: 309 IGPHTILTFVFLEQ 322
           I PHTI+   F+EQ
Sbjct: 294 IAPHTIMCLTFMEQ 307



>gi|320037570|gb|EFW19507.1| mitochondrial oxaloacetate transporter [Coccidioides posadasii str.
           Silveira]
          Length = 310

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 187/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +     VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QSKKEAVRKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L      + +  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYVYQILLNGCRLGFYEPLRQGLTSVLYKDPAYQSLGINIFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH YKN+FD L +I   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHQYKNSFDGLRQIHGNEG-ITGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +I++ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIRHLGMEDGPGL-HLASSACSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTVTTEGVLAIYKGYFAHLARILPHTILTLTLAEQ 289



>gi|410079018|ref|XP_003957090.1| hypothetical protein KAFR_0D03070 [Kazachstania africana CBS 2517]
 gi|372463675|emb|CCF57955.1| hypothetical protein KAFR_0D03070 [Kazachstania africana CBS 2517]
          Length = 321

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 149/312 (47%), Positives = 201/312 (64%), Gaps = 28/312 (8%)

Query: 24  AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRS---NSNYVKPYRNIFQ 80
           A + +  +  F  GG AAC AVT TNP E++KTRLQLQGEL+ +    +N++  YRN  Q
Sbjct: 10  AAQKLSKVGSFTAGGLAACIAVTVTNPIEMIKTRLQLQGELSSAVSAQANHI--YRNPLQ 67

Query: 81  AFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-----STSMP 135
           AF VI KNEG+RG+QKGL AAY YQ+ +NG+RLGFY+PIR SL +FF +S       ++ 
Sbjct: 68  AFRVIFKNEGIRGLQKGLFAAYFYQIGLNGSRLGFYEPIRKSLNQFFYSSIEPHKVQNVT 127

Query: 136 ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFK 195
           I+  SG ++G+ G  +GSPLYLVKTRMQSYS    +G Q +Y   +  +  I KE    K
Sbjct: 128 INATSGAISGAIGGVVGSPLYLVKTRMQSYSNIIKMGDQTHYSGLWHGITAIFKENG-IK 186

Query: 196 GLFRGVDAAMIRTGVGSCTQLSSY-----FFIKRSVIKYSGMSDDNILVHALSSLVSGFC 250
           GLFRGVDAA++RT +GS  QL +Y     FFI+  +++      D   +H  SS+V+G  
Sbjct: 187 GLFRGVDAAILRTSIGSAAQLPTYNATKNFFIRNDIMR------DGPGLHLASSMVAGIV 240

Query: 251 VCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIG 310
           V   MNP+DV+ TR+YNQ+ ++      YK  +DC +KT + EGI   YKGF AH LR+ 
Sbjct: 241 VTIIMNPWDVVLTRIYNQRDNR------YKGPIDCMVKTAKVEGISALYKGFDAHLLRMA 294

Query: 311 PHTILTFVFLEQ 322
           PHTI+    +EQ
Sbjct: 295 PHTIICLTAMEQ 306



>gi|448097467|ref|XP_004198681.1| Piso0_002065 [Millerozyma farinosa CBS 7064]
 gi|359380103|emb|CCE82344.1| Piso0_002065 [Millerozyma farinosa CBS 7064]
          Length = 332

 Score =  280 bits (716), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 203/324 (62%), Gaps = 25/324 (7%)

Query: 16  QTTANKARAK---ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV 72
           Q T  + R K   E +  L GF+ GG AAC AVTFTNP E+VKTR+QLQGEL +++ +  
Sbjct: 3   QETKTETRQKSSAEKVSTLGGFIAGGLAACGAVTFTNPIELVKTRMQLQGELEKADKHAT 62

Query: 73  KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-- 130
           K YRN  QAF  + K+EG+RG+QKGL   Y YQ+ +NG R+G Y+P R  + K       
Sbjct: 63  KLYRNPVQAFLHVYKHEGIRGLQKGLLCGYYYQIGLNGCRIGLYEPSRYYITKLVQPDII 122

Query: 131 ------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA-------IGHQHNY 177
                   ++ +++L+G ++G+ GA + SP +LVKTRMQSYS   A       +G Q  Y
Sbjct: 123 QEGRPIPQNVSVNVLAGTISGAAGAVLASPFFLVKTRMQSYSGTQATHSSVPHVGQQTYY 182

Query: 178 KNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNI 237
           KN +D L KI   E   KGLFRGVDAA++RTG GS  QL  Y  IK +++ Y  + + + 
Sbjct: 183 KNFWDGLTKIYSSEG-VKGLFRGVDAAVLRTGAGSAAQLPIYNLIKHTLLDYKLVEESST 241

Query: 238 LVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFG 297
           L+  +SS ++G  V   MNP+DV+ TR+YNQ      KG+LYK  LDCFIK++R EG+  
Sbjct: 242 LLSFISSAMAGVGVSIVMNPWDVVLTRVYNQ------KGNLYKGPLDCFIKSVRIEGVAA 295

Query: 298 FYKGFGAHYLRIGPHTILTFVFLE 321
            YKGF A   R+ PH++LT +F+E
Sbjct: 296 LYKGFWAQLFRVWPHSVLTLMFME 319



>gi|448101309|ref|XP_004199529.1| Piso0_002065 [Millerozyma farinosa CBS 7064]
 gi|359380951|emb|CCE81410.1| Piso0_002065 [Millerozyma farinosa CBS 7064]
          Length = 332

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 203/324 (62%), Gaps = 25/324 (7%)

Query: 16  QTTANKARAK---ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV 72
           Q T  + R K   E I  L GF+ GG AAC AVTFTNP E+VKTR+QLQGEL +++ +  
Sbjct: 3   QETNTETRQKSSAEKISTLGGFIAGGLAACGAVTFTNPIELVKTRMQLQGELEKADKHAT 62

Query: 73  KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-- 130
           K YRN  QAF  + K+EG+RG+QKGL   Y YQ+ +NG R+G Y+P R  + K       
Sbjct: 63  KLYRNPVQAFLHVYKHEGIRGLQKGLLCGYYYQIGLNGCRIGLYEPSRYYITKLVQPDLI 122

Query: 131 ------STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA-------IGHQHNY 177
                   ++ +++++G ++G+ GA + SP +LVKTRMQSYS   A       +G Q  Y
Sbjct: 123 QEGKPIPQNVSVNVIAGTISGAAGAVLASPFFLVKTRMQSYSGTQATHSSVPHVGQQTYY 182

Query: 178 KNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNI 237
           KN +D L KI   E   KGLFRGVDAA++RTG GS  QL  Y   K +++ Y  + +++ 
Sbjct: 183 KNVWDGLAKIYSSEG-VKGLFRGVDAAVLRTGAGSAAQLPIYNLTKHALLDYKLVEENST 241

Query: 238 LVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFG 297
           L+  +SS ++G  V   MNP+DV+ TR+YNQ      KG+LYK  LDCFIK++R EG+  
Sbjct: 242 LLSFISSAMAGVGVSIVMNPWDVVLTRVYNQ------KGNLYKGPLDCFIKSVRIEGVAA 295

Query: 298 FYKGFGAHYLRIGPHTILTFVFLE 321
            YKGF A   R+ PH++LT +F+E
Sbjct: 296 LYKGFWAQLFRVWPHSVLTLMFME 319



>gi|402222803|gb|EJU02869.1| mitochondrial carrier [Dacryopinax sp. DJM-731 SS1]
          Length = 329

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 198/320 (61%), Gaps = 11/320 (3%)

Query: 17  TTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYR 76
           TT         +  +  F+ GG AAC AVT +NP EV KTRLQL GEL +S S  V  YR
Sbjct: 2   TTLTTKAPVPPLSTIESFMCGGLAACCAVTISNPPEVAKTRLQLDGELAKSGSPRV--YR 59

Query: 77  NIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM-- 134
           N+   F    KNEG+RGIQ+GLG AY YQ+++NG+RLGFY+P R +  +       ++  
Sbjct: 60  NVLDVFAKTWKNEGIRGIQRGLGPAYIYQILLNGSRLGFYEPFRVTFNRMIGRPDKTVLA 119

Query: 135 PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYF 194
             S+ +G  +G+ GAA+G+PL+L+K RMQ+YS    +G Q +YK+++DAL  I + E   
Sbjct: 120 STSISAGVASGAVGAALGNPLFLIKARMQAYSPALPVGAQRHYKSSWDALSTIFRTEG-L 178

Query: 195 KGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFT 254
           +GL RG+DAA++RT +GS  QL SY  +K ++++ +G   D       SS VSG  VC  
Sbjct: 179 RGLLRGIDAALLRTCMGSSVQLPSYNLVKTTLVQ-NGWRSDGFWTFLASSSVSGATVCIV 237

Query: 255 MNPFDVISTRMYNQKA---DQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
           M P D   TRMYNQ      ++GK  G LYKN +DC  KTL+ EG FG+YKG  AH+LRI
Sbjct: 238 MQPADTALTRMYNQPTTLDPKTGKSVGLLYKNPIDCLWKTLKTEGPFGWYKGTVAHFLRI 297

Query: 310 GPHTILTFVFLEQYRGLYIK 329
            PHTI+T    E    LY++
Sbjct: 298 APHTIVTLTANELIMSLYVR 317



>gi|327356920|gb|EGE85777.1| mitochondrial carrier protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 310

 Score =  279 bits (714), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ Y+ +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKQEAVRKYKGVFHGVRVILQNEGARG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  + K  + + +  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRVGVTKAIYKDPAHQSLGINVFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+ D L +I + E   +GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHMYRNSVDGLRQIHRGEG-VRGLYRGVYAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLASSACSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHT+LT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTISKEGVLAIYKGYFAHLARILPHTVLTLSLAEQ 289



>gi|401624919|gb|EJS42956.1| oac1p [Saccharomyces arboricola H-6]
          Length = 324

 Score =  279 bits (714), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 199/319 (62%), Gaps = 16/319 (5%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN 68
           +S+  ++Q    +  A + I     F+ GG AAC AVT TNP E++K R+QLQGE++ S 
Sbjct: 1   MSSENSKQGKEIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60

Query: 69  SNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF- 127
           +   K Y+N  Q   VI KNEG++G+QKGL AAY YQ+ +NG+RLGFY+PIR SL   F 
Sbjct: 61  A---KIYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRTSLNHLFF 117

Query: 128 ----NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
               +    S+ I++ SG  +G  GA +GSPL+LVKTR+QSYS F  IG Q +Y   ++ 
Sbjct: 118 PDQESHKVQSVGINVFSGAASGIIGAVVGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNG 177

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L  I K E   KGLFRG+DAA++RTG GS  QL  Y   K  ++K   M D   L H  +
Sbjct: 178 LVTIFKTEG-VKGLFRGIDAAILRTGAGSSVQLPIYNTAKSFLVKNDIMKDGPAL-HLTA 235

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S +SG  V   MNP+DVI TR+YNQ      KG+LYK  +DC +KT++ EGI   YKGF 
Sbjct: 236 STISGLGVAVVMNPWDVILTRIYNQ------KGNLYKGPIDCLVKTVKIEGITALYKGFV 289

Query: 304 AHYLRIGPHTILTFVFLEQ 322
           A   RI PHTI+   F+EQ
Sbjct: 290 AQVFRIAPHTIMCLTFMEQ 308



>gi|501751269|emb|CCG84429.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 315

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 152/305 (49%), Positives = 192/305 (62%), Gaps = 11/305 (3%)

Query: 20  NKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
            KAR K  +  + GF+ GG AAC AVT TNP EVVKTRLQLQGEL+ S+    + Y N+F
Sbjct: 8   QKARPK-GLSTMGGFVSGGMAACFAVTVTNPLEVVKTRLQLQGELS-SSGQVKRVYTNVF 65

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPIS 137
           QA  VI KNEG RG+Q+GL  AY YQ+ +NG RLG Y+PIR +       + +   + ++
Sbjct: 66  QALGVIGKNEGFRGLQRGLLTAYVYQIALNGCRLGLYEPIRQNANNLLYGDRNKQVVAVN 125

Query: 138 MLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGL 197
           +LSG ++G  G  +GSP +LVKTRMQ+YS   A+G QHNY   FDA  KI     Y +GL
Sbjct: 126 VLSGAVSGIMGGVLGSPFFLVKTRMQAYSPVFAVGTQHNYTGVFDAFRKIIATSGY-RGL 184

Query: 198 FRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNP 257
            +G DAA++RTG GS  QL  Y   KR + K+  +  +    H  +S  SG  VC  M+ 
Sbjct: 185 MKGADAAILRTGAGSSVQLPIYNASKRFIEKHD-LIKEGPRKHLAASAASGVGVCCVMHI 243

Query: 258 FDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
           FD I TR YNQ+       +LYKN  DCF+K +R EG F  YKGF AH LRIGPHTILT 
Sbjct: 244 FDTILTRSYNQQGQ-----TLYKNPFDCFVKIVRTEGFFALYKGFFAHLLRIGPHTILTL 298

Query: 318 VFLEQ 322
           + LEQ
Sbjct: 299 MALEQ 303



>gi|189198924|ref|XP_001935799.1| mitochondrial dicarboxylate transporter [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187982898|gb|EDU48386.1| mitochondrial dicarboxylate transporter [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 310

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 189/294 (64%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++ ++  + Y+ +F    VI+KNEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHGFETVKIRLQLQGEL-KAKTDAPRLYKGVFHGVSVILKNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFG 148
            RG+ +GLG AY YQ+ +NG RLGFY+PIR +L K   T     S  I++ +G  +G  G
Sbjct: 64  PRGLLRGLGCAYIYQMTLNGCRLGFYEPIRKTLTKVAYTDGNVQSFGINLFAGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QSYS F  +G QH+YKN  D + +I   E   KGL+RGV  AMIRT
Sbjct: 124 AACGSPFFLVKTRLQSYSPFLPVGTQHHYKNAVDGMRQIYTHEG-VKGLYRGVGPAMIRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM  + + +H  SS  SGF VC  M+P D I +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGM-QEGMPLHIASSTASGFVVCCVMHPPDTIMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY +  DC  +T++ EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ------TGNLYSSAYDCLSRTIKMEGILALYKGYFAHLARILPHTILTLTLAEQ 289



>gi|242777630|ref|XP_002479073.1| mitochondrial oxaloacetate transporter (Oac), putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218722692|gb|EED22110.1| mitochondrial oxaloacetate transporter (Oac), putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 308

 Score =  279 bits (713), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 188/291 (64%), Gaps = 13/291 (4%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL    S+ VK YR +F    VI++NEG +G
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL---QSDAVKKYRGVFHGVKVILQNEGPQG 64

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L    + + S  S+ I++ SG  +G  GAA 
Sbjct: 65  LFRGIGSAYIYQILLNGCRLGFYEPLRTGLTTAIYGDPSVQSLGINVFSGASSGMLGAAA 124

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH YKN +D + +I   E   KGL+RGV AAM+RTG G
Sbjct: 125 GSPFFLVKTRLQSYSPFLPVGTQHQYKNAYDGMRQIYTNEG-VKGLYRGVGAAMVRTGFG 183

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + ++ GM +   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 184 SSVQLPTYFFAKRRLTRHLGMEEGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 240 ---TGNLYKGVFDCLYKTVSTEGLLAIYKGYFAHLARILPHTILTLSLAEQ 287



>gi|471568228|gb|EMR67945.1| putative mitochondrial oxaloacetate transport protein [Eutypa lata
           UCREL1]
          Length = 310

 Score =  279 bits (713), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 145/291 (49%), Positives = 185/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +S  +    YR  F    VI++NEG+RG
Sbjct: 8   FVAGGIAACGAVTATHPFETVKIRMQLQGEL-QSKGHQPHHYRGPFHGVSVIIRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +GLG AY YQ+++NG RLGFY+P+R  L      + +  ++ I+M  G  +G  GAA 
Sbjct: 67  IYRGLGCAYVYQILLNGCRLGFYEPMRQGLATLLLKDGAKQNLAINMFCGASSGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N  D   +I + E    GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHRYRNALDGTSQIYRAEG-VGGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS VSGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVRHLGMEEGAPL-HLASSTVSGFVVCCVMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT++ EG F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---HGNLYKGVFDCLGKTIKTEGFFAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|212533261|ref|XP_002146787.1| mitochondrial oxaloacetate transporter (Oac), putative [Talaromyces
           marneffei ATCC 18224]
 gi|210072151|gb|EEA26240.1| mitochondrial oxaloacetate transporter (Oac), putative [Talaromyces
           marneffei ATCC 18224]
          Length = 308

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 188/291 (64%), Gaps = 13/291 (4%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL    S+ VK YR +     VI++NEG +G
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL---QSDAVKKYRGVLHGVKVILQNEGPKG 64

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+PIR  L K  + + S  S+ +++ SG  +G  GAA 
Sbjct: 65  LFRGIGSAYVYQVLLNGCRLGFYEPIRTGLTKAIYGDPSVQSLGVNVFSGASSGILGAAA 124

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH YKN +D + +I   E   KGL+RGV AAM+RTG G
Sbjct: 125 GSPFFLVKTRLQSYSPFLPVGTQHKYKNAYDGMRQIYGNEG-VKGLYRGVGAAMVRTGFG 183

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + ++ GM +   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 184 SSVQLPTYFFAKRRLKRHFGMEEGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 240 ---TGNLYKGVFDCLYKTVSTEGLLAIYKGYFAHLARILPHTILTLSLAEQ 287



>gi|119174778|ref|XP_001239724.1| hypothetical protein CIMG_09345 [Coccidioides immitis RS]
 gi|392869915|gb|EAS28454.2| mitochondrial oxaloacetate transporter [Coccidioides immitis RS]
          Length = 310

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/291 (49%), Positives = 186/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +     VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QSKKEAVRKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L      + +  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYVYQILLNGCRLGFYEPLRQGLTSVLYKDPAYQSLGINIFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH YKN+FD L +I   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHQYKNSFDGLRQIHGNEG-ITGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + ++ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLTRHLGMEDGPGL-HLASSACSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLYKTVTTEGVLAIYKGYFAHLARILPHTILTLTLAEQ 289



>gi|347826872|emb|CCD42569.1| similar to mitochondrial oxaloacetate transport protein
           [Botryotinia fuckeliana T4]
 gi|472244755|gb|EMR89358.1| putative mitochondrial oxaloacetate transport protein [Botryotinia
           fuckeliana BcDW1]
          Length = 310

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/304 (49%), Positives = 190/304 (62%), Gaps = 15/304 (4%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP--YRNIFQAFYVIVKN 88
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL       ++P  Y+        IV+N
Sbjct: 5   LGAFVAGGIAACGAVTATHPFETVKIRMQLQGELQEKG---LQPRLYKGPIHGVTTIVRN 61

Query: 89  EGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLE-KFFNTSST-SMPISMLSGFLAGS 146
           EG+ GI +G+GAAY YQ+++NG RLGFY+PIR +L    F+ S T S+ I++ SG  +G 
Sbjct: 62  EGLGGIYRGIGAAYIYQMILNGCRLGFYEPIRETLTGALFDDSKTQSLGINIFSGATSGI 121

Query: 147 FGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMI 206
            GAA GSP +LVKTR+QS+S  A +G QH YKN  D + KI   E    GL+RGV AAM+
Sbjct: 122 LGAAAGSPFFLVKTRLQSFSPQAPVGTQHGYKNAVDGMKKIYTTEG-VNGLYRGVGAAMV 180

Query: 207 RTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMY 266
           RTG GS  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D I +RMY
Sbjct: 181 RTGFGSSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTASGFVVCCVMHPPDTIMSRMY 239

Query: 267 NQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
           NQ       G+LY    DC  KT++ EGIF  YKGF  H  RI PHTILT    EQ   L
Sbjct: 240 NQ------TGNLYSGIFDCLAKTVKTEGIFAIYKGFLPHLARILPHTILTLSLAEQTNKL 293

Query: 327 YIKY 330
             K+
Sbjct: 294 MRKF 297



>gi|405123239|gb|AFR98004.1| oxaloacetate carrier [Cryptococcus neoformans var. grubii H99]
          Length = 317

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 195/317 (61%), Gaps = 16/317 (5%)

Query: 25  KETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYV 84
           ++ +  L  FL GG A C AVT TN  E +KTRLQLQGEL R++ +  + YRN+   F  
Sbjct: 4   QQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGELQRNDPSAPRVYRNVLDVFRK 63

Query: 85  IVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP------ISM 138
             ++EG+RG+Q+GL  AY YQ ++NG+RLG Y+P R    + FN +    P       ++
Sbjct: 64  TWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCR----RLFNRAIGKDPNEGVFITAI 119

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
            +G + G  GA++GSPL+L+K RMQ+YS    +G QH YKN+FDAL  I K + +F GL+
Sbjct: 120 TAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYKNSFDALRTILKSDGFF-GLW 178

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RGV  A++RT +GS  QL SY   K  ++  +GM+ D+      +S VSG CVC  M P 
Sbjct: 179 RGVSTAILRTAMGSSVQLPSYNLSKHYLVSSAGMAADSFWTFLAASSVSGVCVCIAMQPP 238

Query: 259 DVISTRMYNQ---KADQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
           D   TRMYNQ   K   +GK  G+LY N  DC  KT +AEGI G+YKG  AH+LRI PHT
Sbjct: 239 DTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTFKAEGIAGWYKGTTAHFLRITPHT 298

Query: 314 ILTFVFLEQYRGLYIKY 330
           I T VF E     Y K+
Sbjct: 299 IFTLVFNELIMAEYTKW 315



>gi|401885777|gb|EJT49865.1| hypothetical protein A1Q1_01017 [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406695569|gb|EKC98872.1| hypothetical protein A1Q2_06843 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 334

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 201/324 (62%), Gaps = 10/324 (3%)

Query: 15  QQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP 74
           +Q  A + R   T+     F+IGG A C+AVT TN  E +KTRLQLQGEL ++++N  K 
Sbjct: 11  EQMAAGQPRIPLTLPE--SFMIGGLAGCAAVTVTNVAETMKTRLQLQGELVKADANVEKV 68

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSST 132
           Y+N+F  F    KNEG+RG+Q+GL  AY YQ+++NG+RLGFY+P+R+ L +    N    
Sbjct: 69  YKNVFDVFKKTWKNEGIRGLQRGLFPAYGYQILLNGSRLGFYEPVRHVLNRAIGRNPDDV 128

Query: 133 SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEER 192
               ++ +G + G  GA +GSPL+L+K RMQ+YS    +G QH Y+N++DA+ KI   + 
Sbjct: 129 IFGTAITAGAITGCIGACLGSPLFLIKARMQAYSPALPVGTQHYYRNSYDAMQKIVATDG 188

Query: 193 YFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVC 252
             +GL+RGV AA++RT  GS  QL SY + K  +  Y  +  ++  ++  +S VSG  VC
Sbjct: 189 -VRGLWRGVSAAILRTCCGSAVQLPSYNYTKTVLSNYGIIDPNSFWMYMAASSVSGVVVC 247

Query: 253 FTMNPFDVISTRMYNQKA---DQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYL 307
             M P D + TRMYNQ       +GK  G+LY N  DC  KT + EG+ G+YKG  AH+L
Sbjct: 248 AAMQPADTVLTRMYNQPIIVDPVTGKRRGALYTNPFDCLWKTAKTEGVLGWYKGTTAHFL 307

Query: 308 RIGPHTILTFVFLEQYRGLYIKYT 331
           RI PHTI+T V  E     Y K+T
Sbjct: 308 RIAPHTIITLVANELIGKEYKKWT 331



>gi|440635324|gb|ELR05243.1| hypothetical protein GMDG_01681 [Geomyces destructans 20631-21]
          Length = 747

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 186/294 (63%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL +  +   K Y+       VIV+NEG
Sbjct: 5   LGAFIAGGVAACGAVTATHPFETVKIRMQLQGEL-QGKAQQPKLYKGPIHGVTVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFG 148
           +RGI +G+GAAY YQ+++NG RLGFY+P+R +  K     ST  S+ +++ SG  +G  G
Sbjct: 64  LRGIYRGIGAAYIYQVLLNGCRLGFYEPLRATATKVVYGDSTVQSLGVNVFSGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +L+KTR+QS+S    +G QH YKN  D    I   E   KGL+RGV AAM+RT
Sbjct: 124 AAAGSPFFLIKTRLQSFSPMRPVGTQHKYKNALDGFKSIYGTE-GLKGLYRGVGAAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF+KR ++K+ GM +   L H  SS  SGF VC  M+P D I +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFVKRRLVKHFGMEEGPAL-HLASSTTSGFVVCCVMHPPDTIMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LYK   DC  KT+R EG    YKG+  H  RI PHTILT  F EQ
Sbjct: 242 ------NGNLYKGVYDCLSKTVRTEGFLAIYKGYLPHLARILPHTILTLSFAEQ 289



>gi|512187502|gb|EPE03281.1| mitochondrial oxaloacetate transport protein [Ophiostoma piceae
           UAMH 11346]
          Length = 308

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 182/291 (62%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +S  +    YR       VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QSKGHQPHHYRGPLHGVSVIVRNEGLRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +GLG AY YQ+++NG RLGFY+P+R +L  F   N S  S+PI+ML G  +G  GAA 
Sbjct: 67  IYRGLGCAYIYQVLLNGCRLGFYEPMRQTLTNFLYKNDSVQSLPINMLCGAGSGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS    +G QH Y+N  D + +I   E   +GL+RGV AA IRTG G
Sbjct: 127 GSPFFLVKTRLQSYSPHRPVGTQHKYRNAIDGMRQIYGAEG-VRGLYRGVGAACIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + ++  M +   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLQRHLDMKEGPAL-HLASSTASGFVVCIFMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT+R EG    YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYSGVFDCLAKTVRTEGFLAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|408392876|gb|EKJ72165.1| hypothetical protein FPSE_07652 [Fusarium pseudograminearum CS3096]
          Length = 310

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEGVR 
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QNKGHQPHHYRGPIHGVSVIVRNEGVRK 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+GAAY YQ+++NG RLGFYDP+RN+L KF   + ++ ++ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGAAYIYQILLNGCRLGFYDPMRNALAKFIFKDGNAQNLGINMFCGAASGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH+Y   +     I   E    GL+RGV AAMIRT  G
Sbjct: 127 GSPFFLVKTRLQSFSKFRPVGTQHHYTGAWHGFKSIYSTEG-IGGLYRGVQAAMIRTAFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS +SGF VC  M+P D + +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVRHLGMEEGPGL-HLASSAISGFVVCCVMHPPDTVMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DCF KT+R+EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYTSAADCFAKTIRSEGVFALYKGFFPHLARILPHTILTLSLAEQ 289



>gi|46122073|ref|XP_385590.1| hypothetical protein FG05414.1 [Fusarium graminearum PH-1]
          Length = 387

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 145/291 (49%), Positives = 188/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEGVR 
Sbjct: 85  FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QNKGHQPHHYRGPIHGVSVIVRNEGVRK 143

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+GAAY YQ+++NG RLGFYDP+RN+L KF   + ++ ++ I+M  G  +G  GAA 
Sbjct: 144 IYRGIGAAYIYQILLNGCRLGFYDPMRNALAKFIFKDGNAQNLGINMFCGAASGVIGAAA 203

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH+Y   +     I   E    GL+RGV AAMIRT  G
Sbjct: 204 GSPFFLVKTRLQSFSKFRPVGTQHHYTGAWHGFKSIYSTEG-IGGLYRGVQAAMIRTAFG 262

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H  SS +SGF VC  M+P D + +RMYNQ   
Sbjct: 263 SSVQLPTYFFAKRRLVRHFGMEEGPGL-HLASSAISGFVVCCVMHPPDTVMSRMYNQ--- 318

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DCF KT+R+EGIF  YKGF  H  RI PHTILT    EQ
Sbjct: 319 ---NGNLYTSAADCFAKTIRSEGIFALYKGFFPHLARILPHTILTLSLAEQ 366



>gi|134109639|ref|XP_776498.1| hypothetical protein CNBC4240 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259176|gb|EAL21851.1| hypothetical protein CNBC4240 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 318

 Score =  276 bits (706), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 196/319 (61%), Gaps = 16/319 (5%)

Query: 23  RAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAF 82
           + ++ +  L  FL GG A C AVT TN  E +KTRLQLQGEL R++ +  + YRN+   F
Sbjct: 3   QPQQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGELQRNDPSAPRVYRNVLDVF 62

Query: 83  YVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP------I 136
               ++EG+RG+Q+GL  AY YQ ++NG+RLG Y+P R    + FN +    P       
Sbjct: 63  RKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCR----RLFNRAIGKDPNEGVFIT 118

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKG 196
           ++ +G + G  GA++GSPL+L+K RMQ+YS    +G QH YKN++DAL  I K + +F G
Sbjct: 119 AITAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYKNSYDALRTILKSDGFF-G 177

Query: 197 LFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMN 256
           L+RGV  A++RT +GS  QL SY   K  ++  +GM+ D+      +S VSG CVC  M 
Sbjct: 178 LWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMASDSFWTFLAASSVSGVCVCIAMQ 237

Query: 257 PFDVISTRMYNQ---KADQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
           P D   TRMYNQ   K   +GK  G+LY N  DC  KT +AEGI G+YKG  AH+LRI P
Sbjct: 238 PPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTFKAEGIAGWYKGTTAHFLRITP 297

Query: 312 HTILTFVFLEQYRGLYIKY 330
           HTI T VF E     Y K+
Sbjct: 298 HTIFTLVFNELIMAEYTKW 316



>gi|171687068|ref|XP_001908475.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943495|emb|CAP69148.1| unnamed protein product [Podospora anserina S mat+]
          Length = 310

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 145/298 (48%), Positives = 186/298 (62%), Gaps = 11/298 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEG+RG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QTKGHQPHHYRGPLHGVSVIVRNEGIRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFY+P+R  L K    + +  ++ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGCAYIYQVLLNGCRLGFYEPMRAGLAKLMLNDAAKQNLGINMFCGAASGIMGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N  D L +I + E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHRYRNALDGLSQIFRAEG-VRGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + K+ GM +   L H  SS  SGF VC  M+P D I +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLQKHLGMEEGAPL-HLASSTASGFVVCVVMHPPDTIMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
               G+LYK   DC  KT++ EG F  YKG   H  RI PHTILT    EQ   L  K
Sbjct: 242 ---NGNLYKGVFDCLAKTIKTEGFFAIYKGVFPHLARILPHTILTLSLAEQTNKLMKK 296



>gi|255954085|ref|XP_002567795.1| Pc21g07550 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211589506|emb|CAP95652.1| Pc21g07550 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 310

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 186/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL   N   VK Y+       VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGELQTKNQA-VKMYKGPLHGIKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+PIR++L    + +    S+  ++++G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPIRSNLTTAVYNDPKVQSLAANVIAGAASGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS    +G QHNYKN+FD L KI K E   KG++RGV AAMIRT  G
Sbjct: 127 GSPFFLVKTRLQSYSPLLPVGTQHNYKNSFDGLSKIYKGEG-IKGIYRGVGAAMIRTSFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + ++ GM +   L H  SS  SGF VC  M+P D I  RMYNQ   
Sbjct: 186 SAVQLPTYFFAKRRLTRHLGMEEGPAL-HLASSAASGFVVCCFMHPPDTIMARMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC +KT+R EG    YKGF AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYGGVFDCLLKTIRTEGPLAIYKGFFAHLARILPHTILTLSLAEQ 289



>gi|255713308|ref|XP_002552936.1| KLTH0D04928p [Lachancea thermotolerans]
 gi|238934316|emb|CAR22498.1| KLTH0D04928p [Lachancea thermotolerans CBS 6340]
          Length = 325

 Score =  276 bits (705), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 203/312 (65%), Gaps = 17/312 (5%)

Query: 16  QTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPY 75
           +T A+K  A++  K    F+ GG AAC AVT TNP E+VKTR+QLQGE++  +    + Y
Sbjct: 11  KTDADKPAAQKVTKT-GSFIAGGLAACIAVTVTNPIELVKTRMQLQGEMSAESQ---RIY 66

Query: 76  RNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--- 132
           +N +Q+  +I KNEG+RG+QKGL  AY YQ+ +NG+RLGFY+PIR+ L K F  +     
Sbjct: 67  KNPWQSLKIIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSLLNKTFYPNQDPHK 126

Query: 133 --SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKE 190
             ++ ++++SG  +G  GA +GSPL+L+KTRMQ+YS    IG Q +Y + ++ L  I + 
Sbjct: 127 VQNVAVNVVSGASSGIIGAIMGSPLFLIKTRMQAYSNAIQIGQQTHYTSIWNGLSSIYRA 186

Query: 191 ERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFC 250
           E   KGL+RGVDAA++RTG GS  QL  Y   KR ++ +  M +   L H ++S +SG  
Sbjct: 187 EG-LKGLYRGVDAAILRTGAGSSVQLPIYNTAKRFLLNHDIMKEGTGL-HLVASTLSGIG 244

Query: 251 VCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIG 310
           V   MNP+DVI TR+YNQ      KG+LYK  +DC IKT+R EG+   YKGF A   RI 
Sbjct: 245 VGVVMNPWDVILTRVYNQ------KGNLYKGPIDCLIKTVRIEGVSALYKGFEAQLFRIA 298

Query: 311 PHTILTFVFLEQ 322
           PHTIL   F+EQ
Sbjct: 299 PHTILCLTFMEQ 310



>gi|254565221|ref|XP_002489721.1| Mitochondrial inner membrane transporter, transports oxaloacetate,
           sulfate, and thiosulfate [Komagataella pastoris GS115]
 gi|238029517|emb|CAY67440.1| Mitochondrial inner membrane transporter, transports oxaloacetate,
           sulfate, and thiosulfate [Komagataella pastoris GS115]
          Length = 321

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 184/286 (64%), Gaps = 13/286 (4%)

Query: 42  CSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAA 101
           C AVT TNP EVVKTR+QLQGEL+  N++  +PY+N  Q   V+ +NEG++G Q+GL +A
Sbjct: 28  CGAVTITNPIEVVKTRMQLQGELSAKNAHVPRPYKNPIQGVLVVYRNEGIKGCQRGLVSA 87

Query: 102 YAYQLVMNGARLGFYDPIRNSLEKFFNTSST-----SMPISMLSGFLAGSFGAAIGSPLY 156
           + YQL +NG RLG Y+PIRN+L +    S       +  I+++SG ++G+ GA +GSPL+
Sbjct: 88  WIYQLGLNGCRLGLYEPIRNTLNRLMYPSRDPHTVQNTAINVISGAVSGAAGATVGSPLF 147

Query: 157 LVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQL 216
           LVKTRMQSYS    IG Q +Y+  ++ L  I ++   F GLF+GVDAA+IRT  GS  QL
Sbjct: 148 LVKTRMQSYSNSIQIGQQTHYRGVWNGLSTIYRQSG-FMGLFQGVDAAIIRTAAGSSVQL 206

Query: 217 SSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKG 276
             Y F K  ++K   M +   L H  SSL +G  V   MNP+DVI TR+YNQK       
Sbjct: 207 PIYNFAKHELLKNQIMEEGTGL-HLTSSLFAGIGVSVVMNPWDVILTRIYNQKTK----- 260

Query: 277 SLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
            LY   LDC IK ++ EGI   YKGF A  LR+ PHTIL  VF+EQ
Sbjct: 261 -LYSGPLDCLIKIVKVEGIMALYKGFEAQILRVAPHTILCLVFMEQ 305



>gi|50292577|ref|XP_448721.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528033|emb|CAG61684.1| unnamed protein product [Candida glabrata]
          Length = 320

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 189/304 (62%), Gaps = 16/304 (5%)

Query: 24  AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFY 83
           A + +     F  GG AAC AVT TNP EVVK R+QLQGEL  +N    + Y N FQA  
Sbjct: 12  AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQ---RIYTNPFQAMG 68

Query: 84  VIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF-----NTSSTSMPISM 138
           V+ +NEG+RG+QKGL AAY YQ+ +NG+RLGFY+PIR  + K F     +    S+ I++
Sbjct: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
            +G  +G  GA +GSPL+LVKTR+QSYS    IG Q +Y   ++ L  I   E   KGLF
Sbjct: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEG-VKGLF 187

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RG+DAA++RTG GS  QL  Y   K  +++   M D   L H  +S +SG  V   MNP+
Sbjct: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL-HLTASTISGLGVAVVMNPW 246

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           DVI TR+YNQK D      LYK  +DC +KT++ EGI   YKGF A   RIGPHTIL   
Sbjct: 247 DVILTRIYNQKGD------LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300

Query: 319 FLEQ 322
           FLEQ
Sbjct: 301 FLEQ 304



>gi|260946966|ref|XP_002617780.1| hypothetical protein CLUG_01239 [Clavispora lusitaniae ATCC 42720]
 gi|238847652|gb|EEQ37116.1| hypothetical protein CLUG_01239 [Clavispora lusitaniae ATCC 42720]
          Length = 325

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 201/317 (63%), Gaps = 23/317 (7%)

Query: 20  NKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
           +K+ A+E +  L GFL GG AAC AVTF NP E++KTR+QLQGELT+  SN  + Y N  
Sbjct: 6   HKSLAQE-VSTLGGFLAGGIAACGAVTFRNPIELIKTRMQLQGELTKM-SNAPRLYTNPL 63

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS------ 133
           QAF VI KNEG+RG+Q+GL   Y YQ+ +NG R+G Y+P R  L +  + +  S      
Sbjct: 64  QAFAVIYKNEGIRGLQQGLVCGYWYQMGLNGCRIGLYEPSRKYLTQLLHPADYSDDVSKI 123

Query: 134 ---MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA-----IGHQHNYKNTFDALH 185
              + I++L+GF++G  GA I +PL+L+KTRMQSY+  ++     +G Q  YK   D   
Sbjct: 124 PQNLLINVLAGFVSGGTGAVIANPLFLIKTRMQSYNKASSKLQVSVGQQTYYKGVLDGFR 183

Query: 186 KISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSL 245
           +I   E   +G FRGVDAA++RTG GS  QL  Y   K  ++ ++ M + +I +H +SS 
Sbjct: 184 QIYAAEG-VRGWFRGVDAAVLRTGAGSSAQLPVYNLTKNYLLNHNLMENGSIGLHFVSSS 242

Query: 246 VSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAH 305
           ++G  V   MNP+DV+ TR+YNQK D      LYK   DCF K ++ EG +  YKGF A 
Sbjct: 243 MAGLGVAIVMNPWDVVLTRLYNQKGD------LYKGPADCFAKIIKTEGPWALYKGFWAQ 296

Query: 306 YLRIGPHTILTFVFLEQ 322
            LRIGPH+ILT +F+EQ
Sbjct: 297 LLRIGPHSILTLMFMEQ 313



>gi|321253695|ref|XP_003192820.1| mitochondrial inner membrane transporter; Oac1p [Cryptococcus
           gattii WM276]
 gi|317459289|gb|ADV21033.1| Mitochondrial inner membrane transporter, putative; Oac1p
           [Cryptococcus gattii WM276]
          Length = 309

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 192/313 (61%), Gaps = 16/313 (5%)

Query: 20  NKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
            + + +  +  L  FL GG A C AVT TN  E +KTRLQLQGEL R++ +  K YRN+F
Sbjct: 2   TQPQPQRPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGELQRADPSAPKVYRNVF 61

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP---- 135
             F    ++EG+RG+Q+GL  AY YQ ++NG+RLG Y+P R    + FN +    P    
Sbjct: 62  DVFRKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCR----RLFNRAIGKDPNEGV 117

Query: 136 --ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERY 193
              ++ +G   G  GA++GSPL+L+K RMQ+YS    +G QH YKN++DAL  I K + +
Sbjct: 118 FITAITAGAFTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYKNSYDALRTILKSDGF 177

Query: 194 FKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCF 253
           F GL+RGV  A++RT +GS  QL SY   K  ++  +GM  D+      +S VSG CVC 
Sbjct: 178 F-GLWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMPADSFWTFLAASSVSGVCVCI 236

Query: 254 TMNPFDVISTRMYNQ---KADQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLR 308
            M P D   TRMYNQ   K   +GK  G+LY N  DC  KT +AEGI G+YKG  AH+LR
Sbjct: 237 AMQPPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTFKAEGIAGWYKGTTAHFLR 296

Query: 309 IGPHTILTFVFLE 321
           I PHTI T VF E
Sbjct: 297 ITPHTIFTLVFNE 309



>gi|367008538|ref|XP_003678770.1| hypothetical protein TDEL_0A02270 [Torulaspora delbrueckii]
 gi|359746427|emb|CCE89559.1| hypothetical protein TDEL_0A02270 [Torulaspora delbrueckii]
          Length = 322

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 197/319 (61%), Gaps = 17/319 (5%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSN 68
           +S   N+     K+ A++ I     F  GG AAC AVT TNP E+VK R+QLQGEL+   
Sbjct: 1   MSEKANEGKVIEKSAAQK-ISKFGSFTAGGLAACIAVTVTNPIELVKIRMQLQGELS--- 56

Query: 69  SNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN 128
           S+  + Y+N  Q   VI KNEG+RG+QKGL AAY YQ+ +NG+RLGFY+P+R  + K F 
Sbjct: 57  SSLQRTYKNPVQGMGVIFKNEGIRGLQKGLVAAYIYQICLNGSRLGFYEPLRGVMNKTFY 116

Query: 129 TSST-----SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
                    ++ I+++SG  +G  GA +GSPL+LVKTR+QSYS    IG Q +Y   ++ 
Sbjct: 117 PEEEPHKVQNVTINVVSGAASGIIGAVLGSPLFLVKTRLQSYSDVVKIGEQTHYTGVWNG 176

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L  I ++E  F GL+RGVDAA++RTG GS  QL  Y   K  ++ +  M D   L H  +
Sbjct: 177 LKTIFQKEG-FMGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLNHDIMKDGTGL-HLTA 234

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S +SG  V   MNP+DVI TR+YNQK D      LYK  LDCFIKT+R EG+   YKGF 
Sbjct: 235 STISGLGVAVVMNPWDVILTRIYNQKGD------LYKGPLDCFIKTVRIEGVSALYKGFE 288

Query: 304 AHYLRIGPHTILTFVFLEQ 322
           A   RI PHTI+    +EQ
Sbjct: 289 AQVFRIAPHTIICLTMMEQ 307



>gi|58265578|ref|XP_569945.1| oxaloacetate carrier [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57226177|gb|AAW42638.1| oxaloacetate carrier, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 307

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 193/310 (62%), Gaps = 16/310 (5%)

Query: 23  RAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAF 82
           + ++ +  L  FL GG A C AVT TN  E +KTRLQLQGEL R++ +  + YRN+   F
Sbjct: 3   QPQQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGELQRNDPSAPRVYRNVLDVF 62

Query: 83  YVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP------I 136
               ++EG+RG+Q+GL  AY YQ ++NG+RLG Y+P R    + FN +    P       
Sbjct: 63  RKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCR----RLFNRAIGKDPNEGVFIT 118

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKG 196
           ++ +G + G  GA++GSPL+L+K RMQ+YS    +G QH YKN++DAL  I K + +F G
Sbjct: 119 AITAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYKNSYDALRTILKSDGFF-G 177

Query: 197 LFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMN 256
           L+RGV  A++RT +GS  QL SY   K  ++  +GM+ D+      +S VSG CVC  M 
Sbjct: 178 LWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMASDSFWTFLAASSVSGVCVCIAMQ 237

Query: 257 PFDVISTRMYNQ---KADQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
           P D   TRMYNQ   K   +GK  G+LY N  DC  KT +AEGI G+YKG  AH+LRI P
Sbjct: 238 PPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTFKAEGIAGWYKGTTAHFLRITP 297

Query: 312 HTILTFVFLE 321
           HTI T VF E
Sbjct: 298 HTIFTLVFNE 307



>gi|402079102|gb|EJT74367.1| mitochondrial oxaloacetate transporter [Gaeumannomyces graminis
           var. tritici R3-111a-1]
          Length = 310

 Score =  273 bits (698), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 185/294 (62%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+P+E VK R+QLQGEL +   +    YR  F    VIV+NEG
Sbjct: 5   LGAFIAGGIAACGAVTATHPFETVKIRMQLQGEL-QEKGHQPHHYRGPFHGVSVIVRNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFG 148
             GI +GLG AY YQ+++NG RL FY+P+R++L    F +  + S+ ++M  G  +G  G
Sbjct: 64  PGGIYRGLGCAYIYQVLLNGCRLSFYEPMRSTLTGLIFSDEKTQSLGVNMFCGAGSGIIG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QSYS F  +G QH Y+N    L +I + E    GL+RGV AAMIRT
Sbjct: 124 AAAGSPFFLVKTRLQSYSPFLPVGTQHEYRNALHGLSQIYRGEG-IGGLYRGVGAAMIRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D I +R+YNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTASGFVVCCVMHPPDTIMSRLYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY    DCF KT++ EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ------TGNLYSGVFDCFAKTVKTEGVFAIYKGFLPHLARILPHTILTLSLAEQ 289



>gi|358057236|dbj|GAA96845.1| hypothetical protein E5Q_03518 [Mixia osmundae IAM 14324]
          Length = 335

 Score =  273 bits (698), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 188/306 (61%), Gaps = 13/306 (4%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV---KPYRNIFQAFYVIVKNE 89
           GF+ G  AAC + T TNP EV KTRLQL GEL    S      K Y+N F A     + E
Sbjct: 25  GFVSGALAACVSATVTNPAEVAKTRLQLDGELQSRTSGAAGRQKVYKNAFDALAKTWRYE 84

Query: 90  GVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI--SMLSGFLAGSF 147
           G+ G+Q+GLGAAYAYQ+++NG+RLGFY+PIR  + +     + +  I  ++ +G L+G  
Sbjct: 85  GLAGVQRGLGAAYAYQIMLNGSRLGFYEPIRRRINRIAGRQTDAQTILGNLTAGALSGVV 144

Query: 148 GAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIR 207
           GA +G+PL+LVK RMQ+YS    +G QH Y N +DAL  + + E  FKGL RG+DAAM+R
Sbjct: 145 GAILGNPLFLVKARMQAYSPSNPVGAQHYYANAWDALRSVYRAEG-FKGLCRGMDAAMLR 203

Query: 208 TGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYN 267
           T +GS  QL +Y   K  + +Y  +   +I  +  +S  SG CVC  M P D   TRMYN
Sbjct: 204 TSMGSSVQLPAYNLAKSRLAEY--LPATSIWTYLAASTFSGACVCLVMQPADTALTRMYN 261

Query: 268 QKADQSG-----KGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           Q  +  G     +G LYKN +DC  KTLRAEG+ G+YKG  AH +RI PHTI+T V  E 
Sbjct: 262 QSPNAIGPDGKPRGLLYKNPIDCLWKTLRAEGVRGWYKGSTAHLMRIAPHTIITLVVNEG 321

Query: 323 YRGLYI 328
               +I
Sbjct: 322 ITQWWI 327



>gi|325091190|gb|EGC44500.1| mitochondrial carrier protein [Ajellomyces capsulatus H88]
          Length = 569

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 186/282 (65%), Gaps = 11/282 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKREAVRKYRGVFHGVKVILQNEGARG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R ++ +     ST  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRVNITQAIYKDSTHQSLGINVFSGAASGVLGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+FD L +I   E   KGL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHKYRNSFDGLRQIYMGEG-VKGLYRGVYAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLASSTCSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHT
Sbjct: 242 ---TGNLYKGVFDCLYKTISTEGVLAIYKGYFAHLARILPHT 280



>gi|475673200|gb|EMT70323.1| Mitochondrial oxaloacetate transport protein [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 310

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 186/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEGVR 
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QNKGHQPHHYRGPIHGVSVIVRNEGVRN 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+GAAY YQ+++NG RLGFYDP+RN+L  FF  +  + ++ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGAAYIYQVLLNGCRLGFYDPMRNALASFFLKDGKAQNLGINMFCGAASGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH+Y+  +     I   E    GL+RGV AAMIRT  G
Sbjct: 127 GSPFFLVKTRLQSFSAFRPVGTQHHYRGAWHGFKSIYGTEG-ISGLYRGVQAAMIRTAFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++  M +   L H  SS +SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVRHFDMEEGPGL-HLASSAISGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DC  KT+R+EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYSSVADCLSKTIRSEGLFALYKGFFPHLARILPHTILTLSLAEQ 289



>gi|299756290|ref|XP_001829225.2| oxaloacetate carrier [Coprinopsis cinerea okayama7#130]
 gi|298411610|gb|EAU92551.2| oxaloacetate carrier [Coprinopsis cinerea okayama7#130]
          Length = 329

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 197/317 (62%), Gaps = 11/317 (3%)

Query: 20  NKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
           +K+    T+    GF+ GG AAC AVT +NP EV KTRLQLQGEL +     V+ Y N  
Sbjct: 5   SKSSQPRTLSTAEGFICGGIAACIAVTVSNPAEVAKTRLQLQGELAKGGG--VRVYNNSL 62

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIR---NSLEKFFNTSSTSMPI 136
                  +NEG+RG+Q+GLG AY YQ+++NG+RLGFY+P R   NSL  +  +    M  
Sbjct: 63  DVLKKTWRNEGIRGLQRGLGPAYVYQILLNGSRLGFYEPFRLAANSLLGWAPSDQVVM-T 121

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKG 196
           S+ +G  +G+ GA +G+PL+LVK RMQ+YS    +G QH Y+++  AL  I K E   +G
Sbjct: 122 SVFAGASSGAVGATLGNPLFLVKARMQAYSPSLPVGTQHKYRSSLHALSTIFKAEGP-RG 180

Query: 197 LFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMN 256
           L RGVDAA++RT +GS  QL SY F KR+++K + + +++     +SS VSG CV   M 
Sbjct: 181 LVRGVDAAILRTSMGSSVQLPSYNFTKRTLVKNNILPENSTWTFLVSSAVSGACVLVVMQ 240

Query: 257 PFDVISTRMYNQK----ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPH 312
           P D   TR+YNQ      D   +G+LYKN LDC  KT + EG+ G+YKG  AH++RI PH
Sbjct: 241 PADTALTRVYNQPTVIGPDGRVRGALYKNPLDCLWKTFKTEGVRGWYKGSTAHFMRIAPH 300

Query: 313 TILTFVFLEQYRGLYIK 329
           TI+T    +    LY K
Sbjct: 301 TIITLTANDIILNLYKK 317



>gi|342870148|gb|EGU73445.1| hypothetical protein FOXB_16083 [Fusarium oxysporum Fo5176]
 gi|477520965|gb|ENH73084.1| Mitochondrial oxaloacetate transport protein [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 310

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 186/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEGVR 
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QNKGHQPHHYRGPIHGVSVIVRNEGVRN 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+GAAY YQ+++NG RLGFYDP+RN+L  FF  +  + ++ I+M  G  +G  GAA 
Sbjct: 67  IYRGIGAAYIYQVLLNGCRLGFYDPMRNALASFFLKDGKAQNLGINMFCGAASGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH+Y+  +     I   E    GL+RGV AAMIRT  G
Sbjct: 127 GSPFFLVKTRLQSFSAFRPVGTQHHYRGAWHGFKSIYGTEG-ISGLYRGVQAAMIRTAFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++  M +   L H  SS +SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVRHFDMEEGPGL-HLASSAISGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY +  DC  KT+R+EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYSSVADCLSKTIRSEGLFALYKGFFPHLARILPHTILTLSLAEQ 289



>gi|240275352|gb|EER38866.1| mitochondrial carrier protein [Ajellomyces capsulatus H143]
          Length = 569

 Score =  273 bits (697), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 186/282 (65%), Gaps = 11/282 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ YR +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKREAVRKYRGVFHGVKVILQNEGARG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST--SMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R ++ +     ST  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRVNITQAIYKDSTHQSLGINVFSGAASGVLGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+FD L +I   E   KGL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHKYRNSFDGLRQIYMGEG-VKGLYRGVYAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLASSTCSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHT
Sbjct: 242 ---TGNLYKGVFDCLYKTISTEGVLAIYKGYFAHLARILPHT 280



>gi|485917842|gb|EOD44647.1| putative mitochondrial oxaloacetate transporter protein
           [Neofusicoccum parvum UCRNP2]
          Length = 307

 Score =  272 bits (696), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 143/294 (48%), Positives = 188/294 (63%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +      I+KNEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKKDAPKLYRGVLHGVSTILKNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFG 148
            +G+ +GL  AY YQ+ +NG RLGFY+PIR +L +  F +T+  S  I++ SG  +G  G
Sbjct: 64  PKGLFRGLSCAYIYQMTLNGCRLGFYEPIRGNLTRLLFHDTNVQSFGINIFSGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QS+S F  +G QH+Y+N +D + +I   E   KGL+RGV  AM+RT
Sbjct: 124 AAAGSPFFLVKTRLQSFSPFLPVGTQHHYRNAWDGMKQIYTGEG-IKGLYRGVGPAMVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D + +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGMGEGPAL-HLASSTASGFVVCCVMHPPDTVMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY +  DC  +T++ EGI   YKGF AH  RI PHTILT    EQ
Sbjct: 242 ------TGNLYTSAFDCLFRTVKTEGILAVYKGFFAHLARILPHTILTLSLAEQ 289



>gi|363749589|ref|XP_003645012.1| hypothetical protein Ecym_2469 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888645|gb|AET38195.1| Hypothetical protein Ecym_2469 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 325

 Score =  272 bits (696), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 195/315 (61%), Gaps = 16/315 (5%)

Query: 17  TTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYR 76
           + A +  A + I     F+ GG AAC AVTFTNP EV KTR+QLQGEL+         Y+
Sbjct: 11  SPAGERNAAQRISKTGSFIAGGLAACIAVTFTNPVEVAKTRMQLQGELSAVGETI---YK 67

Query: 77  NIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK-FFNTSST--- 132
           N FQA  +I K EG+RG+QKGL  AY YQ+ +NG+RLGFY+PIR    K  F+T +    
Sbjct: 68  NPFQAMGLIGKTEGIRGLQKGLNCAYIYQIGLNGSRLGFYEPIRLETNKLLFSTKNPYVH 127

Query: 133 -SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEE 191
            +M +++++G L+G  GA IGSPLYL+KTRMQSYS+   +G Q  Y + ++ +  I K  
Sbjct: 128 QNMAVNIVAGTLSGMIGAVIGSPLYLIKTRMQSYSSAIQVGQQTRYSSIWNGITSIVKNH 187

Query: 192 RYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCV 251
              KGLF G DAA++RTG GS  QL  Y   K  +++ + M D   L H ++S +SG  V
Sbjct: 188 G-IKGLFHGTDAAILRTGAGSAVQLPIYNSAKNFLLRNAHMQDGYSL-HLIASTISGVGV 245

Query: 252 CFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
              MNP+DVI TR+YNQ       GSLYK  +DCF+KT++ EG    YKGF A   RI P
Sbjct: 246 AIVMNPWDVILTRVYNQ------SGSLYKGPIDCFLKTIKIEGPSALYKGFAAQLSRICP 299

Query: 312 HTILTFVFLEQYRGL 326
           HTIL   FLEQ   L
Sbjct: 300 HTILCLTFLEQTMNL 314



>gi|115387425|ref|XP_001211218.1| mitochondrial oxaloacetate transport protein [Aspergillus terreus
           NIH2624]
 gi|114195302|gb|EAU37002.1| mitochondrial oxaloacetate transport protein [Aspergillus terreus
           NIH2624]
          Length = 294

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/282 (49%), Positives = 187/282 (66%), Gaps = 11/282 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S  + VK YR +F    VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QSKGDAVKKYRGVFHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+ +AY YQ+++NG RLGFY+P+R  +    + + +  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIDSAYIYQILLNGCRLGFYEPLRKGITTTVYNDPNVQSLGINVFSGAASGIIGAAC 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            SP +LVKTR+QSYS F  +G QH Y+N+FD L +I   E   +GL+RGV+AAM+RTG G
Sbjct: 127 ASPFFLVKTRLQSYSPFLPVGTQHQYRNSFDGLRQIYTSEGA-RGLYRGVNAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
               G+LYK+  DC  +T+R EGI   YKG+ AH  RI PHT
Sbjct: 242 ---TGNLYKSAFDCLAQTVRTEGILAIYKGYFAHLARILPHT 280



>gi|261189557|ref|XP_002621189.1| mitochondrial oxaloacetate transporter [Ajellomyces dermatitidis
           SLH14081]
 gi|239591425|gb|EEQ74006.1| mitochondrial oxaloacetate transporter [Ajellomyces dermatitidis
           SLH14081]
 gi|239613044|gb|EEQ90031.1| mitochondrial oxaloacetate transporter [Ajellomyces dermatitidis
           ER-3]
          Length = 283

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 187/283 (66%), Gaps = 11/283 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S    V+ Y+ +F    VI++NEG RG
Sbjct: 8   FIAGGLAACGAVTVTHSFETVKIRLQLQGEL-QSKQEAVRKYKGVFHGVRVILQNEGARG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  + K  + + +  S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRVGVTKAIYKDPAHQSLGINVFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N+ D L +I + E   +GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHMYRNSVDGLRQIHRGEG-VRGLYRGVYAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR +IK+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLIKHLGMEDGPAL-HLASSACSGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTI 314
               G+LYK   DC  KT+  EG+   YKG+ AH  RI PHT+
Sbjct: 242 ---TGNLYKGVFDCLYKTISKEGVLAIYKGYFAHLARILPHTV 281



>gi|328350140|emb|CCA36540.1| Uncharacterized WD repeat-containing protein alr3466 [Komagataella
            pastoris CBS 7435]
          Length = 1159

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 184/286 (64%), Gaps = 13/286 (4%)

Query: 42   CSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAA 101
            C AVT TNP EVVKTR+QLQGEL+  N++  +PY+N  Q   V+ +NEG++G Q+GL +A
Sbjct: 866  CGAVTITNPIEVVKTRMQLQGELSAKNAHVPRPYKNPIQGVLVVYRNEGIKGCQRGLVSA 925

Query: 102  YAYQLVMNGARLGFYDPIRNSLEKFFNTSST-----SMPISMLSGFLAGSFGAAIGSPLY 156
            + YQL +NG RLG Y+PIRN+L +    S       +  I+++SG ++G+ GA +GSPL+
Sbjct: 926  WIYQLGLNGCRLGLYEPIRNTLNRLMYPSRDPHTVQNTAINVISGAVSGAAGATVGSPLF 985

Query: 157  LVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQL 216
            LVKTRMQSYS    IG Q +Y+  ++ L  I ++   F GLF+GVDAA+IRT  GS  QL
Sbjct: 986  LVKTRMQSYSNSIQIGQQTHYRGVWNGLSTIYRQSG-FMGLFQGVDAAIIRTAAGSSVQL 1044

Query: 217  SSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKG 276
              Y F K  ++K   M +   L H  SSL +G  V   MNP+DVI TR+YNQK       
Sbjct: 1045 PIYNFAKHELLKNQIMEEGTGL-HLTSSLFAGIGVSVVMNPWDVILTRIYNQKT------ 1097

Query: 277  SLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
             LY   LDC IK ++ EGI   YKGF A  LR+ PHTIL  VF+EQ
Sbjct: 1098 KLYSGPLDCLIKIVKVEGIMALYKGFEAQILRVAPHTILCLVFMEQ 1143



>gi|294656293|ref|XP_458551.2| DEHA2D01914p [Debaryomyces hansenii CBS767]
 gi|199431356|emb|CAG86683.2| DEHA2D01914p [Debaryomyces hansenii CBS767]
          Length = 335

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 206/328 (62%), Gaps = 25/328 (7%)

Query: 12  SVNQQTTANKAR-AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSN 70
           +VN++  +N  + A E +  L GFL GG AAC AVTFTNP E++KTR+QLQGEL++ NSN
Sbjct: 2   TVNEEVGSNPNKSAAENVSTLGGFLAGGLAACGAVTFTNPIELIKTRMQLQGELSK-NSN 60

Query: 71  YVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS 130
             K Y+N FQAF +I + EG++G+Q+GL   Y YQL +NG R+G Y+P R  L K    S
Sbjct: 61  APKLYKNPFQAFGLIYRKEGIKGLQQGLTCGYYYQLGLNGCRIGLYEPSRYFLTKILKPS 120

Query: 131 S--------TSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA--------IGHQ 174
           S         ++ I++L+GF +G+ GA + SP +L+KTRMQSYS   A        +G Q
Sbjct: 121 SFKEGEKVPQNLWINVLAGFASGAAGAVLASPFFLIKTRMQSYSGAKAASSEGAQGVGQQ 180

Query: 175 HNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSD 234
             YK + D L KI K E    GLFRGVDAA++RTG GS  QL  Y F K  +++Y  + D
Sbjct: 181 TYYKGSADGLSKIYKAEGIV-GLFRGVDAAILRTGAGSAAQLPVYNFTKSLLLEYDIVED 239

Query: 235 DNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEG 294
           ++  +H LS   +G  V   MNP+DVI TR+YNQK D      LYK  +DCF KT+R EG
Sbjct: 240 NSTGLHFLSGASAGLGVAIVMNPWDVILTRVYNQKGD------LYKGPIDCFSKTVRTEG 293

Query: 295 IFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               YKGF A   RI PH+ILT +F+E 
Sbjct: 294 FSALYKGFYAQLFRIWPHSILTLMFMEH 321



>gi|156849205|ref|XP_001647483.1| hypothetical protein Kpol_1018p165 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156118169|gb|EDO19625.1| hypothetical protein Kpol_1018p165 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 322

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 190/316 (60%), Gaps = 16/316 (5%)

Query: 12  SVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNY 71
           ++ ++    +  A + I     F  GG AAC AVTFTNP E+VK R+QLQGEL       
Sbjct: 2   AIEKKEVVVEKTAAQKISKFGSFTAGGIAACIAVTFTNPIELVKIRMQLQGELAAVGEGI 61

Query: 72  VKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF---- 127
              Y+N  Q   VI +NEG+  +QKGL AAY YQ+ +NG+RLGFY+PIR +  +      
Sbjct: 62  ---YKNPIQGVGVIFRNEGIMALQKGLNAAYIYQIALNGSRLGFYEPIRTASNRALFPGQ 118

Query: 128 -NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHK 186
                 S+ +++ SG  +G  GA IGSPL+LVKTR+QSYS    IG Q +Y+  +D L  
Sbjct: 119 DPHKKQSVAVNVFSGASSGIIGAVIGSPLFLVKTRLQSYSEAFKIGEQTHYRGVWDGLKT 178

Query: 187 ISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLV 246
           I + E   +GL+RG+DAA++RTG GS  QL  Y   K  ++K   M D  +L H  +S +
Sbjct: 179 IYRSEG-IRGLYRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNRLMKDGPLL-HLTASTI 236

Query: 247 SGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHY 306
           SG  V   MNP+DVI TR+YNQK D      LYK  +DCFIKT+R EG+   YKGF A  
Sbjct: 237 SGMGVAVVMNPWDVILTRIYNQKGD------LYKGPIDCFIKTVRIEGVSALYKGFEAQI 290

Query: 307 LRIGPHTILTFVFLEQ 322
            RI PHTIL   F+EQ
Sbjct: 291 FRIAPHTILCLTFMEQ 306



>gi|449302144|gb|EMC98153.1| hypothetical protein BAUCODRAFT_67402 [Baudoinia compniacensis UAMH
           10762]
          Length = 323

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 145/304 (47%), Positives = 184/304 (60%), Gaps = 21/304 (6%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +     VI +NEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKQDAPKLYRGVLHGVRVIYQNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF-FNTSST-----------SMPISM 138
           +RG+ +GL  AY YQ+ +NG RLGFYDPIR SL     N   +           S+PI++
Sbjct: 64  MRGLLRGLSCAYIYQMTLNGCRLGFYDPIRTSLNSLALNRDLSHMQDTRVKQYQSLPINI 123

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
            SG  +G  GAA GSP +LVKTR+QSYS F  +G QH Y+N +D L +I + E   +GL+
Sbjct: 124 FSGATSGILGAAAGSPFFLVKTRLQSYSPFLPVGTQHQYRNAWDGLSQIYRAEG-IRGLY 182

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RG+  AM+RTG GS  QL +YF  KR +  +  M D   L H LSS  SGF VC  M+P 
Sbjct: 183 RGIYPAMVRTGFGSAVQLPTYFLAKRRLQSWFDMPDGAPL-HLLSSTASGFVVCVFMHPP 241

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           D + +RMYNQ       G+LY    DC  +T++ EGI   YKGF AH  RI PHTILT  
Sbjct: 242 DTVMSRMYNQ------TGNLYSGAFDCLYRTVKTEGILAVYKGFFAHLARILPHTILTLS 295

Query: 319 FLEQ 322
             EQ
Sbjct: 296 LAEQ 299



>gi|429863481|gb|ELA37932.1| mitochondrial oxaloacetate transport protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 388

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 192/324 (59%), Gaps = 37/324 (11%)

Query: 34  FLIGGAAACSAVTFTNPWEVVK--------------------------TRLQLQGELTRS 67
           F+ GG AAC AVT T+P+E VK                          +R+QLQGEL + 
Sbjct: 60  FIAGGIAACGAVTATHPFETVKIRFVPALLALPPMLALPQCADPSSTTSRMQLQGEL-KD 118

Query: 68  NSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF 127
             +    YR   Q   VIV+NEGVRGI +G+G AY YQ+++NG RLGFY+P+R+ L    
Sbjct: 119 KGHQPHQYRGPLQGVSVIVRNEGVRGIYRGIGCAYVYQVLLNGCRLGFYEPMRHGLASLI 178

Query: 128 --NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALH 185
             + S  S+ I+M  G  +G  GAA GSP +LVKTR+QS+S F  +G QH Y+N ++ L 
Sbjct: 179 YNDGSKQSLGINMFCGAGSGIMGAAAGSPFFLVKTRLQSFSPFLPVGTQHKYRNAWNGLS 238

Query: 186 KISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSL 245
            I   E   +GL+RGV AAMIRTG GS  QL +YFF KR ++++ GM ++ + +H  SS 
Sbjct: 239 SIYHNEG-VRGLYRGVGAAMIRTGFGSSVQLPTYFFAKRRLVRHLGM-EEGLPLHLASST 296

Query: 246 VSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAH 305
           VSGF VC  M+P D I +R+YNQ       G+LYK   DC  KT+R EG+F  YKGF  H
Sbjct: 297 VSGFVVCCVMHPPDTIMSRLYNQ------NGNLYKGVFDCLSKTVRTEGLFAIYKGFLPH 350

Query: 306 YLRIGPHTILTFVFLEQYRGLYIK 329
             RI PHTILT    EQ   L  K
Sbjct: 351 LARILPHTILTLTLAEQMNKLIRK 374



>gi|358397916|gb|EHK47284.1| hypothetical protein TRIATDRAFT_128804 [Trichoderma atroviride IMI
           206040]
          Length = 312

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 139/280 (49%), Positives = 183/280 (65%), Gaps = 11/280 (3%)

Query: 45  VTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAY 104
           VT T+P EV+K R QLQGEL ++     + YR       VIVKNEG++GI +GLGAAY Y
Sbjct: 19  VTVTHPAEVLKIRQQLQGEL-QTKGAQPQYYRGPIHGISVIVKNEGIKGIYRGLGAAYVY 77

Query: 105 QLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRM 162
           Q+++NG RLGFY+PIR SL   F  + S+ ++ I++ +G  +G  GAA GSP +LVKTR+
Sbjct: 78  QVLLNGCRLGFYEPIRKSLATLFLKDESAQNLGINVFAGASSGILGAAAGSPFFLVKTRL 137

Query: 163 QSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFI 222
           QS+S    +G QHNY+N +D L +I + E +F GL+RG+ AAM+RTG GS  QL +YF  
Sbjct: 138 QSFSPVRPVGTQHNYRNAWDGLRQIYRGEGFF-GLYRGISAAMVRTGFGSSVQLPTYFLA 196

Query: 223 KRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNT 282
           KR ++K++GM +   L H  SS VSGF VC  M+P D I +R+YNQ       G+LY   
Sbjct: 197 KRQLVKHAGMEEGPAL-HLSSSAVSGFVVCCVMHPPDTIMSRLYNQ------HGNLYSGI 249

Query: 283 LDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
            DC  KT+R EG+   YKGF  H  RI PHTILT    EQ
Sbjct: 250 FDCLGKTIRTEGVLAIYKGFIPHLARILPHTILTLSLAEQ 289



>gi|407923325|gb|EKG16398.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina
           MS6]
          Length = 308

 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 141/294 (47%), Positives = 186/294 (63%), Gaps = 11/294 (3%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +      I+KNEG
Sbjct: 5   LGSFIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKKDAPKLYRGVLHGVATILKNEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFG 148
            +G+ +GL  AY YQ+ +NG RLGFY+PIR +L K  F + +  S  +++ SG  +G  G
Sbjct: 64  PKGLFRGLSCAYIYQMTLNGCRLGFYEPIRGNLTKLLFHDANVQSFGVNIFSGASSGILG 123

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
           AA GSP +LVKTR+QS+S F  +G QH+YKN +D + +I   E   KGL+RGV  A +RT
Sbjct: 124 AAAGSPFFLVKTRLQSFSPFLPVGTQHHYKNAWDGMKQIYTAEG-IKGLYRGVGPACVRT 182

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
           G GS  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P D + +RMYNQ
Sbjct: 183 GFGSSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSTASGFVVCCVMHPPDTVMSRMYNQ 241

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                  G+LY +  DC  +T++ EG+   YKGF AH  RI PHTILT    EQ
Sbjct: 242 ------TGNLYTSAFDCLFRTVKTEGLLAVYKGFFAHLARILPHTILTLSLAEQ 289



>gi|393218320|gb|EJD03808.1| oxaloacetate carrier [Fomitiporia mediterranea MF3/22]
          Length = 325

 Score =  269 bits (687), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 182/291 (62%), Gaps = 9/291 (3%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVR 92
           GF+ GG AAC+AVT +NP EV KTRLQLQGEL R     VK Y +         +NEG+R
Sbjct: 18  GFICGGLAACTAVTVSNPAEVAKTRLQLQGELVRGGG--VKVYNSAIDVLVKTWRNEGIR 75

Query: 93  GIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM--PISMLSGFLAGSFGAA 150
           G+Q+GL  AY YQ+++NG+RLGFY+P R +  +      T      S+ +G  +G  GA 
Sbjct: 76  GLQRGLSPAYVYQILLNGSRLGFYEPFRRTFNRLVGRPITEQIATTSVAAGAASGIVGAC 135

Query: 151 IGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           +G+PL+L+K RMQ+YS    +G QH YK + DAL  I + ER F+GL RG+DAAM+RT  
Sbjct: 136 LGNPLFLIKARMQAYSPALPVGTQHYYKGSLDALVTIFRAER-FRGLIRGIDAAMLRTAC 194

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKA 270
           GS  QL +Y + K+ +      ++ +I     SS VSG CVC  M P D   TRMYNQ  
Sbjct: 195 GSAVQLPTYNWTKKHLAATGITNEGSIWTFLASSAVSGACVCLAMQPADTALTRMYNQPT 254

Query: 271 DQ--SGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
            +  +G+  G+LYK+  DC  KTL+ EG FG YKG  AH+LRI PHTI+T 
Sbjct: 255 HRLPNGRMVGTLYKHPFDCLWKTLKIEGPFGLYKGSTAHFLRIAPHTIITL 305



>gi|169779221|ref|XP_001824075.1| oxaloacetate transport protein [Aspergillus oryzae RIB40]
 gi|238499847|ref|XP_002381158.1| mitochondrial oxaloacetate transporter (Oac), putative [Aspergillus
           flavus NRRL3357]
 gi|83772814|dbj|BAE62942.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220692911|gb|EED49257.1| mitochondrial oxaloacetate transporter (Oac), putative [Aspergillus
           flavus NRRL3357]
 gi|391873172|gb|EIT82246.1| oxaloacetate carrier protein [Aspergillus oryzae 3.042]
          Length = 310

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 193/291 (66%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S  VK Y+ +F    VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKSEAVKKYKGVFHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R +L    + +    S+ I++ +G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRKTLTTTIYQDPQVQSLGINVFAGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QHNY N+FD L KI   E    GL+RGV+AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHNYHNSFDGLRKIYTSEG-VGGLYRGVNAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGMEDGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK  LDC  +T+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGALDCLYQTVRKEGLLAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|50552101|ref|XP_503525.1| YALI0E04048p [Yarrowia lipolytica]
 gi|49649394|emb|CAG79104.1| YALI0E04048p [Yarrowia lipolytica CLIB122]
          Length = 317

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/306 (46%), Positives = 189/306 (61%), Gaps = 12/306 (3%)

Query: 20  NKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
            K +  + I  L GF+ G  AAC AVT TNP E+VKTR+QLQGEL  +     K Y +  
Sbjct: 8   QKKQPPKQISTLGGFVAGAIAACGAVTVTNPIELVKTRMQLQGELA-ARGEAKKVYTSPL 66

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS---STSMPI 136
           QA   I K+EG++G+Q GL +AY YQ+ +NG RLG Y+P R  +    N        + +
Sbjct: 67  QALVKIYKSEGIKGLQSGLFSAYVYQIGLNGCRLGLYEPTRKVIANVCNIDLNKENPVGL 126

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKG 196
           ++ SG ++G  GA  GSP YL+KTR QSYS    +G Q  YK+  D   +I   E  FKG
Sbjct: 127 NVASGAISGIMGAVAGSPFYLIKTRQQSYSPAFKVGAQTYYKSIGDGFRQIYGAEG-FKG 185

Query: 197 LFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMN 256
           L+RGVDAA++RTG GS  QL  Y + K  ++K+  ++D     H ++S +SG  V   MN
Sbjct: 186 LYRGVDAAILRTGAGSSVQLPIYNWAKELLLKHH-ITDPGASTHLVASAMSGLGVAVVMN 244

Query: 257 PFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILT 316
           P+DV+ TRMYNQK      G++YKN  DC +KT+  EG F  YKGFGAH LRI PHTILT
Sbjct: 245 PWDVLMTRMYNQK------GNMYKNPFDCLMKTVSIEGPFALYKGFGAHLLRIAPHTILT 298

Query: 317 FVFLEQ 322
            +F+EQ
Sbjct: 299 LMFMEQ 304



>gi|494834339|gb|EON69988.1| hypothetical protein W97_09254 [Coniosporium apollinis CBS 100218]
          Length = 310

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 183/291 (62%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG A C AVT T+ +E VK RLQLQGEL +S  +  + YR +     VI+KNEG+RG
Sbjct: 8   FIAGGIAGCGAVTVTHSFETVKIRLQLQGEL-QSKKDAPRLYRGVLHGASVILKNEGMRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +GL   Y YQ+ +NG RLGFY+P+R SL    F + +  S  +++ SG  +G  GAA 
Sbjct: 67  LLRGLSCGYIYQMTLNGCRLGFYEPLRKSLTTALFKDPNVQSFGVNIFSGAASGILGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH+Y++ +D L  I + E   KGL+RGV  AM+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHHYRSAWDGLSTIYRNEG-VKGLYRGVGPAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM +   L H  SS  SG  VC  M+P D + +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGMEEGPAL-HLASSAASGVVVCCVMHPPDTVMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  +T++ EG+   YKGF AH  RI PHT+LT    EQ
Sbjct: 242 ---TGNLYSGAFDCLFRTIKTEGVLAVYKGFFAHLARILPHTVLTLSLAEQ 289



>gi|302904126|ref|XP_003049008.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729942|gb|EEU43295.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 309

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 185/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL ++  +    YR       VIV+NEGVR 
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QNKGHQPHHYRGPIHGVSVIVRNEGVRR 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+GAAY YQ+++NG RLGFY+P+R+ L   F  +  + ++ I+ML G  +G  GAA 
Sbjct: 67  IYRGIGAAYIYQVLLNGCRLGFYEPMRHGLATLFLKDGKAQNLGINMLCGASSGVIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH+Y+  +     I   E    GL+RGV AAMIRT  G
Sbjct: 127 GSPFFLVKTRLQSYSEFRPVGTQHHYRGAWHGFKSIYGSEG-ITGLYRGVRAAMIRTAFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++++ GM +   L H   S +SGF VC  M+P D + +R+YNQ   
Sbjct: 186 SSVQLPTYFFAKRRLVRHLGMEEGPGL-HLACSAMSGFVVCCVMHPPDTVMSRLYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK  +DC  KT+ +EG+F  YKGF  H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYKGVIDCLSKTIHSEGLFALYKGFLPHLARILPHTILTLSLAEQ 289



>gi|350639698|gb|EHA28052.1| hypothetical protein ASPNIDRAFT_41991 [Aspergillus niger ATCC 1015]
          Length = 310

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +     VI++NEG RG
Sbjct: 8   FIAGGVAACGAVTVTHSFETVKIRLQLQGEL-QAKQDAAKKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L    + +    S+ I++L+G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRQGLATTIYQDAQVQSLGINVLAGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QHNYKN+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHNYKNSFDGLRKIHTSEG-VSGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMKHLGMEDGPGL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT++ EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLFKTIKTEGVLAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|317034851|ref|XP_001401309.2| oxaloacetate transport protein [Aspergillus niger CBS 513.88]
          Length = 310

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/303 (49%), Positives = 195/303 (64%), Gaps = 15/303 (4%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +     VI++NEG RG
Sbjct: 8   FIAGGVAACGAVTVTHSFETVKIRLQLQGEL-QAKQDAAKKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L    + +    S+ I++L+G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRQGLATTIYQDAQVQSLGINVLAGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QHNYKN+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHNYKNSFDGLRKIHTSEG-VSGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMKHLGMEDGPGL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ----YRGLY 327
               G+LYK   DC  KT++ EG+   YKG+ AH  RI PHTILT    EQ     RGL 
Sbjct: 242 ---TGNLYKGVFDCLFKTIKTEGVLAIYKGYFAHLARILPHTILTLSLAEQTNKIMRGLE 298

Query: 328 IKY 330
            ++
Sbjct: 299 DRF 301



>gi|340522217|gb|EGR52450.1| mitochondrial oxaloacetate/sulfate/thiosulfate transporter-like
           protein [Trichoderma reesei QM6a]
          Length = 312

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 181/280 (64%), Gaps = 11/280 (3%)

Query: 45  VTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAY 104
           VT T+P EV+K R QLQGEL ++     + YR       VIVKNEG+RGI +GLGAAY Y
Sbjct: 19  VTVTHPAEVLKIRQQLQGEL-QTKGAQPQYYRGPIHGISVIVKNEGIRGIYRGLGAAYIY 77

Query: 105 QLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRM 162
           Q+++NG RLGFY+P+R +    F  + +  ++ I++  G  +G  GAA GSP +LVKTR+
Sbjct: 78  QVLLNGCRLGFYEPMRKATAALFLGDETRQNLAINVFCGASSGILGAAAGSPFFLVKTRL 137

Query: 163 QSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFI 222
           QSYS    +G QHNY+N +D L +I + E  F GL+RG+ AAM+RTG GS  QL +YF  
Sbjct: 138 QSYSPVRPVGTQHNYRNLWDGLRQIYRGEG-FTGLYRGITAAMVRTGFGSSVQLPTYFLA 196

Query: 223 KRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNT 282
           KR ++K++GM +   L H  SS VSGF VC  M+P D I +R+YNQ       G+LY   
Sbjct: 197 KRQLVKHAGMEEGPAL-HLASSSVSGFVVCCVMHPPDTIMSRLYNQ------HGNLYSGI 249

Query: 283 LDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           LDC  KT+R EGIF  YKGF  H  RI PHTILT    EQ
Sbjct: 250 LDCAGKTIRTEGIFAIYKGFIPHLARILPHTILTLSLAEQ 289



>gi|452846107|gb|EME48040.1| hypothetical protein DOTSEDRAFT_69840 [Dothistroma septosporum
           NZE10]
          Length = 320

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/309 (46%), Positives = 187/309 (60%), Gaps = 21/309 (6%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E +K RLQLQGEL ++  +  + Y+ +     V+  NEG +G
Sbjct: 8   FIAGGIAACGAVTVTHSFETIKIRLQLQGEL-KAKKDAPRLYKGVLHGVRVVYTNEGFKG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF-FNTSST-----------SMPISMLSG 141
           + +GLG AY YQ+ +NG RLGFYDPIR SL     + S T           S+PI++ SG
Sbjct: 67  LLRGLGCAYVYQMTLNGCRLGFYDPIRTSLNSIALHRSPTHMSDPDVKAMQSLPINIASG 126

Query: 142 FLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
             +G  GA +GSP +LVKTR+QSYS F  +G QH Y+N  D + +I   E    GL+RGV
Sbjct: 127 ASSGILGAFLGSPFFLVKTRLQSYSPFLPVGTQHQYRNAVDGMRQIYGAEG-VTGLWRGV 185

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVI 261
             AM+RTG GS  QL +YFF KR + +   + D   L H +SS  SGF VC  M+P D +
Sbjct: 186 GPAMVRTGFGSSVQLPTYFFAKRLLQRNFDIKDGAPL-HLMSSTASGFVVCVVMHPPDTV 244

Query: 262 STRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
            +RMYNQ       G+LY   LDC  KT+++EGIF  YKGF AH  RI PHTILT    E
Sbjct: 245 MSRMYNQ------TGNLYSGALDCLFKTVKSEGIFAVYKGFFAHLARILPHTILTLSLAE 298

Query: 322 QYRGLYIKY 330
           Q   L  K+
Sbjct: 299 QTNKLMRKF 307



>gi|70997333|ref|XP_753416.1| mitochondrial oxaloacetate transporter (Oac) [Aspergillus fumigatus
           Af293]
 gi|66851052|gb|EAL91378.1| mitochondrial oxaloacetate transporter (Oac), putative [Aspergillus
           fumigatus Af293]
          Length = 377

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S  VK Y+ +F    VI++NEG RG
Sbjct: 75  FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKSEAVKKYKGVFHGVKVILQNEGPRG 133

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  +    + +    S+ I++ SG  +G  GAA 
Sbjct: 134 LFRGIGSAYIYQILLNGCRLGFYEPLRKGITTAVYKDPQVQSLGINVFSGAASGIIGAAA 193

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 194 GSPFFLVKTRLQSYSPFLPVGTQHEYRNSFDGLRKIYMSEG-VGGLYRGVGAAMVRTGFG 252

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS VSGF VC  M+P D + +RMYNQ   
Sbjct: 253 SSVQLPTYFFAKRRLVKHLGMEDGPGL-HLASSTVSGFVVCCVMHPPDTVMSRMYNQ--- 308

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+R EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 309 ---TGNLYKGAFDCLFKTIRKEGILAIYKGYFAHLARILPHTILTLSLAEQ 356



>gi|159126857|gb|EDP51973.1| mitochondrial oxaloacetate transporter (Oac), putative [Aspergillus
           fumigatus A1163]
          Length = 377

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 191/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++ S  VK Y+ +F    VI++NEG RG
Sbjct: 75  FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKSEAVKKYKGVFHGVKVILQNEGPRG 133

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  +    + +    S+ I++ SG  +G  GAA 
Sbjct: 134 LFRGIGSAYIYQILLNGCRLGFYEPLRKGITTAVYKDPQVQSLGINVFSGAASGIIGAAA 193

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 194 GSPFFLVKTRLQSYSPFLPVGTQHEYRNSFDGLRKIYMSEG-VGGLYRGVGAAMVRTGFG 252

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS VSGF VC  M+P D + +RMYNQ   
Sbjct: 253 SSVQLPTYFFAKRRLVKHLGMEDGPGL-HLASSTVSGFVVCCVMHPPDTVMSRMYNQ--- 308

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+R EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 309 ---TGNLYKGAFDCLFKTIRKEGILAIYKGYFAHLARILPHTILTLSLAEQ 356



>gi|121713830|ref|XP_001274526.1| mitochondrial carrier protein [Aspergillus clavatus NRRL 1]
 gi|119402679|gb|EAW13100.1| mitochondrial carrier protein [Aspergillus clavatus NRRL 1]
          Length = 310

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 189/291 (64%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL +S S+ VK YR +F    VI++NEG RG
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QSKSDAVKKYRGVFHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  +    + +    S+ I++ SG  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRKGITTAVYKDPQVQSLGINVFSGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHKYRNSFDGLRKIYTSEG-VGGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++ + GM D   L H  SS  SGF VC  M+P D + +RMYNQ  D
Sbjct: 186 SSVQLPTYFFAKRRLMNHLGMEDGPAL-HLASSTASGFVVCCVMHPPDTVMSRMYNQTGD 244

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
                 LYK   DC  KT+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 245 ------LYKGAFDCLFKTIRKEGVLAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|392576958|gb|EIW70088.1| hypothetical protein TREMEDRAFT_38758 [Tremella mesenterica DSM
           1558]
          Length = 339

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 195/316 (61%), Gaps = 14/316 (4%)

Query: 25  KETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYV 84
           +  +  L  F+ GG A C+AVT +N  EV KTRLQLQGEL R++SN  + Y+N+F  F  
Sbjct: 25  QAPLNLLESFMCGGLAGCAAVTVSNMPEVCKTRLQLQGELQRADSNAPRVYKNVFDVFVK 84

Query: 85  IVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPIS--MLSGF 142
             K+EG+RG+Q+GL  AY YQ+++NG+RLGFY+PIR  L            IS  + +G 
Sbjct: 85  TWKHEGIRGLQRGLVPAYGYQILLNGSRLGFYEPIRRMLNTAIGRDPAEGLISTALTAGA 144

Query: 143 LAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVD 202
           L G  GAA+GSPL+LVK R+Q++S    +G QH YK ++DAL  I K +    GL+RGV+
Sbjct: 145 LTGCIGAALGSPLFLVKARIQAFSPALPVGAQHYYKGSYDALRTILKTDGVL-GLWRGVN 203

Query: 203 AAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVIS 262
           AA++RT + S  QL SY   K  ++K +G  D +      +S +SG CVC  M P D + 
Sbjct: 204 AALLRTAMAS-FQLPSYNLGKSILVK-NGWDDKSFFTFLTASSISGVCVCAAMQPADTVL 261

Query: 263 TRMYNQKADQSG-----KGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
           TRMYNQ   +       +G+LY N +DC  KT + EGI G+YKG  AH+LRI PHT++T 
Sbjct: 262 TRMYNQNTIKDPITGRVRGALYTNPIDCLWKTFKTEGIAGWYKGTTAHFLRIAPHTVVTL 321

Query: 318 V----FLEQYRGLYIK 329
           V     + QY+ +  K
Sbjct: 322 VANELIMTQYKNMREK 337



>gi|358383614|gb|EHK21278.1| hypothetical protein TRIVIDRAFT_70356 [Trichoderma virens Gv29-8]
          Length = 313

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 137/280 (48%), Positives = 180/280 (64%), Gaps = 11/280 (3%)

Query: 45  VTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAY 104
           VT T+P EV+K R QLQGEL ++     + YR       VIVKNEG+RGI +GLGAAY Y
Sbjct: 19  VTVTHPAEVLKIRQQLQGEL-QTKGAQPQYYRGPIHGISVIVKNEGIRGIYRGLGAAYIY 77

Query: 105 QLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRM 162
           Q+++NG RLGFY+P+R  +   F  +  + ++ I++  G  +G  GAA GSP +LVKTR+
Sbjct: 78  QVLLNGCRLGFYEPMRKGMSNLFLGDEKAQNLAINVFCGASSGIIGAAAGSPFFLVKTRL 137

Query: 163 QSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFI 222
           QSYS    +G QHNY+N +D L +I + E +F GL+RG+ AAM+RTG GS  QL +YF  
Sbjct: 138 QSYSPVRPVGTQHNYRNAWDGLRQIYRGEGFF-GLYRGISAAMVRTGFGSSVQLPTYFLA 196

Query: 223 KRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNT 282
           KR ++K++GM +   L H  SS VSGF VC  M+P D I +R+YNQ       G+LY   
Sbjct: 197 KRQLVKHAGMEEGPAL-HLASSSVSGFVVCCVMHPPDTIMSRLYNQ------HGNLYSGI 249

Query: 283 LDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
            DC  KT+R EG+   YKGF  H  RI PHTILT    EQ
Sbjct: 250 FDCLGKTIRTEGVLAIYKGFIPHLARILPHTILTLSLAEQ 289



>gi|367003573|ref|XP_003686520.1| hypothetical protein TPHA_0G02510 [Tetrapisispora phaffii CBS 4417]
 gi|357524821|emb|CCE64086.1| hypothetical protein TPHA_0G02510 [Tetrapisispora phaffii CBS 4417]
          Length = 321

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 188/313 (60%), Gaps = 16/313 (5%)

Query: 15  QQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP 74
            +T   +  A + I     F  GG AAC AVTFTNP EV+K R+QLQGEL          
Sbjct: 4   DKTDIREKSAAQKISKFGSFTAGGLAACIAVTFTNPIEVIKIRMQLQGELASVGQGI--- 60

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS- 133
           Y+N FQ   V+ +NEG   +QKGL AAY YQ+ +NG+RLGFY+PIR +L K F     S 
Sbjct: 61  YKNPFQGIGVVFRNEGFMALQKGLNAAYIYQIALNGSRLGFYEPIRYALNKTFFPGVDSH 120

Query: 134 ----MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISK 189
               + +++ +G  +G  GA IGSPL+LVKTR+QSYS    +G Q  Y   ++ L  I K
Sbjct: 121 LKQNVAVNVAAGATSGIIGAVIGSPLFLVKTRLQSYSEAFKVGEQTRYTGVWNGLKAIYK 180

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
            E  F+GL+RGVDAA++RTG GS  QL  Y   K  +IK   M D   L H  +S +SG 
Sbjct: 181 TEG-FRGLYRGVDAAILRTGAGSSVQLPIYNTTKSVLIKSDLMKDGPAL-HLTASTISGL 238

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   MNP+DVI TR+YNQ      +G+ YK  +DC +KT++ EG+   YKGF A   RI
Sbjct: 239 GVAVVMNPWDVILTRIYNQ------RGNKYKGPIDCLVKTVKIEGLSALYKGFEAQVFRI 292

Query: 310 GPHTILTFVFLEQ 322
           GPHTI+   F+EQ
Sbjct: 293 GPHTIMCLTFMEQ 305



>gi|353240749|emb|CCA72603.1| related to OAC1-similarity to mitochondrial uncoupling proteins
           (MCF) [Piriformospora indica DSM 11827]
          Length = 322

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 186/307 (60%), Gaps = 13/307 (4%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F  GG AAC AVT +NP EV KTRLQLQGEL +     V  Y +         +NEG+RG
Sbjct: 13  FFCGGLAACVAVTISNPAEVAKTRLQLQGELAKDGGQRV--YHSAIDVLRKTWRNEGIRG 70

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF--FNTSSTSMPISMLSGFLAGSFGAAI 151
           IQ+GL   Y YQ+++NG+RLGFY+PIR ++     F      +  S+L+G  +G  GA++
Sbjct: 71  IQRGLPPGYVYQILLNGSRLGFYEPIRTTVNSILGFKPKEQIVGTSVLAGAASGVVGASL 130

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           G+PL+L+K RMQ+YS    IG QH YK++FDAL  I K++    GL RG+DAA++RT  G
Sbjct: 131 GNPLFLIKARMQAYSPALPIGAQHYYKSSFDALSSIYKKDGA-HGLIRGMDAAILRTAAG 189

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL SY + K  ++    +  D+      SS VSG CVC  M PFD   TR+YNQ  +
Sbjct: 190 SSVQLPSYNWTKNQLVTRGILPADSTWTFLASSTVSGACVCLVMQPFDTALTRVYNQPTE 249

Query: 272 Q--SGKGS------LYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQY 323
           +   G+G       LY+N +DC  KT+  EG++G YKG  AH+LRI PHTI+T    E  
Sbjct: 250 RRPDGRGGFRTVGLLYRNPIDCLWKTVSMEGVYGLYKGSTAHFLRIAPHTIITLTANELI 309

Query: 324 RGLYIKY 330
             LY ++
Sbjct: 310 IALYRRF 316



>gi|254585099|ref|XP_002498117.1| ZYRO0G02640p [Zygosaccharomyces rouxii]
 gi|238941011|emb|CAR29184.1| ZYRO0G02640p [Zygosaccharomyces rouxii]
          Length = 325

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 193/326 (59%), Gaps = 16/326 (4%)

Query: 6   VSGISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELT 65
           +SG      +   A++    + +     F+ GG AAC AVT TNP E+VKTR+QLQGE++
Sbjct: 1   MSGAEPPYEEMKRASELSPAQKVSKFGSFVAGGLAACVAVTVTNPIELVKTRMQLQGEMS 60

Query: 66  RSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK 125
            +N      Y+N  QA  +I +NEG   +QKGL AAY YQ+ +NG+RLG Y+P R  + K
Sbjct: 61  ATNQQV---YKNPIQAMVIIFRNEGFVSLQKGLLAAYVYQIALNGSRLGLYEPSRGFVNK 117

Query: 126 FFNTSST-----SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNT 180
            F          +  I++  G  AG FGA +GSPLY+VKTR+QSYS+  +IG Q  Y   
Sbjct: 118 IFYPDEEPHKVQNPAINVFCGAAAGVFGAVLGSPLYMVKTRLQSYSSTVSIGEQTRYNGV 177

Query: 181 FDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVH 240
           +D L  + + E   KGLFRG++AAM+RTGVGS  QL  Y  +K   IK + +  +   +H
Sbjct: 178 WDGLKTVYRGEG-IKGLFRGIEAAMLRTGVGSAVQLPIYNVVK-GFIKDNDLMREGTSLH 235

Query: 241 ALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYK 300
             +S V+G  V   MNP+DVI TR+YNQK D      LYK  +DCFIKT++ EG    YK
Sbjct: 236 LTASTVAGIGVGIAMNPWDVILTRIYNQKGD------LYKGPIDCFIKTVKIEGPGALYK 289

Query: 301 GFGAHYLRIGPHTILTFVFLEQYRGL 326
           GF A   RI PHTIL    +E+   L
Sbjct: 290 GFQAQLFRIAPHTILCLTMMEKTMNL 315



>gi|358374796|dbj|GAA91385.1| mitochondrial oxaloacetate transporter (Oac) [Aspergillus kawachii
           IFO 4308]
          Length = 310

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K YR +     VI++NEG RG
Sbjct: 8   FIAGGVAACGAVTVTHSFETVKIRLQLQGEL-QAKQDAAKKYRGVLHGVKVILQNEGPRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           + +G+G+AY YQ+++NG RLGFY+P+R  L    + +    S+ +++++G  +G  GAA 
Sbjct: 67  LFRGIGSAYIYQVLLNGCRLGFYEPLRKGLATTIYQDAQVQSLGVNVIAGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QHNYKN+FD L KI   E    GL+RGV AAM+RTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFLPVGTQHNYKNSFDGLRKIHSTEG-VSGLYRGVGAAMVRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR ++K+ GM D   L H  SS  SGF VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLMKHLGMEDGPGL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+R EG+   YKG+ AH  RI PHTILT    EQ
Sbjct: 242 ---TGNLYKGVFDCLFKTIRTEGVLAIYKGYFAHLARILPHTILTLSLAEQ 289



>gi|388583393|gb|EIM23695.1| mitochondrial carrier [Wallemia sebi CBS 633.66]
          Length = 320

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 187/310 (60%), Gaps = 18/310 (5%)

Query: 28  IKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVK 87
           +  L GF+ G  A+C AVT +NP EV KTRLQLQGEL +     +K Y N+ + F    K
Sbjct: 4   LSTLEGFICGALASCGAVTLSNPMEVAKTRLQLQGELAKEG---IKVYNNVGEVFTKTYK 60

Query: 88  NEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF------NTSSTSMPISMLSG 141
           NEG+RG+Q+GLG +Y YQ  +NG RLGFY+P+R  L   F      N +STS+     +G
Sbjct: 61  NEGIRGLQRGLGTSYVYQTALNGCRLGFYEPVRRQLNGLFGIPLEKNVTSTSVG----AG 116

Query: 142 FLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
            ++G  GAA G+P YL+K RMQ+YS    +G QH+Y++ FDAL  + + E    GL RG+
Sbjct: 117 IVSGMMGAASGNPFYLIKARMQAYSPSLPVGTQHHYRHGFDALRSVVRVEG-LGGLLRGI 175

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVI 261
           DAA++RT +GS  QL +Y   K    K+     +++     SS +SG CVC  M P DV 
Sbjct: 176 DAAILRTCMGSSVQLPTYIAAKTYFSKHGIFEPNSLANFIFSSSISGACVCLMMQPPDVS 235

Query: 262 STRMYNQKAD--QSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
            TRMYNQ     ++GK  G  YKN +DC  KT+RAEG  G YKG  A +LRI PHT+   
Sbjct: 236 LTRMYNQPTIKLENGKTVGQFYKNPIDCMYKTVRAEGFTGLYKGTSAQFLRIAPHTVCCL 295

Query: 318 VFLEQYRGLY 327
           VF +   G Y
Sbjct: 296 VFNDLVCGWY 305



>gi|398407773|ref|XP_003855352.1| hypothetical protein MYCGRDRAFT_68931 [Zymoseptoria tritici IPO323]
 gi|339475236|gb|EGP90328.1| hypothetical protein MYCGRDRAFT_68931 [Zymoseptoria tritici IPO323]
          Length = 319

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 138/301 (45%), Positives = 184/301 (61%), Gaps = 21/301 (6%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  + Y+ +     VI  NEG++G
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-KAKRDAPRLYKGVLHGVKVIYTNEGMKG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST------------SMPISMLSG 141
           + +GL  AY YQ+ +NG RLGFYDPIR SL   +   S             S+PI++ SG
Sbjct: 67  LLRGLSCAYIYQMTLNGCRLGFYDPIRTSLNSLYLHRSPTHRSDADVKAMQSLPINIASG 126

Query: 142 FLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
             +G  GA +GSP +LVKTR+QS+S F  +G QH Y+N  D L +I + E   +GL+RGV
Sbjct: 127 ASSGILGAFLGSPFFLVKTRLQSFSPFLPVGTQHQYRNAADGLSQIYRSEG-IRGLWRGV 185

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVI 261
             AM+RTG GS  QL +YFF KR + +   + D   L H +SS  SGF VC  M+P D +
Sbjct: 186 GPAMVRTGFGSSVQLPTYFFAKRLLQRNFSIQDGAPL-HLMSSTASGFVVCVVMHPPDTV 244

Query: 262 STRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
            +RMYNQ       G+LY   +DC ++T++ EG+   YKGF AH  RI PHTILT    E
Sbjct: 245 MSRMYNQ------TGNLYSGAMDCLVRTVKTEGMLAVYKGFFAHLARILPHTILTLSLAE 298

Query: 322 Q 322
           Q
Sbjct: 299 Q 299



>gi|410915630|ref|XP_003971290.1| PREDICTED: solute carrier family 25 member 35-like [Takifugu
           rubripes]
          Length = 298

 Score =  263 bits (673), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 184/296 (62%), Gaps = 6/296 (2%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++ G AAC A  FTNP EVVKTR+QLQGEL +S  +Y   YRN+F AFY I K +G+  
Sbjct: 3   FILSGVAACGACLFTNPLEVVKTRMQLQGEL-QSRGSYQVYYRNVFHAFYTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS-TSMPISMLSGFLAGSFGAAIG 152
           +QKGL     YQ  MNG RLG Y  I +S   + +T+   S   S ++G +AG  GA +G
Sbjct: 62  LQKGLAPGLVYQFFMNGVRLGSYAIIESS--GYIHTNGRVSAAKSTVAGSVAGVVGAVMG 119

Query: 153 SPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+YLVKT +QS +T + A+GHQ+ ++    AL  I KE     GL+RG  AA+ R  VG
Sbjct: 120 SPIYLVKTHLQSQATSSIAVGHQYKHQGMIHALRAIYKEHGVI-GLWRGSSAAVARVSVG 178

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QLS++   K  V+ +     D+ LV   + ++S   V   M PFDV+STR+YNQ  D
Sbjct: 179 SAAQLSTFSSSKEMVVDFQVFPKDSWLVGLTAGMISSVVVVMAMTPFDVVSTRLYNQPVD 238

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
             GKG LYK  +DCF KTLR EG+ G YKG GA Y R+GPHTIL+  F  + R +Y
Sbjct: 239 HLGKGQLYKGFVDCFSKTLRKEGVVGLYKGLGASYFRLGPHTILSLFFWHELRKMY 294



>gi|320585799|gb|EFW98478.1| mitochondrial oxaloacetate transporter [Grosmannia clavigera
           kw1407]
          Length = 310

 Score =  263 bits (671), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 145/291 (49%), Positives = 184/291 (63%), Gaps = 11/291 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT T+P+E VK R+QLQGEL +S  +    YR       VI++NEG+RG
Sbjct: 8   FLAGGIAACGAVTATHPFETVKIRMQLQGEL-QSKGHQPHHYRGPIHGVSVILRNEGIRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAI 151
           I +G+  AYAYQ+++NG RLGFY+P+R SL      N +  S+PI+M  G  +G  GAA 
Sbjct: 67  IYRGISCAYAYQILLNGCRLGFYEPMRKSLSGLLYRNDAVQSLPINMFCGAASGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QS+S F  +G QH Y+N  D + +I + +   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSFSPFFPVGTQHKYRNALDGVRQIHQADG-LRGLYRGVSAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL +YFF KR + K+ GM++   L H  SS  SG  VC  M+P D I +RMYNQ   
Sbjct: 186 SSVQLPTYFFAKRRLQKHFGMTEGPAL-HLTSSAASGCVVCVVMHPPDTIMSRMYNQ--- 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LY    DC  KT+R EG F  YKG   H  RI PHTILT    EQ
Sbjct: 242 ---NGNLYSGVFDCLAKTIRTEGFFAIYKGVLPHLARILPHTILTLSLAEQ 289



>gi|396476075|ref|XP_003839930.1| similar to mitochondrial oxaloacetate transport protein
           [Leptosphaeria maculans JN3]
 gi|312216501|emb|CBX96451.1| similar to mitochondrial oxaloacetate transport protein
           [Leptosphaeria maculans JN3]
          Length = 338

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/319 (44%), Positives = 186/319 (58%), Gaps = 39/319 (12%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL RS +   + Y+ +F    VI+KNEG RG
Sbjct: 8   FIAGGIAACGAVTVTHGFETVKIRLQLQGEL-RSKNEAPRLYKGVFHGVSVILKNEGPRG 66

Query: 94  IQKGLGAA----------------------------YAYQLVMNGARLGFYDPIRNSLEK 125
           + +GLG A                            Y YQ+ +NG RLGFY+P+R S+  
Sbjct: 67  LLRGLGCAVCLASVLSRPIASPRWQIQRTWLTMRKQYVYQMTLNGCRLGFYEPLRKSVTS 126

Query: 126 --FFNTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
             + + +  S  I++ SG  +G  GA  GSP +LVKTR+QSYS F  +G QH YK   D 
Sbjct: 127 LIYHDPAFQSFGINIFSGAASGILGAVAGSPFFLVKTRLQSYSPFLPVGTQHMYKGALDG 186

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L +I   E   KGL+RGV  AM+RTG GS  QL +YFF KR ++K+ GM  + + +H  S
Sbjct: 187 LRQIYTSEG-VKGLYRGVGPAMVRTGFGSSVQLPTYFFAKRRLVKHLGM-QEGMPLHVAS 244

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S  SGF VC  M+P D I +RMYNQ       G+LY +  DC  KT+++EG+   YKG+ 
Sbjct: 245 STASGFVVCCVMHPPDTIMSRMYNQ------TGNLYTSAFDCLSKTVKSEGVLALYKGYF 298

Query: 304 AHYLRIGPHTILTFVFLEQ 322
           AH  RI PHTILT    EQ
Sbjct: 299 AHLARILPHTILTLTLAEQ 317



>gi|409052124|gb|EKM61600.1| hypothetical protein PHACADRAFT_204767 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 325

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/314 (44%), Positives = 195/314 (62%), Gaps = 13/314 (4%)

Query: 23  RAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAF 82
           R    +    GF++GG AA  AVT +N  +V KTR+QLQGEL +     V+ Y+N+F   
Sbjct: 7   REPRPLSTAEGFILGGIAASVAVTLSNIPDVAKTRMQLQGELAKDGG--VRVYKNVFDVL 64

Query: 83  YVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN-TSSTSMPI-SMLS 140
               +NEG+RG+Q+GLG AY YQ+++NG+RLGFY+P R +L +      S  MP+ S+++
Sbjct: 65  VKTWRNEGIRGMQRGLGPAYVYQILLNGSRLGFYEPFRRTLNQMVGLKPSDQMPLTSVIA 124

Query: 141 GFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRG 200
           G  +G+ GA +G+PL+L+K RMQ+YS    +GHQH YK+++DAL  I + E   +GL RG
Sbjct: 125 GAGSGAIGAVLGNPLFLIKARMQAYSPALPVGHQHFYKHSWDALSTIYRAEG-LRGLVRG 183

Query: 201 VDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDV 260
           VDAA++RT +GS  QL +Y + K  + +   +  D+I     SS VSG CV   M P D 
Sbjct: 184 VDAAVLRTAMGSSVQLPTYNWTKNQLTQRGILPADSIWTFLASSSVSGMCVLAVMQPADT 243

Query: 261 ISTRMYNQK----ADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILT 316
             TRMYNQ      D    G LYKN +DC  KTL+ EG  G+YKG  AH+LRI PHTI+T
Sbjct: 244 ALTRMYNQPTKVMPDGRHVGLLYKNPIDCLWKTLKIEGPLGWYKGSTAHFLRIAPHTIIT 303

Query: 317 F----VFLEQYRGL 326
                V +  Y+ L
Sbjct: 304 LTANDVIIRLYKKL 317



>gi|385304626|gb|EIF48636.1| mitochondrial oxaloacetate transport protein [Dekkera bruxellensis
           AWRI1499]
          Length = 322

 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 143/297 (48%), Positives = 190/297 (63%), Gaps = 14/297 (4%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L G + G  A C+AVTFTNP E+VKTR+QL+GEL+ S     K YRN FQAF ++ KNEG
Sbjct: 19  LGGCIAGALAGCAAVTFTNPIELVKTRMQLEGELS-STKGXAKXYRNPFQAFALVYKNEG 77

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIR---NSL--EKFFNTSSTSMPISMLSGFLAG 145
           +RG+QKGL A+Y YQ  +N  RLGFY+P+R   NSL   K       SM ++   G   G
Sbjct: 78  LRGVQKGLIASYLYQTGLNSCRLGFYEPMRCWINSLVFPKRDPVQFQSMGVNXFVGVATG 137

Query: 146 SFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAM 205
             G+ + SP YL+KTRMQS+S    IG Q +Y + +  L  I ++E   +GLFRG +AA+
Sbjct: 138 VIGSVVSSPFYLLKTRMQSFSEQVKIGSQSHYDSVWQGLKDIFQDEG-VRGLFRGANAAI 196

Query: 206 IRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRM 265
           +RT VGS  QL +YFF K+ + K   + D   +  A S+  +G  V   MNPFDV+ TR+
Sbjct: 197 LRTAVGSGAQLPAYFFAKQQLEKLGNLKDGLGMQLACSAF-AGVGVTVVMNPFDVVLTRL 255

Query: 266 YNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           YNQ      KG+LYK T+DCF+KT+R+EG+   YKGF A  LR  PH+IL  +F+EQ
Sbjct: 256 YNQ------KGALYKGTVDCFVKTVRSEGLGALYKGFVAQLLRNTPHSILLLMFMEQ 306



>gi|389751818|gb|EIM92891.1| oxaloacetate carrier [Stereum hirsutum FP-91666 SS1]
          Length = 324

 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 205/320 (64%), Gaps = 16/320 (5%)

Query: 17  TTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYR 76
           +T  K R    ++    F +GG AAC AVTF+NP EV+KTR+QLQGEL +     V  Y+
Sbjct: 5   STPPKPRQMNVVET---FFLGGLAACIAVTFSNPAEVMKTRMQLQGELVKGGGKKV--YQ 59

Query: 77  NIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MP 135
           N+F  F    K+EG++GIQ+GL  AYAYQL++NG+RLGFY+P R ++ + F  S    +P
Sbjct: 60  NVFDCFGKTWKHEGIKGIQRGLPPAYAYQLLLNGSRLGFYEPFRQNINRAFGLSPKDQLP 119

Query: 136 I-SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYF 194
           + S+++G  +G+ GA++G+PL+L+K RMQ+YS    +G QH YK+++DAL  I   E   
Sbjct: 120 VTSVIAGAASGAVGASLGNPLFLIKARMQAYSPVLPVGAQHYYKHSWDALSTIYSREG-L 178

Query: 195 KGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFT 254
           +G+ RG+DAA++RT +GS  QL +Y + K  ++    +  +++L +  SS VSG CV   
Sbjct: 179 RGMVRGIDAAILRTAMGSSVQLPTYNWTKNQLVSRGILPANSVLTYLASSSVSGVCVLLM 238

Query: 255 MNPFDVISTRMYNQKADQ--SGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIG 310
           M P D   TR+YNQ   +  +G+  G+LYK+ +DC  KT + EG   +YKG  AH+LRI 
Sbjct: 239 MQPADTALTRVYNQPTQKLPNGRIVGTLYKSPIDCLWKTFKTEGPLAWYKGSTAHFLRIA 298

Query: 311 PHTILTF----VFLEQYRGL 326
           PHTI+T     + L  YR L
Sbjct: 299 PHTIITLTANDIILNLYRRL 318



>gi|67515569|ref|XP_657670.1| hypothetical protein AN0066.2 [Aspergillus nidulans FGSC A4]
 gi|40746088|gb|EAA65244.1| hypothetical protein AN0066.2 [Aspergillus nidulans FGSC A4]
          Length = 299

 Score =  259 bits (663), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 138/271 (50%), Positives = 176/271 (64%), Gaps = 11/271 (4%)

Query: 54  VKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARL 113
           V   LQLQGEL ++ S  VK Y+ +     VI++NEG RG+ +G+G+AY YQ+++NG RL
Sbjct: 17  VAPSLQLQGEL-QAKSEAVKKYKGVLHGVKVILQNEGPRGLFRGIGSAYIYQVLLNGCRL 75

Query: 114 GFYDPIRNSL-EKFFNTSST-SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAI 171
           GFY+PIRN L    +N S   S+ I++ +G  +G  GAA GSP +LVKTR+QS+S F  +
Sbjct: 76  GFYEPIRNGLTTAVYNDSHVQSLGINVFAGASSGIIGAAAGSPFFLVKTRLQSFSPFLPV 135

Query: 172 GHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSG 231
           G QH Y+N+FD L KI   E    GL+RGV AAM+RTG GS  QL +YFF KR ++K+ G
Sbjct: 136 GTQHQYRNSFDGLRKIFASEG-VGGLYRGVGAAMVRTGFGSSVQLPTYFFAKRRLVKHLG 194

Query: 232 MSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLR 291
           M D   L H  SS  SGF VC  M+P D I +RMYNQ       G+LYK   DC  KT+R
Sbjct: 195 MEDGPAL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ------TGNLYKGVFDCLAKTIR 247

Query: 292 AEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
            EG+F  YKG+ AH  RI PHTILT    EQ
Sbjct: 248 TEGLFAIYKGYFAHLARILPHTILTLSLAEQ 278



>gi|470443137|ref|XP_004339616.1| solute carrier family protein [Acanthamoeba castellanii str. Neff]
 gi|440796494|gb|ELR17603.1| solute carrier family protein [Acanthamoeba castellanii str. Neff]
          Length = 326

 Score =  259 bits (662), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 190/310 (61%), Gaps = 10/310 (3%)

Query: 22  ARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQA 81
           ARA  T K    F++GG A  +AV FTNP EVVKTRLQLQGEL +  +   + YR ++ A
Sbjct: 18  ARALLTHKQAADFVLGGLATVTAVLFTNPIEVVKTRLQLQGELQQRVAKNKRTYRGVWHA 77

Query: 82  FYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRN-SLEKFFNTSSTSMPI--SM 138
           F  I+  EG   IQKGL  A AYQ  MNG RLG Y   +   LE   + S  S+    +M
Sbjct: 78  FKTIISTEGPLAIQKGLFPAAAYQFCMNGMRLGSYSVFKQLLLENHGSASKDSLFFLKNM 137

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA--IGHQHNYKNTFDALHKISKEERYFKG 196
           L+G  AG  GA  GSP +LVKTRMQ+ + +    +     YK+   A   I + E   +G
Sbjct: 138 LAGATAGVLGAVAGSPFFLVKTRMQAQTEYCGRYVALTWGYKH--RAFKSIVQAEGP-RG 194

Query: 197 LFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMN 256
           L RG DAA +R GVGS  QL  Y   K S+I  +G   +NI  H  +SLVSG  +   MN
Sbjct: 195 LMRGADAAALRVGVGSSVQLPLYDNAK-SLILATGWLGNNIYAHVAASLVSGVGLVVAMN 253

Query: 257 PFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILT 316
           PFDV++TR+YNQK +  GKG+LY+   DC  KT++AEG++G YKG  AHYLR GPHTILT
Sbjct: 254 PFDVVATRLYNQKVE-GGKGALYRGPFDCLWKTVKAEGVYGLYKGVFAHYLRTGPHTILT 312

Query: 317 FVFLEQYRGL 326
           FVF EQY+ L
Sbjct: 313 FVFWEQYKKL 322



>gi|150832499|ref|NP_001092917.1| solute carrier family 25 member 35 [Danio rerio]
 gi|150416119|sp|A3KPP4.1|S2535_DANRE RecName: Full=Solute carrier family 25 member 35
 gi|213624884|gb|AAI71721.1| Novel protein similar to vertebrate solute carrier family 25,
           member 35 (SLC25A35) [Danio rerio]
 gi|213627834|gb|AAI71554.1| Novel protein similar to vertebrate solute carrier family 25,
           member 35 (SLC25A35) [Danio rerio]
          Length = 298

 Score =  259 bits (662), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 140/299 (46%), Positives = 184/299 (61%), Gaps = 4/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++GG AAC A  FTNP EVVKTR+QLQGEL +S   Y   YRN+F AFY I K +G+ G
Sbjct: 3   FILGGVAACGACFFTNPLEVVKTRMQLQGEL-KSRGTYQVYYRNVFHAFYTIGKIDGLAG 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL     YQ  MNG RLG Y  +  SL         S   S +SG +AG  GA +GS
Sbjct: 62  LQKGLVPGLVYQFFMNGVRLGSY-ALTESLGYIHTDGRVSATKSTVSGAIAGVVGAVMGS 120

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+YLVKT +QS ST + A+GHQ+ ++   +AL  I K+     GL+RG  AA+ R  VGS
Sbjct: 121 PIYLVKTHLQSQSTSSIAVGHQYKHRGMTNALFAIHKQHGIL-GLWRGASAAIPRVSVGS 179

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QL+++   K  V      S+ + L+   + ++S   V   M PFDV+STR+YNQ  D 
Sbjct: 180 AAQLATFSASKEMVNDLQVFSEGSWLIALSAGMISSVVVVLAMTPFDVVSTRLYNQPVDH 239

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG LY+  +DCF KTL+ EG+ G YKG GA Y R+GPHTIL+ +F  + R L+  Y+
Sbjct: 240 LGKGMLYRGFVDCFSKTLKKEGMTGLYKGLGASYFRLGPHTILSLLFWNELRCLHQSYS 298



>gi|452985895|gb|EME85651.1| hypothetical protein MYCFIDRAFT_64950 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 319

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 181/309 (58%), Gaps = 21/309 (6%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E VK RLQLQGEL ++  +  K Y+ +     VI  NEG++G
Sbjct: 8   FIAGGIAACGAVTVTHSFETVKIRLQLQGEL-QAKQDAPKLYKGVLHGVRVIYSNEGLKG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST------------SMPISMLSG 141
           + +GL  AY YQ+ +NG RLGFYDPIR +L     T S             S+PI++ SG
Sbjct: 67  LLRGLNCAYIYQMTLNGCRLGFYDPIRTTLNSLVLTRSPLNAADPQVKAMQSVPINIASG 126

Query: 142 FLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
             +G  GA +GSP +LVKTR+QS+S F  +G QH Y+   D L +I   E   KGL+RGV
Sbjct: 127 ASSGILGAFLGSPFFLVKTRLQSFSPFLPVGTQHQYRGAVDGLRQIYGAEG-IKGLWRGV 185

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVI 261
             AM+RTG GS  QL +YF  KR + +   + D   L H +SS  SGF VC  M+P D +
Sbjct: 186 GPAMVRTGFGSSVQLPTYFLAKRVLQRNFDIKDGTPL-HLMSSTASGFVVCVVMHPPDTV 244

Query: 262 STRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
            +RMYNQ       G+LY    DC   T++ EG+   YKGF AH  RI PHTILT    E
Sbjct: 245 MSRMYNQ------TGNLYNGAFDCLYNTVKIEGVLAVYKGFFAHLARILPHTILTLTLAE 298

Query: 322 QYRGLYIKY 330
           Q   L  ++
Sbjct: 299 QTNKLMRRF 307



>gi|453087039|gb|EMF15080.1| mitochondrial dicarboxylate transporter [Mycosphaerella populorum
           SO2202]
          Length = 320

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 184/309 (59%), Gaps = 21/309 (6%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+ +E +K RLQLQGEL ++  +  + Y+ +     V+  NEG++G
Sbjct: 8   FIAGGIAACGAVTVTHSFETIKIRLQLQGEL-QAKKDAPRLYKGVLHGVKVVYTNEGLKG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST------------SMPISMLSG 141
           + +GL  AY YQ+ +NG RLGFYDPIR +L     T S             S+P+++ SG
Sbjct: 67  LLRGLNCAYVYQMTLNGCRLGFYDPIRTTLNSLVLTRSPLNTHDPNVKAMQSLPVNIASG 126

Query: 142 FLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
             +G  GA +GSP +LVKTR+QS+S F  +G QH Y++  D + +I   E   +GL+RGV
Sbjct: 127 ASSGILGAFLGSPFFLVKTRLQSFSPFLPVGTQHQYRSAADGMRQIYGAEG-IRGLWRGV 185

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVI 261
             AM+RTG GS  QL +YFF KR + +   + D   L H +SS  SGF VC  M+P D +
Sbjct: 186 GPAMVRTGFGSSVQLPTYFFAKRLLQRNFDIKDGTPL-HLMSSSASGFVVCCVMHPPDTV 244

Query: 262 STRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
            +RMYNQ       G+LY    DC  +T++ EGI   YKGF AH  RI PHTILT    E
Sbjct: 245 MSRMYNQ------TGNLYSGAFDCLYRTVKTEGILAVYKGFFAHLARILPHTILTLTLAE 298

Query: 322 QYRGLYIKY 330
           Q   L  K+
Sbjct: 299 QTNKLMRKF 307



>gi|403213793|emb|CCK68295.1| hypothetical protein KNAG_0A06360 [Kazachstania naganishii CBS
           8797]
          Length = 322

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/304 (46%), Positives = 184/304 (60%), Gaps = 16/304 (5%)

Query: 24  AKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFY 83
           A + I     F+ GG AAC AVT TNP E+VK R+QLQGEL          Y+N  Q   
Sbjct: 14  AAQKISKFGSFVAGGIAACCAVTVTNPIELVKIRMQLQGELAAVGQGI---YKNPIQGIS 70

Query: 84  VIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-----MPISM 138
           VI KNEG +  QKGL +AY YQ+ +NG+RLGFY+PIR +L + F  +  S     + I+M
Sbjct: 71  VIYKNEGFKACQKGLVSAYFYQIALNGSRLGFYEPIRLTLNRTFFPAQESHKVQNVGINM 130

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
            SG  +G  GA IGSPL+LVKTRMQSYS+  A+G Q  Y   ++ L  I +E    +GLF
Sbjct: 131 FSGASSGVIGAIIGSPLFLVKTRMQSYSSSIALGDQTKYTGVWNGLSTIFREGG-VRGLF 189

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           +GVDAA++RTG GS  QL  Y   K  +++   M +   L H  +S +SG  V   MNP+
Sbjct: 190 KGVDAAILRTGAGSSVQLPIYNTAKNILLRNDLMENGPAL-HLTASTISGMGVAVVMNPW 248

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           DVI TR+YNQK ++      YK  +DC +KT++ EGI   YKGF A   RI PHTI+   
Sbjct: 249 DVILTRIYNQKTNK------YKGPIDCLVKTVKIEGITALYKGFEAQVFRIAPHTIICLT 302

Query: 319 FLEQ 322
            LEQ
Sbjct: 303 LLEQ 306



>gi|390355037|ref|XP_782823.3| PREDICTED: solute carrier family 25 member 35-like
           [Strongylocentrotus purpuratus]
          Length = 309

 Score =  256 bits (655), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 182/295 (61%), Gaps = 3/295 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F +GG A C A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AFY I + +G+  
Sbjct: 8   FFLGGIATCGAGLFTNPLEVVKTRMQLQGEL-KARGTYQRHYRNVFHAFYTIARVDGLLA 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQL MNGARLG Y  + N      +    S P ++ +G  AG  GA +GS
Sbjct: 67  LQKGLVPALWYQLFMNGARLGTYQCLVNMGLTKNSKGELSYPRAVAAGAFAGCCGACVGS 126

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YL+KT++Q+ S  A A+GHQH +      L  I  +  +F GL+RGV AA+ R  VGS
Sbjct: 127 PFYLIKTQLQARSHQAIAVGHQHTHHGMTHGLRLIYSDGGFF-GLWRGVSAAIARVTVGS 185

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++   K  +       D++IL+   +S++SG  V   M PFDVISTR+YNQ  D 
Sbjct: 186 AAQLSTFSATKEFIKDSKVFRDESILIPITASMISGVAVVVFMTPFDVISTRLYNQGLDG 245

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
            G+G  Y+  LDCF+K L  EG  GFYKG+ A + R+ PHT+L+ VF +Q R LY
Sbjct: 246 KGRGLYYRGFLDCFLKVLMKEGPLGFYKGWSASWFRLAPHTVLSLVFWDQTRILY 300



>gi|426237575|ref|XP_004012733.1| PREDICTED: solute carrier family 25 member 35 isoform 2 [Ovis
           aries]
          Length = 300

 Score =  256 bits (654), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 137/301 (45%), Positives = 187/301 (62%), Gaps = 7/301 (2%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL R+   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-RAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM-PI-SMLSGFLAGSFGAAI 151
           +QKGL  A  YQ +MNG RLG Y  +      + +T+  ++ P+ S  +G LAG  GA +
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLVEAG--GYLHTAEGTLSPVRSAAAGALAGVMGAYL 119

Query: 152 GSPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           GSP+Y+VKT +Q+ + T  A+GHQ+N++  F AL KI ++     GL+RG    + R  V
Sbjct: 120 GSPIYMVKTHLQAQAATEIAVGHQYNHQGMFQALTKIGQKHG-LVGLWRGALGGLPRVIV 178

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKA 270
           GS TQL ++   K  + ++      +  V   +++VSG  V   M PFDV+STR+YNQ  
Sbjct: 179 GSSTQLCTFSSTKDLMTQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVVSTRLYNQPT 238

Query: 271 DQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           D  GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R +Y  Y
Sbjct: 239 DAQGKGLMYRGLLDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRMVYYTY 298

Query: 331 T 331
           T
Sbjct: 299 T 299



>gi|505755572|gb|EOQ99779.1| hypothetical protein J056_001611 [Wallemia ichthyophaga EXF-994]
          Length = 380

 Score =  256 bits (653), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 190/308 (61%), Gaps = 20/308 (6%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L GF  G AA+C AVT +NP EV KTRLQLQGEL++     VK Y N+ + F    ++EG
Sbjct: 68  LIGFFCGAAASCGAVTLSNPMEVAKTRLQLQGELSKQG---VKVYNNVGEVFTKTYRHEG 124

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF------NTSSTSMPISMLSGFLA 144
           +RG+Q+GLG +Y YQ  +NG RLGFY+P+R  L          N ++TS+     +G ++
Sbjct: 125 IRGLQRGLGTSYVYQTALNGCRLGFYEPVRRQLNSLTGIPADKNVTTTSVG----AGIVS 180

Query: 145 GSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAA 204
           G  GAA G+P YL+K RMQ+YS    +G QH+Y++ +DAL  + + E    GL RG+DAA
Sbjct: 181 GMMGAASGNPFYLIKARMQAYSPSLPVGTQHHYRHGYDALKSVIRVEG-ISGLIRGMDAA 239

Query: 205 MIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHAL-SSLVSGFCVCFTMNPFDVIST 263
           ++RT +GS  QL +Y   K +    +G+ +   L + + SS +SG CVC  M P DV  T
Sbjct: 240 ILRTCMGSSVQLPTYIAAK-TYFSSNGIFEPTSLANFIFSSSISGACVCLMMQPPDVALT 298

Query: 264 RMYNQKAD--QSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVF 319
           RMYNQ     ++GK  G  YKN +DC  KT++AEG+ G YKG  A +LRI PHT+   VF
Sbjct: 299 RMYNQPTQKMENGKSVGQFYKNPIDCLYKTVKAEGVTGLYKGTSAQFLRIAPHTVCCLVF 358

Query: 320 LEQYRGLY 327
            +   G Y
Sbjct: 359 NDLVCGWY 366



>gi|331212363|ref|XP_003307451.1| hypothetical protein PGTG_00401 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309297854|gb|EFP74445.1| hypothetical protein PGTG_00401 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 334

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 147/327 (44%), Positives = 185/327 (56%), Gaps = 34/327 (10%)

Query: 22  ARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQA 81
           A +   +  L GF  G   AC AVTFTNP EV KTRLQL GEL    S   K Y N F  
Sbjct: 3   AASSHQLSTLEGFASGALGACVAVTFTNPMEVAKTRLQLDGELRSKGSP--KAYTNTFDV 60

Query: 82  FYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF--NTSSTSMPISML 139
                K+EG+R  QKGLGAAY YQ  +NG+RLGFY+P+R S+      + S   +  S+ 
Sbjct: 61  LTKTAKSEGLRACQKGLGAAYTYQFALNGSRLGFYEPLRRSIGSLSGQDPSRVQLWSSVS 120

Query: 140 SGFLAGSFGAAIGSPLYLVKTRMQSYST-------------------------FAAIGHQ 174
           +G L+G  GA +G+PL+LVK RMQ+YS+                          +    Q
Sbjct: 121 AGALSGVIGAILGNPLFLVKARMQAYSSVRDSSAGKLMTASKAGSMSSSTKPSLSPHPTQ 180

Query: 175 HNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSD 234
           H YK+  D LH+I K E  FKGL RGVDAAM+RT +GS  QL +Y + K ++  Y   S 
Sbjct: 181 HAYKSALDGLHQIFKAEG-FKGLMRGVDAAMMRTAMGSSVQLPAYNYAKTNLAPY--FSP 237

Query: 235 DNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEG 294
           D+  ++  SS  SG CV   M P D   TRMYNQ ++Q GK  LYKN +DC  KT++ EG
Sbjct: 238 DSFWLYIASSSFSGLCVLTAMQPADTALTRMYNQ-SNQPGK-RLYKNPVDCLWKTVQIEG 295

Query: 295 IFGFYKGFGAHYLRIGPHTILTFVFLE 321
             G YKG  AH+ RI PHTI+T V  E
Sbjct: 296 FTGLYKGSTAHFFRIAPHTIITLVANE 322



>gi|393240380|gb|EJD47906.1| oxaloacetate carrier [Auricularia delicata TFB-10046 SS5]
          Length = 319

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 177/294 (60%), Gaps = 9/294 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL GG AAC AVT +NP EV KTR+QLQGEL +     V  Y+N         +NEG+RG
Sbjct: 11  FLCGGLAACVAVTISNPAEVAKTRMQLQGELVKGGGPKV--YKNAIDVLVKTYRNEGIRG 68

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM--PISMLSGFLAGSFGAAI 151
           +Q+GLG AY YQ ++NG+RLGFY+  R    +     +       S+ +G  +G  GA +
Sbjct: 69  VQRGLGPAYVYQSLLNGSRLGFYEAFRRQFNRLARAPAERQLASTSIAAGAASGIVGAIL 128

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           G+PL+L+K RMQ+YS    +G QH YK++ DAL  I + E   +GL RGVDAA++RT +G
Sbjct: 129 GNPLFLIKARMQAYSPSLPVGTQHYYKSSIDALSTIVRAEGP-RGLARGVDAAVLRTAMG 187

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  Q+ SY   K  ++    +S D+   +  SS  SG C C  M P D   TR+YNQ   
Sbjct: 188 SSVQIPSYTLAKTQLVNNGILSADSPWTYLASSSFSGVCTCIVMQPADTALTRVYNQPTQ 247

Query: 272 --QSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
              +G+  G LYKN +DC  KTL+ EG FG+YKG  AH+LRI PHTI+T    E
Sbjct: 248 VLPNGRTVGLLYKNPIDCLWKTLQTEGPFGWYKGSTAHFLRIAPHTIVTLTANE 301



>gi|348560818|ref|XP_003466210.1| PREDICTED: solute carrier family 25 member 35-like [Cavia
           porcellus]
          Length = 300

 Score =  253 bits (646), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 185/300 (61%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I + +G+  
Sbjct: 3   FLMSGVAACGACVFTNPLEVVKTRMQLQGEL-KAPGTYQRHYRNVFHAFFTIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  + +S      T  T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LADSSGYLHTTEGTLSPVRSAATGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG   ++ R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYRHQGMFQALTEIGQKHG-LVGLWRGALGSLPRVAVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 VQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRFLYHTYT 299



>gi|472357784|ref|XP_004398518.1| PREDICTED: solute carrier family 25 member 35 [Odobenus rosmarus
           divergens]
          Length = 300

 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 181/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLAEAGGHLHTAEGTLSQPRSAAAGALAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALSEIGQKHG-LVGLWRGALGGLPRVIIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  V  ++++VSG  V   M PFDV+STR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDFITQWEIFPPQSWKVALVAAMVSGIAVVLAMTPFDVVSTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F ++ R LY  YT
Sbjct: 241 RGKGLMYRGMLDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDRLRTLYYTYT 299



>gi|73955699|ref|XP_546609.2| PREDICTED: solute carrier family 25 member 35 [Canis lupus
           familiaris]
          Length = 300

 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 180/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I + +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-KAPGTYQRHYRNVFHAFITIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYSLAEARGYLHTAEGTLSPPRSAAAGALAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL KI ++     GL+RG    + R  +GS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALSKIGQKHG-LVGLWRGALGGLPRVIIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  V  ++++VSG  V   M PFDV STR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDFITQWEIFPPQSWKVALVAAMVSGIAVVLAMTPFDVASTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 241 RGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRTLYYTYT 299



>gi|310798397|gb|EFQ33290.1| hypothetical protein GLRG_08434 [Glomerella graminicola M1.001]
          Length = 279

 Score =  252 bits (643), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 170/267 (63%), Gaps = 11/267 (4%)

Query: 58  LQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYD 117
           +QLQGEL +   +    YR   Q   +IV+NEGVRGI +GLG AY YQ+++NG RLGFY+
Sbjct: 1   MQLQGEL-KDKGHQPHQYRGPLQGVSIIVRNEGVRGIYRGLGCAYIYQVLLNGCRLGFYE 59

Query: 118 PIRNSLEKF-FNTSST-SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQH 175
           P+R +L    FN S T S+ I+M  G  +G  GAA GSP +LVKTR+QSYS F   G QH
Sbjct: 60  PMRETLTTLVFNDSKTQSLGINMACGAGSGIMGAAAGSPFFLVKTRLQSYSPFMPTGTQH 119

Query: 176 NYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDD 235
           NY+N ++ +  I   E   +GL+RGV AAMIRTG GS  QL +YFF KR  +++ GM ++
Sbjct: 120 NYRNAWNGMASIYGSEG-IRGLYRGVGAAMIRTGFGSSVQLPTYFFAKRRFVRHLGM-EE 177

Query: 236 NILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGI 295
            + +H  SS VSGF VC  M+P D I +R+YNQ       G+LYK   DC  KT+R EG 
Sbjct: 178 GLPLHLASSTVSGFVVCCVMHPPDTIMSRLYNQ------NGNLYKGVFDCLAKTVRTEGF 231

Query: 296 FGFYKGFGAHYLRIGPHTILTFVFLEQ 322
              YKGF  H  RI PHTILT    EQ
Sbjct: 232 LAIYKGFLPHLARILPHTILTLTLAEQ 258



>gi|410979915|ref|XP_003996326.1| PREDICTED: solute carrier family 25 member 35 [Felis catus]
          Length = 499

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 180/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I + +G+  
Sbjct: 202 FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGRVDGLAA 260

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 261 LQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTLSPPRSAAAGALAGVMGAYLGS 320

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS
Sbjct: 321 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALSEIGQKHGLV-GLWRGALGGLPRVIIGS 379

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++  +   +  V   +++VSG  V   M PFDV+STR+YNQ  D 
Sbjct: 380 STQLCTFSSTKDLITQWEILPPQSWKVALAAAMVSGIAVVLAMTPFDVVSTRLYNQPTDS 439

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD   +T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 440 QGKGLMYRGMLDALRQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRTLYHTYT 498



>gi|511880734|ref|XP_004760268.1| PREDICTED: solute carrier family 25 member 35 isoform X1 [Mustela
           putorius furo]
 gi|511972933|ref|XP_004804468.1| PREDICTED: solute carrier family 25 member 35 isoform X1 [Mustela
           putorius furo]
          Length = 300

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 179/299 (59%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL R+   Y + YRN+F AF  I K +G   
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-RAPGTYQRHYRNVFHAFITIGKVDGPAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGALSRPRSAAAGALAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHRGMFQALSEIGQKHG-LVGLWRGALGGLPRVIIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  V  ++++VSG  V   M PFDV+STR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDLITQWEIFPPQSWKVALMAAMVSGIAVVLAMTPFDVVSTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EG FG YKG GA Y R+GPHT+L+  F +Q R LY  YT
Sbjct: 241 QGKGLMYRGILDALLQTARTEGFFGMYKGIGASYFRLGPHTVLSLFFWDQLRTLYNTYT 299



>gi|336371156|gb|EGN99496.1| hypothetical protein SERLA73DRAFT_182472 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 322

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 187/306 (61%), Gaps = 9/306 (2%)

Query: 28  IKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVK 87
           +  L GFL GG AAC+AVT +NP EV KTR+QLQGEL +     V  Y N   A     +
Sbjct: 9   LSPLEGFLCGGTAACTAVTVSNPAEVAKTRMQLQGELAKGGGQRV--YNNALDALAKTWR 66

Query: 88  NEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS-MPISMLS-GFLAG 145
           NEG+RG+Q+GLGAAY+YQ++++G+   FY+ +R +   F        +P++ +S G ++G
Sbjct: 67  NEGIRGLQRGLGAAYSYQILLHGSSFAFYEHVRRAFNNFVGKPPIDQIPLTSISAGAVSG 126

Query: 146 SFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAM 205
           + GA +G+P +L+K RMQ+YS    +G Q  YK++F+A   I K E+ F+GL RG+DAA+
Sbjct: 127 AIGACLGNPFFLIKARMQAYSPALPVGTQRYYKSSFNAFTTIWKAEK-FRGLIRGIDAAV 185

Query: 206 IRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRM 265
           +RT +GS   L SY+  K  ++    + +++I  +  SS VS  CV   M P D   TR+
Sbjct: 186 LRTTIGSSVLLPSYYGTKHQIVSNGLLPENSIWTYLASSSVSTICVTIVMQPSDTALTRL 245

Query: 266 YNQKADQSGK----GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLE 321
           YNQ   +       G+LYKN +DC  KT++AEGI G YKG  A  L++ PHTI+     +
Sbjct: 246 YNQPTKRLPNGTLIGTLYKNPIDCLWKTIQAEGIRGCYKGSTAQLLQVAPHTIIILTAND 305

Query: 322 QYRGLY 327
             R +Y
Sbjct: 306 IIRNIY 311



>gi|322709427|gb|EFZ01003.1| mitochondrial oxaloacetate transport protein [Metarhizium
           anisopliae ARSEF 23]
          Length = 277

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 174/277 (62%), Gaps = 15/277 (5%)

Query: 58  LQLQGELTRSNSNYVKP--YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGF 115
           +QLQGEL +      +P  YR       VI++NEG+RGI +GLG AY YQ+++NG RLGF
Sbjct: 1   MQLQGELQQKGR---QPHFYRGPIHGVGVILRNEGLRGIYRGLGTAYIYQILLNGCRLGF 57

Query: 116 YDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGH 173
           YDP+R  L   F  N ++ ++ I+M  G  +G  GAA GSP +LVKTR+QSYS F  +G 
Sbjct: 58  YDPMRKGLATLFLKNENAQNLGINMFCGAFSGVIGAAAGSPFFLVKTRLQSYSPFLPVGT 117

Query: 174 QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMS 233
           QH Y+N +D L +I + E    GL+RG+ AAMIRTG GS  QL +YFF KR +++++GM 
Sbjct: 118 QHQYRNAWDGLSQIYRAEG-VGGLYRGIGAAMIRTGFGSSVQLPTYFFAKRRLMRHAGME 176

Query: 234 DDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAE 293
           +   L H  SS  SGF VC  M+P D I +R+YNQ       G+LYK   DC  KT+R E
Sbjct: 177 EGPAL-HLASSAASGFVVCCFMHPPDTIMSRLYNQ------NGNLYKGVFDCLGKTIRTE 229

Query: 294 GIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           G+F  YKGF  H  RI PHTILT    EQ   L  K+
Sbjct: 230 GLFAIYKGFLPHLARILPHTILTLSLAEQTNKLVRKF 266



>gi|405950433|gb|EKC18423.1| Solute carrier family 25 member 35 [Crassostrea gigas]
          Length = 306

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 135/290 (46%), Positives = 179/290 (61%), Gaps = 3/290 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FLIGG AAC A  FTNP EVVKTR+QLQGEL ++   +   YRN F A   IVK +G+  
Sbjct: 3   FLIGGIAACGAGFFTNPLEVVKTRMQLQGEL-QARGQHAIHYRNSFHAIKTIVKTDGILA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           IQ GL  A  YQLVMNG RLG Y  + N         + S P S+++G  AG  GA++GS
Sbjct: 62  IQSGLVPALWYQLVMNGIRLGSYQTMLNVGITKDKHGNVSFPKSIIAGACAGCMGASVGS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P Y++KT MQS +    A+GHQH +++    L  +  +   F GL+RGV AA+ R  VGS
Sbjct: 122 PFYMIKTHMQSKAAKEIAVGHQHPHESMLHGLRSVF-QSYGFTGLWRGVSAAIPRVMVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQLSS+   K  + K      ++ L    +++ S F V   M PFDV+STRMYNQ  D+
Sbjct: 181 ATQLSSFTKSKEYLTKRQIFPANSWLNTFGATICSAFTVTMCMTPFDVVSTRMYNQGIDK 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
            G G  YKN +DCF+K  R EG++GFYKG+G  +LR+GPHT+L+    ++
Sbjct: 241 HGNGLHYKNVVDCFVKIFRTEGLWGFYKGWGPSFLRLGPHTVLSLTIWDR 290



>gi|465992264|ref|XP_004266913.1| PREDICTED: solute carrier family 25 member 35 isoform 1 [Orcinus
           orca]
 gi|470652266|ref|XP_004329215.1| PREDICTED: solute carrier family 25 member 35 isoform 1 [Tursiops
           truncatus]
          Length = 300

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/300 (45%), Positives = 183/300 (61%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYRRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGCLHTAEGTLSPVRSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + T  A+GHQ+N++  F AL KI ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAATEIAVGHQYNHQGMFQALIKIGQKYG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  V ++      +  V  ++++VS   V   M PFDV+STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLVTQWEIFPPQSWKVALVAAMVSSIAVVLAMTPFDVVSTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGI+G YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 AQGKGLMYRGLLDALLQTARIEGIWGMYKGIGASYFRLGPHTILSLFFWDQLRTLYYVYT 299



>gi|507953699|ref|XP_004684669.1| PREDICTED: solute carrier family 25 member 35 [Condylura cristata]
          Length = 300

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 178/299 (59%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYPRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              S S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGSLSPPRSAAAGALAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    M R  +GS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGMPRVVIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  V   +++VSG  V   M PFDV  TR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDLLTQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVACTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 241 QGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRILYYAYT 299



>gi|126309124|ref|XP_001368207.1| PREDICTED: solute carrier family 25 member 35-like [Monodelphis
           domestica]
          Length = 300

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 184/296 (62%), Gaps = 5/296 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AA  A  FTNP EVVKTR+QLQGEL R+  +Y + YRN+F AF+ I K +GV  
Sbjct: 3   FLLSGLAASGACVFTNPLEVVKTRMQLQGEL-RAPGSYQRHYRNVFHAFFTIGKVDGVAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP-ISMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +      F +++    P  S L+G +AG  GA +G
Sbjct: 62  LQKGLAPALVYQFLMNGIRLGIYGLVEAK-GFFLDSNGNHSPGRSALAGGIAGVIGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ S +  A+GHQ+ ++  F AL  I+++   F GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQSASEIAVGHQYKHQGMFQALSVIARKHGLF-GLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++  IK  V ++      +  +   S++VS   V   M PFDVISTR+YNQ  D
Sbjct: 180 SSTQLCTFSSIKDLVAQWEVFPPQSWKLALASAMVSSMAVVLAMTPFDVISTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
             GKG +Y+   D  ++T+R EGI+G YKG GA Y R+GPHTIL+  F +Q R LY
Sbjct: 240 AHGKGLMYRGLPDALMQTIRTEGIWGMYKGVGASYFRLGPHTILSLFFWDQLRILY 295



>gi|507674880|ref|XP_004638510.1| PREDICTED: solute carrier family 25 member 35 [Octodon degus]
          Length = 300

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 183/300 (61%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  + +S         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LADSSGYLHTAEGTLSPVRSAAAGGLAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LGGLWRGALGGLPRVVVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 IQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRFLYHSYT 299



>gi|343403810|ref|NP_001230286.1| solute carrier family 25, member 35 [Sus scrofa]
          Length = 318

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 182/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I + +G+  
Sbjct: 21  FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGRVDGLAA 79

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P+ S  +G LAG  GA +G
Sbjct: 80  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTLSPVRSAAAGALAGVMGAYLG 138

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL KI ++     GL+RG    + R  VG
Sbjct: 139 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTKIGQKHG-LVGLWRGALGGLPRVIVG 197

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV+STR+YNQ  D
Sbjct: 198 SSTQLCTFSSTKDLMTQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVVSTRLYNQPTD 257

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 258 AQGKGLMYRGLLDALLQTARTEGIFGMYKGLGASYFRLGPHTILSLFFWDQLRMLYYTYT 317



>gi|440486444|gb|ELQ66307.1| mitochondrial oxaloacetate transport protein [Magnaporthe oryzae
           P131]
          Length = 276

 Score =  249 bits (636), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 169/267 (63%), Gaps = 11/267 (4%)

Query: 58  LQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYD 117
           +QLQGEL R   +    YR  F    VIV+NEG+ GI +G+  AY YQ+++NG RLGFY+
Sbjct: 1   MQLQGEL-RDKGHQPHFYRGPFHGVSVIVRNEGLGGIYRGISCAYVYQILLNGCRLGFYE 59

Query: 118 PIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQH 175
           P+R +L   F  + +  ++ I++  G  +G  GAA GSP +LVKTR+QSYS F  +G QH
Sbjct: 60  PMRQTLTGLFYNDKNQQNLGINIFCGASSGIIGAAAGSPFFLVKTRLQSYSPFLPVGTQH 119

Query: 176 NYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDD 235
            YKN  D + +I   E   KG++RGV AAMIRTG GS  QL +YFF KR ++K+ GM + 
Sbjct: 120 EYKNALDGMRQIYGAEGA-KGMYRGVGAAMIRTGFGSSVQLPTYFFAKRRLVKHLGMEEG 178

Query: 236 NILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGI 295
             L H  SS VSGF VC  M+P D I +RMYNQ       G+LY   LDCF KT++ EG+
Sbjct: 179 PAL-HLASSTVSGFVVCCVMHPPDTIMSRMYNQ------SGNLYSGVLDCFAKTVKTEGV 231

Query: 296 FGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           F  YKGF  H  RI PHTILT    EQ
Sbjct: 232 FAIYKGFLPHLARILPHTILTLSLAEQ 258



>gi|428178958|gb|EKX47831.1| hypothetical protein GUITHDRAFT_162598 [Guillardia theta CCMP2712]
          Length = 326

 Score =  249 bits (636), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 139/311 (44%), Positives = 187/311 (60%), Gaps = 19/311 (6%)

Query: 29  KALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKN 88
           K +   + GG AA  A  F+NP+EVVKTRLQLQGE+  S +   + Y+ +  AF  I + 
Sbjct: 24  KLMTDIITGGTAASLACVFSNPFEVVKTRLQLQGEMANSAAQG-RVYKGLIDAFMKIPRE 82

Query: 89  EGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISML----SGFLA 144
           EGV  IQKGL     YQ  MNGARLG Y     +L++  N   +  P+++L    +G  +
Sbjct: 83  EGVLAIQKGLVPGMVYQFFMNGARLGIYP----TLKRLLNDDGSHSPMNVLRQIGAGATS 138

Query: 145 GSFGAAIGSPLYLVKTRMQSYSTFAA-----IGHQHNYKNTFDALHKISKEERYFKGLFR 199
           G+ GA IGSP ++VK R+Q+ S  A        +Q++YK   D L K+ KEE    G FR
Sbjct: 139 GAIGAVIGSPFFMVKCRLQAMSKIAKNSGTLHANQYDYKGMVDGLVKVYKEEG-MSGWFR 197

Query: 200 GVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFD 259
           G+D A+ R  VGS +QL++Y  +K+ ++   G   D IL H  SS+VSG  V   MNPFD
Sbjct: 198 GIDGAVPRVMVGSASQLATYETVKQRILAL-GYLHDGILCHFSSSMVSGIVVTTIMNPFD 256

Query: 260 VISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVF 319
           V+STR+Y Q     G   +Y   +DCFIKT RAEG+ GF+KG+ AHY R+GPHT+L  VF
Sbjct: 257 VVSTRLYTQP---QGAKRIYSGPVDCFIKTARAEGLGGFFKGWTAHYARLGPHTVLCLVF 313

Query: 320 LEQYRGLYIKY 330
            EQ R L  K+
Sbjct: 314 WEQVRNLAHKF 324



>gi|323354053|gb|EGA85899.1| Oac1p [Saccharomyces cerevisiae VL3]
          Length = 275

 Score =  249 bits (635), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 132/270 (48%), Positives = 171/270 (63%), Gaps = 16/270 (5%)

Query: 58  LQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYD 117
           +QLQGE++ S +   K Y+N  Q   VI KNEG++G+QKGL AAY YQ+ +NG+RLGFY+
Sbjct: 1   MQLQGEMSASAA---KVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYE 57

Query: 118 PIRNSLEKFFNTSST-----SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIG 172
           PIR+SL + F          S+ +++ SG  +G  GA IGSPL+LVKTR+QSYS F  IG
Sbjct: 58  PIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIG 117

Query: 173 HQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGM 232
            Q +Y   ++ L  I K E   KGLFRG+DAA++RTG GS  QL  Y   K  ++K   M
Sbjct: 118 EQTHYTGVWNGLVTIFKTEG-VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLM 176

Query: 233 SDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRA 292
            D   L H  +S +SG  V   MNP+DVI TR+YNQK D      LYK  +DC +KT+R 
Sbjct: 177 KDGPAL-HLTASTISGLGVAVVMNPWDVILTRIYNQKGD------LYKGPIDCLVKTVRI 229

Query: 293 EGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           EG+   YKGF A   RI PHTI+   F+EQ
Sbjct: 230 EGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 259



>gi|354469608|ref|XP_003497219.1| PREDICTED: solute carrier family 25 member 35-like [Cricetulus
           griseus]
 gi|344237763|gb|EGV93866.1| Solute carrier family 25 member 35 [Cricetulus griseus]
          Length = 300

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 183/301 (60%), Gaps = 7/301 (2%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLLSGMAACGACVFTNPLEVVKTRMQLQGEL-KAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM-PI-SMLSGFLAGSFGAAI 151
           +QKGLG A  YQ +MNG RLG Y       + + +T    + P+ S  +G LAG  GA +
Sbjct: 62  LQKGLGPALLYQFLMNGIRLGTYGLAER--KGYLSTDEGVLSPVRSAAAGALAGVIGAYL 119

Query: 152 GSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           GSP+YLVKT +Q+ +T   A+GHQ+ ++  F AL +I ++     GL+RG    + R  +
Sbjct: 120 GSPIYLVKTHLQAQATSEIAVGHQYKHQGMFQALTQIGQKHG-LVGLWRGAVGGLPRVVI 178

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKA 270
           GS TQL ++   K  + ++      +      +++VSG  V   M PFDV STR+YNQ  
Sbjct: 179 GSSTQLCTFSSTKDFLSQWEIFPPQSWKAALAAAMVSGMAVVLAMTPFDVASTRLYNQPT 238

Query: 271 DQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           D  GKG +Y+   D  ++T R EGIFG YKG GA Y R+GPHT+L+  F +Q R LY  Y
Sbjct: 239 DTHGKGLMYRGIFDALLQTARTEGIFGMYKGIGASYFRLGPHTVLSLFFWDQLRSLYNTY 298

Query: 331 T 331
           T
Sbjct: 299 T 299



>gi|74222819|dbj|BAE42267.1| unnamed protein product [Mus musculus]
          Length = 299

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 181/299 (60%), Gaps = 5/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGVAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGLG A  YQ +MNG RLG Y  +  S         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLGPALLYQFLMNGIRLGTYG-LAESRGYLHTNEGTHSPVRSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGAVGGLPRVVIG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++  IK  + ++      +  V   +++VSG  +   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSIKDLLSQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             GKG +Y+  LD  ++T R EG FG YKG GA Y R+GPHTIL+  F +Q R  Y  Y
Sbjct: 240 TRGKGLMYRGILDALLQTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSFYNTY 298



>gi|291236157|ref|XP_002737995.1| PREDICTED: solute carrier family 25, member 35-like [Saccoglossus
           kowalevskii]
          Length = 303

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 178/297 (59%), Gaps = 3/297 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++GG AAC A  F+NP EVVK R+QLQGEL ++   YV+ Y+N F  FY + K +G+  
Sbjct: 4   FILGGLAACGACLFSNPLEVVKIRMQLQGEL-QARGTYVRSYKNAFHGFYTVGKVDGLLA 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQL+MNG RLG +  ++N+              S+++G  +GS GA +GS
Sbjct: 63  LQKGLVPALFYQLLMNGTRLGTFQCLKNAGLITDKNGDVVFWQSVVAGAFSGSCGAIVGS 122

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+YLVKT +QS S    A+GHQH +     AL  I KE     GL+RGV  A+ R  VGS
Sbjct: 123 PMYLVKTHLQSQSNVEIAVGHQHTHNGMTSALRTIYKEHGVI-GLWRGVSGAVPRVMVGS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++  IK  V K      ++  +   SS VS   V   M PFDV+STR+YNQ  D 
Sbjct: 182 GAQLSTFSTIKDMVEKSKIFKHESWFIPITSSCVSAVVVTAFMTPFDVVSTRLYNQGTDA 241

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
            GKG  Y    DCF+K LR EG  GFYKG+ A + R+GPH+IL+ VF ++ R  Y K
Sbjct: 242 RGKGIFYTGFFDCFLKILRKEGPLGFYKGWTASFFRLGPHSILSLVFWDKLRHFYTK 298



>gi|21312550|ref|NP_082324.1| solute carrier family 25 member 35 [Mus musculus]
 gi|150416120|sp|Q5SWT3.2|S2535_MOUSE RecName: Full=Solute carrier family 25 member 35
 gi|12841015|dbj|BAB25048.1| unnamed protein product [Mus musculus]
 gi|18044819|gb|AAH19996.1| Solute carrier family 25, member 35 [Mus musculus]
 gi|148678514|gb|EDL10461.1| solute carrier family 25, member 35, isoform CRA_a [Mus musculus]
 gi|148678515|gb|EDL10462.1| solute carrier family 25, member 35, isoform CRA_a [Mus musculus]
          Length = 300

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 181/299 (60%), Gaps = 5/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGVAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGLG A  YQ +MNG RLG Y  +  S         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLGPALLYQFLMNGIRLGTYG-LAESRGYLHTNEGTHSPVRSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGAVGGLPRVVIG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++  IK  + ++      +  V   +++VSG  +   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSIKDLLSQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             GKG +Y+  LD  ++T R EG FG YKG GA Y R+GPHTIL+  F +Q R  Y  Y
Sbjct: 240 TRGKGLMYRGILDALLQTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSFYNTY 298



>gi|478517832|ref|XP_004433147.1| PREDICTED: solute carrier family 25 member 35 [Ceratotherium simum
           simum]
          Length = 300

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 182/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITISKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTLSPVRSAAAGALAGVSGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG   ++ R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFHALIEIGQKHG-LVGLWRGALGSLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLMTQWEIFPPQSWTVALAAAMVSGIAVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 TQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRTLYYTYT 299



>gi|157817424|ref|NP_001102503.1| solute carrier family 25 member 35 [Rattus norvegicus]
 gi|149053008|gb|EDM04825.1| similar to solute carrier family 25, member 35, isoform CRA_a
           [Rattus norvegicus]
 gi|149053010|gb|EDM04827.1| similar to solute carrier family 25, member 35, isoform CRA_a
           [Rattus norvegicus]
 gi|165971028|gb|AAI58840.1| Solute carrier family 25, member 35 [Rattus norvegicus]
          Length = 300

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 181/299 (60%), Gaps = 5/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGVAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGLG A  YQ +MNG RLG Y  +  S         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLGPALLYQFLMNGIRLGTYG-LAESGGYLRTKEGTHSPVRSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGAVGGLPRVVIG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKVALAAAMVSGVAVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             GKG +Y+  LD  ++T R EG+FG YKG GA Y R+GPHTIL+  F +Q R  Y  Y
Sbjct: 240 TRGKGLMYRGILDALLQTARTEGLFGMYKGIGASYFRLGPHTILSLFFWDQLRSFYSTY 298



>gi|291405075|ref|XP_002719057.1| PREDICTED: solute carrier family 25, member 35-like [Oryctolagus
           cuniculus]
          Length = 300

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 178/298 (59%), Gaps = 3/298 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYKRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLAEARGYLHTAEGALSPPRSAAAGALAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VGS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVVVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  V   +++VSG  V   M PFDV  TR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDLMSQWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVACTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  Y
Sbjct: 241 HGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYHTY 298



>gi|395533504|ref|XP_003768798.1| PREDICTED: solute carrier family 25 member 35 [Sarcophilus
           harrisii]
          Length = 334

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 195/319 (61%), Gaps = 8/319 (2%)

Query: 17  TTANKARAKETIKALPG---FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVK 73
           T + K  A+    +LPG   FL+ G AAC A  FTNP EVVKTR+QLQGEL ++  +Y +
Sbjct: 17  TASQKGGAQLPFCSLPGAMDFLLSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGSYQR 75

Query: 74  PYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS 133
            YRN+F AF+ I + +G+  +QKGL  A  YQ +MNG RLG Y  +  +     +++   
Sbjct: 76  HYRNVFHAFFTIGQVDGLAALQKGLVPALVYQFLMNGIRLGTYG-LAEAGGYLLDSNGNH 134

Query: 134 MP-ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEE 191
            P  S  +G LAG  GA IGSP+Y+VKT +Q+ S +  A+GHQ+ +++ + AL  I +++
Sbjct: 135 SPGRSAAAGALAGVMGAYIGSPIYMVKTHLQAQSASEIAVGHQYKHQSMYQALCVIGRKQ 194

Query: 192 RYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCV 251
               GL+RG    + R  VGS TQL ++  IK  V ++      +  +   +++VS   V
Sbjct: 195 G-LVGLWRGALGGLPRVMVGSSTQLCTFSSIKDLVTQWEVFPPQSWKLALTAAMVSSLAV 253

Query: 252 CFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
              M PFDV+STR+YNQ  D  GKG +Y+   D  ++T+R EGI+G YKG GA Y R+GP
Sbjct: 254 VAAMTPFDVVSTRLYNQPTDAHGKGLMYRGLPDAVMQTIRTEGIWGMYKGMGASYFRLGP 313

Query: 312 HTILTFVFLEQYRGLYIKY 330
           HTIL+  F +Q R LY K+
Sbjct: 314 HTILSLFFWDQLRILYQKH 332



>gi|507558954|ref|XP_004663211.1| PREDICTED: solute carrier family 25 member 35 [Jaculus jaculus]
          Length = 300

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 131/300 (43%), Positives = 181/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P+ S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYS-LAETKGYLHTAEGTVSPVRSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVVIG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V   +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPSQSWKVALAAAMVSGIAVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGI+G YKG GA Y R+GPHTIL+  F +Q R  Y  YT
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIWGMYKGIGASYFRLGPHTILSLFFWDQLRLFYYTYT 299



>gi|504170453|ref|XP_004594818.1| PREDICTED: solute carrier family 25 member 35 [Ochotona princeps]
          Length = 300

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 180/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G A C A  FTNP EVVKTR+QLQGEL    S Y + YRN+F AF+ I + +G+  
Sbjct: 3   FLMSGLAGCGACVFTNPLEVVKTRMQLQGELQVPGS-YKRHYRNVFHAFFTIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y  +           + S P  +++G +AG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGVVEARGYLHTAEGNLSPPRCLVAGAMAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALAEIGQKHG-LVGLWRGALGGLPRVIMGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  +   +++VSG  V   M PFDV  TR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDLMSQWEIFPPQSWKLALAAAMVSGIAVVLAMTPFDVACTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EG+FG YKG GA Y RIGPHTIL+  F +Q R LY KYT
Sbjct: 241 QGKGLMYRGILDALLRTARTEGLFGMYKGIGASYFRIGPHTILSLFFWDQLRSLYHKYT 299



>gi|328862416|gb|EGG11517.1| hypothetical protein MELLADRAFT_33336 [Melampsora larici-populina
           98AG31]
          Length = 312

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 181/300 (60%), Gaps = 10/300 (3%)

Query: 25  KETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYV 84
           K ++ A  GF+ G   AC AVTFTNP EV KTRLQL GEL +  S   K Y N +     
Sbjct: 7   KYSLSAGEGFVAGALGACVAVTFTNPMEVAKTRLQLDGELQQKGSP--KTYTNTYDVLRK 64

Query: 85  IVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKF--FNTSSTSMPISMLSGF 142
           I + EG+R  Q+GLGAAYAYQ  +NG+RLGFY+PIR+++      + S   +  S+ +G 
Sbjct: 65  IARAEGLRSCQRGLGAAYAYQFALNGSRLGFYEPIRSNISSLSGHHPSHVQLWSSVSAGA 124

Query: 143 LAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVD 202
           L+G  GA  G+PL+LVK R+Q+ S   +   ++ Y++  D L +I  +E   KG+ RGVD
Sbjct: 125 LSGVIGAIFGNPLFLVKARLQA-SASTSHSSRYAYRSAIDGLAQIFHQEG-LKGMMRGVD 182

Query: 203 AAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVIS 262
           A+M+RT +GS  QL +Y + K ++  Y     +++ ++  SS  SG CV   M P D   
Sbjct: 183 ASMLRTAMGSSVQLPAYNYAKTNLTPY--FDPNSVWLYIASSSFSGMCVLTAMQPADTTL 240

Query: 263 TRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           TRMYNQ  D   +  LYKN  DC  KT++ EG  G YKG  AH+ RI PHTI+T V  EQ
Sbjct: 241 TRMYNQPTDPGKR--LYKNPWDCLWKTIKIEGFTGLYKGSTAHFFRIAPHTIITLVANEQ 298



>gi|432899448|ref|XP_004076563.1| PREDICTED: solute carrier family 25 member 35-like [Oryzias
           latipes]
          Length = 343

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 186/299 (62%), Gaps = 4/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++ G AAC A  FTNP EVVKTR+QLQGEL +S  +Y   YRN+F AFY I K +G+ G
Sbjct: 3   FVLSGVAACGACLFTNPLEVVKTRMQLQGEL-KSRGSYSVHYRNVFHAFYTIGKVDGLLG 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ  MNG RLG Y  I +S     N   + +  + L+G +AG  GA +GS
Sbjct: 62  LQKGLVPALYYQFFMNGVRLGSYAIIESSGHIHTNGRVSGVKTT-LAGAVAGVVGAVMGS 120

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+YLVKT +QS ST + A+GHQ+ ++    AL  I ++     GL+RG  AA+ R  +GS
Sbjct: 121 PIYLVKTHLQSQSTSSIAVGHQYQHQGMMHALSVIYRQHG-IVGLWRGSSAAVPRVSIGS 179

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++   K  V+      +D+ LV   + ++S   V   M PFDV+STR+YNQ  D 
Sbjct: 180 AAQLSTFSSSKELVMDLQVFPEDSWLVALSAGMISSVVVVLAMTPFDVVSTRLYNQPVDH 239

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG LYK   DCF KTL+ EG+ G YKG GA Y R+GPHTIL+  F ++ R LY K T
Sbjct: 240 LGKGQLYKGFTDCFSKTLKKEGLAGLYKGLGASYFRLGPHTILSLFFWDELRKLYWKST 298



>gi|119478851|ref|XP_001259461.1| mitochondrial carrier protein [Neosartorya fischeri NRRL 181]
 gi|119407615|gb|EAW17564.1| mitochondrial carrier protein [Neosartorya fischeri NRRL 181]
          Length = 298

 Score =  243 bits (619), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 181/285 (63%), Gaps = 12/285 (4%)

Query: 41  ACSAVTFTNPWE-VVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLG 99
            C  ++  +  + ++  RLQLQGEL ++ S  VK Y+ +F    VI++NEG RG+ +G+G
Sbjct: 2   PCPPMSLIDGTDFLLIPRLQLQGEL-QAKSEAVKKYKGVFHGVKVILQNEGPRGLFRGIG 60

Query: 100 AAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAIGSPLYL 157
           +AY YQ+++NG RLGFY+P+R  +    + +    S+ I++ SG  +G  GAA GSP +L
Sbjct: 61  SAYIYQILLNGCRLGFYEPLRKGITTAVYKDPQVQSLGINVFSGAASGIIGAAAGSPFFL 120

Query: 158 VKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLS 217
           VKTR+QSYS F  +G QH Y+N+FD L KI   E    GL+RGV AAM+RTG GS  QL 
Sbjct: 121 VKTRLQSYSPFLPVGTQHEYRNSFDGLRKIYTSEG-VGGLYRGVGAAMVRTGFGSSVQLP 179

Query: 218 SYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGS 277
           +YFF KR ++K+ GM D   L H  SS VSGF VC  M+P D + +RMYNQ  D      
Sbjct: 180 TYFFAKRRLVKHLGMEDGPAL-HLASSTVSGFVVCCVMHPPDTVMSRMYNQTGD------ 232

Query: 278 LYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
           LYK   DC  KT+R EGI   YKG+ AH  RI PHTILT    EQ
Sbjct: 233 LYKGAFDCLFKTIRKEGILAIYKGYFAHLARILPHTILTLSLAEQ 277



>gi|47222526|emb|CAG02891.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 305

 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/299 (45%), Positives = 177/299 (59%), Gaps = 13/299 (4%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++ G AAC    FTNP EVVKTR+QLQGEL +S   Y   YRN+F AFY I K +G+  
Sbjct: 3   FILSGVAACGRCLFTNPLEVVKTRMQLQGEL-QSRGTYQVFYRNVFHAFYTIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS-TSMPISMLSGFLAGSFGAAIG 152
           +QKGL     YQ  MNG RLG Y  I +S   + +T    S   S ++G LAG  GA +G
Sbjct: 62  LQKGLVPGLVYQFFMNGVRLGSYAIIESS--GYIHTEGRVSAAKSTVAGSLAGVVGAVMG 119

Query: 153 SPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+YLVKT +QS +  + A+GHQ+ ++    AL  I K+     GL+RG  AA+ R  VG
Sbjct: 120 SPIYLVKTHLQSQANSSIAVGHQYKHQGMIHALRAIYKDHGVI-GLWRGSSAAVARVSVG 178

Query: 212 SCTQLSSYFFIKR-------SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTR 264
           S  QL ++   K        SVI       D+ LV   + ++S   V   M PFDV+STR
Sbjct: 179 SAAQLCTFSSSKEMLLTFSISVITPQVFPKDSWLVGLSAGMISSVVVVLAMTPFDVVSTR 238

Query: 265 MYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQY 323
           +YNQ  D+ GKG LYK   DCF+KTLR E + G YKG GA Y R+GPHTIL+  F  ++
Sbjct: 239 LYNQPVDRLGKGQLYKGFSDCFLKTLRKESLVGLYKGLGASYFRLGPHTILSLFFWHEF 297



>gi|196007096|ref|XP_002113414.1| hypothetical protein TRIADDRAFT_26899 [Trichoplax adhaerens]
 gi|190583818|gb|EDV23888.1| hypothetical protein TRIADDRAFT_26899 [Trichoplax adhaerens]
          Length = 302

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 183/283 (64%), Gaps = 5/283 (1%)

Query: 47  FTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQL 106
           FTNP EVVKTRLQLQGEL ++   Y + YRN  QAF+ I K +G+ G+QKGLG A  YQ 
Sbjct: 17  FTNPIEVVKTRLQLQGEL-QARGLYQRHYRNPIQAFFAIAKTDGILGLQKGLGPALVYQC 75

Query: 107 VMNGARLGFYDPIRNS-LEKFFNTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSY 165
            MNG RLG +  I NS L K  N +  ++   +L+G  AG  GA +GSP+Y+VKT +Q+ 
Sbjct: 76  TMNGIRLGSFQVILNSGLTKDKNGNQNALK-CVLAGCFAGMCGAFVGSPIYMVKTHLQAQ 134

Query: 166 STFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR 224
           ST + A+G+QH++ +++ AL +I  +    +GL+RG   A++RT VGS  QLS++  I+ 
Sbjct: 135 STSSIAVGYQHHHNSSYQALREIYLKFG-IRGLWRGASGAVLRTMVGSGIQLSTFTLIRD 193

Query: 225 SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLD 284
            +   +     ++ V   +S VSG  +   M PFDV+STR++NQ  D +G+G  Y   LD
Sbjct: 194 KIAGLNLWPSGSVCVPISASFVSGIMISICMTPFDVVSTRLFNQGVDSTGRGQHYTGVLD 253

Query: 285 CFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
           CF+K LR EG+ G +KG  A YLR+GPHT L+ VF ++ R LY
Sbjct: 254 CFMKILRKEGVPGLFKGLTASYLRLGPHTALSLVFWDRLRRLY 296



>gi|91091348|ref|XP_972245.1| PREDICTED: similar to predicted protein [Tribolium castaneum]
 gi|270014146|gb|EFA10594.1| hypothetical protein TcasGA2_TC012854 [Tribolium castaneum]
          Length = 299

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 184/298 (61%), Gaps = 3/298 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F IGGAAA  A  FTNP EV+KTR+QLQGEL +S  ++   Y+N+F A YVI K++GV  
Sbjct: 3   FAIGGAAAVCAGFFTNPLEVMKTRMQLQGEL-KSRGHHAVHYKNVFHAGYVIAKHDGVLA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +Q GL     +QLV+NG R G Y  + +         +     S+  G  AG+ GA I S
Sbjct: 62  LQAGLVPGLWFQLVLNGYRFGLYQILDDKGYMKDKKGNLVFYKSVAIGGFAGASGAFIAS 121

Query: 154 PLYLVKTRMQSY-STFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YL+KT +QS  S   A GHQ++YK T+  L  + KE+   KGLFRG  +A+ R  VGS
Sbjct: 122 PFYLIKTHLQSQASKEIAFGHQYHYKGTWSGLWSVYKEQG-VKGLFRGSFSAVPRAFVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            +QL+S+ + K  + KY  +++  +L+   +S+V G  +   M PFD++STR+YNQ  D+
Sbjct: 181 TSQLTSFAYCKEFMRKYGILTNSPLLMTFTASMVGGVAISLMMTPFDLVSTRLYNQGVDK 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           SG+G LYK   DC  K  + EG  GFYKG G  Y R+GPHT+L  VF ++++ LY ++
Sbjct: 241 SGRGLLYKGYTDCVFKIWKTEGFLGFYKGLGPSYFRLGPHTVLCLVFWDEFKELYHRF 298



>gi|472588449|gb|EMS25921.1| oxaloacetate carrier [Rhodosporidium toruloides NP11]
          Length = 352

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 185/323 (57%), Gaps = 43/323 (13%)

Query: 33  GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELT-RSN----------------------S 69
           GF+ G  AAC+AVT TNP EV KTRLQL GEL  R++                      S
Sbjct: 20  GFVSGALAACTAVTITNPMEVAKTRLQLDGELQGRAHIKLAPAVAGSGAAAAGIPEVHAS 79

Query: 70  NYVKP----YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK 125
               P    Y +         + EG+RGIQ+GLGAAYAYQ+ +NG+RLGF++P R+++  
Sbjct: 80  VKAGPSGRVYTSALDCMQKTWRFEGLRGIQRGLGAAYAYQVALNGSRLGFFEPFRHAINS 139

Query: 126 F--FNTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
              +  +S     S+L+G  +G  GA +G+PL+LVK RMQ+YS F  +G QH+Y + F+ 
Sbjct: 140 VAGYEQNSVHAWTSLLAGASSGVVGAILGNPLFLVKARMQAYSPFNPVGAQHHYTSAFNG 199

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
           L  I ++E   KGL RGVDAAM+RT +GS  QL +Y   K ++  + GM  DN+ V+ LS
Sbjct: 200 LASIVRKEG-VKGLARGVDAAMLRTAMGSSVQLPAYNLAKTTLNGW-GMG-DNVGVYLLS 256

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSG-----KGSLYKNTLDCFIKTLRAEGIFGF 298
           S  SG CVC  M P D   TRMYNQ  +  G     +G LYKN +DC  KT R EG  G 
Sbjct: 257 STFSGMCVCAVMQPADTALTRMYNQSPNSVGPDGKPRGLLYKNPIDCLWKTWRTEGFAGL 316

Query: 299 YKGFGAHYLRIGPHTILTFVFLE 321
           YKG       I PHT++T V  E
Sbjct: 317 YKG------TIAPHTVVTLVTNE 333



>gi|431894046|gb|ELK03852.1| Solute carrier family 25 member 35 [Pteropus alecto]
          Length = 300

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 178/298 (59%), Gaps = 3/298 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL +S   Y + Y+N+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QSPGTYQRHYKNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y  +           + +  +S  +G L G  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLVEAGGYLHTAEGTVNPALSAATGALTGITGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + +  A+GHQ+ ++  F AL  I+++     GL+RG    + R  VGS
Sbjct: 122 PIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTDIAQKHG-LVGLWRGAMGCLPRVFVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  +   +S+VS   V   M PFDV+STR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDFMTQWEIFPPQSWKLTLAASMVSSIAVVLAMTPFDVVSTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  Y
Sbjct: 241 QGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRILYYTY 298



>gi|134081994|emb|CAK46679.1| unnamed protein product [Aspergillus niger]
          Length = 406

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 136/279 (48%), Positives = 178/279 (63%), Gaps = 15/279 (5%)

Query: 58  LQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYD 117
           LQLQGEL ++  +  K YR +     VI++NEG RG+ +G+G+AY YQ+++NG RLGFY+
Sbjct: 128 LQLQGEL-QAKQDAAKKYRGVLHGVKVILQNEGPRGLFRGIGSAYIYQVLLNGCRLGFYE 186

Query: 118 PIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQH 175
           P+R  L    + +    S+ I++L+G  +G  GAA GSP +LVKTR+QS+S F  +G QH
Sbjct: 187 PLRQGLATTIYQDAQVQSLGINVLAGAASGIIGAAAGSPFFLVKTRLQSFSPFLPVGTQH 246

Query: 176 NYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDD 235
           NYKN+FD L KI   E    GL+RGV AAM+RTG GS  QL +YFF KR ++K+ GM D 
Sbjct: 247 NYKNSFDGLRKIHTSEG-VSGLYRGVGAAMVRTGFGSSVQLPTYFFAKRRLMKHLGMEDG 305

Query: 236 NILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGI 295
             L H  SS  SGF VC  M+P D I +RMYNQ       G+LYK   DC  KT++ EG+
Sbjct: 306 PGL-HLASSTASGFVVCCVMHPPDTIMSRMYNQ------TGNLYKGVFDCLFKTIKTEGV 358

Query: 296 FGFYKGFGAHYLRIGPHTILTFVFLEQ----YRGLYIKY 330
              YKG+ AH  RI PHTILT    EQ     RGL  ++
Sbjct: 359 LAIYKGYFAHLARILPHTILTLSLAEQTNKIMRGLEDRF 397



>gi|343424789|emb|CBQ68327.1| related to OAC1-similarity to mitochondrial uncoupling proteins
           (MCF) [Sporisorium reilianum SRZ2]
          Length = 373

 Score =  239 bits (609), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 197/362 (54%), Gaps = 48/362 (13%)

Query: 12  SVNQQTTANKARAKET-IKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSN 70
           S NQ T A    AK   I    GF+ G  AA +AVT TNP EV KTR+QLQGEL  +   
Sbjct: 2   SSNQSTAAAGTAAKPVKISTAEGFIAGALAAMTAVTVTNPMEVCKTRMQLQGELMSAAPR 61

Query: 71  YV-------------------KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGA 111
            +                   + Y++    F   +K+EGV+G+Q+G+GAAY YQ+++NG+
Sbjct: 62  VLSAQAGSAAPQAGAQAAVGARLYKSSLDCFAKTLKSEGVKGVQRGIGAAYVYQVLLNGS 121

Query: 112 RLGFYDPIRNSLEKFFNTSSTSMP------ISMLSGFLAGSFGAAIGSPLYLVKTRMQSY 165
           RLGFY+P R    K  N ++   P       +  +G  +G  GA +G+PL+LVK R+Q+Y
Sbjct: 122 RLGFYEPFR----KAINRAAGKRPEEQWAAGAFAAGASSGCVGAILGNPLFLVKARLQAY 177

Query: 166 STFAAIGH-QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR 224
           S    IG   HNYK+T D L KI K E   +GL RG+DAA++RT +GS  QL +Y + K 
Sbjct: 178 SPHFVIGKASHNYKSTVDGLLKIVKSEG-LRGLARGMDAAVLRTAMGSTVQLPAYTWFKS 236

Query: 225 ------------SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ--KA 270
                       + +K      D+   +  SS+ SG CVC  M P D   TRMYNQ  + 
Sbjct: 237 YLTNMDVNANPYNPLKLLANKPDSFFTYFASSIFSGLCVCAVMQPADTALTRMYNQPVRI 296

Query: 271 DQSGK--GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYI 328
           D+ G+  G+LY+N   C   T +AEG+ G+YKG  AH  RI PHT+LT V  E Y   Y 
Sbjct: 297 DERGRSVGTLYRNPFHCLYLTAKAEGVLGWYKGTTAHLFRIAPHTVLTLVVNEAYLRWYT 356

Query: 329 KY 330
            +
Sbjct: 357 NW 358



>gi|388855924|emb|CCF50499.1| related to OAC1-similarity to mitochondrial uncoupling proteins
           (MCF) [Ustilago hordei]
          Length = 360

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 191/342 (55%), Gaps = 28/342 (8%)

Query: 16  QTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV--- 72
            + A  A     I  + GF+ G  AA +AVT TNP EV KTR+QLQGEL  S    V   
Sbjct: 5   DSAAEIAAKPAKISTVEGFMTGALAAMTAVTITNPMEVCKTRMQLQGELMSSAPRLVSGQ 64

Query: 73  -----KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF 127
                + Y++    F   +K EG+RG+Q+G+GAAY YQL++NG+RLGFY+P R ++ +  
Sbjct: 65  EGSGARLYKSSLDCFTKTIKWEGIRGVQRGIGAAYVYQLLLNGSRLGFYEPFRKAINRAG 124

Query: 128 NTSSTSM--PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGH-QHNYKNTFDAL 184
              +       +  +G  +G  GA +G+PL+L+K RMQ+YS    IG   HNY +T D +
Sbjct: 125 GKRADEQWAAGAFAAGASSGCVGAILGNPLFLIKARMQAYSPHYLIGRASHNYTSTLDGI 184

Query: 185 HKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIK------------RSVIKYSGM 232
            KI K E   +GL RG+DAA++RT +GS  QL +Y + K             + +K+   
Sbjct: 185 SKIFKSEG-LRGLIRGMDAAVLRTAMGSTVQLPAYNWFKGYLTNMDVDANAYNPLKFLAN 243

Query: 233 SDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ--KADQSGK--GSLYKNTLDCFIK 288
              +   +  SS+ SG CVC  M P D   TRMYNQ  + DQ G+  G+LY+N   C   
Sbjct: 244 KPTSFFTYLASSIFSGLCVCAVMQPADTALTRMYNQPVRIDQRGRSVGTLYRNPFHCLYL 303

Query: 289 TLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           T +AEG+ G+YKG  AH  RI PHT+LT +  E Y   Y  +
Sbjct: 304 TAKAEGLLGWYKGTTAHLFRIAPHTVLTLMMNEGYLRWYTNF 345



>gi|260841807|ref|XP_002614102.1| hypothetical protein BRAFLDRAFT_113728 [Branchiostoma floridae]
 gi|229299492|gb|EEN70111.1| hypothetical protein BRAFLDRAFT_113728 [Branchiostoma floridae]
          Length = 306

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 180/296 (60%), Gaps = 3/296 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FLIGG + C A  FTNP EVVKTR+QLQGEL +S   Y + YRN+F AF+ I + +G+  
Sbjct: 4   FLIGGFSTCGACVFTNPLEVVKTRMQLQGEL-KSRGTYQRHYRNVFHAFFTIGRVDGLLA 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ  MNG RLG Y  + N      ++ +     S+++G  +G  GA +GS
Sbjct: 63  LQKGLVPALWYQFFMNGVRLGTYQSLDNLGLTTDSSGNVVWWRSIMAGAASGCAGAFVGS 122

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT++QS S +  A+GHQH + +    L  I  E     GL+RGV  AM R  VGS
Sbjct: 123 PIYMVKTQLQSRSASTIAVGHQHTHASMTQGLKGIYAEYG-IMGLWRGVSGAMPRVTVGS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++   K  +        ++  V  L ++VS   V   M PFDV+STR+YNQ  D 
Sbjct: 182 AAQLSTFAISKEKIQNLGIFPHNSFAVPMLGAIVSSVVVVTFMTPFDVVSTRLYNQPVDA 241

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYI 328
            GKG+LY+   DCF K    EG++GFYKG  A Y R+GPHTIL+ +F +++R LY+
Sbjct: 242 RGKGTLYRGVWDCFKKIFHKEGVWGFYKGTAASYFRLGPHTILSLLFWDRFRELYL 297



>gi|170051686|ref|XP_001861878.1| mitochondrial carrier protein [Culex quinquefasciatus]
 gi|167872834|gb|EDS36217.1| mitochondrial carrier protein [Culex quinquefasciatus]
          Length = 311

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 178/292 (60%), Gaps = 2/292 (0%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+GG AA  A  F+NP++V+KTR QLQGEL      +  PYR+IF++F  I+K EG+ G
Sbjct: 14  FLLGGCAATCAGIFSNPFDVIKTRQQLQGELGDQPGTHRNPYRSIFKSFQSILKAEGIAG 73

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL +A A+Q  MN  RLG Y    N          TS+  S+  G L+G  GA +  
Sbjct: 74  LQKGLVSALAFQFTMNSIRLGIYQTAENYEWTRGRNKLTSLLYSIGWGGLSGVIGATVAC 133

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           PLY++KT++Q+ S    A+G QHN+  TFDAL  I +      GL+RG    + RT VGS
Sbjct: 134 PLYMIKTQIQATSHGKYAVGFQHNHAGTFDALAGIYRTYG-ITGLWRGYPGIVTRTAVGS 192

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QL+++   K   +++    +  +    ++S+ SGF  C  M+PFDVI+TR++NQ  D 
Sbjct: 193 SAQLATFSQCKEFFVQFEFFQESVMATAFVASMFSGFFCCVFMSPFDVIATRLFNQGVDS 252

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
            G+G LY +  DCF KTLRAEG+ G YKGF  +Y RI PHTIL   F +Q++
Sbjct: 253 RGRGLLYTSVWDCFSKTLRAEGLHGLYKGFVPNYWRIAPHTILNLTFWDQFK 304



>gi|383850008|ref|XP_003700620.1| PREDICTED: solute carrier family 25 member 35-like [Megachile
           rotundata]
          Length = 314

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 132/302 (43%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 32  PG--FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNE 89
           PG  F IGG AA  A  FTNP +VVK RLQLQGEL   NS Y K Y+N   A Y+I K+E
Sbjct: 13  PGIEFAIGGLAAVGAGFFTNPVDVVKVRLQLQGELEARNS-YKKIYKNTVHAAYLIAKHE 71

Query: 90  GVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGA 149
           G+  +Q G+  A  +Q+V+NG RLG Y+  +       +  +T +  +++    AG  GA
Sbjct: 72  GILALQAGIVPALYFQVVLNGIRLGIYNTAKKYELITNDKGNTDVLKTVIVTGTAGCIGA 131

Query: 150 AIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRT 208
            +GSP Y+VKT++Q+ S  + A+GHQHNY  T+ A   + KE  +F  L+RG  A + R 
Sbjct: 132 VLGSPFYMVKTQLQAQSAQSIAVGHQHNYSGTWYAFKSLWKEGGFF-ALYRGWYANIPRV 190

Query: 209 GVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ 268
            VGS TQL+++      +      +D  +L+  L+SL+ G CV  TM PFDV++TR+YNQ
Sbjct: 191 FVGSATQLTTFGLTADWLRSLEIFTDQPLLLTFLASLIGGSCVALTMQPFDVLATRLYNQ 250

Query: 269 KADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYI 328
           + D  GKGSLY   LD  IK  R EG+ G YKG    ++RI PHT+L  VF E+   LY 
Sbjct: 251 RTDAGGKGSLYNGLLDALIKISRTEGLTGLYKGIFPTWMRIAPHTVLCLVFYEKLDQLYN 310

Query: 329 KY 330
           ++
Sbjct: 311 RF 312



>gi|126328973|ref|XP_001377422.1| PREDICTED: solute carrier family 25 member 34-like [Monodelphis
           domestica]
          Length = 328

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 182/317 (57%), Gaps = 9/317 (2%)

Query: 15  QQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKP 74
           Q T A       ++      ++G +A C A  FTNP EVVKTRLQLQGEL ++   + +P
Sbjct: 15  QTTPAPGGADAASVSPAADLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTHPRP 73

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM 134
           YR +F+A   + + +G+RG+QKGLGAA  YQ +MNG R   Y     +LE          
Sbjct: 74  YRGLFRAVGAVARADGLRGLQKGLGAALLYQGLMNGVRFYCYS---LALEAGLTQQPGGT 130

Query: 135 PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTF-AAIGHQHNYKNTFDALHKISKEERY 193
            ++       G+F   +GSP YLVKT++Q+ +    A+GHQH +++   AL  I +++  
Sbjct: 131 VLAGALAGALGAF---VGSPAYLVKTQLQAKTAATVAVGHQHEHQSVLGALETIWRQQG- 186

Query: 194 FKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCF 253
             GL+RGV  A+ R  VGS  QL+++   K  V  +    +D+ LV     ++S   V  
Sbjct: 187 VPGLWRGVGGAVPRVMVGSAAQLATFASAKSWVQDHKWFQEDSWLVALAGGMISSVAVAI 246

Query: 254 TMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
            M PFDVISTR+YNQ  D +G+G LY+  LDC +K  +AEG    YKG G  YLR+GPHT
Sbjct: 247 VMTPFDVISTRLYNQPVDPTGRGQLYRGLLDCLVKITQAEGPLALYKGLGPAYLRLGPHT 306

Query: 314 ILTFVFLEQYRGLYIKY 330
           +L+ +F ++ R L  ++
Sbjct: 307 VLSLLFWDELRKLTYRF 323



>gi|156379531|ref|XP_001631510.1| predicted protein [Nematostella vectensis]
 gi|156218552|gb|EDO39447.1| predicted protein [Nematostella vectensis]
          Length = 311

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 183/306 (59%), Gaps = 13/306 (4%)

Query: 31  LPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEG 90
           L  F++G  AA  A  FTNP EVVKTR+QLQGEL +S   Y   YRN+F A Y I K EG
Sbjct: 5   LKEFVLGATAASGACFFTNPLEVVKTRMQLQGEL-KSRGTYSVYYRNVFHASYTIAKYEG 63

Query: 91  VRGIQKGLGAAYAYQLVMNGARLGFYDPIRN-SLEKFFNTSSTSMPI---SMLSGFLAGS 146
           +  +QKGL  A  YQ++MNG RLG Y  I N  L K     +   P+    +++G ++G 
Sbjct: 64  ILAMQKGLFPALIYQVIMNGTRLGSYQIITNFGLTK----DADGKPVFYKCLIAGAMSGG 119

Query: 147 FGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERY-FKGLFRGVDAA 204
            GA +GSP YL+KT++Q+ S    A+G+QH +K +   L  +    R+  KGL++G+ A 
Sbjct: 120 LGATLGSPFYLLKTQLQAQSAQQIAVGYQHQHKGSLKPLWDV--YTRFGVKGLYQGLSAG 177

Query: 205 MIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTR 264
           + R   GS  QLS++   +  +      +  + L+   +S++S   V   M P+DV++TR
Sbjct: 178 ITRVMFGSAAQLSTFSTTRNFIANSEVFNTGSWLIPTCASMISSIAVVVCMTPWDVVATR 237

Query: 265 MYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
           +YNQ    SG+  LY+   DCF+K  R EG+ GFYKG G HY RIGPHT+L+ +F +Q +
Sbjct: 238 LYNQGTSSSGEKLLYRGFFDCFLKIFRKEGVLGFYKGVGPHYFRIGPHTVLSLLFWDQLK 297

Query: 325 GLYIKY 330
            LY KY
Sbjct: 298 SLYNKY 303



>gi|321478911|gb|EFX89867.1| hypothetical protein DAPPUDRAFT_189793 [Daphnia pulex]
          Length = 299

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 187/301 (62%), Gaps = 19/301 (6%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           +  GG AAC A  FTNP +VVKTR+QLQGEL  S   Y   Y+N   AFYV+ KN+G++G
Sbjct: 3   YAFGGLAACGACLFTNPLDVVKTRMQLQGELL-SRGAYSVLYKNSLHAFYVVAKNDGIKG 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ++MNG RLG Y  + N      + S +S+  S+ +G ++G+ GA   S
Sbjct: 62  LQKGLVPALWYQMIMNGTRLGLYHFMENQGWTHSHGSVSSV-FSIAAGAVSGASGAFSAS 120

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YL+KT++QS S+   A+G QHN+     A+ K+        GL+RGV A+M+RTGVGS
Sbjct: 121 PFYLIKTQLQSQSSQTIAVGCQHNHTGFLSAMQKLYYSGG-ITGLWRGVTASMMRTGVGS 179

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVH------ALSSLVSGFCVCFTMNPFDVISTRMY 266
             QLS++   + ++      ++ NIL H        ++++SG  V   M+PFDVISTR+Y
Sbjct: 180 AAQLSTFTKSRETI------NNLNILPHNSWKSTLAAAMLSGVAVAVAMSPFDVISTRLY 233

Query: 267 NQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILT---FVFLEQY 323
           NQ  D+ GKG  Y    +C IK  +AEG FG YKG  A+YLR+GPH++LT   + FL + 
Sbjct: 234 NQTLDRYGKGVYYSGPFECLIKVFKAEGFFGLYKGCLANYLRVGPHSVLTLTIWTFLRET 293

Query: 324 R 324
           +
Sbjct: 294 K 294



>gi|156545453|ref|XP_001606805.1| PREDICTED: solute carrier family 25 member 35-like [Nasonia
           vitripennis]
          Length = 317

 Score =  236 bits (602), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 183/312 (58%), Gaps = 7/312 (2%)

Query: 20  NKARAKETIKALPG--FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRN 77
           +K  A  T +  PG  F IG  AA  A  FTNP +VVK RLQLQGEL  +  +Y K YRN
Sbjct: 4   SKPNAVPTSEKPPGVEFAIGALAAVGAGFFTNPIDVVKIRLQLQGEL-EARGSYQKIYRN 62

Query: 78  IFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYD-PIRNSLEKFFNTSSTSMPI 136
            F A Y I ++EG+  +Q G+  A  +Q+V+NG RLG Y+   R  L    N  +  +  
Sbjct: 63  TFHAAYQIARHEGIFALQSGIVTALGFQVVLNGTRLGSYNLAKRYGLTLNANGETNVVKT 122

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFK 195
            ++SG +AGS GA IGSPLYLVKT++QS S  + A+GHQHN+  T+ A   +  E+   +
Sbjct: 123 VLVSG-IAGSVGAIIGSPLYLVKTQLQSQSARSIAVGHQHNHTGTWSAFKSLWNEDG-VR 180

Query: 196 GLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTM 255
           GL+RG  A + R  VGS TQL+++      +       D  I +  ++SL+ G CV FTM
Sbjct: 181 GLYRGWYANIPRVFVGSATQLTAFGLFADWLRPMEVFKDKPIFMTFVASLLGGSCVAFTM 240

Query: 256 NPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTIL 315
            PFDV++TR+YNQ  D  GKG LY    D   K  R EG+FG YKG    +LRI PHT+L
Sbjct: 241 QPFDVVATRLYNQGIDAKGKGVLYNGLFDALYKIFRTEGVFGLYKGVFPTWLRIAPHTVL 300

Query: 316 TFVFLEQYRGLY 327
             VF E+    Y
Sbjct: 301 CLVFYEKIARFY 312



>gi|322693760|gb|EFY85609.1| mitochondrial oxaloacetate transport protein [Metarhizium acridum
           CQMa 102]
          Length = 305

 Score =  236 bits (602), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 173/305 (56%), Gaps = 43/305 (14%)

Query: 58  LQLQGELTRSNSNYVKP--YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGF 115
           +QLQGEL +      +P  YR       VI++NEG+RGI +GLG AY YQ+++NG RLGF
Sbjct: 1   MQLQGELQQKGR---QPHFYRGPIHGVGVILRNEGLRGIYRGLGTAYIYQILLNGCRLGF 57

Query: 116 YDPIRNSLEKFF--NTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGH 173
           YDP+R  L   F  N ++ ++ I+M  G  +G  GAA GSP +LVKTR+QSYS F  +G 
Sbjct: 58  YDPMRKGLATLFLDNENAQNLGINMFCGAFSGVIGAAAGSPFFLVKTRLQSYSPFLPVGT 117

Query: 174 QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMS 233
           QH Y+N +D L +I + E    GL+RG+ AAMIRTG GS  QL +YFF KR +++++GM 
Sbjct: 118 QHQYRNAWDGLSQIYRGEG-VGGLYRGIGAAMIRTGFGSSVQLPTYFFAKRRLMRHAGME 176

Query: 234 DDNILVHALSSLVSGFCVCFTMNP----------------------------FDVISTRM 265
           +   L H  SS  SGF VC  M+P                             D I +R+
Sbjct: 177 EGPAL-HLASSAASGFVVCCFMHPPGKWLSSPKNAKRGLRRGASIADTNASSIDTIMSRL 235

Query: 266 YNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRG 325
           YNQ       G+LYK   DC  KT+R EG F  YKGF  H  RI PHTILT    EQ   
Sbjct: 236 YNQ------NGNLYKGVFDCLGKTIRTEGFFAIYKGFLPHLARILPHTILTLSLAEQTNK 289

Query: 326 LYIKY 330
           L  K+
Sbjct: 290 LVRKF 294



>gi|432959025|ref|XP_004086151.1| PREDICTED: solute carrier family 25 member 34-like [Oryzias
           latipes]
          Length = 339

 Score =  236 bits (601), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 177/298 (59%), Gaps = 11/298 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F +G  A C A  FTNP EVVKTRLQLQGEL  +  +Y   YR + QA +V+ + +G+RG
Sbjct: 49  FALGALACCGACVFTNPLEVVKTRLQLQGELC-ARGSYQIHYRGVLQALWVVGRTDGLRG 107

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL     YQ VMNG RLG Y     S  ++     T+ P  S+L G   G+ GA   
Sbjct: 108 LQKGLSVGLIYQGVMNGVRLGCY-----SYCEYLGV--TAFPGGSLLCGAGVGALGALCA 160

Query: 153 SPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP YLVKT +Q+ +  A A+GHQHN++   +A   I + E    GL+RGV+ A+ R  VG
Sbjct: 161 SPAYLVKTHLQAQTIQAIAVGHQHNHQGVSNAFMTIYRREG-LSGLWRGVNGAVPRVMVG 219

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QLS++   K  V        +  L+  +++ +SG  V  TM PFDVISTR+YNQ  D
Sbjct: 220 SAAQLSTFTSAKDWVSHCQWFGSNRWLMALVAASISGVAVAITMTPFDVISTRLYNQPVD 279

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
           + G+G LY+   DC +K  +AEG+ G YKG G  ++R+ PHT+L+ +F +  R   +K
Sbjct: 280 KLGRGRLYRGFCDCLLKVCQAEGLLGLYKGMGPVFVRLAPHTVLSMLFWDLMRQQAVK 337



>gi|488541786|ref|XP_004462479.1| PREDICTED: solute carrier family 25 member 35 [Dasypus
           novemcinctus]
          Length = 300

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 182/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL R+   Y + YRN+F AF  I + +G+  
Sbjct: 3   FLLSGLAACGACVFTNPLEVVKTRMQLQGEL-RAPGTYQRHYRNVFHAFITIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y  +        +  + S P S  +G LAG+ GA +GS
Sbjct: 62  LQKGLTPALIYQFLMNGIRLGTYGMVEAGGYLRTSEGTLSPPRSAATGALAGALGAYLGS 121

Query: 154 PLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ + T  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VGS
Sbjct: 122 PIYMVKTHLQAQAATEIAVGHQYKHQGMFQALVQIGQKHG-LVGLWRGAMGGLPRVVVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +      +++ SG  V   M PFDV+STR+YNQ  D 
Sbjct: 181 STQLCTFTSTKDLITQWEVFPPQSWKAALAAAMTSGIAVVLAMTPFDVVSTRLYNQPTDS 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R +Y KYT
Sbjct: 241 QGKGLMYRGLLDALLQTARKEGIFGMYKGLGASYFRLGPHTILSLFFWDQLRIVYHKYT 299



>gi|425772245|gb|EKV10656.1| Mitochondrial oxaloacetate transporter (Oac), putative [Penicillium
           digitatum Pd1]
 gi|425777424|gb|EKV15598.1| Mitochondrial oxaloacetate transporter (Oac), putative [Penicillium
           digitatum PHI26]
          Length = 264

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 159/250 (63%), Gaps = 10/250 (4%)

Query: 75  YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSST 132
           Y+       VI++NEG RG+ +G+G+AY YQ+++NG RLGFY+PIR++L    + +    
Sbjct: 2   YKGPLHGIKVILQNEGPRGLFRGIGSAYIYQVLLNGCRLGFYEPIRSNLTSAIYSDPKVQ 61

Query: 133 SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEER 192
           S+  ++++G  +G  GAA GSP +LVKTR+QSYS F  +G QH YKN+FD L KI K E 
Sbjct: 62  SLAANVVAGAASGVIGAAAGSPFFLVKTRLQSYSPFLPVGTQHKYKNSFDGLSKIYKGEG 121

Query: 193 YFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVC 252
             KG++RGV AAMIRT  GS  QL +YFF KR + ++ GM +   L H  SS  SGF VC
Sbjct: 122 -IKGIYRGVGAAMIRTSFGSAVQLPTYFFAKRRLTRHLGMEEGPAL-HLASSATSGFVVC 179

Query: 253 FTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPH 312
             M+P D I  RMYNQ       G+LY    DC +KT+R EG    YKGF AH  RI PH
Sbjct: 180 CFMHPPDTIMARMYNQ------TGNLYGGVFDCLLKTIRTEGPLAIYKGFFAHLARILPH 233

Query: 313 TILTFVFLEQ 322
           TILT    EQ
Sbjct: 234 TILTLSLAEQ 243



>gi|507690763|ref|XP_004712990.1| PREDICTED: solute carrier family 25 member 35 [Echinops telfairi]
          Length = 300

 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 180/299 (60%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++  +Y + YRN+F AF  I K +G   
Sbjct: 3   FLLSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGSYQRHYRNVFHAFITIGKVDGPAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G LAG  GA +GS
Sbjct: 62  LQKGLVPALIYQFLMNGIRLGTYGLAEAGGYLCTAEGTLSPPRSAAAGALAGVLGAYLGS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ +  A A+GHQ+ ++  F AL +I ++     GL+RG    + R  VGS
Sbjct: 122 PIYMVKTHLQAQAASAIAVGHQYKHQGMFQALTQIGQKHG-LVGLWRGSLGGLPRVVVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QL ++   K  + ++      +  V  ++++VSG  V   M PFDV STR+YNQ  D 
Sbjct: 181 SAQLCTFSSTKDLISQWEVFPSQSWKVALVAAMVSGIVVVLAMTPFDVASTRLYNQPTDG 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGI+G YKG GA Y R+GPHTIL+  F +Q R LY KYT
Sbjct: 241 GGKGLMYRGILDALLQTARTEGIWGMYKGIGASYFRLGPHTILSLFFWDQLRSLYSKYT 299



>gi|240849523|ref|NP_001155734.1| solute carrier family 25 member 35-like [Acyrthosiphon pisum]
 gi|239788828|dbj|BAH71075.1| ACYPI007990 [Acyrthosiphon pisum]
          Length = 310

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/293 (41%), Positives = 174/293 (59%), Gaps = 3/293 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++G   A  AV FTNP EV+KTR QLQGEL +   NY   YRN   A YV+ KNEG   
Sbjct: 3   FILGALGASGAVCFTNPLEVIKTRFQLQGELKKVG-NYKVHYRNFAHAIYVVAKNEGPLA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  +  +Q+ +NG RLG +D  +       +  + S+  S L G  AG  G  +GS
Sbjct: 62  LQKGLLPSMGHQVFLNGTRLGIFDLAQKKNWILKSDGTVSLIKSALVGAGAGMLGGFLGS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           PL ++K  +QS+S  + A+GHQHN  +T + L  + ++     GL+RG   AM+R GV S
Sbjct: 122 PLGMLKIHLQSFSAQSIAVGHQHNTTSTINGLLTLYRKYGVVHGLWRGATGAMVRIGVAS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHAL-SSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
            TQLS+   +  ++I +  ++ D   +  L  S++ G  +   M PFD++STR+YNQ  D
Sbjct: 182 ATQLSTISLLNEALIDHGVLTKDQKFLSTLICSMLGGVLMSIVMAPFDLVSTRLYNQAVD 241

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
             G+G LY + ++C  KT R EGI+G YKG    YLR+GPH +L+ VF ++ R
Sbjct: 242 ARGRGLLYSSYMECLTKTFRQEGIYGLYKGVVPCYLRLGPHVVLSMVFWDRLR 294



>gi|13435410|gb|AAH04569.1| Slc25a35 protein, partial [Mus musculus]
          Length = 290

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/286 (43%), Positives = 173/286 (60%), Gaps = 5/286 (1%)

Query: 47  FTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQL 106
           FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF+ I K +G+  +QKGLG A  YQ 
Sbjct: 6   FTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFFTIGKVDGLAALQKGLGPALLYQF 64

Query: 107 VMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIGSPLYLVKTRMQSY 165
           +MNG RLG Y  +  S         T  P+ S  +G LAG  GA +GSP+Y+VKT +Q+ 
Sbjct: 65  LMNGIRLGTYG-LAESRGYLHTNEGTHSPVRSAAAGALAGVMGAYLGSPIYMVKTHLQAQ 123

Query: 166 S-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR 224
           + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS TQL ++  IK 
Sbjct: 124 AASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGAVGGLPRVVIGSSTQLCTFSSIKD 182

Query: 225 SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLD 284
            + ++      +  V   +++VSG  +   M PFDV STR+YNQ  D  GKG +Y+  LD
Sbjct: 183 LLSQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTDTRGKGLMYRGILD 242

Query: 285 CFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             ++T R EG FG YKG GA Y R+GPHTIL+  F +Q R  Y  Y
Sbjct: 243 ALLQTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSFYNTY 288



>gi|507547026|ref|XP_004657416.1| PREDICTED: solute carrier family 25 member 34 [Jaculus jaculus]
          Length = 318

 Score =  233 bits (595), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/314 (39%), Positives = 178/314 (56%), Gaps = 12/314 (3%)

Query: 17  TTANKARAKETIKALP---GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVK 73
           T A  A   E +K +P     ++G +A C A  FTNP EVVKTR+QLQGEL R+   Y +
Sbjct: 4   TQAQPAPGTEAVKTVPPAVDLVLGASACCLACVFTNPLEVVKTRMQLQGEL-RARGTYPR 62

Query: 74  PYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTS 133
           PYR +  +   + + +G+ G+QKGL A   YQ +MNG R   Y     + +         
Sbjct: 63  PYRGLVSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYS---LACQTGLAQQPGG 119

Query: 134 MPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEER 192
             I+       G+F   +GSP YLVKT++Q+ +  + A+GHQH +++  DAL  I +++ 
Sbjct: 120 TVIAGAVAGALGAF---VGSPAYLVKTQLQAQTVASVAVGHQHQHQSVLDALETIWRQQG 176

Query: 193 YFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVC 252
              GL+RGV  AM R  VGS  QL+++   K  V +   +S+D+ LV     ++S   V 
Sbjct: 177 LL-GLWRGVGGAMPRVMVGSAAQLATFASAKTWVQEKQWLSEDSWLVALAGGMISSVAVV 235

Query: 253 FTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPH 312
             M PFDV+STR+YNQ  D +G+G LY    DC +K  + EG    YKG G  YLR+GPH
Sbjct: 236 AVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTDCLVKICQQEGPLALYKGLGPAYLRLGPH 295

Query: 313 TILTFVFLEQYRGL 326
           TIL+ +F ++ R L
Sbjct: 296 TILSMLFWDELRKL 309



>gi|325190793|emb|CCA25283.1| Mitochondrial Carrier (MC) Family putative [Albugo laibachii Nc14]
          Length = 376

 Score =  233 bits (595), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 196/327 (59%), Gaps = 16/327 (4%)

Query: 9   ISTSVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELT-RS 67
           ++TS   ++T       +    L   +I   A  +A   +NP EVVKTR+QLQGEL  +S
Sbjct: 59  LATSSTSESTIRLEDDHKVPVFLRELIIAAYATGAACIGSNPMEVVKTRMQLQGELAMKS 118

Query: 68  NSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFF 127
            SN    YRN   AFY I + EG+ GIQ+GL    +YQ  MNG RLG ++P    L++FF
Sbjct: 119 GSN--TRYRNFAHAFYTICRTEGLGGIQRGLIPGISYQAAMNGPRLGLFEP----LQQFF 172

Query: 128 ---NTSSTSMPI-SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDA 183
              + S  + PI ++L+G  +G  GA  GSP  +VKTR+Q+ S+ +  G ++ Y    D 
Sbjct: 173 GATDPSRATFPILNILAGASSGVIGAVFGSPFSIVKTRIQATSSSSTNG-KYQYAGMIDG 231

Query: 184 LHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS 243
             +I + E    G FRG+ A + R  +GS  QLS+Y   K  V++ +G  +D ++VH  S
Sbjct: 232 FRQILRAEG-ITGFFRGLTATVPRIAIGSAIQLSTYAQAKNFVME-AGF-EDGLMVHFGS 288

Query: 244 SLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFG 303
           S+VSG  V   +NP DVISTR+Y+Q+   +GKG LY N  D   KT +AEG+  FYKG+ 
Sbjct: 289 SIVSGLAVTTAINPLDVISTRLYSQRVI-NGKGELYDNLTDSIRKTYKAEGLRAFYKGWT 347

Query: 304 AHYLRIGPHTILTFVFLEQYRGLYIKY 330
           AHYLR+GPHTILTF+  EQ + L IKY
Sbjct: 348 AHYLRVGPHTILTFILWEQAKRLVIKY 374



>gi|432105643|gb|ELK31837.1| Solute carrier family 25 member 35 [Myotis davidii]
          Length = 300

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 182/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++  +Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGSYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +     +   T  PI S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAKGYLHSADGTHSPIRSAAAGALAGVLGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R   G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGAVGGLPRVIAG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL ++   K  + ++      +  V   +++VSG  V   M PFDV+STR+YNQ  D
Sbjct: 180 SSAQLCTFSSTKDLITQWEIFPPQSWKVALAAAMVSGIVVVLAMTPFDVVSTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 TQGKGLMYRGVLDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRFLYSTYT 299



>gi|149724291|ref|XP_001504869.1| PREDICTED: solute carrier family 25 member 35-like isoform 1 [Equus
           caballus]
          Length = 300

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 178/301 (59%), Gaps = 7/301 (2%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++  +Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGSYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSM-PISMLSGFLAGSFGAA-I 151
           +QKGL  A  YQ +MNG RLG Y  I      +  T+   + P    +         A +
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLIEAG--GYLRTAEGGLSPARSAAAGALAGVMGAYL 119

Query: 152 GSPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGV 210
           GSP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG   ++ R  V
Sbjct: 120 GSPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGSVPRVTV 178

Query: 211 GSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKA 270
           GS TQL ++   K  + K+      +  V   +++VSG  V   M PFDV STR+YNQ  
Sbjct: 179 GSSTQLCTFSSTKDLMTKWEIFPPQSWKVALAAAMVSGIAVVLAMTPFDVASTRLYNQPT 238

Query: 271 DQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           D  GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  Y
Sbjct: 239 DAQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRTLYYTY 298

Query: 331 T 331
           T
Sbjct: 299 T 299



>gi|505787016|ref|XP_004604896.1| PREDICTED: solute carrier family 25 member 35 [Sorex araneus]
          Length = 300

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 131/299 (43%), Positives = 178/299 (59%), Gaps = 3/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACLFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ +MNG RLG Y              + S P S  +G +AG  GA +GS
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTLSPPRSAAAGAMAGVMGAYLGS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT +Q+ +T   A+GHQ+ ++  F AL +I ++     GL+RG    + R  +GS
Sbjct: 122 PIYMVKTHLQAQATSEIAVGHQYKHQGMFQALVEIGQKHG-LMGLWRGAMGGLPRVVIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL ++   K  + ++      +  +  L+++VSG  V   M PFDV  TR+YNQ  D 
Sbjct: 181 STQLCTFSSTKDLLTQWEIFPPQSWKIALLAAMVSGIAVVLAMTPFDVACTRLYNQPTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
            GKG +Y+  LD  ++T R EGI G YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 241 QGKGLMYRGILDVLLQTARTEGILGMYKGIGASYFRLGPHTILSLFFWDQLRILYNTYT 299



>gi|410966066|ref|XP_003989559.1| PREDICTED: solute carrier family 25 member 34 [Felis catus]
          Length = 318

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 177/309 (57%), Gaps = 9/309 (2%)

Query: 19  ANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNI 78
           A+   A+ET+      ++G +A C A  FTNP EVVKTRLQLQGEL R+   Y +PYR  
Sbjct: 9   ASGTEARETVAPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-RARGTYPRPYRGF 67

Query: 79  FQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISM 138
           F +   +++ +G+ G+QKGL A   YQ +MNG R   Y     + +           ++ 
Sbjct: 68  FASVAAVIRADGLCGLQKGLAAGLLYQGLMNGVRFYCYS---LACQAGLTQQPGGTVVAG 124

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGL 197
                 G+F   +GSP YLVKT++Q+ +  A A+GHQH++++   AL  I +++    GL
Sbjct: 125 AVAGALGAF---VGSPAYLVKTQLQAQTVAAMAVGHQHHHQSVLGALETIWRQQG-LAGL 180

Query: 198 FRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNP 257
           +RGV  A+ R  VGS  QL+++   K  V K   + +D+ LV     ++S   V   M P
Sbjct: 181 WRGVGGAVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSVAVAAVMTP 240

Query: 258 FDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
           FDV+STR+YNQ  D +GKG LY    DC +K  R EG    YKG G  YLR+GPHTIL+ 
Sbjct: 241 FDVVSTRLYNQPVDGTGKGQLYGGLADCLVKIWRQEGPLALYKGLGPAYLRLGPHTILSM 300

Query: 318 VFLEQYRGL 326
           +F ++ R L
Sbjct: 301 LFWDELRKL 309



>gi|312375733|gb|EFR23044.1| hypothetical protein AND_13778 [Anopheles darlingi]
          Length = 316

 Score =  233 bits (594), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 186/307 (60%), Gaps = 17/307 (5%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTR-----------SNSN----YVKPYRNI 78
           FL+GG AA  A  F+NP++V+KTR QL GEL             S+ N       PYR++
Sbjct: 3   FLLGGCAATCAGFFSNPFDVIKTRQQLHGELLSRTVVATGTGPASDGNGGQQTRNPYRSV 62

Query: 79  FQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISM 138
           F++F  I+K+EGV G+QKGL +A A+Q  MN  RLG Y    N      ++ + ++  S+
Sbjct: 63  FKSFRTILKSEGVLGLQKGLVSALAFQFTMNSVRLGIYQTAENYDWTRGDSKAGTVFYSI 122

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGL 197
           L G  +G  G+ I  PLY++KT++Q+ S    A+G+QH + +T DAL  I + +   +GL
Sbjct: 123 LWGGFSGVIGSTIACPLYMIKTQIQARSHGKYAVGYQHRHTSTLDALTGIYRTQG-VRGL 181

Query: 198 FRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNP 257
           +RG +    RT +GS  QL ++   K   +++    +        +S++SGF  C  M+P
Sbjct: 182 WRGYNGIATRTAIGSSAQLGTFSTFKDFFVQFEFFRESVAFTAFAASMISGFFTCVFMSP 241

Query: 258 FDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
           FDVI+TR++NQ  D +GKG LY++ +DCF KTLRAEG++G YKGF  +Y RI PHTIL  
Sbjct: 242 FDVIATRLFNQGVDANGKGLLYRSVVDCFTKTLRAEGLYGLYKGFVPNYWRIAPHTILNL 301

Query: 318 VFLEQYR 324
            F +Q++
Sbjct: 302 TFWDQFK 308



>gi|501306825|dbj|GAC95824.1| hypothetical protein PHSY_003401 [Pseudozyma hubeiensis SY62]
          Length = 372

 Score =  233 bits (593), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 197/357 (55%), Gaps = 47/357 (13%)

Query: 16  QTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRS-------- 67
           Q  A  A A   +    GF+ G  AA +AVT TNP EV KTR+QLQGEL  +        
Sbjct: 5   QPAAGTAVAPVKLSTAEGFVAGALAAMTAVTVTNPMEVCKTRMQLQGELMSAAPRVLSGQ 64

Query: 68  -----------NSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFY 116
                      N+   + Y++    F   +K+EG++G+Q+G+GAAY YQ+++NG+RLGFY
Sbjct: 65  AGSAAPQTGAQNAVGARLYKSSLDCFAKTLKSEGIKGVQRGIGAAYVYQVLLNGSRLGFY 124

Query: 117 DPIRNSLEKFFNTSSTSMP------ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA 170
           +P+R    K  N ++   P       +  +G  +G  GA +G+PL+L+K R+Q+YS    
Sbjct: 125 EPLR----KAINRAAGKRPEEQWAAGAFAAGASSGCVGAILGNPLFLIKARIQAYSPHFV 180

Query: 171 IGH-QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR----- 224
           IG   HNYK+T D L KI + E   +GL RG+DAA++RT +GS  QL +Y + K      
Sbjct: 181 IGKASHNYKSTIDGLVKIVRSEGA-RGLVRGMDAAVLRTAMGSTVQLPAYTWFKSYLTNM 239

Query: 225 -------SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ--KADQSGK 275
                  + +K+     ++   +  SS+ SG CVC  M P D   TRMYNQ  + D+ G+
Sbjct: 240 DVDANPYNPLKFLANKPNSFFTYFASSIFSGLCVCAVMQPADTALTRMYNQPVRIDERGR 299

Query: 276 --GSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             G+LY+N   C   T ++EG+ G+YKG  AH  RI PHT+LT V  E Y   Y  +
Sbjct: 300 SVGTLYRNPFHCLYLTAKSEGVLGWYKGTTAHLFRIAPHTVLTLVVNEAYLRWYTNF 356



>gi|410919699|ref|XP_003973321.1| PREDICTED: solute carrier family 25 member 34-like [Takifugu
           rubripes]
          Length = 347

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 182/297 (61%), Gaps = 9/297 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++G  A C A  FTNP EVVKTRLQLQGEL RS  +Y + YR   QA +V+ + +G+RG
Sbjct: 51  FVLGAFACCVACVFTNPLEVVKTRLQLQGEL-RSRGSYQRHYRGALQALWVVGRTDGLRG 109

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL     YQ VMNG RLG Y    +  E    TS      S+LSG  AG+ GA I S
Sbjct: 110 LQKGLSVGLIYQGVMNGVRLGSY----SYCEALGITSYHGG--SLLSGAGAGALGAFIAS 163

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YLVKT +Q+ +  + A+GHQHN+    DA   I + E    GL+RGV+ A+ R  VGS
Sbjct: 164 PAYLVKTHLQAQTVKSIAVGHQHNHLGVADAFVTIYRREG-LVGLWRGVNGAVPRVMVGS 222

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QL+++   K  V +   +S D  L   ++++VSG  V  TM PFDVISTR+YNQ  D+
Sbjct: 223 AAQLATFSSAKDWVTRSQWLSPDTWLTALVAAMVSGVAVAVTMTPFDVISTRLYNQPVDE 282

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
           S +G LY   LDC +K  +AEG+ G YKG G  +LR+ PHT+L+ +F +  R   +K
Sbjct: 283 SHRGRLYAGFLDCMLKVCQAEGLLGLYKGMGPVFLRLAPHTVLSMLFWDLMRQQAMK 339



>gi|71019273|ref|XP_759867.1| hypothetical protein UM03720.1 [Ustilago maydis 521]
 gi|46099665|gb|EAK84898.1| hypothetical protein UM03720.1 [Ustilago maydis 521]
          Length = 371

 Score =  231 bits (590), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 136/353 (38%), Positives = 194/353 (54%), Gaps = 39/353 (11%)

Query: 16  QTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELT---------R 66
           Q       A   I    GF+ G  AA +AVT TNP EV KTR+QLQGEL          +
Sbjct: 5   QVAPGTPAAPVKISTAEGFITGALAAMTAVTVTNPMEVCKTRMQLQGELMSAAPRVLGGQ 64

Query: 67  SNSNYVKP----------YRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFY 116
           + S   +P          Y++    F   +K+EG++G+Q+G+GAAY YQ+++NG+RLGFY
Sbjct: 65  TGSAASQPGTQAGVGARLYKSSLDCFTKTLKSEGLKGVQRGIGAAYVYQVLLNGSRLGFY 124

Query: 117 DPIRNSLEKFFNTSSTSM--PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGH- 173
           +P R ++ +     +       +  +G  +G  GA +G+PL+LVK R+Q+YS    IG  
Sbjct: 125 EPFRKAINRAAGKQAEEQWAAGAFAAGASSGCVGAILGNPLFLVKARIQAYSPHFVIGKA 184

Query: 174 QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIK---------- 223
            HNYK+T D L KI + E   +GL RG+DAA++RT +GS  QL +Y + K          
Sbjct: 185 SHNYKSTIDGLVKIVQSEG-VRGLVRGMDAAVLRTAMGSTVQLPAYTWFKGYLTNMDVDA 243

Query: 224 --RSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ--KADQSGK--GS 277
              + +K+     ++   +  SS+ SG CVC  M P D   TRMYNQ  + D+ G+  G+
Sbjct: 244 NEYNPLKWLANKPNSFFTYFASSIFSGLCVCAVMQPADTALTRMYNQPVRVDERGRSVGT 303

Query: 278 LYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           LY+N   C   T +AEG+ G+YKG  AH  RI PHT+LT V  E Y   Y  +
Sbjct: 304 LYRNPFHCLYLTAKAEGVMGWYKGTTAHLFRIAPHTVLTLVVNEAYLRWYTNF 356



>gi|471371094|ref|XP_004376055.1| PREDICTED: solute carrier family 25 member 35 [Trichechus manatus
           latirostris]
          Length = 300

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 181/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++  +Y + YRN+F AF  I K +G+  
Sbjct: 3   FLLSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGSYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  S         T  P  S  +G LAG  GA +G
Sbjct: 62  LQKGLAPALIYQFLMNGIRLGTYG-LAESRGYLHTAEGTHSPARSAAAGALAGVLGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+G+Q+ ++  F AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGYQYKHQGMFQALTQIGQKHG-LVGLWRGSLGCLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +      +++VSG  V   M PFDV STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLITQWEVFPSQSWKAALAAAMVSGIVVVLAMTPFDVASTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R +Y KYT
Sbjct: 240 AGGKGLIYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSIYYKYT 299



>gi|348538736|ref|XP_003456846.1| PREDICTED: solute carrier family 25 member 35-like [Oreochromis
           niloticus]
          Length = 298

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/295 (44%), Positives = 171/295 (57%), Gaps = 4/295 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++ G AAC A  FTNP EVVKTR+QLQGEL +S  +Y   YRN+F AFY I K EG+ G
Sbjct: 3   FVLSGVAACGACVFTNPLEVVKTRMQLQGEL-KSRGSYHVYYRNVFHAFYTIGKVEGLVG 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL     YQ  MNG RLG Y  I +S     N    ++  ++              S
Sbjct: 62  LQKGLVPGLWYQFFMNGVRLGSYAIIESSGYIHTNGRVNAVKTTVAGAVAGVVGAVMG-S 120

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+YLVKT +QS +T + A+GHQ+ ++    AL  I +      GL+RG  AA+ R  VGS
Sbjct: 121 PIYLVKTHLQSQATSSIAVGHQYKHQGMTHALVAIYRNHGIL-GLWRGSSAAVPRVSVGS 179

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++   K  VI       ++ LV   + ++S   V   M PFDV+STR+YNQ  D 
Sbjct: 180 AAQLSTFSSSKELVIDLQVFPANSWLVALSAGMISSVVVVLAMTPFDVVSTRLYNQPVDH 239

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
            GKG LYK   DCF KTL+ EG+ G YKG GA Y R+GPHTIL+  F ++ R  Y
Sbjct: 240 LGKGQLYKGFTDCFSKTLKKEGLTGLYKGLGASYFRLGPHTILSLFFWDELRKFY 294



>gi|443896892|dbj|GAC74235.1| mitochondrial oxaloacetate carrier protein [Pseudozyma antarctica
           T-34]
          Length = 371

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 191/347 (55%), Gaps = 47/347 (13%)

Query: 28  IKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV--------------- 72
           I    GF  G  AA +AVT TNP EV KTR+QLQGEL  +    +               
Sbjct: 17  ISTAEGFFCGALAAMTAVTVTNPMEVCKTRMQLQGELMSAAPRVLSGQAGSAAPQAGAQA 76

Query: 73  ----KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFN 128
               + Y++    F   +K+EGV+G+Q+G+GAAY YQ+++NG+RLGFY+P R    K  N
Sbjct: 77  AVGARLYKSSLDCFTKTIKSEGVKGVQRGIGAAYVYQVLLNGSRLGFYEPFR----KAIN 132

Query: 129 TSSTSMP------ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAAIGH-QHNYKNTF 181
            ++   P       +  +G  +G  GA +G+PL+L+K R+Q+YS    IG   HNYK+T 
Sbjct: 133 RAAGKRPEEQWAAGAFAAGASSGCVGAILGNPLFLIKARIQAYSPHFVIGRASHNYKSTV 192

Query: 182 DALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR------------SVIKY 229
           D L KI + E   +GL RG+DAA++RT +GS  QL +Y + K             + +K+
Sbjct: 193 DGLVKIVQSEG-VRGLVRGMDAAVLRTAMGSTVQLPAYNWFKSYLTNMDVDANAYNPLKF 251

Query: 230 SGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQ--KADQSGK--GSLYKNTLDC 285
                ++   +  SS+ SG CVC  M P D   TRMYNQ  + D+ G+  G+LY+N   C
Sbjct: 252 LANKPNSFFTYLASSIFSGLCVCAVMQPADTALTRMYNQPVRVDERGRSVGTLYRNPFHC 311

Query: 286 FIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYTT 332
              T +AEG+ G+YKG  AH  RI PHT+LT V  E Y   Y  + +
Sbjct: 312 LYLTAKAEGVLGWYKGTTAHLFRIAPHTVLTLVMNEAYLRWYTNFKS 358



>gi|472355008|ref|XP_004397160.1| PREDICTED: solute carrier family 25 member 34 [Odobenus rosmarus
           divergens]
          Length = 318

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 178/317 (56%), Gaps = 11/317 (3%)

Query: 12  SVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNY 71
           S+ Q   A+ A A ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y
Sbjct: 2   SLTQARPASGAEAMETVAPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTY 60

Query: 72  VKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS 131
            +PYR    +   +V+ +G+ G+QKGL A   YQ +MNG R   Y     SL        
Sbjct: 61  PRPYRGFLASVAAVVRADGLCGLQKGLAAGLLYQGLMNGVRFYCY-----SLAG--QAGL 113

Query: 132 TSMPISMLSGFLAGSFGAA-IGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISK 189
           T  P   +          A +GSP YLVKT++Q+ +  A A+GHQH++++   AL  + +
Sbjct: 114 TQQPGGTVVAGAVAGALGAFVGSPAYLVKTQLQAQTVAAMAVGHQHHHQSVLGALETVWR 173

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
           ++    GL+RGV  A+ R  VGS  QL+++   K  V +   + +D+ LV     ++S  
Sbjct: 174 QQG-LAGLWRGVGGAVPRVMVGSAAQLATFASAKAWVQEQQWLPEDSWLVALAGGMISSV 232

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   M PFDV+STR+YNQ  D +G+G LY    DC +K  R EG    YKG G  YLR+
Sbjct: 233 AVAAVMTPFDVVSTRLYNQPVDGAGRGRLYGGLADCLVKIWRQEGPLALYKGLGPAYLRL 292

Query: 310 GPHTILTFVFLEQYRGL 326
           GPHTIL+ +F ++ R L
Sbjct: 293 GPHTILSMLFWDELRKL 309



>gi|157123356|ref|XP_001660132.1| mitochondrial carrier protein [Aedes aegypti]
 gi|108884525|gb|EAT48750.1| AAEL000249-PA [Aedes aegypti]
          Length = 316

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 125/293 (42%), Positives = 179/293 (61%), Gaps = 3/293 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVK-PYRNIFQAFYVIVKNEGVR 92
           FL+GG AA  A  F+NP++V+KTR QLQGEL  + S   + PYR+IF++   I+K EG+ 
Sbjct: 18  FLLGGCAATCAGLFSNPFDVIKTRQQLQGELIDAASETQRNPYRSIFKSIESILKAEGIS 77

Query: 93  GIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIG 152
           G+QKGL +A A+Q  MN  RLG Y    N      ++   ++  S+  G ++G  GA + 
Sbjct: 78  GLQKGLVSALAFQFTMNSIRLGIYQTAENYEWTRGSSKFGTLMYSIFWGGISGVVGATVA 137

Query: 153 SPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
            PLY++KT++Q+ S    A+G QHN+  T DAL  I +     KGL+RG    + RT VG
Sbjct: 138 CPLYMIKTQIQATSHGKYAVGFQHNHTGTMDALAGIYRTYG-IKGLWRGYPGIVTRTAVG 196

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL+++   K   +++             +S+ SGF  C  M+PFDVI+TR++NQ  D
Sbjct: 197 SSAQLATFSSFKDFFVQFEFFQQSVAFTAFAASMFSGFFCCVFMSPFDVIATRLFNQGVD 256

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
            +G+G LY++  DCF KTLRAEG+ G YKGF  +Y RI PHTIL   F +Q++
Sbjct: 257 ANGRGLLYRSVWDCFSKTLRAEGLHGLYKGFVPNYWRIAPHTILNLTFWDQFK 309



>gi|156545451|ref|XP_001606794.1| PREDICTED: solute carrier family 25 member 35-like [Nasonia
           vitripennis]
          Length = 300

 Score =  230 bits (586), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 177/295 (60%), Gaps = 3/295 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F IG  AA  A  FTNP +V+K RLQLQGEL  +  +Y + YRN F A Y+I ++EG+  
Sbjct: 3   FAIGAGAAVCAGFFTNPIDVIKIRLQLQGEL-EARGSYKRIYRNTFHAAYIIARHEGIFA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +Q GL  A  +Q+V+NG RLG Y+  +       +     +  S+L    AG  G+A+ S
Sbjct: 62  LQSGLVPALGFQMVLNGIRLGCYNLAKRYEFTVNDAGQVDILRSLLVSGGAGCVGSALAS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           PLYLVKT++QS ++ + A+G QH++  T+ AL  + +E R F+GL+RG    + R  +GS
Sbjct: 122 PLYLVKTQLQSQASGSIAVGTQHHHSGTWSALRSLWREGR-FRGLYRGWHVGVPRISIGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL++Y  +   +       +  + +  ++SL  G CV  TM PFDV++TR+YNQK D 
Sbjct: 181 STQLTTYSVVADWLKPIQIFDNRPLWLTFVASLAGGTCVAVTMQPFDVVATRVYNQKTDA 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
           SG+G LY    D F K L+ EGI G YKG    +LRI PHT+L  VF E++   Y
Sbjct: 241 SGRGVLYGGLFDAFFKILKTEGITGLYKGVFPTWLRIAPHTVLCLVFYEKFDQYY 295



>gi|73950866|ref|XP_852142.1| PREDICTED: solute carrier family 25 member 34 isoform 1 [Canis
           lupus familiaris]
          Length = 318

 Score =  230 bits (586), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 179/317 (56%), Gaps = 11/317 (3%)

Query: 12  SVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNY 71
           S+ Q   A+   A+ET+      ++G +A C A  FTNP EVVKTRLQLQGEL +++  Y
Sbjct: 2   SLTQAQPASGREARETVTPAVDLVLGASACCLACIFTNPLEVVKTRLQLQGEL-QAHGTY 60

Query: 72  VKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS 131
            +PYR    +   +V+ +G+ G+QKGL A   YQ +MNG R   Y     SL        
Sbjct: 61  PRPYRGFVTSVVAVVRADGLCGLQKGLAAGLLYQGLMNGVRFYCY-----SLA--CQAGL 113

Query: 132 TSMPISMLSGFLAGSFGAA-IGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISK 189
           T  P   +          A +GSP YL+KT++Q+ +  A A+GHQH++++   AL  I +
Sbjct: 114 TQWPGGTVVAGAVAGALGAFVGSPAYLIKTQLQAQTVAAMAVGHQHHHQSVLGALETIWR 173

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
           ++    GL+RGV  A+ R  VGS  QL+++   K  V +   + +D+ LV     ++S  
Sbjct: 174 QQG-LAGLWRGVGGAVPRVMVGSAAQLATFASAKAWVQEQQWLPEDSWLVALAGGMISSV 232

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   M PFDV+STR+YNQ  D +G+G LY    DC +K  R EG    YKG G  YLR+
Sbjct: 233 AVAAVMTPFDVVSTRLYNQPVDGTGRGQLYSGLADCLVKIWRQEGPLALYKGLGPAYLRL 292

Query: 310 GPHTILTFVFLEQYRGL 326
           GPHTIL+ +F ++ R L
Sbjct: 293 GPHTILSMLFWDELRKL 309



>gi|444722899|gb|ELW63571.1| Solute carrier family 25 member 35 [Tupaia chinensis]
          Length = 300

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 125/299 (41%), Positives = 174/299 (58%), Gaps = 5/299 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAA-IG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P    +         A +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPARSAAAGALAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  +G
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVIIG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  V  ++++VSG  V   M PFDV+STR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLMSQWEIFPPQSWKVALVAAMVSGIAVVLAMTPFDVVSTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
             GKG +Y+  LD  ++T R EG FG YKG GA Y R+GPHTIL+  F +Q R LY  Y
Sbjct: 240 AQGKGLMYRGLLDALLQTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTY 298



>gi|281200634|gb|EFA74852.1| transmembrane protein [Polysphondylium pallidum PN500]
          Length = 340

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 191/340 (56%), Gaps = 24/340 (7%)

Query: 1   MNSQKVSGISTSVNQQTTAN----KARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKT 56
           +N+   S   T+V   +T N     ++     + + GFL G  A+  A TFTNP E+VKT
Sbjct: 10  INTNNSSSTKTNVKSSSTVNNSNIDSKEPSNYQVITGFLSGSLASMVATTFTNPIELVKT 69

Query: 57  RLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFY 116
           RLQLQGEL  S     + Y  I  AF  I K EG+ G+Q+GL  AY  Q  +NG RLG Y
Sbjct: 70  RLQLQGELKMS----ARVYTGIGDAFIKIWKAEGLIGMQRGLFPAYLSQGTLNGCRLGSY 125

Query: 117 DPIRNSL------EKFFNTSSTSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFAA 170
           D I+  +      E +F  +  +  ++   G       A++GSP  LVK RMQ+   F  
Sbjct: 126 DAIKRLIGADPEKENYFIKNLAAGALAGAFG-------ASMGSPFDLVKVRMQAARMFPN 178

Query: 171 IGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYS 230
                NY +T  A  +I + E  F+GL RG+  +  RT VGS  QLS+YF  KR +I  +
Sbjct: 179 DPQFSNYTSTSRAFAQIIRTEG-FRGLTRGMATSAQRTAVGSSIQLSTYFETKRFIINKT 237

Query: 231 GMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTL 290
           GM DD I  H LSSLV+G  V   MNPFDV  TR+Y Q    +  G  YK+ +DC  KT+
Sbjct: 238 GMEDD-IYAHLLSSLVAGLFVTVGMNPFDVARTRLYYQGQGNT-HGEKYKSLMDCIYKTV 295

Query: 291 RAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
           + EG F  YKGF AHYLR+GPHTI T VF EQ++ ++ K+
Sbjct: 296 KVEGFFALYKGFLAHYLRLGPHTIFTLVFWEQFKMVFAKF 335



>gi|322798634|gb|EFZ20238.1| hypothetical protein SINV_09639 [Solenopsis invicta]
          Length = 335

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 190/314 (60%), Gaps = 13/314 (4%)

Query: 20  NKARAKETIKALPG--FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRN 77
           N +RA E +   PG  F+IG  AA  A  FTNP +VVK RLQLQGEL  +  +Y K Y+N
Sbjct: 21  NISRADERVVRRPGVEFVIGALAAVGAGFFTNPVDVVKVRLQLQGEL-EARGSYKKIYKN 79

Query: 78  IFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRN---SLEKFFNTSSTSM 134
                Y+I K+EGV  +Q GL  A A+Q+V+NG RLG Y   +     ++K  NT    +
Sbjct: 80  TLHTAYLIAKHEGVLALQAGLVPALAFQVVLNGIRLGAYKSAQRYELIVDKQGNTDI--L 137

Query: 135 PISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERY 193
             +++SG  AG  GA +GSPLYLVKT++Q+ S  + A+G+QHN+  ++DA   +  E   
Sbjct: 138 RTAVVSG-TAGCVGAVLGSPLYLVKTQLQAQSAQSIAVGYQHNHSGSWDAFRSLWLEGG- 195

Query: 194 FKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCF 253
              L+RG +A M R  VGS TQL+++      +   +   +  IL+  L+S++ G CV  
Sbjct: 196 ITALYRGWNANMPRVFVGSATQLTTFGLASDWLRSLN--VNRPILLTFLASVIGGSCVAV 253

Query: 254 TMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
           TM PFDV++TR+YNQ+ D +GKG+LYK   D  IK  R EG+ G YKG    ++RI PHT
Sbjct: 254 TMQPFDVLATRLYNQQTDAAGKGTLYKGLGDALIKIFRTEGLTGLYKGTFPTWMRIAPHT 313

Query: 314 ILTFVFLEQYRGLY 327
           +L  VF EQ   +Y
Sbjct: 314 VLCLVFYEQLDQMY 327



>gi|507656050|ref|XP_004705222.1| PREDICTED: solute carrier family 25 member 34 [Echinops telfairi]
          Length = 318

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 176/311 (56%), Gaps = 13/311 (4%)

Query: 19  ANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNI 78
           A +  A E +      ++G +A C A  FTNP EVVKTRLQLQGEL R+   Y +PYR I
Sbjct: 9   APRPEAMEPVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-RARGTYPRPYRGI 67

Query: 79  FQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNS--LEKFFNTSSTSMPI 136
             A   + + +G+RG+QKGL A   YQ +MNG R   Y     +   ++   T       
Sbjct: 68  VAAAAAVARTDGLRGLQKGLAAGLLYQALMNGVRFYCYSLACQAGLAQQPGGTLVAGALA 127

Query: 137 SMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFK 195
             L  F        +GSP YLVKT++Q+ S  A A+GHQH+++    AL  I +++    
Sbjct: 128 GALGAF--------VGSPAYLVKTQLQAQSVAAMAVGHQHHHQGVLGALETIWRQQG-VT 178

Query: 196 GLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTM 255
           GL+RGV  A+ R  VGS  QL+++   K  V +   + +++ LV     ++S   V   M
Sbjct: 179 GLWRGVGGAVPRVMVGSAAQLATFASSKAWVQERQWLPEESWLVALAGGMISSVAVAAVM 238

Query: 256 NPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTIL 315
            PFDV+STR+YNQ  D++G+G LY+  +DC +K  R EG    YKG G  Y+R+GPHTIL
Sbjct: 239 TPFDVVSTRLYNQPVDEAGRGQLYRGLVDCLVKIWRQEGPLALYKGLGPAYVRLGPHTIL 298

Query: 316 TFVFLEQYRGL 326
           + +F ++ R L
Sbjct: 299 SMLFWDELRKL 309



>gi|402898692|ref|XP_003912354.1| PREDICTED: solute carrier family 25 member 35 isoform 1 [Papio
           anubis]
          Length = 300

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 181/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I + +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P  S  +G +AG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPARSAAAGAMAGIMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++     ++  +  ++++VSG  V   M PFDV  TR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPESWKLALVAAMVSGIAVVLAMAPFDVACTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTYT 299



>gi|307199076|gb|EFN79786.1| Solute carrier family 25 member 35 [Harpegnathos saltator]
          Length = 317

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 175/297 (58%), Gaps = 3/297 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F IG  AA  A  FTNP +VVK RLQLQGEL  +   Y K Y+N   A Y+I K+EGV  
Sbjct: 17  FAIGALAAVGAGFFTNPVDVVKVRLQLQGEL-EARGAYKKIYKNTLHAAYLIAKHEGVLA 75

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +Q GL  A A+Q+V+NG RLG Y   +          +T +  + L    AG  GA +GS
Sbjct: 76  LQAGLVPALAFQVVLNGIRLGAYKSAQRYELIVDKQGNTDVLRTTLVSGTAGCVGAVLGS 135

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YLVKT++Q+ S  + A+G+QH++  ++DA   + KE      L+RG +A + R  VGS
Sbjct: 136 PFYLVKTQLQAQSAKSIAVGYQHDHSGSWDAFKSLWKEGG-VAALYRGWNANLPRVFVGS 194

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL+++      +   +   D  IL+  L+S + G CV  TM PFDV++TR+YNQ+ D 
Sbjct: 195 ATQLTTFGLASDWLRSLNIFPDRPILLTFLASAIGGSCVAVTMQPFDVLATRLYNQQTDA 254

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIK 329
           +GKG+LY   +D F+K  R EG  G YKG    ++RI PHT+L  VF EQ   LY K
Sbjct: 255 AGKGTLYNGLVDAFVKIFRTEGFTGLYKGTFPTWMRIAPHTVLCLVFYEQLDQLYRK 311



>gi|340721448|ref|XP_003399132.1| PREDICTED: solute carrier family 25 member 35-like [Bombus
           terrestris]
          Length = 314

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 180/309 (58%), Gaps = 5/309 (1%)

Query: 22  ARAKETIKALPG--FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIF 79
           A    +I   PG  F IG  AA  A  FTNP +V+K RLQLQGEL   N+ Y K Y+N  
Sbjct: 3   AAPSTSISRPPGIEFAIGALAAVGAGFFTNPIDVIKVRLQLQGELEARNT-YKKIYKNTL 61

Query: 80  QAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISML 139
            A Y+I K+EG+  +Q G+  A  +Q+V+NG RLG Y+  +       +   T +  +++
Sbjct: 62  HAGYLIAKHEGITALQAGIVPALYFQVVLNGIRLGIYNTAKKYDLITNDKGDTDILKTVV 121

Query: 140 SGFLAGSFGAAIGSPLYLVKTRMQSYST-FAAIGHQHNYKNTFDALHKISKEERYFKGLF 198
               +GS GA +GSP Y+VKT++Q+ S    A+G+QHNY  T+ A   + KE      L+
Sbjct: 122 LTGTSGSVGAVLGSPFYMVKTQLQAQSAQTIAVGYQHNYLGTWSAFKSLWKEGG-IVALY 180

Query: 199 RGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPF 258
           RG  A + R  VGS TQL+++      +      +D  I +  L+S++ G CV  TM PF
Sbjct: 181 RGWYANIPRVFVGSATQLTTFGLAADWLRSLQVFTDQPIFLTFLASIIGGSCVALTMQPF 240

Query: 259 DVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFV 318
           DV++TR+YNQ+ D SGKG+LY   LD  IK LR EG+ G YKG    ++RI PHT+L  V
Sbjct: 241 DVLATRLYNQQTDVSGKGTLYNGLLDAIIKILRTEGLSGLYKGIFPTWMRIAPHTVLCLV 300

Query: 319 FLEQYRGLY 327
           F E+   LY
Sbjct: 301 FYEKLDELY 309



>gi|332251126|ref|XP_003274698.1| PREDICTED: solute carrier family 25 member 35 isoform 1 [Nomascus
           leucogenys]
          Length = 300

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 180/300 (60%), Gaps = 5/300 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P  S  +G +AG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  +  +++++SG  V   M PFDV  TR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY  YT
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTYT 299



>gi|213982847|ref|NP_001135591.1| solute carrier family 25, member 34 [Xenopus (Silurana) tropicalis]
 gi|195540014|gb|AAI68116.1| Unknown (protein for MGC:186127) [Xenopus (Silurana) tropicalis]
          Length = 301

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 167/293 (56%), Gaps = 11/293 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F++G +A C A  FTNP EVVKTRLQLQGEL RS   Y + YR + QA   + + +G+RG
Sbjct: 9   FVLGASACCMACVFTNPLEVVKTRLQLQGEL-RSRGTYTRHYRGVLQAMVAVGQADGLRG 67

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAA-IG 152
           +QKGL A   YQ +MNG R   Y               T  P   ++         A +G
Sbjct: 68  LQKGLTAGLLYQAMMNGVRFYLYSHAEG-------IGLTEQPGGNIAAGAVAGATGAFVG 120

Query: 153 SPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP YLVKT +Q+ +  A A+GHQHN+++   A   I K++    GL+RGV+ A+ R  VG
Sbjct: 121 SPAYLVKTHLQAQTVAAIAVGHQHNHQSVSSAFETIYKKQGIL-GLWRGVNGAVPRVMVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S  QL+++   K  V K      D+ LV     ++S   V   M PFDV+STR+YNQ  D
Sbjct: 180 SAVQLATFANAKEWVKKQQWFPHDSWLVALTGGMISSIGVAIAMTPFDVVSTRLYNQPVD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
            SGKG LY+  LDC +K +  EG+   YKG    Y+R+GPHTIL+ +F E+ R
Sbjct: 240 SSGKGRLYRGFLDCILKIIHKEGVLALYKGIVPAYIRLGPHTILSLLFWEELR 292



>gi|47229661|emb|CAG06857.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 339

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 179/292 (61%), Gaps = 9/292 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F +G  A C A  FTNP EVVKTRLQLQGEL RS  +Y + YR + QA +++ +N+G+RG
Sbjct: 52  FALGAVACCVACVFTNPLEVVKTRLQLQGEL-RSRGSYQRHYRGVLQALWLVGRNDGLRG 110

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL     YQ VMNG RLG Y    +  E    TS      S+LSG  AG+ GA I S
Sbjct: 111 LQKGLSVGLIYQGVMNGVRLGSY----SYCEALGVTSYHGG--SLLSGAGAGALGAFIAS 164

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P YLVKT +Q+ +    A+GHQH++    DA   I + E    GL+RGV+ A+ R  VGS
Sbjct: 165 PAYLVKTHLQAQTVKTIAVGHQHSHVGVSDAFATIYRREG-LVGLWRGVNGAVPRVMVGS 223

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL+++   K  V +    S D+ L   +++ +SG  V   M PFDVISTR+YNQ  D+
Sbjct: 224 ATQLATFSSAKDWVSRSQRFSPDSWLTALVAAAISGVAVAVAMTPFDVISTRLYNQPVDE 283

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
           + +G LY   LDC +K  +AEG+ G YKG G  +LR+ PHT+L+ +F +  R
Sbjct: 284 AHRGRLYGGFLDCMLKVCQAEGLLGLYKGMGPVFLRLAPHTVLSMLFWDLMR 335



>gi|402853053|ref|XP_003891218.1| PREDICTED: solute carrier family 25 member 34 [Papio anubis]
          Length = 318

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 175/315 (55%), Gaps = 9/315 (2%)

Query: 13  VNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV 72
           + Q   A  A A ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y 
Sbjct: 3   LAQAQKATGAEAMETVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTYP 61

Query: 73  KPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSST 132
           +PYR    +   + + +G+ G+QKGL A   YQ +MNG R   Y     + +        
Sbjct: 62  QPYRGFMASVAAVARVDGLWGLQKGLAAGLLYQGLMNGVRFYCYS---LACQAGLTQQPG 118

Query: 133 SMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEE 191
              ++       G+F   +GSP YL+KT++Q+ +  A A+GHQHN++    AL  I +++
Sbjct: 119 GTVVAGAVAGALGAF---VGSPAYLIKTQLQAQTVAAMAVGHQHNHQTVLGALETIWRQQ 175

Query: 192 RYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCV 251
               GL++GV  A+ R  VGS  QL+++   K  V K   + +D+ LV     ++S   V
Sbjct: 176 GLL-GLWQGVGGAVPRVMVGSAAQLATFTSAKAWVQKQQWLPEDSWLVALAGGMISSIAV 234

Query: 252 CFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGP 311
              M PFDV+STR+YNQ  D++G+G LY    DC +K  R EG    YKG    YLR+GP
Sbjct: 235 VVAMTPFDVVSTRLYNQPVDRAGRGQLYGGLTDCMVKIWRQEGPLALYKGLAPAYLRLGP 294

Query: 312 HTILTFVFLEQYRGL 326
           HTIL+ +F ++ R L
Sbjct: 295 HTILSMLFWDELRKL 309



>gi|443694826|gb|ELT95862.1| hypothetical protein CAPTEDRAFT_174650 [Capitella teleta]
          Length = 308

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 171/295 (57%), Gaps = 3/295 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+GG AA  A  FTNP EV KTR+QLQGE+ ++   Y   Y+N+F AFY I K +GV  
Sbjct: 4   FLLGGIAASGAGFFTNPLEVAKTRMQLQGEM-KARGQYRVHYKNVFHAFYTIGKVDGVCA 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A  YQ  MNG RLG Y    N           S   S+  G  +G  GAA GS
Sbjct: 63  LQKGLVPALWYQFFMNGFRLGAYQVFSNLGWNKDKDGKVSFVRSVFMGAASGCVGAACGS 122

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P Y+VKT++Q+ +  A A+G+Q      F AL +++  E   +GL+RGV  A+ R  VGS
Sbjct: 123 PFYMVKTQLQAQANQAIAVGYQRELPGMFGAL-RVAFHEHGVRGLWRGVSGAVPRVMVGS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
             QLS++      +I      + ++     +S+ SG  V   M PFDV+STR+YNQ  D 
Sbjct: 182 GAQLSTFSTALEIIISLKIFREGSLWNTLSASMCSGVVVVMFMTPFDVVSTRLYNQATDT 241

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
            GKG  YK   DCF+K    EG++GFYKG+GA   R+GPHT+L+ VF ++ R  Y
Sbjct: 242 HGKGIYYKGLSDCFLKIFHNEGLWGFYKGWGASLFRLGPHTVLSLVFWQETRRWY 296



>gi|397494497|ref|XP_003818112.1| PREDICTED: solute carrier family 25 member 35 isoform 1 [Pan
           paniscus]
          Length = 300

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 178/296 (60%), Gaps = 5/296 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P  S  +G +AG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL KI ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTKIGQKHG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  +  +++++SG  V   M PFDV  TR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLY 295



>gi|108997750|ref|XP_001083788.1| PREDICTED: solute carrier family 25 member 34 [Macaca mulatta]
          Length = 318

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 173/309 (55%), Gaps = 9/309 (2%)

Query: 19  ANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNI 78
           A  A A ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y +PYR  
Sbjct: 9   ATGAEAVETVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTYPQPYRGF 67

Query: 79  FQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISM 138
             +   + + +G+ G+QKGL A   YQ +MNG R   Y     + +           ++ 
Sbjct: 68  MASVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYS---LACQAGLTQQPGGTVVAG 124

Query: 139 LSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGL 197
                 G+F   +GSP YL+KT++Q+ +  A A+GHQHN++    AL  I +++    GL
Sbjct: 125 AVAGALGAF---VGSPAYLIKTQLQAQTVAAMAVGHQHNHQTVLGALETIWRQQGLL-GL 180

Query: 198 FRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNP 257
           ++GV  A+ R  VGS  QL+++   K  V K   + +D+ LV     ++S   V   M P
Sbjct: 181 WQGVGGAVPRVMVGSAAQLATFTSAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVAMTP 240

Query: 258 FDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTF 317
           FDV+STR+YNQ  D++G+G LY    DC +K  R EG    YKG    YLR+GPHTIL+ 
Sbjct: 241 FDVVSTRLYNQPVDRAGRGQLYGGLTDCMVKIWRQEGPLALYKGLAPAYLRLGPHTILSM 300

Query: 318 VFLEQYRGL 326
           +F ++ R L
Sbjct: 301 LFWDELRKL 309



>gi|157118162|ref|XP_001659038.1| mitochondrial carrier protein [Aedes aegypti]
 gi|108875806|gb|EAT40031.1| AAEL008211-PA [Aedes aegypti]
          Length = 308

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 175/299 (58%), Gaps = 2/299 (0%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F +GG ++C AV FTNP++V+KTR QL+GEL   +S     YR ++Q+   +VK++G+RG
Sbjct: 3   FALGGLSSCCAVLFTNPFDVLKTRQQLEGELLAKSSVKQHAYRGLWQSIVTVVKSDGLRG 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL AA  YQL MN  RLG Y  + N        +  +  +S+  G  AG   A +  
Sbjct: 63  LQKGLPAAALYQLSMNSVRLGTYQTVDNLGWTRSENALLTPFLSVFWGGFAGMISATVSC 122

Query: 154 PLYLVKTRMQSYSTFAAIGH-QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y++KT+MQ+ S  +     QH +    DA   + +E    +GL+RG  A + R  +GS
Sbjct: 123 PVYVIKTQMQAVSCGSYTAKFQHRHSGVIDAFRTMYREAG-IRGLYRGYTANLARVAMGS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQ++S+   K    +Y    +  +L    SS V+GF     M+P DV++TRM NQ    
Sbjct: 182 STQMASFAACKDFFTQYEIFRESVVLTAIASSSVAGFFTSVLMSPCDVVTTRMTNQGVSS 241

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
           +GKG LYKN  DCF+K  RAEGI G YKGF   Y+R+ PHT+L   F E ++ L+ +YT
Sbjct: 242 TGKGLLYKNIFDCFVKIYRAEGIHGMYKGFIPLYVRVAPHTVLNLTFWEFFKKLHDQYT 300



>gi|327285119|ref|XP_003227282.1| PREDICTED: solute carrier family 25 member 35-like [Anolis
           carolinensis]
          Length = 302

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 130/298 (43%), Positives = 176/298 (59%), Gaps = 3/298 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL R+   Y + YRN+F AFY I + +G+  
Sbjct: 3   FLLSGVAACGACLFTNPLEVVKTRMQLQGEL-RAPGTYTRHYRNVFHAFYTIGRVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +Q+GL  A  YQ   NG RLG Y  +  +     +    S   + ++G LAG+  A   S
Sbjct: 62  LQRGLMPALLYQFGFNGIRLGTYGMVETASYIHASDGRVSPLRTTVAGALAGAMAAIASS 121

Query: 154 PLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+YLVKT +Q+ S    A+GHQ+ ++  F AL  I KE     GL+RG  +++ R  VGS
Sbjct: 122 PIYLVKTHIQAQSAAEIAVGHQYQHQGMFHALTMIHKEHGIL-GLWRGAISSVPRVMVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQL+++   K    +      D+ LV   + +VS F V   M+PFDV STR+YNQ    
Sbjct: 181 ATQLATFSSAKEFFQRLEVFPKDSWLVALSAGMVSSFTVALAMSPFDVASTRLYNQPVGP 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
            G+G +YK  LDC  K +R+EG  G YKG GA Y RIGPHTIL+ +F  + R  Y ++
Sbjct: 241 EGQGLIYKGLLDCLAKIIRSEGFLGVYKGLGACYFRIGPHTILSLLFWNELRQNYARW 298



>gi|511833644|ref|XP_004741463.1| PREDICTED: solute carrier family 25 member 34 [Mustela putorius
           furo]
 gi|511929359|ref|XP_004783743.1| PREDICTED: solute carrier family 25 member 34 [Mustela putorius
           furo]
          Length = 304

 Score =  226 bits (576), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 171/303 (56%), Gaps = 11/303 (3%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y +PYR    +   +
Sbjct: 2   ETVAPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTYPRPYRGFLASVAAV 60

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAG 145
           V+ +G+ G+QKGL A   YQ +MNG R   Y     SL        T  P   +      
Sbjct: 61  VRADGLCGLQKGLAAGLLYQGLMNGVRFYCY-----SLAG--QAGLTQQPGGTVVAGAVA 113

Query: 146 SFGAA-IGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDA 203
               A +GSP YLVKT++Q+ +  A A+GHQH++++   AL  I +++    GL+RGV  
Sbjct: 114 GALGAFVGSPAYLVKTQLQAQTVAAMAVGHQHHHQSVLGALETIWRQQG-LAGLWRGVGG 172

Query: 204 AMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVIST 263
           A+ R  VGS  QL+++   K  V K   + +D+ LV     ++S   V   M PFDV+ST
Sbjct: 173 AVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSVAVAVVMTPFDVVST 232

Query: 264 RMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQY 323
           R+YNQ  D +G+G LY    DC +K  R EG    YKG G  YLR+GPHTIL+ +F ++ 
Sbjct: 233 RLYNQPVDGTGRGQLYGGLADCLVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDEL 292

Query: 324 RGL 326
           R L
Sbjct: 293 RKL 295



>gi|426384076|ref|XP_004058602.1| PREDICTED: solute carrier family 25 member 35 isoform 2 [Gorilla
           gorilla gorilla]
          Length = 300

 Score =  226 bits (576), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 179/296 (60%), Gaps = 5/296 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P  S  +G +AG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPSRSAAAGAMAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++ TF AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGTFQALTEIGQKHG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  +  +++++SG  V   M PFDV  TR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHT+L+  F +Q R LY
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTVLSLFFWDQLRSLY 295



>gi|391339564|ref|XP_003744118.1| PREDICTED: solute carrier family 25 member 35-like isoform 1
           [Metaseiulus occidentalis]
          Length = 347

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 133/318 (41%), Positives = 191/318 (60%), Gaps = 10/318 (3%)

Query: 21  KARAKETIKALPG----FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYR 76
           K R ++ ++   G    F++GG AA  A   TNP +VVKTR+QLQGEL ++  +Y   YR
Sbjct: 7   KVRPQQKVRKDQGIVMEFVLGGVAAAGAGFLTNPLDVVKTRIQLQGEL-QNRGSYKVHYR 65

Query: 77  NIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTS-STSMP 135
           N   A YVI K++G+  +Q G+G A  +Q VMNG RLG Y  I +S E   ++  S   P
Sbjct: 66  NTLHACYVIAKHDGLMALQSGIGPALWFQFVMNGTRLGCYS-IMDSFELTRSSDGSLCFP 124

Query: 136 ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYF 194
            +++ G L+G+ G+   SPLYLVKT++QS S +  A+G QH + N   A   I ++E +F
Sbjct: 125 KTVVCGALSGAMGSFFASPLYLVKTQIQSRSLSEIAVGFQHQHSNMSQAFVSIYRKEGFF 184

Query: 195 KGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFT 254
             L+RG +AAM+R   GS  QLS++  I+  +I+   M+    L    +S  +G  +C  
Sbjct: 185 -ALWRGANAAMVRVSAGSAIQLSTFSNIRDKIIENETMAHYPNLATLAASFFAGIGLCLV 243

Query: 255 MNPFDVISTRMYNQKADQ-SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHT 313
           M PFDV+ TR+YNQ  D  + +G  Y   LDCF+K  + EG +GFYKG GA Y+R+GPHT
Sbjct: 244 MTPFDVVCTRLYNQGLDPVTKRGLFYSGLLDCFVKMFKTEGCWGFYKGVGASYIRLGPHT 303

Query: 314 ILTFVFLEQYRGLYIKYT 331
           +LT +F    +  Y K T
Sbjct: 304 MLTMMFWVNLKEQYAKLT 321



>gi|471378956|ref|XP_004377279.1| PREDICTED: solute carrier family 25 member 34 [Trichechus manatus
           latirostris]
          Length = 304

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 174/302 (57%), Gaps = 9/302 (2%)

Query: 26  ETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVI 85
           ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y +PYR+   +   +
Sbjct: 2   ETVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QAPGTYPRPYRSFLASVVTV 60

Query: 86  VKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAG 145
            + +G+ G+QKGL A   YQ +MNG R   Y     + +   +       ++       G
Sbjct: 61  ARADGLWGLQKGLAAGLLYQGLMNGVRFYCYS---LACQAGLSQQPGGTVLAGAMAGAVG 117

Query: 146 SFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAA 204
           +F   +GSP YLVKT++Q+ +  A A+GHQH++++   AL  I +++    GL+RGV  A
Sbjct: 118 AF---VGSPAYLVKTQLQAQTVAAMAVGHQHHHQSVLGALETIWRQQG-LAGLWRGVGGA 173

Query: 205 MIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTR 264
           + R  VGS  QL+++   K  V +   + +D+ LV     ++S   V   M PFDV+STR
Sbjct: 174 VPRVMVGSAAQLATFASAKAWVQERQWLPEDSWLVALAGGMISSIAVAAVMTPFDVVSTR 233

Query: 265 MYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYR 324
           +YNQ  D++G+G LY    DC +K  R EG    YKG G  YLR+GPHTIL+ +F ++ R
Sbjct: 234 LYNQPVDRAGRGQLYGGLADCLVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELR 293

Query: 325 GL 326
            L
Sbjct: 294 KL 295



>gi|380010913|ref|XP_003689560.1| PREDICTED: solute carrier family 25 member 35-like, partial [Apis
           florea]
          Length = 306

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 183/301 (60%), Gaps = 9/301 (2%)

Query: 32  PG--FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNE 89
           PG  F+IGG AA  A  FTNP +V+K RLQLQGEL  +   Y K Y+N   A Y+I K+E
Sbjct: 4   PGIEFVIGGLAAVGAGFFTNPIDVIKVRLQLQGEL-EARRTYKKIYKNTLHAGYLIAKHE 62

Query: 90  GVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI--SMLSGFLAGSF 147
           G+  +Q G+  A  +Q+V+NG RLG Y+  +   E   N S  +  I  +M++G  AG  
Sbjct: 63  GICALQAGIIPALYFQVVLNGIRLGIYNTAKK-YELITNDSGNTDIIKTAMVTG-TAGCI 120

Query: 148 GAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMI 206
           GA +GSP Y++KT++Q+ S  + A+G+QHNY  T+ A   + KE      L+RG  A + 
Sbjct: 121 GAVLGSPFYMIKTQLQAQSAQSIAVGYQHNYLGTWYAFKSLWKEGG-IVALYRGWYAGIP 179

Query: 207 RTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMY 266
           R  +GS TQL+++      +      ++  IL+   +S++ G CV FT+ PFDV++TR+Y
Sbjct: 180 RIFIGSATQLTTFDLAADWLRSSQVFTNQPILLTFFASVIGGSCVAFTIQPFDVLATRLY 239

Query: 267 NQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
           NQ+ D  GKG+LY   LD F+K +R EG+ G YKG    ++RI PHT+L  VF E+   L
Sbjct: 240 NQRIDVEGKGTLYNGLLDAFVKIVRTEGLIGLYKGIFPTWMRIAPHTVLCLVFYEKLDQL 299

Query: 327 Y 327
           Y
Sbjct: 300 Y 300



>gi|336271373|ref|XP_003350445.1| hypothetical protein SMAC_02158 [Sordaria macrospora k-hell]
 gi|380090967|emb|CCC11500.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 282

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 167/291 (57%), Gaps = 38/291 (13%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +S+S+    YR       VIV+NEG+ G
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QSSSSSPHFYRGPIHGVSVIVRNEGLGG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK-FFNTSST-SMPISMLSGFLAGSFGAAI 151
           I +G+G AY YQ+++NG RLGFY+P+R++L    FN + T ++ I+M  G  +G  GA  
Sbjct: 67  IYRGIGCAYIYQILLNGCRLGFYEPMRHTLATTLFNDAKTQNLGINMFCGAASGIMGAMA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +L KTR+QS+S F  +G QH YKN +D L KI K E       RG+          
Sbjct: 127 GSPFFLAKTRLQSFSPFLPVGTQHQYKNAWDGLTKIYKGEG-----VRGL---------- 171

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
                         ++K+ GM +   L H  SS  SGF VC  M+P D I +R+YNQ   
Sbjct: 172 -------------RLVKHLGMEEGPAL-HLASSTASGFVVCVVMHPPDTIMSRLYNQN-- 215

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQ 322
               G+LYK   DC  KT+R EG F  YKG   H  RI PHTILT    EQ
Sbjct: 216 ----GNLYKGVFDCLAKTIRTEGFFAIYKGVIPHLTRILPHTILTLSLAEQ 262



>gi|355691876|gb|EHH27061.1| hypothetical protein EGK_17170 [Macaca mulatta]
          Length = 318

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 175/312 (56%), Gaps = 12/312 (3%)

Query: 19  ANKARAKETIKALP---GFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPY 75
           A KA   E ++ +P     ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y +PY
Sbjct: 6   AQKATGVEAVETVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGEL-QARGTYPQPY 64

Query: 76  RNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP 135
           R    +   + + +G+ G+QKGL A   YQ +MNG R   Y     + +           
Sbjct: 65  RGFMASVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYS---LACQAGLTQQPGGTV 121

Query: 136 ISMLSGFLAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYF 194
           ++       G+F   +GSP YL+KT++Q+ +  A A+GHQHN++    AL  I +++   
Sbjct: 122 VAGAVAGALGAF---VGSPAYLIKTQLQAQTVAAMAVGHQHNHQTVLGALETIWRQQGLL 178

Query: 195 KGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFT 254
            GL++GV  A+ R  VGS  QL+++   K  V K   + +D+ LV     ++S   V   
Sbjct: 179 -GLWQGVGGAVPRVMVGSAAQLATFTSAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVA 237

Query: 255 MNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTI 314
           M PFDV+STR+YNQ  D++G+G LY    DC +K  R EG    YKG    YLR+GPHTI
Sbjct: 238 MTPFDVVSTRLYNQPVDRAGRGQLYGGLTDCMVKIWRQEGPLALYKGLAPAYLRLGPHTI 297

Query: 315 LTFVFLEQYRGL 326
           L+ +F ++ R L
Sbjct: 298 LSMLFWDELRKL 309



>gi|391339566|ref|XP_003744119.1| PREDICTED: solute carrier family 25 member 35-like isoform 2
           [Metaseiulus occidentalis]
          Length = 326

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 176/288 (61%), Gaps = 6/288 (2%)

Query: 47  FTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQL 106
            TNP +VVKTR+QLQGEL ++  +Y   YRN   A YVI K++G+  +Q G+G A  +Q 
Sbjct: 16  LTNPLDVVKTRIQLQGEL-QNRGSYKVHYRNTLHACYVIAKHDGLMALQSGIGPALWFQF 74

Query: 107 VMNGARLGFYDPIRNSLEKFFNTS-STSMPISMLSGFLAGSFGAAIGSPLYLVKTRMQSY 165
           VMNG RLG Y  I +S E   ++  S   P +++ G L+G+ G+   SPLYLVKT++QS 
Sbjct: 75  VMNGTRLGCYS-IMDSFELTRSSDGSLCFPKTVVCGALSGAMGSFFASPLYLVKTQIQSR 133

Query: 166 S-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKR 224
           S +  A+G QH + N   A   I ++E +F  L+RG +AAM+R   GS  QLS++  I+ 
Sbjct: 134 SLSEIAVGFQHQHSNMSQAFVSIYRKEGFF-ALWRGANAAMVRVSAGSAIQLSTFSNIRD 192

Query: 225 SVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ-SGKGSLYKNTL 283
            +I+   M+    L    +S  +G  +C  M PFDV+ TR+YNQ  D  + +G  Y   L
Sbjct: 193 KIIENETMAHYPNLATLAASFFAGIGLCLVMTPFDVVCTRLYNQGLDPVTKRGLFYSGLL 252

Query: 284 DCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
           DCF+K  + EG +GFYKG GA Y+R+GPHT+LT +F    +  Y K T
Sbjct: 253 DCFVKMFKTEGCWGFYKGVGASYIRLGPHTMLTMMFWVNLKEQYAKLT 300



>gi|242021883|ref|XP_002431372.1| mitochondrial 2-oxoglutarate/malate carrier protein, putative
           [Pediculus humanus corporis]
 gi|212516648|gb|EEB18634.1| mitochondrial 2-oxoglutarate/malate carrier protein, putative
           [Pediculus humanus corporis]
          Length = 322

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 179/293 (61%), Gaps = 6/293 (2%)

Query: 37  GGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRGIQK 96
           G  A   A  FTNP +VVKTR+QLQGEL ++  ++V  Y+N  QAFYVI K EG+  +QK
Sbjct: 6   GAMAGVMAGCFTNPLDVVKTRMQLQGEL-KARGHHVVHYKNTLQAFYVIAKTEGIVSLQK 64

Query: 97  GLGAAYAYQLVMNGARLGFYDPIRN-SLEKFFNTSSTSMPISMLSGFLAGSFGAAIGSPL 155
           G+  A  +Q+ +NG RLG +D  +     K  N        +++S   +G  G+  GSP 
Sbjct: 65  GIVPALWFQVFLNGIRLGSFDIAQKLGWTKNKNNEVNVFKTAIVSA-CSGCLGSFTGSPF 123

Query: 156 YLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGSCT 214
           YLVK   QS++ +  A+G+QH +  T  AL  I K E   +GL+RG  +++ R GVGS  
Sbjct: 124 YLVKIHYQSHAASQIAVGYQHTHTGTLSALKNIFKAEG-VRGLWRGSLSSLPRVGVGSSI 182

Query: 215 QLSSYFFIKRSVIKYSGMSDDNILVHALS-SLVSGFCVCFTMNPFDVISTRMYNQKADQS 273
           QLS++   K  +  Y  +S +  L ++ + S++ G  V   + PFDVI TR+YNQ  D++
Sbjct: 183 QLSTFSTAKEFLENYKLLSKEKSLWNSFAASMLCGVAVATAITPFDVIQTRLYNQGVDKN 242

Query: 274 GKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGL 326
           GKG LY   +DCFIK  + EGI GF+KGFG  YLRIGPH++LT VF + ++ L
Sbjct: 243 GKGLLYNGIIDCFIKMSKTEGILGFFKGFGPCYLRIGPHSLLTLVFWDIFKKL 295



>gi|91091346|ref|XP_972193.1| PREDICTED: similar to predicted protein [Tribolium castaneum]
          Length = 300

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 174/298 (58%), Gaps = 3/298 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+I G AA  A  FTNP EV+KTR+QLQGEL  +   Y   YRNI  A Y I K+EG   
Sbjct: 3   FIIAGVAAVGAGFFTNPLEVLKTRMQLQGEL-HAKGQYTVHYRNIIHASYTIAKHEGFLS 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL  A   Q ++NG RLG Y  + +      +   T    S+L+G + G  G    S
Sbjct: 62  LQKGLSPALWVQFILNGVRLGIYQSLEDRGLILNSEGGTVFYKSVLAGGVGGVAGQIACS 121

Query: 154 PLYLVKTRMQSY-STFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P++LVKT +Q+  S   A+G QH ++   + L +I  EE+  KGLFRG  A++ R  VGS
Sbjct: 122 PVFLVKTHLQTQGSENIAVGFQHKHRGMVEGL-RIIFEEQGIKGLFRGAGASIPRAFVGS 180

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            +QL+S+ + K  + +Y   SD  +L     S+V G  +   M PFD+I TR+YNQ  D 
Sbjct: 181 TSQLTSFKYSKEFLNQYDYFSDKPLLTSFCGSMVGGVAISVMMTPFDLIMTRLYNQPVDP 240

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKY 330
            GKG LY N  DC IK  + EG+  FYKG G  YLR+GPHT+L  VF ++ + LY K+
Sbjct: 241 QGKGLLYANYFDCVIKIFKTEGVSAFYKGVGPMYLRLGPHTVLCLVFWDELKRLYDKF 298



>gi|170031030|ref|XP_001843390.1| mitochondrial oxaloacetate transport protein [Culex
           quinquefasciatus]
 gi|167868870|gb|EDS32253.1| mitochondrial oxaloacetate transport protein [Culex
           quinquefasciatus]
          Length = 302

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 174/299 (58%), Gaps = 2/299 (0%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+GG ++C AV FTNP++V+KTR QL+GEL   +    + YR   Q+   ++K++GVRG
Sbjct: 3   FLLGGLSSCCAVLFTNPFDVLKTRQQLEGELQARSKVGARAYRGFRQSVISVIKSDGVRG 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGFLAGSFGAAIGS 153
           +QKGL AA  YQ  MN  RLG Y  + N        +  S  +S+  G  AG   + +  
Sbjct: 63  LQKGLPAAVLYQFSMNSIRLGTYQTVDNLGWTKSENALLSPVLSVFWGGFAGVISSTVSC 122

Query: 154 PLYLVKTRMQSYSTFAAIGH-QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVGS 212
           P+Y+VKT++Q+ S+ +     QH ++ T DA   I K     +GL+RG  A M R  +GS
Sbjct: 123 PVYVVKTQLQAVSSGSYTAKFQHRHRGTVDAFVSIYKSSG-VRGLYRGYTANMARVSLGS 181

Query: 213 CTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKADQ 272
            TQ++S+   K    +Y    +  +L    SS V+GF     M+P DV++TRM NQ   +
Sbjct: 182 STQMASFAACKDFFTQYELFRESVVLTALASSTVAGFFTSVLMSPCDVVTTRMTNQGLSE 241

Query: 273 SGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLYIKYT 331
           SGKG LY+N  DCF+K  RAEG+ G YKGF   Y R+ PHT+L   F E ++ LY  Y+
Sbjct: 242 SGKGLLYRNIFDCFVKIYRAEGLHGLYKGFVPLYARVAPHTVLNLTFWEFFKKLYDSYS 300



>gi|121942600|sp|Q3KQZ1.1|S2535_HUMAN RecName: Full=Solute carrier family 25 member 35
 gi|77415333|gb|AAI05996.1| SLC25A35 protein [Homo sapiens]
 gi|119610468|gb|EAW90062.1| solute carrier family 25, member 35, isoform CRA_a [Homo sapiens]
          Length = 300

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 178/296 (60%), Gaps = 5/296 (1%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+ G AAC A  FTNP EVVKTR+QLQGEL ++   Y + YRN+F AF  I K +G+  
Sbjct: 3   FLMSGLAACGACVFTNPLEVVKTRMQLQGEL-QAPGTYQRHYRNVFHAFITIGKVDGLAA 61

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPI-SMLSGFLAGSFGAAIG 152
           +QKGL  A  YQ +MNG RLG Y  +  +         T  P  S  +G +AG  GA +G
Sbjct: 62  LQKGLAPALLYQFLMNGIRLGTYG-LAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLG 120

Query: 153 SPLYLVKTRMQSYS-TFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           SP+Y+VKT +Q+ + +  A+GHQ+ ++  F AL +I ++     GL+RG    + R  VG
Sbjct: 121 SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHG-LVGLWRGALGGLPRVIVG 179

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYNQKAD 271
           S TQL ++   K  + ++      +  +  +++++SG  V   M PFDV  TR+YNQ  D
Sbjct: 180 SSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTD 239

Query: 272 QSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
             GKG +Y+  LD  ++T R EGIFG YKG GA Y R+GPHTIL+  F +Q R LY
Sbjct: 240 AQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLY 295



>gi|347963462|ref|XP_310872.5| AGAP000253-PA [Anopheles gambiae str. PEST]
 gi|333467188|gb|EAA06438.6| AGAP000253-PA [Anopheles gambiae str. PEST]
          Length = 313

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 128/313 (40%), Positives = 186/313 (59%), Gaps = 18/313 (5%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYV-----------KPYRNIFQAF 82
           FL+GG AA  A  F+NP++V+KTR QL GEL +  S               PY ++ ++F
Sbjct: 3   FLLGGCAATCAGFFSNPFDVIKTRQQLHGELLQRTSGAPATTTTTTTPASNPYSSVVRSF 62

Query: 83  YVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMPISMLSGF 142
             I+++EGV G+QKGL +A A+Q  MN  RLG Y    N       + + ++  S+  G 
Sbjct: 63  RSILRSEGVLGLQKGLVSALAFQFAMNSVRLGIYQTAENCEWTRGASPAGTLLRSIGWGG 122

Query: 143 LAGSFGAAIGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISKEERYFKGLFRGV 201
           L+G  G+ +  P Y+VKT++Q+ S    A+G+QH +  T  AL  I +E R  +GL+RG 
Sbjct: 123 LSGVIGSTVACPFYMVKTQIQARSHGKYAVGYQHRHTGTLAALTGIYRE-RGIRGLWRGY 181

Query: 202 DAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALS-SLVSGFCVCFTMNPFDV 260
              + RT VGS  QL+++   K    ++   + D++ V+A + S+VSGF  C  M+PFDV
Sbjct: 182 PGIVTRTAVGSSAQLATFSTCKDLFGQFE-WARDSVAVNAFAASMVSGFFTCVFMSPFDV 240

Query: 261 ISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFL 320
           I+TR++NQ  D +G+G LY++  DCF KTLR EG+ G YKGF  +Y RI PHTIL   F 
Sbjct: 241 IATRLFNQGVDANGRGLLYRSVADCFTKTLRTEGLHGLYKGFVPNYWRIAPHTILNLTFW 300

Query: 321 EQ---YRGLYIKY 330
           +Q   +R LY  Y
Sbjct: 301 DQFKAWRDLYYGY 313



>gi|301772098|ref|XP_002921464.1| PREDICTED: solute carrier family 25 member 34-like [Ailuropoda
           melanoleuca]
          Length = 318

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 178/317 (56%), Gaps = 11/317 (3%)

Query: 12  SVNQQTTANKARAKETIKALPGFLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNY 71
           S+ +   A+   A ET+      ++G +A C A  FTNP EVVKTRLQLQGEL ++   Y
Sbjct: 2   SLTRALPASGTEAMETVAPAVDLVLGASACCLACIFTNPLEVVKTRLQLQGEL-QARGTY 60

Query: 72  VKPYRNIFQAFYVIVKNEGVRGIQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSS 131
            +PYR    +   +V+ +G+ G+QKGL A   YQ +MNG R   Y     SL        
Sbjct: 61  RRPYRGFVASIAAVVRADGLCGLQKGLAAGLLYQGLMNGVRFYCY-----SLAG--QAGL 113

Query: 132 TSMPISMLSGFLAGSFGAA-IGSPLYLVKTRMQSYSTFA-AIGHQHNYKNTFDALHKISK 189
           T +P   L          A +GSP YLVKT++Q+ +  A A+GHQH++++   AL  I +
Sbjct: 114 TQLPGGTLVAGAVAGALGAFVGSPAYLVKTQLQAQTVAAMAVGHQHHHQSVLGALETIWR 173

Query: 190 EERYFKGLFRGVDAAMIRTGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGF 249
           ++    GL+RGV  A+ R  VGS  QL+++   K  V +   + +D+ LV     ++S  
Sbjct: 174 QQG-LMGLWRGVGGAVPRVMVGSAAQLATFASAKAWVQERQWLPEDSWLVALAGGMISSV 232

Query: 250 CVCFTMNPFDVISTRMYNQKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRI 309
            V   M PFDV+STR+YNQ  D +G+G LY    DC +K  R EG    YKG G  YLR+
Sbjct: 233 AVAAVMTPFDVVSTRLYNQPVDGTGRGLLYGGLADCLVKIWRQEGPLALYKGLGPAYLRL 292

Query: 310 GPHTILTFVFLEQYRGL 326
           GPHTIL+ +F ++ R L
Sbjct: 293 GPHTILSMLFWDELRKL 309



>gi|500262142|gb|EOO04413.1| putative mitochondrial oxaloacetate transport protein [Togninia
           minima UCRPA7]
          Length = 241

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 151/226 (66%), Gaps = 5/226 (2%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           F+ GG AAC AVT T+P+E VK R+QLQGEL +   +    YR  F    VI++NEGVRG
Sbjct: 8   FIAGGIAACGAVTATHPFETVKIRMQLQGEL-QDKGHQPHHYRGPFHGVSVIIRNEGVRG 66

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEK--FFNTSSTSMPISMLSGFLAGSFGAAI 151
           I +GLG AY YQ+++NG RLGFY+P+R +L    F +    S+ I+ML G  +G  GAA 
Sbjct: 67  IYRGLGTAYIYQVLLNGCRLGFYEPMRKTLSNLIFKDEKVQSLGINMLCGASSGIIGAAA 126

Query: 152 GSPLYLVKTRMQSYSTFAAIGHQHNYKNTFDALHKISKEERYFKGLFRGVDAAMIRTGVG 211
           GSP +LVKTR+QSYS F  +G QH Y+N +D L +I K E   +GL+RGV AAMIRTG G
Sbjct: 127 GSPFFLVKTRLQSYSPFLPVGTQHKYRNAWDGLSQIYKGEGP-RGLYRGVGAAMIRTGFG 185

Query: 212 SCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNP 257
           S  QL +YFF KR ++K+ GM +   L H  SS  SGF VC  M+P
Sbjct: 186 SSVQLPTYFFAKRRLVKHLGMEEGPAL-HLTSSACSGFVVCVFMHP 230



>gi|158285973|ref|XP_308547.4| AGAP007255-PA [Anopheles gambiae str. PEST]
 gi|157020247|gb|EAA04077.4| AGAP007255-PA [Anopheles gambiae str. PEST]
          Length = 304

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 177/303 (58%), Gaps = 11/303 (3%)

Query: 34  FLIGGAAACSAVTFTNPWEVVKTRLQLQGELTRSNSNYVKPYRNIFQAFYVIVKNEGVRG 93
           FL+GGA++  AV FTNP++V+KTR QL+GEL    +   + Y+ I Q+   +V+ +G+RG
Sbjct: 3   FLLGGASSMCAVLFTNPFDVLKTRQQLEGELIAKQNLKERAYKGIRQSVLTVVRTDGLRG 62

Query: 94  IQKGLGAAYAYQLVMNGARLGFYDPIRNSLEKFFNTSSTSMP-----ISMLSGFLAGSFG 148
           +QKGL AA  YQ  MNG RLG Y     + E    T STS P     +S+  G  AG   
Sbjct: 63  LQKGLPAALLYQFSMNGVRLGTYQ----TAENLGWTKSTSNPSLTPLLSVFWGGCAGLAS 118

Query: 149 AAIGSPLYLVKTRMQSYSTFAAIGH-QHNYKNTFDALHKISKEERYFKGLFRGVDAAMIR 207
           A    P Y+VKT++Q+ ++ +     QH++  T  A   I ++    +GLFRG  A + R
Sbjct: 119 ATASCPFYVVKTQLQAVTSGSYTARFQHHHSGTLSAFVNIYRQSG-VRGLFRGYTATLAR 177

Query: 208 TGVGSCTQLSSYFFIKRSVIKYSGMSDDNILVHALSSLVSGFCVCFTMNPFDVISTRMYN 267
             VGS  Q+SS+   K   ++Y    +  +L    SS V+GF     M+P DV++TRM N
Sbjct: 178 LVVGSSVQMSSFSACKEFFLRYQVFQESIVLTALASSTVAGFLTSVLMSPCDVVTTRMTN 237

Query: 268 QKADQSGKGSLYKNTLDCFIKTLRAEGIFGFYKGFGAHYLRIGPHTILTFVFLEQYRGLY 327
           Q    +GKG LY N  DCF+K  R+EGI G+YKGF   YLR+ PHT+L   F E ++GL+
Sbjct: 238 QAVSANGKGLLYTNIFDCFLKIYRSEGIHGYYKGFVPMYLRVAPHTMLNLTFWEFFKGLH 297

Query: 328 IKY 330
            +Y
Sbjct: 298 DRY 300