BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp1012_c0_seq1-m.48 complete 179-586(+) 136 (+)
         (135 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|50425123|ref|XP_461153.1| DEHA2F18282p [Debaryomyces hansenii...   162   3e-38   Debaryomyces hansenii CBS767
gi|126140258|ref|XP_001386651.1| hypothetical protein PICST_3716...   159   2e-37   Scheffersomyces stipitis CBS 6054
gi|378731839|gb|EHY58298.1| histone H2A [Exophiala dermatitidis ...   159   2e-37   Exophiala dermatitidis NIH/UT8656
gi|361128085|gb|EHL00038.1| putative Histone H2A [Glarea lozoyen...   159   3e-37   Glarea lozoyensis 74030
gi|511002667|gb|EPB84095.1| histone H2A.1 [Mucor circinelloides ...   158   4e-37   Mucor circinelloides f. circinelloides 1006PhL
gi|50554035|ref|XP_504426.1| YALI0E26477p [Yarrowia lipolytica] ...   158   5e-37   Yarrowia lipolytica CLIB122
gi|344301059|gb|EGW31371.1| histone H2A-1 [Spathaspora passalida...   158   5e-37   Spathaspora passalidarum NRRL Y-27907
gi|448106105|ref|XP_004200664.1| Piso0_003260 [Millerozyma farin...   157   7e-37   Millerozyma farinosa CBS 7064
gi|384501244|gb|EIE91735.1| histone H2A [Rhizopus delemar RA 99-...   157   7e-37   Rhizopus delemar RA 99-880
gi|406602987|emb|CCH45455.1| Histone H2A.1 [Wickerhamomyces cife...   157   7e-37   Wickerhamomyces ciferrii
gi|384492927|gb|EIE83418.1| histone H2A [Rhizopus delemar RA 99-...   157   7e-37   Rhizopus delemar RA 99-880
gi|146416185|ref|XP_001484062.1| histone H2A.2 [Meyerozyma guill...   157   8e-37   Meyerozyma guilliermondii ATCC 6260
gi|406862071|gb|EKD15123.1| histone H2A [Marssonina brunnea f. s...   157   1e-36   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|354543953|emb|CCE40675.1| hypothetical protein CPAR2_107100 [...   156   1e-36   Candida parapsilosis
gi|448518688|ref|XP_003867971.1| Hta2 histone H2A [Candida ortho...   156   2e-36   Candida orthopsilosis Co 90-125
gi|326491419|dbj|BAJ94187.1| predicted protein [Hordeum vulgare ...   156   2e-36   Hordeum vulgare subsp. vulgare [barley]
gi|261195777|ref|XP_002624292.1| histone H2A [Ajellomyces dermat...   156   2e-36   Blastomyces gilchristii SLH14081
gi|302916225|ref|XP_003051923.1| histone 2A [Nectria haematococc...   156   2e-36   Nectria haematococca mpVI 77-13-4
gi|154300254|ref|XP_001550543.1| histone H2A [Botryotinia fuckel...   155   2e-36   Botrytis cinerea B05.10
gi|115403023|ref|XP_001217588.1| histone H2A [Aspergillus terreu...   155   3e-36   Aspergillus terreus NIH2624
gi|380478327|emb|CCF43662.1| histone H2A [Colletotrichum higgins...   155   3e-36   Colletotrichum higginsianum
gi|68486742|ref|XP_712725.1| histone H2A [Candida albicans SC531...   155   3e-36   Candida albicans SC5314
gi|340931828|gb|EGS19361.1| hypothetical protein CTHT_0048200 [C...   155   3e-36   Chaetomium thermophilum var. thermophilum DSM 1495
gi|389637391|ref|XP_003716333.1| histone H2A [Magnaporthe oryzae...   155   4e-36   Magnaporthe oryzae 70-15
gi|402080179|gb|EJT75324.1| histone H2A [Gaeumannomyces graminis...   155   4e-36   Gaeumannomyces graminis var. tritici R3-111a-1
gi|225685093|gb|EEH23377.1| histone H2A [Paracoccidioides brasil...   155   4e-36   Paracoccidioides brasiliensis Pb03
gi|241953177|ref|XP_002419310.1| histone H2A.1, putative [Candid...   155   5e-36   Candida dubliniensis CD36
gi|146422613|ref|XP_001487242.1| histone H2A.2 [Meyerozyma guill...   155   5e-36   Meyerozyma guilliermondii ATCC 6260
gi|346326954|gb|EGX96550.1| histone H2A [Cordyceps militaris CM0...   154   5e-36   Cordyceps militaris CM01
gi|302404231|ref|XP_002999953.1| histone H2A [Verticillium albo-...   154   5e-36   Verticillium alfalfae VaMs.102
gi|449303629|gb|EMC99636.1| hypothetical protein BAUCODRAFT_3000...   154   5e-36   Baudoinia panamericana UAMH 10762
gi|226294407|gb|EEH49827.1| histone H2a [Paracoccidioides brasil...   154   6e-36   Paracoccidioides brasiliensis Pb18
gi|50309449|ref|XP_454732.1| hypothetical protein [Kluyveromyces...   154   6e-36   Kluyveromyces lactis NRRL Y-1140
gi|470316710|gb|EMR08456.1| hypothetical protein PNEG_03286 [Pne...   154   6e-36   Pneumocystis murina B123
gi|90101337|sp|Q4HTT1.3|H2A_GIBZE RecName: Full=Histone H2A >gi|...   154   6e-36   Fusarium graminearum PH-1
gi|470316711|gb|EMR08457.1| hypothetical protein, variant [Pneum...   154   6e-36   
gi|440638441|gb|ELR08360.1| hypothetical protein GMDG_03155 [Geo...   154   7e-36   Pseudogymnoascus destructans 20631-21
gi|295657173|ref|XP_002789158.1| histone H2a [Paracoccidioides s...   154   7e-36   Paracoccidioides lutzii Pb01
gi|156630815|sp|Q2HH37.2|H2A_CHAGB RecName: Full=Histone H2A          154   7e-36   Chaetomium globosum CBS 148.51
gi|154281227|ref|XP_001541426.1| histone H2A [Ajellomyces capsul...   154   7e-36   Histoplasma capsulatum NAm1
gi|485922812|gb|EOD48140.1| putative histone h2a protein [Neofus...   154   7e-36   Neofusicoccum parvum UCRNP2
gi|512187912|gb|EPE03688.1| histone h2a [Ophiostoma piceae UAMH ...   154   8e-36   Ophiostoma piceae UAMH 11346
gi|471570461|gb|EMR69571.1| putative histone h2a protein [Eutypa...   154   8e-36   Eutypa lata UCREL1
gi|85092526|ref|XP_959442.1| histone H2A [Neurospora crassa OR74...   154   8e-36   Neurospora crassa OR74A
gi|367032274|ref|XP_003665420.1| histone H2A-like protein [Mycel...   154   8e-36   Myceliophthora thermophila ATCC 42464
gi|158327647|emb|CAO81988.1| histone H2A-EYFP fusion protein [Re...   154   9e-36   Reporter vector pYH2A
gi|50292561|ref|XP_448713.1| hypothetical protein [Candida glabr...   154   9e-36   Candida glabrata CBS 138
gi|453080983|gb|EMF09033.1| histone-fold-containing protein [Myc...   154   9e-36   Sphaerulina musiva SO2202
gi|67526021|ref|XP_661072.1| H2A_EMENI Histone H2A [Aspergillus ...   154   9e-36   Aspergillus nidulans FGSC A4
gi|452837993|gb|EME39934.1| histone H2A like protein [Dothistrom...   154   9e-36   Dothistroma septosporum NZE10
gi|50421315|ref|XP_459207.1| DEHA2D16588p [Debaryomyces hansenii...   154   9e-36   Debaryomyces hansenii CBS767
gi|407917426|gb|EKG10735.1| Histone H2A [Macrophomina phaseolina...   154   9e-36   Macrophomina phaseolina MS6
gi|126137898|ref|XP_001385472.1| hypothetical protein PICST_7349...   154   9e-36   Scheffersomyces stipitis CBS 6054
gi|452977851|gb|EME77615.1| hypothetical protein MYCFIDRAFT_1682...   154   1e-35   Cercospora fijiensis CIRAD86
gi|367010072|ref|XP_003679537.1| hypothetical protein TDEL_0B019...   154   1e-35   Torulaspora delbrueckii
gi|310801860|gb|EFQ36753.1| histone H2A [Glomerella graminicola ...   154   1e-35   Colletotrichum graminicola M1.001
gi|429850315|gb|ELA25603.1| histone h2a [Colletotrichum gloeospo...   154   1e-35   Colletotrichum gloeosporioides Nara gc5
gi|242814596|ref|XP_002486399.1| histone H2A [Talaromyces stipit...   154   1e-35   Talaromyces stipitatus ATCC 10500
gi|119493438|ref|XP_001263909.1| histone h2a [Neosartorya fische...   154   1e-35   Aspergillus fischeri NRRL 181
gi|344230055|gb|EGV61940.1| histone-fold-containing protein [Can...   154   1e-35   Candida tenuis ATCC 10573
gi|212545084|ref|XP_002152696.1| histone H2A [Talaromyces marnef...   154   1e-35   Talaromyces marneffei ATCC 18224
gi|149244632|ref|XP_001526859.1| histone H2A.1 [Lodderomyces elo...   153   1e-35   Lodderomyces elongisporus NRRL YB-4239
gi|50285877|ref|XP_445367.1| hypothetical protein [Candida glabr...   153   1e-35   Candida glabrata CBS 138
gi|3242067|emb|CAA07351.1| histone H2A [Botryotinia fuckeliana]       153   1e-35   Botrytis cinerea
gi|399164319|emb|CCE34763.1| H2A histone H2A [Claviceps purpurea...   153   1e-35   Claviceps purpurea 20.1
gi|358385635|gb|EHK23231.1| hypothetical protein TRIVIDRAFT_2157...   153   1e-35   Trichoderma virens Gv29-8
gi|358394270|gb|EHK43663.1| hypothetical protein TRIATDRAFT_3001...   153   1e-35   Trichoderma atroviride IMI 206040
gi|340518621|gb|EGR48861.1| histone H2A [Trichoderma reesei QM6a]     153   1e-35   Trichoderma reesei QM6a
gi|145245639|ref|XP_001395087.1| histone H2A [Aspergillus niger ...   153   1e-35   Aspergillus niger CBS 513.88
gi|444320878|ref|XP_004181095.1| hypothetical protein TBLA_0F003...   153   1e-35   Tetrapisispora blattae CBS 6284
gi|322701888|gb|EFY93636.1| histone H2A [Metarhizium acridum CQM...   153   1e-35   Metarhizium acridum CQMa 102
gi|169622769|ref|XP_001804793.1| hypothetical protein SNOG_14611...   153   1e-35   Parastagonospora nodorum SN15
gi|6319470|ref|NP_009552.1| Hta2p [Saccharomyces cerevisiae S288...   153   2e-35   Saccharomyces cerevisiae S288c
gi|365762073|gb|EHN03683.1| Hta1p [Saccharomyces cerevisiae x Sa...   152   2e-35   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|189091760|ref|XP_001929713.1| hypothetical protein [Podospora...   152   2e-35   Podospora anserina S mat+
gi|367006342|ref|XP_003687902.1| hypothetical protein TPHA_0L011...   152   2e-35   Tetrapisispora phaffii CBS 4417
gi|345562603|gb|EGX45670.1| hypothetical protein AOL_s00169g4 [A...   152   2e-35   Arthrobotrys oligospora ATCC 24927
gi|499142143|pdb|4JJN|C Chain C, Crystal Structure Of Heterochro...   152   2e-35   Saccharomyces cerevisiae S288c
gi|344304768|gb|EGW35000.1| histone H2A-1 [Spathaspora passalida...   152   2e-35   Spathaspora passalidarum NRRL Y-27907
gi|320588365|gb|EFX00834.1| histone h2a [Grosmannia clavigera kw...   152   3e-35   Grosmannia clavigera kw1407
gi|401626651|gb|EJS44577.1| hta2p [Saccharomyces arboricola H-6]      152   3e-35   Saccharomyces arboricola H-6
gi|260945501|ref|XP_002617048.1| histone H2A.2 [Clavispora lusit...   152   3e-35   Clavispora lusitaniae ATCC 42720
gi|323349249|gb|EGA83478.1| Hta1p [Saccharomyces cerevisiae Lalv...   152   3e-35   Saccharomyces cerevisiae Lalvin QA23
gi|403213609|emb|CCK68111.1| hypothetical protein KNAG_0A04360 [...   152   3e-35   Kazachstania naganishii CBS 8797
gi|344229095|gb|EGV60981.1| histone H2A.1 [Candida tenuis ATCC 1...   152   3e-35   Candida tenuis ATCC 10573
gi|328352153|emb|CCA38552.1| Histone H2A.1 [Komagataella pastori...   152   3e-35   Komagataella phaffii CBS 7435
gi|398366187|ref|NP_010511.3| Hta1p [Saccharomyces cerevisiae S2...   152   3e-35   Saccharomyces cerevisiae S288c
gi|171031|gb|AAA66318.1| histone H2A-1, partial [Saccharomyces c...   152   4e-35   Saccharomyces cerevisiae [brewer's yeast]
gi|254568444|ref|XP_002491332.1| One of two nearly identical (se...   152   4e-35   Komagataella phaffii GS115
gi|254577607|ref|XP_002494790.1| ZYRO0A09724p [Zygosaccharomyces...   152   4e-35   Zygosaccharomyces rouxii CBS 732
gi|15988134|pdb|1ID3|C Chain C, Crystal Structure Of The Yeast N...   151   4e-35   Saccharomyces cerevisiae [brewer's yeast]
gi|430812838|emb|CCJ29773.1| unnamed protein product [Pneumocyst...   151   5e-35   Pneumocystis jirovecii
gi|51701539|sp|Q74ZL4.3|H2A1_ASHGO RecName: Full=Histone H2A.1 >...   151   7e-35   Eremothecium gossypii ATCC 10895
gi|444323591|ref|XP_004182436.1| hypothetical protein TBLA_0I026...   150   7e-35   Tetrapisispora blattae CBS 6284
gi|403218013|emb|CCK72505.1| hypothetical protein KNAG_0K01430 [...   150   8e-35   Kazachstania naganishii CBS 8797
gi|254577153|ref|XP_002494563.1| ZYRO0A04422p [Zygosaccharomyces...   150   8e-35   Zygosaccharomyces rouxii CBS 732
gi|45190604|ref|NP_984858.1| AEL003Cp [Ashbya gossypii ATCC 1089...   150   9e-35   Eremothecium gossypii ATCC 10895
gi|45201280|ref|NP_986850.1| AGR184Wp [Ashbya gossypii ATCC 1089...   150   1e-34   Eremothecium gossypii ATCC 10895
gi|255731037|ref|XP_002550443.1| histone H2A.1 [Candida tropical...   150   1e-34   Candida tropicalis MYA-3404
gi|258566563|ref|XP_002584026.1| histone H2A [Uncinocarpus reesi...   150   1e-34   Uncinocarpus reesii 1704
gi|119195515|ref|XP_001248361.1| histone H2A [Coccidioides immit...   150   1e-34   Coccidioides immitis RS
gi|448082864|ref|XP_004195242.1| Piso0_005789 [Millerozyma farin...   150   1e-34   Millerozyma farinosa CBS 7064
gi|255718943|ref|XP_002555752.1| KLTH0G16522p [Lachancea thermot...   150   1e-34   Lachancea thermotolerans CBS 6340
gi|448087462|ref|XP_004196334.1| Piso0_005789 [Millerozyma farin...   150   1e-34   Millerozyma farinosa CBS 7064
gi|328774037|gb|EGF84074.1| hypothetical protein BATDEDRAFT_3643...   149   2e-34   Batrachochytrium dendrobatidis JAM81
gi|410077253|ref|XP_003956208.1| hypothetical protein KAFR_0C007...   149   2e-34   Kazachstania africana CBS 2517
gi|255715277|ref|XP_002553920.1| KLTH0E10208p [Lachancea thermot...   149   3e-34   Lachancea thermotolerans CBS 6340
gi|398390199|ref|XP_003848560.1| histone 2A [Zymoseptoria tritic...   149   3e-34   Zymoseptoria tritici IPO323
gi|154147097|emb|CAO81982.1| histone H2A [Sordaria macrospora]        148   5e-34   Sordaria macrospora
gi|296411541|ref|XP_002835489.1| hypothetical protein [Tuber mel...   148   5e-34   Tuber melanosporum Mel28
gi|331244552|ref|XP_003334916.1| histone H2A [Puccinia graminis ...   148   5e-34   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|335632373|gb|AEH58057.1| histone variant H2A.X [Mytilus gallo...   148   6e-34   Mytilus galloprovincialis
gi|331234809|ref|XP_003330063.1| histone H2A [Puccinia graminis ...   148   6e-34   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|90101566|sp|P02268.2|H2A_SEPOF RecName: Full=Histone H2A           148   6e-34   Sepia officinalis
gi|19115333|ref|NP_594421.1| histone H2A beta [Schizosaccharomyc...   148   6e-34   Schizosaccharomyces pombe 972h-
gi|340385511|ref|XP_003391253.1| PREDICTED: histone H2A-like [Am...   147   6e-34   Amphimedon queenslandica
gi|328774124|gb|EGF84161.1| hypothetical protein BATDEDRAFT_8166...   147   7e-34   Batrachochytrium dendrobatidis JAM81
gi|494828313|gb|EON65154.1| histone H2A [Coniosporium apollinis ...   147   8e-34   Coniosporium apollinis CBS 100218
gi|68441415|ref|XP_688798.1| PREDICTED: histone H2A-like [Danio ...   147   9e-34   Danio rerio [leopard danio]
gi|342319871|gb|EGU11816.1| Histone H2A [Rhodotorula glutinis AT...   147   9e-34   Rhodotorula toruloides ATCC 204091
gi|326669124|ref|XP_001920286.3| PREDICTED: histone H2A-like [Da...   147   1e-33   
gi|148227934|ref|NP_001083033.1| histone cluster 2, H2ab [Danio ...   147   1e-33   
gi|73611922|ref|NP_001026996.1| histone 2, H2a [Danio rerio] >gi...   147   1e-33   Danio rerio [leopard danio]
gi|66773151|ref|NP_001019567.1| histone 2, H2a [Danio rerio] >gi...   147   1e-33   Danio rerio [leopard danio]
gi|71896453|ref|NP_001025503.1| histone cluster 1, H2ad [Xenopus...   146   1e-33   Xenopus tropicalis [western clawed frog]
gi|512836618|ref|XP_004913865.1| PREDICTED: histone H2A type 1-l...   146   1e-33   
gi|358255301|dbj|GAA57014.1| histone H2A [Clonorchis sinensis]        146   2e-33   Clonorchis sinensis [oriental liver fluke]
gi|213404676|ref|XP_002173110.1| histone H2A beta [Schizosacchar...   146   2e-33   Schizosaccharomyces japonicus yFS275
gi|391340816|ref|XP_003744732.1| PREDICTED: histone H2A-like [Me...   146   2e-33   Metaseiulus occidentalis
gi|505755944|gb|EOR00125.1| Histone H2A-beta [Wallemia ichthyoph...   146   2e-33   Wallemia ichthyophaga EXF-994
gi|512865141|ref|XP_004917645.1| PREDICTED: histone H2A type 1-l...   146   2e-33   
gi|388579407|gb|EIM19731.1| histone 2A [Wallemia sebi CBS 633.66...   146   2e-33   Wallemia mellicola CBS 633.66
gi|301628333|ref|XP_002943319.1| PREDICTED: histone H2A type 1-l...   146   2e-33   Xenopus tropicalis [western clawed frog]
gi|301611035|ref|XP_002935049.1| PREDICTED: histone H2A.x-like [...   146   2e-33   Xenopus tropicalis [western clawed frog]
gi|391344251|ref|XP_003746415.1| PREDICTED: histone H2A-like, pa...   146   2e-33   Metaseiulus occidentalis
gi|505756902|gb|EOR01043.1| Histone H2A-beta [Wallemia ichthyoph...   146   2e-33   Wallemia ichthyophaga EXF-994
gi|301624220|ref|XP_002941404.1| PREDICTED: histone H2A type 1-l...   146   2e-33   Xenopus tropicalis [western clawed frog]
gi|512860300|ref|XP_004917046.1| PREDICTED: histone H2A type 1-l...   146   2e-33   
gi|391344255|ref|XP_003746417.1| PREDICTED: histone H2A-like [Me...   146   2e-33   Metaseiulus occidentalis
gi|391344346|ref|XP_003746462.1| PREDICTED: histone H2A-like [Me...   146   2e-33   Metaseiulus occidentalis
gi|512876553|ref|XP_004919104.1| PREDICTED: histone H2A type 1-l...   146   2e-33   Xenopus tropicalis [western clawed frog]
gi|512836759|ref|XP_004913893.1| PREDICTED: histone H2A type 1-l...   146   2e-33   Xenopus tropicalis [western clawed frog]
gi|158997657|gb|ABW86952.1| histone 2A [Aplysia californica]          146   2e-33   Aplysia californica
gi|350538747|ref|NP_001232892.1| uncharacterized protein LOC1000...   146   2e-33   Danio rerio [leopard danio]
gi|160420285|ref|NP_001086099.1| histone H2A.x [Xenopus laevis] ...   146   2e-33   
gi|225712296|gb|ACO11994.1| Histone H2A [Lepeophtheirus salmonis]     145   2e-33   Lepeophtheirus salmonis
gi|149245718|ref|XP_001527336.1| histone H2A.2 [Lodderomyces elo...   145   2e-33   Lodderomyces elongisporus NRRL YB-4239
gi|195443298|ref|XP_002069354.1| GK18709 [Drosophila willistoni]...   145   2e-33   Drosophila willistoni
gi|328699744|ref|XP_003241031.1| PREDICTED: histone H2A-like [Ac...   145   2e-33   Acyrthosiphon pisum
gi|125808587|ref|XP_001337024.1| PREDICTED: histone H2A-like [Da...   145   2e-33   Danio rerio [leopard danio]
gi|156544915|ref|XP_001600014.1| PREDICTED: histone H2A type 1 [...   145   3e-33   Nasonia vitripennis
gi|391344308|ref|XP_003746443.1| PREDICTED: histone H2A-like [Me...   145   3e-33   Metaseiulus occidentalis
gi|218931194|ref|NP_001136058.1| histone 2, H2a [Danio rerio] >g...   145   3e-33   Danio rerio [leopard danio]
gi|195365473|ref|XP_002045654.1| GM16110 [Drosophila sechellia] ...   145   3e-33   Drosophila sechellia
gi|125855709|ref|XP_687630.2| PREDICTED: histone H2A-like [Danio...   145   3e-33   
gi|51701467|sp|Q6WV66.3|H2A_MYTCA RecName: Full=Histone H2A >gi|...   145   3e-33   Mytilus californianus
gi|499009504|ref|XP_004556980.1| PREDICTED: histone H2A type 1-l...   145   3e-33   Maylandia zebra
gi|125820564|ref|XP_693579.2| PREDICTED: histone H2A-like [Danio...   145   3e-33   Danio rerio [leopard danio]
gi|339233032|ref|XP_003381633.1| histone H2A [Trichinella spiral...   145   3e-33   Trichinella spiralis
gi|209730326|gb|ACI66032.1| Histone H2A.x [Salmo salar] >gi|2236...   145   3e-33   Salmo salar
gi|68441439|ref|XP_689685.1| PREDICTED: histone H2A-like [Danio ...   145   3e-33   
gi|32401021|gb|AAP80716.1| histone H2A protein [Griffithsia japo...   145   3e-33   Griffithsia japonica
gi|301628158|ref|XP_002943225.1| PREDICTED: histone H2A type 1-l...   145   3e-33   Xenopus tropicalis [western clawed frog]
gi|52345546|ref|NP_001004821.1| histone cluster 1, H2aj [Xenopus...   145   3e-33   Xenopus tropicalis [western clawed frog]
gi|405962322|gb|EKC28012.1| Histone H2A [Crassostrea gigas] >gi|...   145   3e-33   Crassostrea gigas
gi|301628150|ref|XP_002943222.1| PREDICTED: histone H2A type 1-l...   145   3e-33   Xenopus tropicalis [western clawed frog]
gi|512876590|ref|XP_004919109.1| PREDICTED: histone H2A type 1-l...   145   3e-33   Xenopus tropicalis [western clawed frog]
gi|504179152|ref|XP_004598453.1| PREDICTED: histone H1.1-like [O...   145   3e-33   
gi|301623191|ref|XP_002940905.1| PREDICTED: histone H2A type 1-l...   145   3e-33   Xenopus tropicalis [western clawed frog]
gi|158298157|ref|XP_318363.4| AGAP003911-PA [Anopheles gambiae s...   145   3e-33   Anopheles gambiae str. PEST
gi|344238180|gb|EGV94283.1| Histone H2A type 1 [Cricetulus griseus]   145   4e-33   Cricetulus griseus [Chinese hamsters]
gi|147898582|ref|NP_001087948.1| histone cluster 1, H2aj [Xenopu...   145   4e-33   Xenopus laevis [clawed frog]
gi|410927072|ref|XP_003976990.1| PREDICTED: histone H2A-like [Ta...   145   4e-33   Takifugu rubripes [tiger puffer]
gi|395850569|ref|XP_003797855.1| PREDICTED: histone H2A.J-like [...   145   4e-33   
gi|187608002|ref|NP_001120117.1| histone cluster 1, H2ah [Xenopu...   145   4e-33   Xenopus tropicalis [western clawed frog]
gi|73535880|pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetra...   145   4e-33   Xenopus laevis [clawed frog]
gi|28948512|pdb|1M18|C Chain C, Ligand Binding Alters The Struct...   145   4e-33   Xenopus laevis [clawed frog]
gi|122004|sp|P02264.2|H2A_ONCMY RecName: Full=Histone H2A >gi|64...   145   4e-33   Oncorhynchus mykiss
gi|513158892|ref|XP_004937732.1| PREDICTED: histone H2A-IV-like ...   145   4e-33   Gallus gallus [bantam]
gi|68484777|ref|XP_713700.1| histone H2A [Candida albicans SC531...   145   4e-33   Candida albicans SC5314
gi|426398304|gb|AFY26295.1| histone H2A, partial [Plectorhinchus...   145   4e-33   Plectorhinchus mediterraneus
gi|157137721|ref|XP_001657149.1| histone h2a [Aedes aegypti] >gi...   145   4e-33   Aedes aegypti
gi|391344330|ref|XP_003746454.1| PREDICTED: uncharacterized prot...   145   4e-33   Metaseiulus occidentalis
gi|225713194|gb|ACO12443.1| Histone H2A [Lepeophtheirus salmonis...   145   4e-33   Lepeophtheirus salmonis
gi|149030603|gb|EDL85640.1| rCG51948 [Rattus norvegicus] >gi|149...   145   4e-33   Rattus norvegicus [brown rat]
gi|327266435|ref|XP_003218011.1| PREDICTED: histone H2A-like [An...   145   4e-33   Anolis carolinensis [Carolina anole]
gi|255683313|ref|NP_001157464.1| histone H2A [Acyrthosiphon pisu...   145   5e-33   Acyrthosiphon pisum
gi|301626032|ref|XP_002942196.1| PREDICTED: histone H2A type 1-l...   145   5e-33   
gi|512836670|ref|XP_004913875.1| PREDICTED: histone H2A type 1-l...   145   5e-33   Xenopus tropicalis [western clawed frog]
gi|410914848|ref|XP_003970899.1| PREDICTED: histone H2A type 1-l...   145   5e-33   Takifugu rubripes [tiger puffer]
gi|327266433|ref|XP_003218010.1| PREDICTED: histone H2A-like [An...   145   5e-33   Anolis carolinensis [Carolina anole]
gi|358255296|dbj|GAA57009.1| histone H2A [Clonorchis sinensis] >...   145   5e-33   Clonorchis sinensis [oriental liver fluke]
gi|499028371|ref|XP_004564912.1| PREDICTED: histone H2A-like [Ma...   145   5e-33   
gi|158298161|ref|XP_318365.3| AGAP003913-PA [Anopheles gambiae s...   145   5e-33   Anopheles gambiae str. PEST
gi|156536997|ref|XP_001608288.1| PREDICTED: histone H2A-like [Na...   145   5e-33   
gi|344238671|gb|EGV94774.1| Histone H3 [Cricetulus griseus]           145   5e-33   Cricetulus griseus [Chinese hamsters]
gi|195373575|ref|XP_002046022.1| GM18786 [Drosophila sechellia] ...   144   5e-33   Drosophila sechellia
gi|301623051|ref|XP_002940841.1| PREDICTED: histone H2A type 1-l...   144   5e-33   
gi|478524318|ref|XP_004436359.1| PREDICTED: core histone macro-H...   144   5e-33   
gi|78707122|ref|NP_001027366.1| histone H2A [Drosophila melanoga...   144   6e-33   Drosophila melanogaster
gi|391344261|ref|XP_003746420.1| PREDICTED: histone H3-like [Met...   144   6e-33   Metaseiulus occidentalis
gi|152012907|gb|AAI50452.1| Gng5 protein [Danio rerio]                144   6e-33   Danio rerio [leopard danio]
gi|195371634|ref|XP_002045932.1| GM19643 [Drosophila sechellia] ...   144   6e-33   Drosophila sechellia
gi|195092990|ref|XP_001997683.1| GH23503 [Drosophila grimshawi] ...   144   6e-33   Drosophila grimshawi
gi|157674605|gb|ABV60391.1| histone H2A [Artemia franciscana]         144   6e-33   Artemia franciscana
gi|110749621|ref|XP_001120186.1| PREDICTED: histone H2A-like [Ap...   144   6e-33   Apis mellifera [European honey bee]
gi|328791683|ref|XP_003251613.1| PREDICTED: histone H2A-like iso...   144   6e-33   Apis mellifera [European honey bee]
gi|110749634|ref|XP_001120346.1| PREDICTED: histone H2A-like [Ap...   144   6e-33   Apis mellifera [European honey bee]
gi|24585673|ref|NP_724343.1| histone H2A [Drosophila melanogaste...   144   6e-33   Drosophila melanogaster
gi|327283951|ref|XP_003226703.1| PREDICTED: histone H2A type 2-C...   144   6e-33   Anolis carolinensis [Carolina anole]
gi|336087638|emb|CBM82464.1| histone H2A.X-III protein, partial ...   144   6e-33   Balanoglossus clavigerus
gi|320583664|gb|EFW97877.1| histone H2A [Ogataea parapolymorpha ...   144   6e-33   
gi|148222886|ref|NP_001089684.1| histone H2A type 1 [Xenopus lae...   144   6e-33   Xenopus laevis [clawed frog]
gi|385301571|gb|EIF45752.1| histone h2a [Dekkera bruxellensis AW...   144   6e-33   Brettanomyces bruxellensis AWRI1499
gi|328863252|gb|EGG12352.1| hypothetical protein MELLADRAFT_5145...   144   6e-33   Melampsora larici-populina 98AG31
gi|212545086|ref|XP_002152697.1| histone H2A [Talaromyces marnef...   144   6e-33   Talaromyces marneffei ATCC 18224
gi|410933015|ref|XP_003979888.1| PREDICTED: histone H2A-like [Ta...   144   6e-33   
gi|410908727|ref|XP_003967842.1| PREDICTED: histone H2A-like [Ta...   144   7e-33   Takifugu rubripes [tiger puffer]
gi|156539055|ref|XP_001599770.1| PREDICTED: histone H2A-like [Na...   144   7e-33   
gi|156536941|ref|XP_001608227.1| PREDICTED: histone H2A-like [Na...   144   7e-33   Nasonia vitripennis
gi|47225209|emb|CAF98836.1| unnamed protein product [Tetraodon n...   144   7e-33   Tetraodon nigroviridis
gi|209156425|pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylat...   144   7e-33   Xenopus laevis [clawed frog]
gi|328862877|gb|EGG11977.1| hypothetical protein MELLADRAFT_5145...   144   7e-33   Melampsora larici-populina 98AG31
gi|260800612|ref|XP_002595192.1| hypothetical protein BRAFLDRAFT...   144   7e-33   Branchiostoma floridae
gi|817939|emb|CAA83210.1| histone H2A [Mus musculus domesticus]       144   7e-33   Mus musculus domesticus
gi|432843014|ref|XP_004065541.1| PREDICTED: histone H2A-like [Or...   144   7e-33   Oryzias latipes [Japanese rice fish]
gi|19075680|ref|NP_588180.1| histone H2A alpha [Schizosaccharomy...   144   7e-33   Schizosaccharomyces pombe 972h-
gi|71000767|ref|XP_755065.1| histone H2A [Aspergillus fumigatus ...   144   7e-33   Aspergillus fumigatus Af293
gi|54400432|ref|NP_001005967.1| histone 2, H2a [Danio rerio] >gi...   144   7e-33   Danio rerio [leopard danio]
gi|507112402|emb|CDF36085.1| Histone H2A [Chondrus crispus]           144   7e-33   Chondrus crispus [Irish moss]
gi|403302779|ref|XP_003942030.1| PREDICTED: histone H2A type 2-A...   144   7e-33   Saimiri boliviensis boliviensis
gi|348544205|ref|XP_003459572.1| PREDICTED: histone H2A-like [Or...   144   7e-33   Oreochromis niloticus
gi|158429126|pdb|2NQB|C Chain C, Drosophila Nucleosome Structure...   144   8e-33   Drosophila melanogaster
gi|301626427|ref|XP_002942386.1| PREDICTED: histone H2A type 1-l...   144   8e-33   Xenopus tropicalis [western clawed frog]
gi|465954614|gb|EMP26030.1| Histone H2A type 2-C [Chelonia mydas]     144   8e-33   Chelonia mydas [green seaturtle]
gi|483521794|gb|EOB06751.1| Histone H2A type 2-C, partial [Anas ...   144   8e-33   Anas platyrhynchos [duck]
gi|110764935|ref|XP_001119899.1| PREDICTED: histone H2A-like [Ap...   144   8e-33   Apis mellifera [European honey bee]
gi|194779416|ref|XP_001967880.1| GF22861 [Drosophila ananassae] ...   144   8e-33   Drosophila ananassae
gi|327285099|ref|XP_003227272.1| PREDICTED: histone H2A type 2-C...   144   8e-33   Anolis carolinensis [Carolina anole]
gi|297290289|ref|XP_001092924.2| PREDICTED: hypothetical protein...   144   8e-33   
gi|6686554|emb|CAB64684.1| putative H2A histone [Asellus aquaticus]   144   8e-33   Asellus aquaticus
gi|348527408|ref|XP_003451211.1| PREDICTED: histone H2A-like [Or...   144   8e-33   Oreochromis niloticus
gi|348522855|ref|XP_003448939.1| PREDICTED: histone H2A-like [Or...   144   8e-33   Oreochromis niloticus
gi|344275518|ref|XP_003409559.1| PREDICTED: histone H2A type 2-C...   144   8e-33   Loxodonta africana [African bush elephant]
gi|173404|gb|AAA35311.1| histone H2A-alpha [Schizosaccharomyces ...   144   8e-33   Schizosaccharomyces pombe
gi|322788651|gb|EFZ14252.1| hypothetical protein SINV_04585 [Sol...   144   8e-33   Solenopsis invicta [imported red fire ant]
gi|332245706|ref|XP_003271994.1| PREDICTED: histone H2A type 1-l...   144   8e-33   Nomascus leucogenys [White-cheeked Gibbon]
gi|432943836|ref|XP_004083294.1| PREDICTED: histone H2A-like [Or...   144   8e-33   Oryzias latipes [Japanese rice fish]
gi|391329466|ref|XP_003739194.1| PREDICTED: histone H2A-like [Me...   144   8e-33   Metaseiulus occidentalis
gi|156404302|ref|XP_001640346.1| predicted protein [Nematostella...   144   8e-33   Nematostella vectensis
gi|24638446|ref|NP_003508.1| histone H2A type 2-C [Homo sapiens]...   144   8e-33   Homo sapiens [man]
gi|194926827|ref|XP_001983087.1| GG16349 [Drosophila erecta] >gi...   144   8e-33   
gi|255032104|gb|ACT98859.1| histone H2A [Solen marginatus]            144   9e-33   Solen marginatus
gi|410929101|ref|XP_003977938.1| PREDICTED: histone H2A-like [Ta...   144   9e-33   Takifugu rubripes [tiger puffer]
gi|348542030|ref|XP_003458489.1| PREDICTED: histone H2A-like [Or...   144   9e-33   
gi|302564472|ref|NP_001180795.1| histone H2A.J [Macaca mulatta] ...   144   9e-33   Macaca mulatta [rhesus macaque]
gi|410958270|ref|XP_003985742.1| PREDICTED: histone H2A type 1-E...   144   9e-33   Felis catus [cat]
gi|195371155|ref|XP_002045914.1| GM13182 [Drosophila sechellia] ...   144   9e-33   Drosophila sechellia
gi|29553970|ref|NP_808760.1| histone H2A.J [Homo sapiens] >gi|11...   144   9e-33   Homo sapiens [man]
gi|483521767|gb|EOB06724.1| Histone H2A.J, partial [Anas platyrh...   144   9e-33   Anas platyrhynchos [duck]
gi|122008|sp|P19178.2|H2A_PLADU RecName: Full=Histone H2A >gi|98...   144   9e-33   Platynereis dumerilii
gi|256087707|ref|XP_002580006.1| histone H2A [Schistosoma manson...   144   9e-33   
gi|14549635|gb|AAK66965.1|AF255739_1 replication-dependent histo...   144   9e-33   Bufo gargarizans [Chusan Island toad]
gi|29244126|ref|NP_808356.1| histone H2A.J [Mus musculus] >gi|15...   144   9e-33   Mus musculus [mouse]
gi|213408587|ref|XP_002175064.1| histone H2A alpha [Schizosaccha...   144   9e-33   Schizosaccharomyces japonicus yFS275
gi|449279158|gb|EMC86804.1| Histone H2A-IV, partial [Columba livia]   144   1e-32   Columba livia [carrier pigeon]
gi|71896919|ref|NP_001025924.1| histone H2A.J [Gallus gallus] >g...   144   1e-32   Gallus gallus [bantam]
gi|348569378|ref|XP_003470475.1| PREDICTED: histone H2A.J-like [...   144   1e-32   Cavia porcellus [guinea pig]
gi|383856475|ref|XP_003703734.1| PREDICTED: histone H2A-like [Me...   144   1e-32   
gi|407262045|ref|XP_003085904.2| PREDICTED: histone H2A type 2-A...   144   1e-32   
gi|449279161|gb|EMC86807.1| Histone H2A-IV, partial [Columba liv...   144   1e-32   Columba livia [carrier pigeon]
gi|241568985|ref|XP_002402622.1| histone 2A [Ixodes scapularis] ...   144   1e-32   Ixodes scapularis [blacklegged tick]
gi|483521796|gb|EOB06753.1| Histone H2A type 2-C, partial [Anas ...   144   1e-32   Anas platyrhynchos [duck]
gi|426398326|gb|AFY26306.1| histone H2A, partial [Plectorhinchus...   144   1e-32   Plectorhinchus mediterraneus
gi|195562366|ref|XP_002077504.1| GD12842 [Drosophila simulans] >...   144   1e-32   
gi|89520693|gb|ABD76392.1| histone H2A [Azumapecten farreri]          144   1e-32   Azumapecten farreri [Farrer's scallop]
gi|466084051|ref|XP_004285170.1| PREDICTED: histone H2A type 2-A...   144   1e-32   
gi|348518790|ref|XP_003446914.1| PREDICTED: histone H2A.x-like [...   144   1e-32   Oreochromis niloticus
gi|465795491|emb|CCV00009.1| unnamed protein product [Malassezia...   144   1e-32   Malassezia sympodialis ATCC 42132
gi|91095403|ref|XP_966580.1| PREDICTED: similar to His2A:CG31618...   144   1e-32   
gi|354474092|ref|XP_003499265.1| PREDICTED: histone H2A.J-like [...   144   1e-32   
gi|256087701|ref|XP_002580003.1| histone H2A [Schistosoma manson...   144   1e-32   
gi|483521771|gb|EOB06728.1| Histone H2A.J, partial [Anas platyrh...   144   1e-32   
gi|164662815|ref|XP_001732529.1| hypothetical protein MGL_0304 [...   144   1e-32   
gi|51701468|sp|Q6WV67.3|H2A_MYTTR RecName: Full=Histone H2A >gi|...   144   1e-32   
gi|291410763|ref|XP_002721657.1| PREDICTED: histone cluster 1, H...   144   1e-32   
gi|32401019|gb|AAP80715.1| histone protein [Griffithsia japonica]     144   1e-32   
gi|512876557|ref|XP_004919105.1| PREDICTED: histone H2A type 1-l...   144   1e-32   
gi|270015325|gb|EFA11773.1| hypothetical protein TcasGA2_TC00410...   144   1e-32   
gi|224094590|ref|XP_002194364.1| PREDICTED: histone H2A type 2-C...   144   1e-32   
gi|226479254|emb|CAX73122.1| Histone H2A [Schistosoma japonicum]      144   1e-32   
gi|195179336|ref|XP_002029102.1| GL16032 [Drosophila persimilis]...   144   1e-32   
gi|295982351|pdb|3KWQ|C Chain C, Structural Characterization Of ...   143   1e-32   
gi|256070862|ref|XP_002571761.1| histone H2A [Schistosoma manson...   143   1e-32   
gi|195366947|ref|XP_002045707.1| GM17710 [Drosophila sechellia] ...   143   1e-32   
gi|483521773|gb|EOB06730.1| Histone H2A-IV, partial [Anas platyr...   143   1e-32   
gi|62857617|ref|NP_001015968.1| H2A histone family, member X [Xe...   143   1e-32   
gi|483521795|gb|EOB06752.1| Histone H2A, partial [Anas platyrhyn...   143   1e-32   
gi|472375201|ref|XP_004407047.1| PREDICTED: histone H2A.J-like [...   143   1e-32   
gi|465954616|gb|EMP26032.1| Histone H2A type 2-C [Chelonia mydas]     143   1e-32   
gi|351709290|gb|EHB12209.1| Histone H2A type 1 [Heterocephalus g...   143   1e-32   
gi|225714686|gb|ACO13189.1| Histone H2A.x [Esox lucius]               143   1e-32   
gi|462233|sp|P35061.2|H2A_ACRFO RecName: Full=Histone H2A >gi|16...   143   1e-32   
gi|483521775|gb|EOB06732.1| Histone H2A-IV, partial [Anas platyr...   143   1e-32   
gi|483521774|gb|EOB06731.1| Histone H2A-IV, partial [Anas platyr...   143   1e-32   
gi|391344342|ref|XP_003746460.1| PREDICTED: uncharacterized prot...   143   1e-32   
gi|270017170|gb|EFA13616.1| hypothetical protein TcasGA2_TC00855...   143   1e-32   
gi|118405202|ref|NP_001072943.1| histone H2A-IV [Gallus gallus] ...   143   1e-32   
gi|449271824|gb|EMC82042.1| Histone H2A type 2-B, partial [Colum...   143   1e-32   
gi|336087646|emb|CBM82468.1| histone H2A-XII protein [Balanoglos...   143   1e-32   
gi|297677449|ref|XP_002816622.1| PREDICTED: histone H2A type 1-J...   143   1e-32   
gi|281346002|gb|EFB21586.1| hypothetical protein PANDA_016839 [A...   143   1e-32   
gi|512971477|ref|XP_004847862.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|202070869|gb|ACH95387.1| histone 2A [Branchiostoma belcheri]       143   1e-32   
gi|76156858|gb|ABA40379.1| SJCHGC05779 protein [Schistosoma japo...   143   1e-32   
gi|348539180|ref|XP_003457067.1| PREDICTED: histone H2A.J-like [...   143   1e-32   
gi|301783443|ref|XP_002927145.1| PREDICTED: hypothetical protein...   143   1e-32   
gi|395516724|ref|XP_003762537.1| PREDICTED: histone H2A.J-like [...   143   1e-32   
gi|281345999|gb|EFB21583.1| hypothetical protein PANDA_016836 [A...   143   1e-32   
gi|126309064|ref|XP_001363204.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|470611192|ref|XP_004315561.1| PREDICTED: histone H2A type 2-A...   143   1e-32   
gi|126313640|ref|XP_001364911.1| PREDICTED: histone H2A type 2-A...   143   1e-32   
gi|432895731|ref|XP_004076134.1| PREDICTED: histone H2A-like [Or...   143   1e-32   
gi|148227628|ref|NP_001085177.1| H2A histone family, member J [X...   143   1e-32   
gi|60834382|gb|AAX37091.1| histone 2 H2aa [synthetic construct] ...   143   1e-32   
gi|426251326|ref|XP_004019375.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|402866172|ref|XP_003897268.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|6980689|pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromo...   143   1e-32   
gi|327265949|ref|XP_003217770.1| PREDICTED: histone H2A type 2-B...   143   1e-32   
gi|149617714|ref|XP_001513730.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|327278192|ref|XP_003223846.1| PREDICTED: histone H2A type 2-C...   143   1e-32   
gi|383856645|ref|XP_003703818.1| PREDICTED: histone H2A-like [Me...   143   1e-32   
gi|326935672|ref|XP_003213892.1| PREDICTED: histone H2A type 2-B...   143   1e-32   
gi|478535390|ref|XP_004441821.1| PREDICTED: histone H2A type 1-l...   143   1e-32   
gi|432896919|ref|XP_004076381.1| PREDICTED: histone H2A.x-like [...   143   1e-32   
gi|410958282|ref|XP_003985748.1| PREDICTED: histone H2A type 1-E...   143   1e-32   
gi|410918159|ref|XP_003972553.1| PREDICTED: histone H2A-like [Ta...   143   1e-32   
gi|242003146|ref|XP_002422628.1| histone H2A [Pediculus humanus ...   143   1e-32   
gi|63448|emb|CAA23704.1| unnamed protein product [Gallus gallus]      143   1e-32   
gi|326478655|gb|EGE02665.1| histone H2A [Trichophyton equinum CB...   143   1e-32   
gi|197321808|gb|ACH68795.1| histone H2A variant H2Abd1 copy 2c [...   143   1e-32   
gi|162319741|gb|ABX84387.1| histone H2A [Penaeus monodon]             143   1e-32   
gi|283468891|emb|CAP53876.1| histone H2A [Xenoturbella bocki] >g...   143   1e-32   
gi|512878121|ref|XP_004919336.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|57110463|ref|XP_545413.1| PREDICTED: histone H2A type 1-E-lik...   143   2e-32   
gi|197321810|gb|ACH68796.1| histone H2A variant H2Abd1 copy 2d [...   143   2e-32   
gi|126313648|ref|XP_001365197.1| PREDICTED: histone H2A type 2-C...   143   2e-32   
gi|4504251|ref|NP_003507.1| histone H2A type 2-A [Homo sapiens] ...   143   2e-32   
gi|224094529|ref|XP_002192812.1| PREDICTED: histone H2A-like [Ta...   143   2e-32   
gi|395859146|ref|XP_003801905.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|109070062|ref|XP_001096671.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|170035757|ref|XP_001845734.1| histone 2A [Culex quinquefascia...   143   2e-32   
gi|147902910|ref|NP_001086775.1| histone cluster 1, H2ad [Xenopu...   143   2e-32   
gi|472374219|ref|XP_004406573.1| PREDICTED: histone H2A type 1-E...   143   2e-32   
gi|10800144|ref|NP_066544.1| histone cluster 1, H2aj [Homo sapie...   143   2e-32   
gi|410958254|ref|XP_003985734.1| PREDICTED: histone H2A type 1-E...   143   2e-32   
gi|126336251|ref|XP_001366966.1| PREDICTED: histone H2A.J-like [...   143   2e-32   
gi|472388747|ref|XP_004413701.1| PREDICTED: histone H2A type 1-E...   143   2e-32   
gi|149617688|ref|XP_001513003.1| PREDICTED: histone H2A type 2-C...   143   2e-32   
gi|18105045|ref|NP_542163.1| histone H2A type 1-H [Homo sapiens]...   143   2e-32   
gi|395533408|ref|XP_003768752.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|260789645|ref|XP_002589856.1| hypothetical protein BRAFLDRAFT...   143   2e-32   
gi|367000117|ref|XP_003684794.1| hypothetical protein TPHA_0C020...   143   2e-32   
gi|197321804|gb|ACH68793.1| histone H2A variant H2Abd1 copy 1a [...   143   2e-32   
gi|297472768|ref|XP_002686133.1| PREDICTED: histone H2A type 2-A...   143   2e-32   
gi|61213116|sp|Q6PV61.3|H2A_PENVA RecName: Full=Histone H2A           143   2e-32   
gi|149593305|ref|XP_001506664.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|122044786|sp|P02270.2|H2A_SIPNU RecName: Full=Histone H2A          143   2e-32   
gi|149617764|ref|XP_001514892.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|511938781|ref|XP_004788226.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|449279168|gb|EMC86814.1| Histone H2A, partial [Columba livia]      143   2e-32   
gi|403270717|ref|XP_003927311.1| PREDICTED: histone H2A type 1-D...   143   2e-32   
gi|348566129|ref|XP_003468855.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|126309078|ref|XP_001363527.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|332823398|ref|XP_003311177.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|472388773|ref|XP_004413714.1| PREDICTED: histone H2A type 1-E...   143   2e-32   
gi|344289470|ref|XP_003416465.1| PREDICTED: histone H2A type 1-C...   143   2e-32   
gi|281346017|gb|EFB21601.1| hypothetical protein PANDA_016908 [A...   143   2e-32   
gi|71005970|ref|XP_757651.1| histone H2A [Ustilago maydis 521] >...   143   2e-32   
gi|195359349|ref|XP_002045354.1| GM11165 [Drosophila sechellia] ...   143   2e-32   
gi|149731850|ref|XP_001496794.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|312370879|gb|EFR19186.1| hypothetical protein AND_22938 [Anop...   143   2e-32   
gi|432108082|gb|ELK33061.1| Histone H2A type 2-A, partial [Myoti...   143   2e-32   
gi|4504245|ref|NP_003503.1| histone H2A type 1-C [Homo sapiens] ...   143   2e-32   
gi|60833122|gb|AAX37037.1| histone 1 H2ac [synthetic construct]       143   2e-32   
gi|27311795|gb|AAO00863.1| Unknown protein [Arabidopsis thaliana]     143   2e-32   
gi|224567|prf||1109175A homeostatic thymus hormone alpha              143   2e-32
gi|296197157|ref|XP_002746151.1| PREDICTED: histone H2A type 1-H...   143   2e-32   
gi|343428185|emb|CBQ71715.1| probable Histone H2A [Sporisorium r...   143   2e-32   
gi|194719519|gb|ACF93799.1| H2A [Carassius gibelio]                   143   2e-32   
gi|156842223|ref|XP_001644480.1| hypothetical protein Kpol_529p2...   143   2e-32   
gi|57110393|ref|XP_545373.1| PREDICTED: histone H2A type 1-A [Ca...   143   2e-32   
gi|149617726|ref|XP_001513993.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|149522279|ref|XP_001512943.1| PREDICTED: histone H2A type 1-l...   143   2e-32   
gi|511938237|ref|XP_004787983.1| PREDICTED: histone H2A type 1-E...   143   2e-32   
gi|57110409|ref|XP_545384.1| PREDICTED: histone H2A type 1-E-lik...   143   2e-32   
gi|195972758|dbj|BAG68514.1| histone 2A [Drosophila takahashii]       142   2e-32   
gi|156354079|ref|XP_001623230.1| predicted protein [Nematostella...   142   2e-32   
gi|149616262|ref|XP_001514760.1| PREDICTED: histone H2A type 1-E...   142   2e-32   
gi|91094985|ref|XP_966943.1| PREDICTED: similar to AGAP003913-PA...   142   2e-32   
gi|4504239|ref|NP_003500.1| histone H2A type 1 [Homo sapiens] >g...   142   2e-32   
gi|281345994|gb|EFB21578.1| hypothetical protein PANDA_016831 [A...   142   2e-32   
gi|149431856|ref|XP_001510088.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|225712152|gb|ACO11922.1| Histone H2A [Lepeophtheirus salmonis...   142   2e-32   
gi|410958360|ref|XP_003985787.1| PREDICTED: histone H2A type 1-A...   142   2e-32   
gi|365982595|ref|XP_003668131.1| hypothetical protein NDAI_0A073...   142   2e-32   
gi|328699715|ref|XP_003241023.1| PREDICTED: histone H2A-like [Ac...   142   2e-32   
gi|321451029|gb|EFX62825.1| hypothetical protein DAPPUDRAFT_2696...   142   2e-32   
gi|47203826|emb|CAF95804.1| unnamed protein product [Tetraodon n...   142   2e-32   
gi|513205255|ref|XP_004944656.1| PREDICTED: histone H2A type 2-B...   142   2e-32   
gi|76633542|ref|XP_602496.2| PREDICTED: histone H2A type 1 [Bos ...   142   2e-32   
gi|328857673|gb|EGG06788.1| hypothetical protein MELLADRAFT_3102...   142   2e-32   
gi|51304|emb|CAA29291.1| unnamed protein product [Mus musculus]       142   2e-32   
gi|74004170|ref|XP_545376.2| PREDICTED: histone H2A type 1-E-lik...   142   2e-32   
gi|355564041|gb|EHH20541.1| Histone H2A.J [Macaca mulatta]            142   2e-32   
gi|507107074|emb|CDF40612.1| Histone H2A [Chondrus crispus]           142   2e-32   
gi|170058992|ref|XP_001865167.1| histone H2A type 1-J [Culex qui...   142   2e-32   
gi|197321812|gb|ACH68797.1| histone H2A variant H2Abd2 copy A [A...   142   2e-32   
gi|432895729|ref|XP_004076133.1| PREDICTED: histone H2A.x-like [...   142   2e-32   
gi|470618186|ref|XP_004317754.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|296197143|ref|XP_002746144.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|444523278|gb|ELV13501.1| Histone H2A type 1 [Tupaia chinensis]     142   2e-32   
gi|156846232|ref|XP_001646004.1| hypothetical protein Kpol_1031p...   142   2e-32   
gi|390461135|ref|XP_003732607.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|512840019|ref|XP_004914345.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|301789704|ref|XP_002930267.1| PREDICTED: histone H2A type 2-B...   142   2e-32   
gi|512971513|ref|XP_004847880.1| PREDICTED: histone H2A type 1-l...   142   2e-32   
gi|302657370|ref|XP_003020409.1| hypothetical protein TRV_05527 ...   142   2e-32   
gi|184186113|ref|NP_001116979.1| histone H2a-beta [Strongylocent...   142   2e-32   
gi|122013|sp|P27325.2|H2A_URECA RecName: Full=Histone H2A >gi|10...   142   2e-32   
gi|156548876|ref|XP_001606447.1| PREDICTED: histone H2A.J [Nason...   142   2e-32   
gi|170059758|ref|XP_001865501.1| histone H2A type 1-A [Culex qui...   142   2e-32   
gi|301623151|ref|XP_002940883.1| PREDICTED: histone H2A type 1-l...   142   3e-32   
gi|197321814|gb|ACH68798.1| histone H2A variant H2Abd2 copy B [A...   142   3e-32   
gi|410918165|ref|XP_003972556.1| PREDICTED: histone H2A-like [Ta...   142   3e-32   
gi|157137737|ref|XP_001657157.1| histone h2a [Aedes aegypti] >gi...   142   3e-32   
gi|513221877|ref|XP_004947974.1| PREDICTED: histone H2A.x-like [...   142   3e-32   
gi|335291882|ref|XP_001928646.3| PREDICTED: histone H2A type 1-F...   142   3e-32   
gi|410915426|ref|XP_003971188.1| PREDICTED: histone H2A.x-like [...   142   3e-32   
gi|440896996|gb|ELR48782.1| Histone H2A type 1-D, partial [Bos g...   142   3e-32   
gi|68060347|ref|XP_672153.1| histone h2a [Plasmodium berghei str...   142   3e-32   
gi|237648978|ref|NP_001153666.1| histone H2A-like protein 2 [Bom...   142   3e-32   
gi|47551085|ref|NP_999718.1| late histone H2A.L3 [Strongylocentr...   142   3e-32   
gi|57096146|ref|XP_539322.1| PREDICTED: histone H2A type 3 [Cani...   142   3e-32   
gi|511938103|ref|XP_004787919.1| PREDICTED: histone H2A type 1-l...   142   3e-32   
gi|57110459|ref|XP_545411.1| PREDICTED: histone H2A type 1-like ...   142   3e-32   
gi|355785929|gb|EHH66112.1| Histone H2A.J [Macaca fascicularis]       142   3e-32   
gi|156408119|ref|XP_001641704.1| predicted protein [Nematostella...   142   3e-32   
gi|293354579|ref|XP_001056658.2| PREDICTED: histone H2A type 1 [...   142   3e-32   
gi|126313650|ref|XP_001365257.1| PREDICTED: histone H2A type 2-B...   142   3e-32   
gi|504147979|ref|XP_004586400.1| PREDICTED: histone H2A type 3-l...   142   3e-32   
gi|336087624|emb|CBM82455.1| histone H2A-III protein [Balanoglos...   142   3e-32   
gi|321476650|gb|EFX87610.1| hypothetical protein DAPPUDRAFT_2303...   142   3e-32   
gi|387182|gb|AAA37763.1| histone H2A.1 [Mus musculus]                 142   3e-32   
gi|41055102|ref|NP_957367.1| histone H2A.x [Danio rerio] >gi|739...   142   3e-32   
gi|260801577|ref|XP_002595672.1| hypothetical protein BRAFLDRAFT...   142   3e-32   
gi|281345281|gb|EFB20865.1| hypothetical protein PANDA_018562 [A...   142   3e-32   
gi|390354298|ref|XP_003728299.1| PREDICTED: histone H2A, embryon...   142   3e-32   
gi|354500273|ref|XP_003512225.1| PREDICTED: histone H2A type 1-H...   142   3e-32   
gi|327279558|ref|XP_003224523.1| PREDICTED: histone H2A type 2-C...   142   3e-32   
gi|157138410|ref|XP_001657282.1| histone h2a [Aedes aegypti] >gi...   142   3e-32   
gi|336087666|emb|CBM82478.1| histone H2A-XXII protein [Balanoglo...   142   3e-32   
gi|30061371|ref|NP_835490.1| histone H2A type 1-K [Mus musculus]...   142   3e-32   
gi|195563210|ref|XP_002077543.1| GD15347 [Drosophila simulans] >...   142   3e-32   
gi|157821615|ref|NP_001102893.1| histone cluster 1, H2ak [Rattus...   142   3e-32   
gi|426251324|ref|XP_004019374.1| PREDICTED: histone H2A type 1-l...   142   3e-32   
gi|323310183|gb|EGA63375.1| Hta2p [Saccharomyces cerevisiae Fost...   142   3e-32   
gi|323305553|gb|EGA59295.1| Hta1p [Saccharomyces cerevisiae Fost...   142   3e-32   
gi|30061327|ref|NP_783590.1| histone H2A type 1-H [Mus musculus]...   142   3e-32   
gi|511938191|ref|XP_004787961.1| PREDICTED: histone H2A type 1-l...   142   3e-32   
gi|29841133|gb|AAP06146.1| similar to GenBank Accession Number X...   142   3e-32   
gi|47222509|emb|CAG02874.1| unnamed protein product [Tetraodon n...   142   3e-32   
gi|158958242|gb|ABW86651.1| histone H2A [Anthonomus grandis]          142   3e-32   
gi|76689692|ref|XP_603142.2| PREDICTED: histone H2A type 1 [Bos ...   142   3e-32   
gi|62177162|ref|NP_001014426.1| histone H2A, embryonic [Strongyl...   142   3e-32   
gi|119575944|gb|EAW55540.1| hCG2039566, isoform CRA_a [Homo sapi...   142   3e-32   
gi|410931680|ref|XP_003979223.1| PREDICTED: histone H2A-like [Ta...   142   3e-32   
gi|336087598|emb|CBM82439.1| histone H2A.X-I protein, partial [R...   142   3e-32   
gi|195507977|ref|XP_002087253.1| GE15142 [Drosophila yakuba] >gi...   142   3e-32   
gi|49258869|pdb|1S32|C Chain C, Molecular Recognition Of The Nuc...   142   3e-32   
gi|195442960|ref|XP_002069208.1| GK10379 [Drosophila willistoni]...   142   3e-32   
gi|7106331|ref|NP_034566.1| histone H2A.x [Mus musculus] >gi|121...   142   3e-32   
gi|512906069|ref|XP_004900769.1| PREDICTED: histone H2A.J-like [...   142   3e-32   
gi|301783431|ref|XP_002927142.1| PREDICTED: hypothetical protein...   142   3e-32   
gi|281346005|gb|EFB21589.1| hypothetical protein PANDA_016842 [A...   142   3e-32   
gi|301786310|ref|XP_002928568.1| PREDICTED: histone H2A type 1-D...   142   3e-32   
gi|466027430|ref|XP_004273517.1| PREDICTED: histone H2A type 1-l...   142   4e-32   
gi|391343998|ref|XP_003746292.1| PREDICTED: histone H2A-like [Me...   142   4e-32   
gi|395533398|ref|XP_003768747.1| PREDICTED: histone H2A type 1-D...   142   4e-32   
gi|260801677|ref|XP_002595722.1| hypothetical protein BRAFLDRAFT...   142   4e-32   
gi|126309040|ref|XP_001362434.1| PREDICTED: histone H2A type 1-D...   142   4e-32   
gi|170059745|ref|XP_001865495.1| histone H2A type 1-A [Culex qui...   142   4e-32   
gi|471403697|ref|XP_004384076.1| PREDICTED: histone H2A type 1-l...   142   4e-32   
gi|3745760|pdb|1AOI|C Chain C, Complex Between Nucleosome Core P...   142   4e-32   
gi|344299127|ref|XP_003421239.1| PREDICTED: histone H2A type 3-l...   142   4e-32   
gi|195462876|ref|XP_002075883.1| GK21010 [Drosophila willistoni]...   142   4e-32   
gi|117168036|gb|AAI25249.1| Hist1h2ah protein [Mus musculus]          142   4e-32   
gi|26800904|emb|CAD38830.1| histone h2A.1 [Oikopleura dioica] >g...   142   4e-32   
gi|10645195|ref|NP_066390.1| histone H2A type 1-B/E [Homo sapien...   142   4e-32   
gi|10800130|ref|NP_066409.1| histone H2A type 1-D [Homo sapiens]...   142   4e-32   


>gi|50425123|ref|XP_461153.1| DEHA2F18282p [Debaryomyces hansenii CBS767]
 gi|74659118|sp|Q6BKW8.3|H2A1_DEBHA RecName: Full=Histone H2A.1
 gi|49656822|emb|CAG89536.1| DEHA2F18282p [Debaryomyces hansenii CBS767]
          Length = 130

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/107 (75%), Positives = 85/107 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS KG A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSAKGKASQEL 130



>gi|126140258|ref|XP_001386651.1| hypothetical protein PICST_37161 [Scheffersomyces stipitis CBS
           6054]
 gi|156630803|sp|A3LZZ0.1|H2A1_PICST RecName: Full=Histone H2A.1
 gi|126093935|gb|ABN68622.1| histone H2A [Scheffersomyces stipitis CBS 6054]
          Length = 131

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS K A A++
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSGKSAKASQ 129



>gi|378731839|gb|EHY58298.1| histone H2A [Exophiala dermatitidis NIH/UT8656]
          Length = 131

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 85/107 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG ++ E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKGKSSQEL 131



>gi|361128085|gb|EHL00038.1| putative Histone H2A [Glarea lozoyensis 74030]
 gi|512205729|gb|EPE34550.1| Histone-fold containing protein [Glarea lozoyensis ATCC 20868]
          Length = 134

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 83/105 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAA 133
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG  AA
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKGGKAA 129



>gi|511002667|gb|EPB84095.1| histone H2A.1 [Mucor circinelloides f. circinelloides 1006PhL]
 gi|511002670|gb|EPB84098.1| histone H2A.1 [Mucor circinelloides f. circinelloides 1006PhL]
 gi|511005102|gb|EPB86450.1| histone H2A.1 [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 131

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/107 (74%), Positives = 84/107 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLR+GNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LQFPVGRIHRLLRRGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH +LLP KSKK  A+ E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHASLLPTKSKKAGASQEL 131



>gi|50554035|ref|XP_504426.1| YALI0E26477p [Yarrowia lipolytica]
 gi|74659783|sp|Q6C4I6.3|H2A_YARLI RecName: Full=Histone H2A
 gi|49650295|emb|CAG80027.1| YALI0E26477p [Yarrowia lipolytica CLIB122]
          Length = 135

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 79/106 (74%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+GAGAP                  GNAARDNKKSRI+PRH
Sbjct: 27  LTFPVGRVHRLLRKGNYAQRIGAGAPIYLAAVLEYLAVEILELSGNAARDNKKSRIVPRH 86

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP+KS KGA  A 
Sbjct: 87  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPRKSAKGAKGAS 132



>gi|344301059|gb|EGW31371.1| histone H2A-1 [Spathaspora passalidarum NRRL Y-27907]
          Length = 131

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSGKATKASQ 129



>gi|448106105|ref|XP_004200664.1| Piso0_003260 [Millerozyma farinosa CBS 7064]
 gi|448109233|ref|XP_004201295.1| Piso0_003260 [Millerozyma farinosa CBS 7064]
 gi|359382086|emb|CCE80923.1| Piso0_003260 [Millerozyma farinosa CBS 7064]
 gi|359382851|emb|CCE80158.1| Piso0_003260 [Millerozyma farinosa CBS 7064]
          Length = 130

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 83/107 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FP GR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LVFPFGRVHRLLRKGNYAQRVGSGAPVYMTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS KG  + E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSAKGKPSQEL 130



>gi|384501244|gb|EIE91735.1| histone H2A [Rhizopus delemar RA 99-880]
          Length = 131

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 84/107 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLR+GNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LQFPVGRIHRLLRRGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH +LLP K+KK  A+ E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHASLLPTKTKKAGASQEL 131



>gi|406602987|emb|CCH45455.1| Histone H2A.1 [Wickerhamomyces ciferrii]
 gi|406603959|emb|CCH44541.1| Histone H2A.1 [Wickerhamomyces ciferrii]
          Length = 132

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSTKAPKASQ 130



>gi|384492927|gb|EIE83418.1| histone H2A [Rhizopus delemar RA 99-880]
 gi|384493018|gb|EIE83509.1| histone H2A [Rhizopus delemar RA 99-880]
 gi|384493026|gb|EIE83517.1| histone H2A [Rhizopus delemar RA 99-880]
          Length = 131

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 84/107 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLR+GNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LQFPVGRIHRLLRRGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH +LLP K+KK  A+ E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHASLLPTKTKKAGASQEL 131



>gi|146416185|ref|XP_001484062.1| histone H2A.2 [Meyerozyma guilliermondii ATCC 6260]
 gi|156630805|sp|A5DJJ2.1|H2A2_PICGU RecName: Full=Histone H2A.2
 gi|146391187|gb|EDK39345.1| histone H2A.2 [Meyerozyma guilliermondii ATCC 6260]
          Length = 130

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGRIHRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LTFPVGRIHRLLRKGNYAQRVGSGAPVYLTSVLEYLTAEILELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQNLLPKKS KG  A++
Sbjct: 83  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQNLLPKKSGKGDKASQ 128



>gi|406862071|gb|EKD15123.1| histone H2A [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 133

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/106 (74%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG   A 
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTVKGGKTAS 130



>gi|354543953|emb|CCE40675.1| hypothetical protein CPAR2_107100 [Candida parapsilosis]
          Length = 130

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/107 (71%), Positives = 83/107 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP K  KG A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKTKGGASQEL 130



>gi|448518688|ref|XP_003867971.1| Hta2 histone H2A [Candida orthopsilosis Co 90-125]
 gi|380352310|emb|CCG22535.1| Hta2 histone H2A [Candida orthopsilosis]
          Length = 130

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/107 (71%), Positives = 83/107 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP K  KG A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKTKGGASQEL 130



>gi|326491419|dbj|BAJ94187.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 132

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 81/101 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKG 125



>gi|261195777|ref|XP_002624292.1| histone H2A [Ajellomyces dermatitidis SLH14081]
 gi|239587425|gb|EEQ70068.1| histone H2A [Ajellomyces dermatitidis SLH14081]
 gi|239614379|gb|EEQ91366.1| histone H2A [Ajellomyces dermatitidis ER-3]
 gi|327351390|gb|EGE80247.1| histone H2A [Ajellomyces dermatitidis ATCC 18188]
          Length = 135

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 81/102 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH NLLPKKS KGA
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHLNLLPKKSGKGA 126



>gi|302916225|ref|XP_003051923.1| histone 2A [Nectria haematococca mpVI 77-13-4]
 gi|256732862|gb|EEU46210.1| histone 2A [Nectria haematococca mpVI 77-13-4]
          Length = 134

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 81/101 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTVKG 126



>gi|154300254|ref|XP_001550543.1| histone H2A [Botryotinia fuckeliana B05.10]
 gi|160332370|sp|O74268.4|H2A_BOTFB RecName: Full=Histone H2A
 gi|347841276|emb|CCD55848.1| hypothetical protein BofuT4_P154100.1 [Botryotinia fuckeliana T4]
 gi|472237299|gb|EMR82204.1| putative histone h2a protein [Botryotinia fuckeliana BcDW1]
          Length = 136

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 81/102 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K A
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKTA 127



>gi|115403023|ref|XP_001217588.1| histone H2A [Aspergillus terreus NIH2624]
 gi|121734392|sp|Q0CBD2.1|H2A_ASPTN RecName: Full=Histone H2A
 gi|114189434|gb|EAU31134.1| histone H2A [Aspergillus terreus NIH2624]
          Length = 131

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/107 (72%), Positives = 83/107 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K   + E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPKAKGSQEL 131



>gi|380478327|emb|CCF43662.1| histone H2A [Colletotrichum higginsianum]
          Length = 133

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 81/101 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGKG 126



>gi|68486742|ref|XP_712725.1| histone H2A [Candida albicans SC5314]
 gi|68486817|ref|XP_712688.1| histone H2A [Candida albicans SC5314]
 gi|255726804|ref|XP_002548328.1| histone H2A.1 [Candida tropicalis MYA-3404]
 gi|74656167|sp|Q59SU5.3|H2A1_CANAL RecName: Full=Histone H2A.1
 gi|46434098|gb|EAK93517.1| histone H2A [Candida albicans SC5314]
 gi|46434136|gb|EAK93554.1| histone H2A [Candida albicans SC5314]
 gi|238880803|gb|EEQ44441.1| histone H2A.2 [Candida albicans WO-1]
 gi|240134252|gb|EER33807.1| histone H2A.1 [Candida tropicalis MYA-3404]
          Length = 132

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 81/106 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQNLLPKKS KG   A 
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQNLLPKKSGKGGVKAS 129



>gi|340931828|gb|EGS19361.1| hypothetical protein CTHT_0048200 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 133

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAK 124



>gi|389637391|ref|XP_003716333.1| histone H2A [Magnaporthe oryzae 70-15]
 gi|74658044|sp|Q5G578.3|H2A_MAGO7 RecName: Full=Histone H2A
 gi|58257461|gb|AAW69352.1| histone H2A-like protein [Magnaporthe grisea]
 gi|351642152|gb|EHA50014.1| histone H2A [Magnaporthe oryzae 70-15]
 gi|440467303|gb|ELQ36533.1| histone H2A [Magnaporthe oryzae Y34]
 gi|440478908|gb|ELQ59706.1| histone H2A [Magnaporthe oryzae P131]
          Length = 136

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 81/102 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K A
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGKTA 127



>gi|402080179|gb|EJT75324.1| histone H2A [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 136

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPK++ K A  A+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKQTGKAAKGAK 131



>gi|225685093|gb|EEH23377.1| histone H2A [Paracoccidioides brasiliensis Pb03]
          Length = 135

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|241953177|ref|XP_002419310.1| histone H2A.1, putative [Candida dubliniensis CD36]
 gi|223642650|emb|CAX42902.1| histone H2A.1, putative [Candida dubliniensis CD36]
          Length = 132

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 81/106 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQNLLPKKS KG   A 
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQNLLPKKSGKGGVNAS 129



>gi|146422613|ref|XP_001487242.1| histone H2A.2 [Meyerozyma guilliermondii ATCC 6260]
 gi|156630802|sp|A5DBG4.1|H2A1_PICGU RecName: Full=Histone H2A.1
 gi|146388363|gb|EDK36521.1| histone H2A.2 [Meyerozyma guilliermondii ATCC 6260]
          Length = 130

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/104 (76%), Positives = 83/104 (79%), Gaps = 1/104 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGRIHRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRIHRLLRKGNYAQRVGSGAPVYLTSVLEYLTAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP-KKSKKGAA 131
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP KKS KGA+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPSKKSIKGAS 127



>gi|346326954|gb|EGX96550.1| histone H2A [Cordyceps militaris CM01]
 gi|400593105|gb|EJP61107.1| histone H2A-like protein [Beauveria bassiana ARSEF 2860]
          Length = 136

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 81/101 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP+K+ KG
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPQKTGKG 126



>gi|302404231|ref|XP_002999953.1| histone H2A [Verticillium albo-atrum VaMs.102]
 gi|261361135|gb|EEY23563.1| histone H2A [Verticillium albo-atrum VaMs.102]
 gi|346975628|gb|EGY19080.1| histone H2A [Verticillium dahliae VdLs.17]
          Length = 134

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSGK 125



>gi|449303629|gb|EMC99636.1| hypothetical protein BAUCODRAFT_30006 [Baudoinia compniacensis UAMH
           10762]
          Length = 136

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 83/105 (79%), Gaps = 2/105 (1%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS--KKGAA 131
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+   KGAA
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTTGSKGAA 130



>gi|226294407|gb|EEH49827.1| histone H2a [Paracoccidioides brasiliensis Pb18]
          Length = 134

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|50309449|ref|XP_454732.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|50311311|ref|XP_455680.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74660276|sp|Q6CK59.3|H2A_KLULA RecName: Full=Histone H2A
 gi|49643867|emb|CAG99819.1| KLLA0E17359p [Kluyveromyces lactis]
 gi|49644816|emb|CAG98388.1| KLLA0F13332p [Kluyveromyces lactis]
          Length = 130

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K  A+ E+
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSSKAKASQEL 130



>gi|470316710|gb|EMR08456.1| hypothetical protein PNEG_03286 [Pneumocystis murina B123]
          Length = 148

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 79/100 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH NLLP KSKK
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHSNLLPAKSKK 124



>gi|90101337|sp|Q4HTT1.3|H2A_GIBZE RecName: Full=Histone H2A
 gi|408392900|gb|EKJ72188.1| hypothetical protein FPSE_07645 [Fusarium pseudograminearum CS3096]
          Length = 134

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|470316711|gb|EMR08457.1| hypothetical protein, variant [Pneumocystis murina B123]
          Length = 130

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 81/103 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH NLLP KSKK A+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHSNLLPAKSKKLAS 127



>gi|440638441|gb|ELR08360.1| hypothetical protein GMDG_03155 [Geomyces destructans 20631-21]
          Length = 133

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 81/104 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ LLPKK+ KG  A
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQKLLPKKTVKGKGA 128



>gi|295657173|ref|XP_002789158.1| histone H2a [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284502|gb|EEH40068.1| histone H2a [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 135

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|156630815|sp|Q2HH37.2|H2A_CHAGB RecName: Full=Histone H2A
          Length = 134

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|154281227|ref|XP_001541426.1| histone H2A [Ajellomyces capsulatus NAm1]
 gi|150411605|gb|EDN06993.1| histone H2A [Ajellomyces capsulatus NAm1]
 gi|225554847|gb|EEH03141.1| histone H2A [Ajellomyces capsulatus G186AR]
 gi|240274224|gb|EER37741.1| histone H2A [Ajellomyces capsulatus H143]
 gi|325091704|gb|EGC45014.1| histone H2A [Ajellomyces capsulatus H88]
          Length = 134

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 123



>gi|485922812|gb|EOD48140.1| putative histone h2a protein [Neofusicoccum parvum UCRNP2]
          Length = 134

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAK 125



>gi|512187912|gb|EPE03688.1| histone h2a [Ophiostoma piceae UAMH 11346]
          Length = 134

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|471570461|gb|EMR69571.1| putative histone h2a protein [Eutypa lata UCREL1]
          Length = 133

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 124



>gi|85092526|ref|XP_959442.1| histone H2A [Neurospora crassa OR74A]
 gi|336259153|ref|XP_003344381.1| HTA2 protein [Sordaria macrospora k-hell]
 gi|30315841|sp|Q8X132.3|H2A_NEUCR RecName: Full=Histone H2A
 gi|17644129|gb|AAL38970.1| histone H2A [Neurospora crassa]
 gi|28920865|gb|EAA30206.1| histone H2A [Neurospora crassa OR74A]
 gi|336467353|gb|EGO55517.1| histone H2A [Neurospora tetrasperma FGSC 2508]
 gi|342877130|gb|EGU78637.1| hypothetical protein FOXB_10823 [Fusarium oxysporum Fo5176]
 gi|350288006|gb|EGZ69242.1| histone H2A [Neurospora tetrasperma FGSC 2509]
 gi|380092668|emb|CCC09421.1| putative HTA2 protein [Sordaria macrospora k-hell]
 gi|475671363|gb|EMT68716.1| Histone H2A [Fusarium oxysporum f. sp. cubense race 4]
 gi|475671365|gb|EMT68718.1| Histone H2A [Fusarium oxysporum f. sp. cubense race 4]
 gi|477515960|gb|ENH68241.1| Histone H2A [Fusarium oxysporum f. sp. cubense race 1]
 gi|500259764|gb|EOO02526.1| putative histone h2a protein [Togninia minima UCRPA7]
          Length = 134

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|367032274|ref|XP_003665420.1| histone H2A-like protein [Myceliophthora thermophila ATCC 42464]
 gi|367047459|ref|XP_003654109.1| histone H2A-like protein [Thielavia terrestris NRRL 8126]
 gi|347001372|gb|AEO67773.1| histone H2A-like protein [Thielavia terrestris NRRL 8126]
 gi|347012691|gb|AEO60175.1| histone H2A-like protein [Myceliophthora thermophila ATCC 42464]
          Length = 134

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|158327647|emb|CAO81988.1| histone H2A-EYFP fusion protein [Reporter vector pYH2A]
          Length = 366

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVT AQGGVLPNIHQNLLPKK+ K A  ++
Sbjct: 86  LQLAIRNDEELNKLLGHVTTAQGGVLPNIHQNLLPKKTGKTAMVSK 131



>gi|50292561|ref|XP_448713.1| hypothetical protein [Candida glabrata CBS 138]
 gi|51701506|sp|Q6FM31.3|H2A2_CANGA RecName: Full=Histone H2A.2
 gi|49528025|emb|CAG61676.1| unnamed protein product [Candida glabrata]
          Length = 131

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 85/107 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K +A+ E+
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPSASQEL 131



>gi|453080983|gb|EMF09033.1| histone-fold-containing protein [Mycosphaerella populorum SO2202]
          Length = 137

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 85/112 (75%), Gaps = 5/112 (4%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK-----KGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+      KG A+ E+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTSGTKPGKGGASQEL 137



>gi|67526021|ref|XP_661072.1| H2A_EMENI Histone H2A [Aspergillus nidulans FGSC A4]
 gi|255945229|ref|XP_002563382.1| Pc20g08590 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|121996|sp|P08844.2|H2A_EMENI RecName: Full=Histone H2A
 gi|168053|gb|AAA33309.1| histone H2A [Emericella nidulans]
 gi|40743822|gb|EAA63008.1| H2A_EMENI Histone H2A [Aspergillus nidulans FGSC A4]
 gi|211588117|emb|CAP86188.1| Pc20g08590 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|259485539|tpe|CBF82646.1| TPA: Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P08844]
           [Aspergillus nidulans FGSC A4]
 gi|425778594|gb|EKV16712.1| Histone H2A [Penicillium digitatum PHI26]
 gi|425784141|gb|EKV21935.1| Histone H2A [Penicillium digitatum Pd1]
          Length = 132

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K    ++
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPKAGKGSQ 130



>gi|452837993|gb|EME39934.1| histone H2A like protein [Dothistroma septosporum NZE10]
          Length = 137

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 79/112 (70%), Positives = 86/112 (76%), Gaps = 5/112 (4%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK-----KGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+      KG+++ E+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTTGTKPGKGSSSQEL 137



>gi|50421315|ref|XP_459207.1| DEHA2D16588p [Debaryomyces hansenii CBS767]
 gi|74659318|sp|Q6BRG3.3|H2A2_DEBHA RecName: Full=Histone H2A.2
 gi|49654874|emb|CAG87378.1| DEHA2D16588p [Debaryomyces hansenii CBS767]
          Length = 131

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 85/108 (78%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP-KKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP KK+K G A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKAKAGNASQEL 131



>gi|407917426|gb|EKG10735.1| Histone H2A [Macrophomina phaseolina MS6]
          Length = 135

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAK 125



>gi|126137898|ref|XP_001385472.1| hypothetical protein PICST_73490 [Scheffersomyces stipitis CBS
           6054]
 gi|156630806|sp|A3LXE7.1|H2A2_PICST RecName: Full=Histone H2A.2
 gi|126092750|gb|ABN67443.1| histone 2A [Scheffersomyces stipitis CBS 6054]
          Length = 131

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 85/108 (78%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP-KKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP KK+K G A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKAKPGKASQEL 131



>gi|452977851|gb|EME77615.1| hypothetical protein MYCFIDRAFT_168270 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 137

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 85/112 (75%), Gaps = 5/112 (4%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK-----KGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+      KG A+ E+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTTGAKPGKGGASQEL 137



>gi|367010072|ref|XP_003679537.1| hypothetical protein TDEL_0B01970 [Torulaspora delbrueckii]
 gi|367013418|ref|XP_003681209.1| hypothetical protein TDEL_0D04140 [Torulaspora delbrueckii]
 gi|359747195|emb|CCE90326.1| hypothetical protein TDEL_0B01970 [Torulaspora delbrueckii]
 gi|359748869|emb|CCE91998.1| hypothetical protein TDEL_0D04140 [Torulaspora delbrueckii]
          Length = 132

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K  AA++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPGAASQ 130



>gi|310801860|gb|EFQ36753.1| histone H2A [Glomerella graminicola M1.001]
          Length = 134

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|429850315|gb|ELA25603.1| histone h2a [Colletotrichum gloeosporioides Nara gc5]
 gi|477525332|gb|ENH77225.1| histone h2a [Colletotrichum orbiculare MAFF 240422]
          Length = 134

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|242814596|ref|XP_002486399.1| histone H2A [Talaromyces stipitatus ATCC 10500]
 gi|218714738|gb|EED14161.1| histone H2A [Talaromyces stipitatus ATCC 10500]
          Length = 133

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|119493438|ref|XP_001263909.1| histone h2a [Neosartorya fischeri NRRL 181]
 gi|121704594|ref|XP_001270560.1| histone h2a [Aspergillus clavatus NRRL 1]
 gi|169779852|ref|XP_001824390.1| histone H2A [Aspergillus oryzae RIB40]
 gi|238506142|ref|XP_002384273.1| histone H2A [Aspergillus flavus NRRL3357]
 gi|90101335|sp|Q4WWC6.3|H2A_ASPFU RecName: Full=Histone H2A
 gi|90101336|sp|Q2U5A8.3|H2A_ASPOR RecName: Full=Histone H2A
 gi|156630814|sp|A1CJ10.1|H2A_ASPCL RecName: Full=Histone H2A
 gi|156630816|sp|A1D8G8.1|H2A_NEOFI RecName: Full=Histone H2A
 gi|83773130|dbj|BAE63257.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|119398706|gb|EAW09134.1| histone h2a [Aspergillus clavatus NRRL 1]
 gi|119412069|gb|EAW22012.1| histone h2a [Neosartorya fischeri NRRL 181]
 gi|220690387|gb|EED46737.1| histone H2A [Aspergillus flavus NRRL3357]
 gi|391868720|gb|EIT77930.1| histone 2A [Aspergillus oryzae 3.042]
          Length = 133

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|344230055|gb|EGV61940.1| histone-fold-containing protein [Candida tenuis ATCC 10573]
          Length = 129

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 79/100 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQNLLPKKS K
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQNLLPKKSGK 123



>gi|212545084|ref|XP_002152696.1| histone H2A [Talaromyces marneffei ATCC 18224]
 gi|210065665|gb|EEA19759.1| histone H2A [Talaromyces marneffei ATCC 18224]
          Length = 133

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|149244632|ref|XP_001526859.1| histone H2A.1 [Lodderomyces elongisporus NRRL YB-4239]
 gi|156630801|sp|A5DWF1.1|H2A1_LODEL RecName: Full=Histone H2A.1
 gi|146449253|gb|EDK43509.1| histone H2A.1 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 130

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 82/107 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP K  K  A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKAKTGASQEL 130



>gi|50285877|ref|XP_445367.1| hypothetical protein [Candida glabrata CBS 138]
 gi|51701507|sp|Q6FWM7.3|H2A1_CANGA RecName: Full=Histone H2A.1
 gi|49524671|emb|CAG58273.1| unnamed protein product [Candida glabrata]
          Length = 131

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 85/107 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K +A+ E+
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPSASQEL 131



>gi|3242067|emb|CAA07351.1| histone H2A [Botryotinia fuckeliana]
          Length = 137

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 81/102 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 27  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 86

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLPKK+ K A
Sbjct: 87  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPKKTAKTA 128



>gi|399164319|emb|CCE34763.1| H2A histone H2A [Claviceps purpurea 20.1]
          Length = 134

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGK 125



>gi|358385635|gb|EHK23231.1| hypothetical protein TRIVIDRAFT_215760 [Trichoderma virens Gv29-8]
          Length = 135

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|358394270|gb|EHK43663.1| hypothetical protein TRIATDRAFT_300145 [Trichoderma atroviride IMI
           206040]
          Length = 135

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|340518621|gb|EGR48861.1| histone H2A [Trichoderma reesei QM6a]
          Length = 135

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|145245639|ref|XP_001395087.1| histone H2A [Aspergillus niger CBS 513.88]
 gi|229890274|sp|P0C953.1|H2A_ASPNC RecName: Full=Histone H2A
 gi|229890275|sp|P0C952.1|H2A_ASPNG RecName: Full=Histone H2A
 gi|2632155|emb|CAA75581.1| histone H2A [Aspergillus niger]
 gi|134079793|emb|CAK40928.1| histone H2A httA-Aspergillus niger
 gi|350631768|gb|EHA20139.1| H2A histone 2A protein [Aspergillus niger ATCC 1015]
 gi|358369018|dbj|GAA85633.1| histone H2A (HttA) [Aspergillus kawachii IFO 4308]
          Length = 134

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTPK 124



>gi|444320878|ref|XP_004181095.1| hypothetical protein TBLA_0F00320 [Tetrapisispora blattae CBS 6284]
 gi|387514139|emb|CCH61576.1| hypothetical protein TBLA_0F00320 [Tetrapisispora blattae CBS 6284]
          Length = 132

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K + A++
Sbjct: 85  LQLAIRNDDELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKPSKASQ 130



>gi|322701888|gb|EFY93636.1| histone H2A [Metarhizium acridum CQMa 102]
 gi|322707966|gb|EFY99543.1| histone H2A [Metarhizium anisopliae ARSEF 23]
          Length = 135

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|169622769|ref|XP_001804793.1| hypothetical protein SNOG_14611 [Phaeosphaeria nodorum SN15]
 gi|189194549|ref|XP_001933613.1| histone H2A [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|330935031|ref|XP_003304806.1| hypothetical protein PTT_17482 [Pyrenophora teres f. teres 0-1]
 gi|396482689|ref|XP_003841523.1| hypothetical protein LEMA_P094530.1 [Leptosphaeria maculans JN3]
 gi|121919482|sp|Q0U1A1.1|H2A_PHANO RecName: Full=Histone H2A
 gi|111057031|gb|EAT78151.1| hypothetical protein SNOG_14611 [Phaeosphaeria nodorum SN15]
 gi|187979177|gb|EDU45803.1| histone H2A [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|311318462|gb|EFQ87125.1| hypothetical protein PTT_17482 [Pyrenophora teres f. teres 0-1]
 gi|312218098|emb|CBX98044.1| hypothetical protein LEMA_P094530.1 [Leptosphaeria maculans JN3]
 gi|451855328|gb|EMD68620.1| hypothetical protein COCSADRAFT_33502 [Bipolaris sorokiniana
           ND90Pr]
 gi|452004373|gb|EMD96829.1| hypothetical protein COCHEDRAFT_1123519 [Bipolaris maydis C5]
 gi|477586613|gb|ENI03697.1| hypothetical protein COCC4DRAFT_41681 [Bipolaris maydis ATCC 48331]
 gi|482813010|gb|EOA89714.1| hypothetical protein SETTUDRAFT_104787 [Setosphaeria turcica Et28A]
          Length = 134

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ K
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAK 125



>gi|6319470|ref|NP_009552.1| Hta2p [Saccharomyces cerevisiae S288c]
 gi|121976|sp|P04912.2|H2A2_YEAST RecName: Full=Histone H2A.2
 gi|3753|emb|CAA24612.1| histone H2A2 [Saccharomyces cerevisiae]
 gi|403313|emb|CAA81267.1| histone H2A [Saccharomyces cerevisiae]
 gi|535978|emb|CAA84818.1| HTA2 [Saccharomyces cerevisiae]
 gi|51013681|gb|AAT93134.1| YBL003C [Saccharomyces cerevisiae]
 gi|151946392|gb|EDN64614.1| histone H2A [Saccharomyces cerevisiae YJM789]
 gi|190408830|gb|EDV12095.1| histone H2A [Saccharomyces cerevisiae RM11-1a]
 gi|256273165|gb|EEU08114.1| Hta2p [Saccharomyces cerevisiae JAY291]
 gi|259144845|emb|CAY77784.1| Hta2p [Saccharomyces cerevisiae EC1118]
 gi|285810334|tpg|DAA07119.1| TPA: Hta2p [Saccharomyces cerevisiae S288c]
 gi|323306064|gb|EGA59798.1| Hta2p [Saccharomyces cerevisiae FostersB]
 gi|323356275|gb|EGA88079.1| Hta2p [Saccharomyces cerevisiae VL3]
 gi|349576378|dbj|GAA21549.1| K7_Hta2p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392301217|gb|EIW12306.1| Hta2p [Saccharomyces cerevisiae CEN.PK113-7D]
 gi|1582561|prf||2118405B histone H2A
          Length = 132

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K A A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTAKASQ 130



>gi|365762073|gb|EHN03683.1| Hta1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|401842889|gb|EJT44906.1| HTA2-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 132

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTTKASQ 130



>gi|189091760|ref|XP_001929713.1| hypothetical protein [Podospora anserina S mat+]
 gi|74620192|sp|Q875B8.3|H2A_PODAS RecName: Full=Histone H2A
 gi|27802990|emb|CAD60693.1| unnamed protein product [Podospora anserina]
 gi|188219233|emb|CAP49213.1| unnamed protein product [Podospora anserina S mat+]
          Length = 135

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|367006342|ref|XP_003687902.1| hypothetical protein TPHA_0L01110 [Tetrapisispora phaffii CBS 4417]
 gi|357526208|emb|CCE65468.1| hypothetical protein TPHA_0L01110 [Tetrapisispora phaffii CBS 4417]
          Length = 132

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKAVKASQ 130



>gi|345562603|gb|EGX45670.1| hypothetical protein AOL_s00169g4 [Arthrobotrys oligospora ATCC
           24927]
          Length = 136

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 79/100 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 28  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 87

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIH NLLPKK+ K
Sbjct: 88  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHNNLLPKKTGK 127



>gi|499142143|pdb|4JJN|C Chain C, Crystal Structure Of Heterochromatin Protein Sir3 In
           Complex With A Silenced Yeast Nucleosome
 gi|499142147|pdb|4JJN|G Chain G, Crystal Structure Of Heterochromatin Protein Sir3 In
           Complex With A Silenced Yeast Nucleosome
          Length = 131

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K A A++
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTAKASQ 129



>gi|344304768|gb|EGW35000.1| histone H2A-1 [Spathaspora passalidarum NRRL Y-27907]
          Length = 131

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 84/108 (77%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP-KKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP KK K G A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPAKKPKAGKASQEL 131



>gi|320588365|gb|EFX00834.1| histone h2a [Grosmannia clavigera kw1407]
          Length = 135

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/98 (77%), Positives = 79/98 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKT 123



>gi|401626651|gb|EJS44577.1| hta2p [Saccharomyces arboricola H-6]
          Length = 132

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTTKASQ 130



>gi|260945501|ref|XP_002617048.1| histone H2A.2 [Clavispora lusitaniae ATCC 42720]
 gi|238848902|gb|EEQ38366.1| histone H2A.2 [Clavispora lusitaniae ATCC 42720]
          Length = 130

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+LLP K     A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPSKKAANKASQEL 130



>gi|323349249|gb|EGA83478.1| Hta1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 139

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQ 130



>gi|403213609|emb|CCK68111.1| hypothetical protein KNAG_0A04360 [Kazachstania naganishii CBS
           8797]
          Length = 132

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/106 (71%), Positives = 84/106 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K A A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPAKASQ 130



>gi|344229095|gb|EGV60981.1| histone H2A.1 [Candida tenuis ATCC 10573]
 gi|344229096|gb|EGV60982.1| hypothetical protein CANTEDRAFT_116035 [Candida tenuis ATCC 10573]
          Length = 130

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQ+LLP K  K  A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQSLLPSKKAKDKASQEL 130



>gi|328352153|emb|CCA38552.1| Histone H2A.1 [Komagataella pastoris CBS 7435]
          Length = 177

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 80/107 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNI   LLPKKS K  A+ E 
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIQSELLPKKSAKAKASQEF 130



>gi|398366187|ref|NP_010511.3| Hta1p [Saccharomyces cerevisiae S288c]
 gi|366988371|ref|XP_003673952.1| hypothetical protein NCAS_0A10130 [Naumovozyma castellii CBS 4309]
 gi|366989931|ref|XP_003674733.1| hypothetical protein NCAS_0B02750 [Naumovozyma castellii CBS 4309]
 gi|121967|sp|P04911.2|H2A1_YEAST RecName: Full=Histone H2A.1
 gi|3751|emb|CAA24611.1| histone H2A1 [Saccharomyces cerevisiae]
 gi|532749|gb|AAC33142.1| histone H2A1 [Saccharomyces cerevisiae]
 gi|728681|emb|CAA88505.1| H2a1p [Saccharomyces cerevisiae]
 gi|151942203|gb|EDN60559.1| histone H2A [Saccharomyces cerevisiae YJM789]
 gi|190404824|gb|EDV08091.1| histone H2A [Saccharomyces cerevisiae RM11-1a]
 gi|256269989|gb|EEU05238.1| Hta1p [Saccharomyces cerevisiae JAY291]
 gi|259145461|emb|CAY78725.1| Hta1p [Saccharomyces cerevisiae EC1118]
 gi|285811243|tpg|DAA12067.1| TPA: Hta1p [Saccharomyces cerevisiae S288c]
 gi|323334102|gb|EGA75486.1| Hta1p [Saccharomyces cerevisiae AWRI796]
 gi|323355654|gb|EGA87473.1| Hta1p [Saccharomyces cerevisiae VL3]
 gi|342299815|emb|CCC67571.1| hypothetical protein NCAS_0A10130 [Naumovozyma castellii CBS 4309]
 gi|342300597|emb|CCC68359.1| hypothetical protein NCAS_0B02750 [Naumovozyma castellii CBS 4309]
 gi|349577283|dbj|GAA22452.1| K7_Hta1p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365761428|gb|EHN03083.1| Hta1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|365766311|gb|EHN07809.1| Hta1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392300339|gb|EIW11430.1| Hta1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gi|401624249|gb|EJS42313.1| hta1p [Saccharomyces arboricola H-6]
 gi|401839770|gb|EJT42835.1| HTA1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 132

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQ 130



>gi|171031|gb|AAA66318.1| histone H2A-1, partial [Saccharomyces cerevisiae]
          Length = 118

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 11  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 70

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 71  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQ 116



>gi|254568444|ref|XP_002491332.1| One of two nearly identical (see also HTA1) histone H2A subtypes
           [Komagataella pastoris GS115]
 gi|238031129|emb|CAY69052.1| One of two nearly identical (see also HTA1) histone H2A subtypes
           [Komagataella pastoris GS115]
          Length = 130

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGVLPNI   LLPKKS K  A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIQSELLPKKSAKAKASQEL 130



>gi|254577607|ref|XP_002494790.1| ZYRO0A09724p [Zygosaccharomyces rouxii]
 gi|238937679|emb|CAR25857.1| ZYRO0A09724p [Zygosaccharomyces rouxii]
          Length = 132

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 85/108 (78%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK-GAAAAEV 135
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K G A+ E+
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPGKASQEL 132



>gi|15988134|pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle
           Reveals Fundamental Differences In Inter-Nucleosome
           Interactions
 gi|15988138|pdb|1ID3|G Chain G, Crystal Structure Of The Yeast Nucleosome Core Particle
           Reveals Fundamental Differences In Inter-Nucleosome
           Interactions
          Length = 131

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQ 129



>gi|430812838|emb|CCJ29773.1| unnamed protein product [Pneumocystis jirovecii]
 gi|430813085|emb|CCJ29528.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 132

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 83/108 (76%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK-GAAAAEV 135
           LQLAIRNDEELNKLLG+VTIAQGGVLPNIH  LLP KSKK G A+ E+
Sbjct: 85  LQLAIRNDEELNKLLGYVTIAQGGVLPNIHSTLLPVKSKKLGKASQEL 132



>gi|51701539|sp|Q74ZL4.3|H2A1_ASHGO RecName: Full=Histone H2A.1
 gi|513034075|gb|AGO14041.1| AaceriAGR184Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 131

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIH NLLPKKS K   A++
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATKASQ 129



>gi|444323591|ref|XP_004182436.1| hypothetical protein TBLA_0I02610 [Tetrapisispora blattae CBS 6284]
 gi|387515483|emb|CCH62917.1| hypothetical protein TBLA_0I02610 [Tetrapisispora blattae CBS 6284]
          Length = 132

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKK+ K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKTSKPTKASQ 130



>gi|403218013|emb|CCK72505.1| hypothetical protein KNAG_0K01430 [Kazachstania naganishii CBS
           8797]
          Length = 132

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPTKASQ 130



>gi|254577153|ref|XP_002494563.1| ZYRO0A04422p [Zygosaccharomyces rouxii]
 gi|238937452|emb|CAR25630.1| ZYRO0A04422p [Zygosaccharomyces rouxii]
          Length = 132

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRKGNYAQRVGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKK+ K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKTAKPGKASQ 130



>gi|45190604|ref|NP_984858.1| AEL003Cp [Ashbya gossypii ATCC 10895]
 gi|51701543|sp|Q757L4.3|H2A2_ASHGO RecName: Full=Histone H2A.2
 gi|44983583|gb|AAS52682.1| AEL003Cp [Ashbya gossypii ATCC 10895]
 gi|374108080|gb|AEY96987.1| FAEL003Cp [Ashbya gossypii FDAG1]
 gi|513032362|gb|AGO12354.1| AaceriAEL003Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 131

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIH NLLPKKS K   A++
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATKASQ 129



>gi|45201280|ref|NP_986850.1| AGR184Wp [Ashbya gossypii ATCC 10895]
 gi|44986134|gb|AAS54674.1| AGR184Wp [Ashbya gossypii ATCC 10895]
 gi|374110099|gb|AEY99004.1| FAGR184Wp [Ashbya gossypii FDAG1]
          Length = 175

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 82/106 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 68  LTFPVGRVHRLLRKGNYAQRIGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRH 127

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIH NLLPKKS K   A++
Sbjct: 128 LQLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATKASQ 173



>gi|255731037|ref|XP_002550443.1| histone H2A.1 [Candida tropicalis MYA-3404]
 gi|240132400|gb|EER31958.1| histone H2A.1 [Candida tropicalis MYA-3404]
          Length = 131

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 84/108 (77%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP-KKSKKGAAAAEV 135
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQ+LLP KK+K G A+ E+
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQSLLPAKKAKAGNASQEL 131



>gi|258566563|ref|XP_002584026.1| histone H2A [Uncinocarpus reesii 1704]
 gi|237907727|gb|EEP82128.1| histone H2A [Uncinocarpus reesii 1704]
          Length = 133

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGV+P+IHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVMPHIHQNLLPKKTPK 124



>gi|119195515|ref|XP_001248361.1| histone H2A [Coccidioides immitis RS]
 gi|303321424|ref|XP_003070706.1| Histone H2A, putative [Coccidioides posadasii C735 delta SOWgp]
 gi|121922228|sp|Q1E5N1.1|H2A_COCIM RecName: Full=Histone H2A
 gi|240110403|gb|EER28561.1| Histone H2A, putative [Coccidioides posadasii C735 delta SOWgp]
 gi|320040171|gb|EFW22104.1| histone H2A.2 [Coccidioides posadasii str. Silveira]
 gi|392862422|gb|EAS36936.2| histone H2A [Coccidioides immitis RS]
          Length = 133

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 79/100 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGV+P IHQNLLPKK+ K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVMPYIHQNLLPKKTPK 124



>gi|448082864|ref|XP_004195242.1| Piso0_005789 [Millerozyma farinosa CBS 7064]
 gi|359376664|emb|CCE87246.1| Piso0_005789 [Millerozyma farinosa CBS 7064]
          Length = 130

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LVFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEEL+KLLGHVTIAQGGVLPNIH +LLP K  K  A+ E+
Sbjct: 84  LQLAIRNDEELSKLLGHVTIAQGGVLPNIHSSLLPAKKAKADASQEL 130



>gi|255718943|ref|XP_002555752.1| KLTH0G16522p [Lachancea thermotolerans]
 gi|238937136|emb|CAR25315.1| KLTH0G16522p [Lachancea thermotolerans CBS 6340]
          Length = 132

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 83/106 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K   A++
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPEKASQ 130



>gi|448087462|ref|XP_004196334.1| Piso0_005789 [Millerozyma farinosa CBS 7064]
 gi|359377756|emb|CCE86139.1| Piso0_005789 [Millerozyma farinosa CBS 7064]
          Length = 208

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 102 LVFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLSAEILELAGNAARDNKKSRIIPRH 161

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEEL+KLLGHVTIAQGGVLPNIH +LLP K  K  A+ E+
Sbjct: 162 LQLAIRNDEELSKLLGHVTIAQGGVLPNIHSSLLPAKKAKADASQEL 208



>gi|328774037|gb|EGF84074.1| hypothetical protein BATDEDRAFT_36433 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 122

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/107 (71%), Positives = 81/107 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 15  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 74

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLG VTIAQGGVLPNIH  LLPKK+K G    E+
Sbjct: 75  LQLAIRNDEELNKLLGAVTIAQGGVLPNIHNVLLPKKTKGGKPGEEL 121



>gi|410077253|ref|XP_003956208.1| hypothetical protein KAFR_0C00780 [Kazachstania africana CBS 2517]
 gi|410080802|ref|XP_003957981.1| hypothetical protein KAFR_0F02490 [Kazachstania africana CBS 2517]
 gi|372462792|emb|CCF57073.1| hypothetical protein KAFR_0C00780 [Kazachstania africana CBS 2517]
 gi|372464568|emb|CCF58846.1| hypothetical protein KAFR_0F02490 [Kazachstania africana CBS 2517]
          Length = 132

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 85/108 (78%), Gaps = 1/108 (0%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQR+G+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK-GAAAAEV 135
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K G A+ E+
Sbjct: 85  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPGKASQEL 132



>gi|255715277|ref|XP_002553920.1| KLTH0E10208p [Lachancea thermotolerans]
 gi|238935302|emb|CAR23483.1| KLTH0E10208p [Lachancea thermotolerans CBS 6340]
          Length = 131

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 80/100 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LTFPVGRVHRLLRRGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRND+ELNKLLG+VTIAQGGVLPNIHQNLLPKKS K
Sbjct: 84  LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSGK 123



>gi|398390199|ref|XP_003848560.1| histone 2A [Zymoseptoria tritici IPO323]
 gi|339468435|gb|EGP83536.1| histone 2A [Zymoseptoria tritici IPO323]
          Length = 136

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/95 (77%), Positives = 76/95 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP 123
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP
Sbjct: 86  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP 120



>gi|154147097|emb|CAO81982.1| histone H2A [Sordaria macrospora]
          Length = 114

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 76/96 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 19  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 78

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPK 124
           LQLAIRNDEELNKLLGHVT AQGGVLPNIHQNLLPK
Sbjct: 79  LQLAIRNDEELNKLLGHVTTAQGGVLPNIHQNLLPK 114



>gi|296411541|ref|XP_002835489.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629273|emb|CAZ79646.1| unnamed protein product [Tuber melanosporum]
          Length = 134

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/95 (77%), Positives = 76/95 (80%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP 123
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP 119



>gi|331244552|ref|XP_003334916.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|331244570|ref|XP_003334925.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309313906|gb|EFP90497.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309313915|gb|EFP90506.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 133

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 77/103 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLLGH  I+QGGV+P IH  LLP KSK  A+
Sbjct: 85  LQLAIRNDEELNKLLGHCVISQGGVIPQIHSELLPAKSKDKAS 127



>gi|335632373|gb|AEH58057.1| histone variant H2A.X [Mytilus galloprovincialis]
          Length = 134

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 79/103 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           +QLAIRNDEELN+LLG VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 83  IQLAIRNDEELNRLLGSVTIAQGGVLPNIQAMLLPKKTSKKAA 125



>gi|331234809|ref|XP_003330063.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309309053|gb|EFP85644.1| histone H2A [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 179

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 77/103 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 71  LQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 130

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLLGH  I+QGGV+P IH  LLP KSK  A+
Sbjct: 131 LQLAIRNDEELNKLLGHCVISQGGVIPQIHSELLPAKSKDKAS 173



>gi|90101566|sp|P02268.2|H2A_SEPOF RecName: Full=Histone H2A
          Length = 125

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/102 (74%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTQKAA 124



>gi|19115333|ref|NP_594421.1| histone H2A beta [Schizosaccharomyces pombe 972h-]
 gi|121972|sp|P04910.2|H2A2_SCHPO RecName: Full=Histone H2A-beta; AltName: Full=H2A.2
 gi|4961|emb|CAA28849.1| unnamed protein product [Schizosaccharomyces pombe]
 gi|173402|gb|AAA35310.1| histone H2A-beta [Schizosaccharomyces pombe]
 gi|2239199|emb|CAB10117.1| histone H2A beta [Schizosaccharomyces pombe]
 gi|224833|prf||1202262B histone H2A.2
          Length = 131

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 83/107 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLGHVTIAQGGV+PNI+ +LLPK+S KG  + E+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKQSGKGKPSQEL 131



>gi|340385511|ref|XP_003391253.1| PREDICTED: histone H2A-like [Amphimedon queenslandica]
          Length = 126

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 79/103 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKKS+K A+
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKSEKAAS 125



>gi|328774124|gb|EGF84161.1| hypothetical protein BATDEDRAFT_8166 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 128

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 78/101 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 15  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 74

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLG VTIAQGGVLPNIH  LLPKK K G
Sbjct: 75  LQLAIRNDEELNKLLGAVTIAQGGVLPNIHNVLLPKKVKGG 115



>gi|494828313|gb|EON65154.1| histone H2A [Coniosporium apollinis CBS 100218]
          Length = 132

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 79/101 (78%), Gaps = 2/101 (1%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGA  P                  GNAARDNKK+RIIPRH
Sbjct: 26  LAFPVGRVHRLLRKGNYAQRVGA--PVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKK+ KG
Sbjct: 84  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTAKG 124



>gi|68441415|ref|XP_688798.1| PREDICTED: histone H2A-like [Danio rerio]
          Length = 128

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|342319871|gb|EGU11816.1| Histone H2A [Rhodotorula glutinis ATCC 204091]
 gi|342319896|gb|EGU11841.1| Histone H2A [Rhodotorula glutinis ATCC 204091]
          Length = 137

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 77/101 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLR GNYAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 28  LQFPVGRIHRLLRNGNYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 87

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELN+LLGHV I+QGGVLPNIH  LLP K+K G
Sbjct: 88  LQLAIRNDEELNRLLGHVVISQGGVLPNIHSELLPSKTKIG 128



>gi|326669124|ref|XP_001920286.3| PREDICTED: histone H2A-like [Danio rerio]
          Length = 144

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 41  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 100

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 101 LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 142



>gi|148227934|ref|NP_001083033.1| histone cluster 2, H2ab [Danio rerio]
 gi|125820546|ref|XP_001334871.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|133778770|gb|AAI34207.1| Zgc:163047 protein [Danio rerio]
          Length = 127

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|73611922|ref|NP_001026996.1| histone 2, H2a [Danio rerio]
 gi|125808575|ref|XP_001336709.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|125820552|ref|XP_001335136.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|189516421|ref|XP_001345113.2| PREDICTED: histone H2A-like [Danio rerio]
 gi|326680407|ref|XP_003201515.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|326680433|ref|XP_003201519.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|71051769|gb|AAH98891.1| Zgc:114037 [Danio rerio]
          Length = 128

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|66773151|ref|NP_001019567.1| histone 2, H2a [Danio rerio]
 gi|156938297|ref|NP_001096634.1| histone 2, H2a like [Danio rerio]
 gi|125855693|ref|XP_001338956.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|292628460|ref|XP_002666972.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|292628472|ref|XP_002666975.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|326680409|ref|XP_003201516.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|62531205|gb|AAH93343.1| Mid1ip1 protein [Danio rerio]
 gi|66267281|gb|AAH95260.1| Zgc:110434 [Danio rerio]
 gi|152012855|gb|AAI50437.1| Zgc:173652 protein [Danio rerio]
 gi|182889670|gb|AAI65493.1| Zgc:110434 protein [Danio rerio]
          Length = 128

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|71896453|ref|NP_001025503.1| histone cluster 1, H2ad [Xenopus (Silurana) tropicalis]
 gi|89269036|emb|CAJ83971.1| histone 2, H2ab [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 127



>gi|512836618|ref|XP_004913865.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 146

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 40  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 99

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 100 LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 143



>gi|358255301|dbj|GAA57014.1| histone H2A [Clonorchis sinensis]
          Length = 215

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 113 LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 172

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 173 LQLAIRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAEK 212



>gi|213404676|ref|XP_002173110.1| histone H2A beta [Schizosaccharomyces japonicus yFS275]
 gi|212001157|gb|EEB06817.1| histone H2A beta [Schizosaccharomyces japonicus yFS275]
          Length = 131

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 82/107 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           LQLAIRNDEELNKLLG+VTIAQGGV+PNIHQ+LLPK S +   + E+
Sbjct: 85  LQLAIRNDEELNKLLGNVTIAQGGVVPNIHQHLLPKTSGRTKPSQEL 131



>gi|391340816|ref|XP_003744732.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391343976|ref|XP_003746281.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391343978|ref|XP_003746282.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391344249|ref|XP_003746414.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391344257|ref|XP_003746418.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391344259|ref|XP_003746419.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
 gi|391344314|ref|XP_003746446.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
          Length = 125

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 78/103 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKAAA 125



>gi|505755944|gb|EOR00125.1| Histone H2A-beta [Wallemia ichthyophaga EXF-994]
          Length = 140

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 78/101 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHR L+ GNYAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 32  LQFPVGRIHRHLKNGNYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 91

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRND+ELNKLLGHVTI+QGGV+PNIH  LLP K+KKG
Sbjct: 92  LQLAIRNDDELNKLLGHVTISQGGVIPNIHTELLPSKTKKG 132



>gi|512865141|ref|XP_004917645.1| PREDICTED: histone H2A type 1-like isoform X1 [Xenopus (Silurana)
           tropicalis]
          Length = 139

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 33  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 92

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 93  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 136



>gi|388579407|gb|EIM19731.1| histone 2A [Wallemia sebi CBS 633.66]
 gi|388581368|gb|EIM21677.1| histone 2A [Wallemia sebi CBS 633.66]
          Length = 140

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 78/101 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHR L+ GNYAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 32  LQFPVGRIHRHLKNGNYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 91

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRND+ELNKLLGHVTI+QGGV+PNIH  LLP K+KKG
Sbjct: 92  LQLAIRNDDELNKLLGHVTISQGGVIPNIHTELLPSKTKKG 132



>gi|301628333|ref|XP_002943319.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKAA 127



>gi|301611035|ref|XP_002935049.1| PREDICTED: histone H2A.x-like [Xenopus (Silurana) tropicalis]
          Length = 139

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 77/102 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKKS   A
Sbjct: 84  LQLAVRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKSSSTA 125



>gi|391344251|ref|XP_003746415.1| PREDICTED: histone H2A-like, partial [Metaseiulus occidentalis]
          Length = 128

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 78/103 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 26  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 86  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKAAA 128



>gi|505756902|gb|EOR01043.1| Histone H2A-beta [Wallemia ichthyophaga EXF-994]
          Length = 140

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 78/101 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHR L+ GNYAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 32  LQFPVGRIHRHLKNGNYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 91

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRND+ELNKLLGHVTI+QGGV+PNIH  LLP K+KKG
Sbjct: 92  LQLAIRNDDELNKLLGHVTISQGGVIPNIHTELLPSKTKKG 132



>gi|301624220|ref|XP_002941404.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKAA 127



>gi|512860300|ref|XP_004917046.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 141

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 35  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 94

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 95  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAA 138



>gi|391344255|ref|XP_003746417.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
          Length = 125

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 78/103 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKTAA 125



>gi|391344346|ref|XP_003746462.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
          Length = 146

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 78/103 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 44  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 103

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 104 LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKAAA 146



>gi|512876553|ref|XP_004919104.1| PREDICTED: histone H2A type 1-like isoform X1 [Xenopus (Silurana)
           tropicalis]
 gi|512878066|ref|XP_004919327.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKAA 127



>gi|512836759|ref|XP_004913893.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKAA 127



>gi|158997657|gb|ABW86952.1| histone 2A [Aplysia californica]
          Length = 127

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKKS+K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKSQKAA 124



>gi|350538747|ref|NP_001232892.1| uncharacterized protein LOC100003969 [Danio rerio]
 gi|152001091|gb|AAI46738.1| Zgc:165551 protein [Danio rerio]
          Length = 127

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           +QFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  IQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|160420285|ref|NP_001086099.1| histone H2A.x [Xenopus laevis]
 gi|73919746|sp|Q6GM86.3|H2AX_XENLA RecName: Full=Histone H2A.x; Short=H2a/x
 gi|49256466|gb|AAH74188.1| MGC82078 protein [Xenopus laevis]
          Length = 139

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 78/105 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAA 133
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKKS  G + +
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSGGVSTS 128



>gi|225712296|gb|ACO11994.1| Histone H2A [Lepeophtheirus salmonis]
          Length = 124

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTEKSA 124



>gi|149245718|ref|XP_001527336.1| histone H2A.2 [Lodderomyces elongisporus NRRL YB-4239]
 gi|156630804|sp|A5DXS8.1|H2A2_LODEL RecName: Full=Histone H2A.2
 gi|146449730|gb|EDK43986.1| histone H2A.2 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 129

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 76/102 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HR LR GNYAQR+G+ AP                  GNAARDNKKSRIIPRH
Sbjct: 27  LTFPVGRVHRFLRNGNYAQRIGSSAPVYLASVLEYLTAEILELAGNAARDNKKSRIIPRH 86

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLG VTIAQGGV+P IHQNLLPKKS K A
Sbjct: 87  LQLAIRNDEELNKLLGQVTIAQGGVMPYIHQNLLPKKSGKAA 128



>gi|195443298|ref|XP_002069354.1| GK18709 [Drosophila willistoni]
 gi|194165439|gb|EDW80340.1| GK18709 [Drosophila willistoni]
          Length = 124

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+KK A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTKKKA 124



>gi|328699744|ref|XP_003241031.1| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
 gi|328699760|ref|XP_003241036.1| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
 gi|328699767|ref|XP_003241039.1| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
 gi|328710890|ref|XP_003244391.1| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
 gi|328713527|ref|XP_001952706.2| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
 gi|328725304|ref|XP_003248420.1| PREDICTED: histone H2A-like [Acyrthosiphon pisum]
          Length = 125

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 125



>gi|125808587|ref|XP_001337024.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|125820558|ref|XP_001335390.1| PREDICTED: histone H2A-like [Danio rerio]
          Length = 127

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|156544915|ref|XP_001600014.1| PREDICTED: histone H2A type 1 [Nasonia vitripennis]
          Length = 136

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 80/106 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++   +A++
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTETSKSASQ 128



>gi|391344308|ref|XP_003746443.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
          Length = 158

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 78/103 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 56  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 115

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 116 LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKAAA 158



>gi|218931194|ref|NP_001136058.1| histone 2, H2a [Danio rerio]
 gi|201090172|gb|AAI69194.1| Unknown (protein for MGC:195633) [Danio rerio]
          Length = 127

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|195365473|ref|XP_002045654.1| GM16110 [Drosophila sechellia]
 gi|194133196|gb|EDW54712.1| GM16110 [Drosophila sechellia]
          Length = 124

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI + LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQEVLLPKKTEKKA 124



>gi|125855709|ref|XP_687630.2| PREDICTED: histone H2A-like [Danio rerio]
          Length = 128

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|51701467|sp|Q6WV66.3|H2A_MYTCA RecName: Full=Histone H2A
 gi|51701469|sp|Q6WV69.3|H2A_MYTCH RecName: Full=Histone H2A
 gi|51701470|sp|Q6WV88.3|H2A_MYTGA RecName: Full=Histone H2A
 gi|51701479|sp|Q8I0T3.3|H2A_MYTED RecName: Full=Histone H2A
 gi|23304757|emb|CAD37817.1| histone H2A [Mytilus edulis]
 gi|23304762|emb|CAD37821.1| histone H2A [Mytilus edulis]
 gi|33114056|gb|AAP94645.1| histone H2A [Mytilus galloprovincialis]
 gi|33114112|gb|AAP94674.1| histone H2A [Mytilus galloprovincialis]
 gi|33114114|gb|AAP94675.1| histone H2A [Mytilus chilensis]
 gi|33114116|gb|AAP94676.1| histone H2A [Mytilus edulis]
 gi|33114120|gb|AAP94678.1| histone H2A [Mytilus californianus]
 gi|157169139|gb|ABV25906.1| histone H2A [Ruditapes philippinarum]
 gi|157169149|gb|ABV25911.1| histone H2A [Ruditapes decussatus]
 gi|157169159|gb|ABV25916.1| histone H2A [Venerupis pullastra]
          Length = 125

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTQKAA 124



>gi|499009504|ref|XP_004556980.1| PREDICTED: histone H2A type 1-like [Maylandia zebra]
          Length = 124

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 83  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 122



>gi|125820564|ref|XP_693579.2| PREDICTED: histone H2A-like [Danio rerio]
 gi|292628448|ref|XP_002666967.1| PREDICTED: histone H2A-like [Danio rerio]
          Length = 128

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|339233032|ref|XP_003381633.1| histone H2A [Trichinella spiralis]
 gi|316979529|gb|EFV62313.1| histone H2A [Trichinella spiralis]
          Length = 335

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 77/98 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+R+GAGAP                  GNAARDNKK+RIIPRH
Sbjct: 224 LQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVMEYLTAEVLELAGNAARDNKKTRIIPRH 283

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLL  VTIAQGGVLPNI+ +LLPKK+
Sbjct: 284 LQLAIRNDEELNKLLHGVTIAQGGVLPNINASLLPKKT 321



>gi|209730326|gb|ACI66032.1| Histone H2A.x [Salmo salar]
 gi|223646390|gb|ACN09953.1| Histone H2A.x [Salmo salar]
 gi|223649424|gb|ACN11470.1| Histone H2A.x [Salmo salar]
 gi|223672237|gb|ACN12300.1| Histone H2A.x [Salmo salar]
          Length = 142

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 80/105 (76%), Gaps = 2/105 (1%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAHRVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAA 133
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK+  GAAAA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT--GAAAA 126



>gi|68441439|ref|XP_689685.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|68441475|ref|XP_691638.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|125949153|ref|XP_698647.2| PREDICTED: histone H2A-like [Danio rerio]
 gi|189522063|ref|XP_001922365.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|292628496|ref|XP_002666988.1| PREDICTED: histone H2A-like [Danio rerio]
 gi|326680438|ref|XP_689030.3| PREDICTED: histone H2A-like [Danio rerio]
          Length = 128

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|32401021|gb|AAP80716.1| histone H2A protein [Griffithsia japonica]
          Length = 124

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 78/107 (72%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRI R LRKG YA RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 18  LQFPVGRIDRFLRKGGYADRVGAGAPVYMAAVMEYLTAEVLELAGNAARDNKKSRIIPRH 77

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           +QLA+RNDEELNKLLG VTIA GGVLPNIHQ L+P+K  KG A+ EV
Sbjct: 78  IQLAVRNDEELNKLLGGVTIASGGVLPNIHQVLMPRKKTKGDASQEV 124



>gi|301628158|ref|XP_002943225.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKAA 127



>gi|52345546|ref|NP_001004821.1| histone cluster 1, H2aj [Xenopus (Silurana) tropicalis]
 gi|71896491|ref|NP_001025496.1| histone cluster 2, H2ab [Xenopus (Silurana) tropicalis]
 gi|301623045|ref|XP_002940829.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301630571|ref|XP_002944390.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512823093|ref|XP_004912080.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836755|ref|XP_004913892.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836767|ref|XP_004913895.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836807|ref|XP_004913902.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836835|ref|XP_004913905.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836847|ref|XP_004913908.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512836877|ref|XP_004913914.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512882096|ref|XP_004919903.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512882112|ref|XP_002942896.2| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512882128|ref|XP_004919909.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|49522803|gb|AAH74601.1| MGC69325 protein [Xenopus (Silurana) tropicalis]
 gi|89267483|emb|CAJ83972.1| H2A histone family, member J [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 127



>gi|405962322|gb|EKC28012.1| Histone H2A [Crassostrea gigas]
 gi|405962327|gb|EKC28017.1| Histone H2A [Crassostrea gigas]
 gi|405962329|gb|EKC28019.1| Histone H2A [Crassostrea gigas]
 gi|405962333|gb|EKC28023.1| Histone H2A [Crassostrea gigas]
 gi|405962338|gb|EKC28028.1| Histone H2A [Crassostrea gigas]
 gi|405962343|gb|EKC28033.1| Histone H2A [Crassostrea gigas]
 gi|405962348|gb|EKC28038.1| Histone H2A [Crassostrea gigas]
          Length = 126

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 79/103 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K AA
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTQKPAA 125



>gi|301628150|ref|XP_002943222.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301628341|ref|XP_002943318.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301628781|ref|XP_002943526.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301631127|ref|XP_002944658.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301632964|ref|XP_002945549.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512823119|ref|XP_002940826.2| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512865145|ref|XP_004917646.1| PREDICTED: histone H2A type 1-like isoform X2 [Xenopus (Silurana)
           tropicalis]
 gi|512882230|ref|XP_004919929.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 127



>gi|512876590|ref|XP_004919109.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   +A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKSA 127



>gi|504179152|ref|XP_004598453.1| PREDICTED: histone H1.1-like [Ochotona princeps]
          Length = 330

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 76/98 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNY++RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK+
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKT 121



>gi|301623191|ref|XP_002940905.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKAA 127



>gi|158298157|ref|XP_318363.4| AGAP003911-PA [Anopheles gambiae str. PEST]
 gi|157014388|gb|EAA13648.4| AGAP003911-PA [Anopheles gambiae str. PEST]
          Length = 124

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKKS+K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKSEKKA 124



>gi|344238180|gb|EGV94283.1| Histone H2A type 1 [Cricetulus griseus]
          Length = 331

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/112 (67%), Positives = 83/112 (74%), Gaps = 5/112 (4%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNY++RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK-----KGAAAAEV 135
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++     KG +AA V
Sbjct: 84  LQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGNSAARV 135



>gi|147898582|ref|NP_001087948.1| histone cluster 1, H2aj [Xenopus laevis]
 gi|30268540|emb|CAD89676.1| Xenopus laevis-like histone H2A [Expression vector pET3-H2A]
 gi|50603611|gb|AAH77816.1| LOC494591 protein [Xenopus laevis]
          Length = 130

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   +A
Sbjct: 84  LQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSA 127



>gi|410927072|ref|XP_003976990.1| PREDICTED: histone H2A-like [Takifugu rubripes]
          Length = 124

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 83  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 122



>gi|395850569|ref|XP_003797855.1| PREDICTED: histone H2A.J-like [Otolemur garnettii]
          Length = 177

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 77/102 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++   
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESAC 125



>gi|187608002|ref|NP_001120117.1| histone cluster 1, H2ah [Xenopus (Silurana) tropicalis]
 gi|301626322|ref|XP_002942343.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|301627987|ref|XP_002943147.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512860247|ref|XP_004917038.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512860286|ref|XP_002942346.2| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512860313|ref|XP_004917049.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512860338|ref|XP_004917055.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512860354|ref|XP_004917059.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512879105|ref|XP_004919470.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512879109|ref|XP_004919471.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|166796530|gb|AAI58989.1| LOC100145139 protein [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAA 127



>gi|73535880|pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome
 gi|73535884|pdb|1ZBB|G Chain G, Structure Of The 4_601_167 Tetranucleosome
 gi|73535888|pdb|1ZBB|CC Chain c, Structure Of The 4_601_167 Tetranucleosome
 gi|73535892|pdb|1ZBB|GG Chain g, Structure Of The 4_601_167 Tetranucleosome
 gi|116667158|pdb|2FJ7|C Chain C, Crystal Structure Of Nucleosome Core Particle Containing A
           Poly (Da.Dt) Sequence Element
 gi|116667162|pdb|2FJ7|G Chain G, Crystal Structure Of Nucleosome Core Particle Containing A
           Poly (Da.Dt) Sequence Element
 gi|294662521|pdb|3LJA|C Chain C, Using Soft X-Rays For A Detailed Picture Of Divalent Metal
           Binding In The Nucleosome
 gi|294662525|pdb|3LJA|G Chain G, Using Soft X-Rays For A Detailed Picture Of Divalent Metal
           Binding In The Nucleosome
 gi|299689067|pdb|3KXB|C Chain C, Structural Characterization Of H3k56q Nucleosomes And
           Nucleosomal Arrays
 gi|299689071|pdb|3KXB|G Chain G, Structural Characterization Of H3k56q Nucleosomes And
           Nucleosomal Arrays
 gi|304445923|pdb|3MVD|C Chain C, Crystal Structure Of The Chromatin Factor Rcc1 In Complex
           With The Nucleosome Core Particle
 gi|304445927|pdb|3MVD|G Chain G, Crystal Structure Of The Chromatin Factor Rcc1 In Complex
           With The Nucleosome Core Particle
 gi|358009717|pdb|3TU4|C Chain C, Crystal Structure Of The Sir3 Bah Domain In Complex With A
           Nucleosome Core Particle.
 gi|358009721|pdb|3TU4|G Chain G, Crystal Structure Of The Sir3 Bah Domain In Complex With A
           Nucleosome Core Particle.
 gi|380258856|pdb|3REH|C Chain C, 2.5 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145)
 gi|380258860|pdb|3REH|G Chain G, 2.5 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145)
 gi|380258866|pdb|3REI|C Chain C, 2.65 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 gi|380258870|pdb|3REI|G Chain G, 2.65 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 gi|380258876|pdb|3REJ|C Chain C, 2.55 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b)
 gi|380258880|pdb|3REJ|G Chain G, 2.55 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b)
 gi|380258886|pdb|3REK|C Chain C, 2.6 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Oxaliplatin
 gi|380258890|pdb|3REK|G Chain G, 2.6 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Oxaliplatin
 gi|380258896|pdb|3REL|C Chain C, 2.7 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 gi|380258900|pdb|3REL|G Chain G, 2.7 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 gi|383875537|pdb|3UT9|C Chain C, Crystal Structure Of Nucleosome Core Particle Assembled
           With A Palindromic Widom '601' Derivative (Ncp-601l)
 gi|383875541|pdb|3UT9|G Chain G, Crystal Structure Of Nucleosome Core Particle Assembled
           With A Palindromic Widom '601' Derivative (Ncp-601l)
 gi|383875547|pdb|3UTA|C Chain C, Crystal Structure Of Nucleosome Core Particle Assembled
           With An Alpha- Satellite Sequence Containing Two Ttaaa
           Elements (Ncp-Ta2)
 gi|383875551|pdb|3UTA|G Chain G, Crystal Structure Of Nucleosome Core Particle Assembled
           With An Alpha- Satellite Sequence Containing Two Ttaaa
           Elements (Ncp-Ta2)
 gi|383875557|pdb|3UTB|C Chain C, Crystal Structure Of Nucleosome Core Particle Assembled
           With The 146b Alpha-Satellite Sequence (Ncp146b)
 gi|383875561|pdb|3UTB|G Chain G, Crystal Structure Of Nucleosome Core Particle Assembled
           With The 146b Alpha-Satellite Sequence (Ncp146b)
          Length = 129

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   +A
Sbjct: 83  LQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSA 126



>gi|28948512|pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|28948516|pdb|1M18|G Chain G, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|28948522|pdb|1M19|C Chain C, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|28948526|pdb|1M19|G Chain G, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|28948532|pdb|1M1A|C Chain C, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|28948536|pdb|1M1A|G Chain G, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 gi|46015077|pdb|1P34|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015081|pdb|1P34|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015087|pdb|1P3A|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015091|pdb|1P3A|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015097|pdb|1P3B|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015101|pdb|1P3B|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015107|pdb|1P3F|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015111|pdb|1P3F|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015117|pdb|1P3G|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015121|pdb|1P3G|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015127|pdb|1P3I|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015131|pdb|1P3I|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015137|pdb|1P3K|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015141|pdb|1P3K|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015147|pdb|1P3L|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015151|pdb|1P3L|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015157|pdb|1P3M|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015161|pdb|1P3M|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015167|pdb|1P3O|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015171|pdb|1P3O|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015177|pdb|1P3P|C Chain C, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 gi|46015181|pdb|1P3P|G Chain G, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
          Length = 129

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   +A
Sbjct: 83  LQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSA 126



>gi|122004|sp|P02264.2|H2A_ONCMY RecName: Full=Histone H2A
 gi|64325|emb|CAA25528.1| unnamed protein product [Oncorhynchus mykiss]
          Length = 128

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K   A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKA 127



>gi|513158892|ref|XP_004937732.1| PREDICTED: histone H2A-IV-like [Gallus gallus]
          Length = 211

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 79/106 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 106 LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 165

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK+    A A+
Sbjct: 166 LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKAK 211



>gi|68484777|ref|XP_713700.1| histone H2A [Candida albicans SC5314]
 gi|68484868|ref|XP_713655.1| histone H2A [Candida albicans SC5314]
 gi|241948681|ref|XP_002417063.1| histone H2A, putative [Candida dubliniensis CD36]
 gi|74656213|sp|Q59VP2.3|H2A2_CANAL RecName: Full=Histone H2A.2
 gi|46435163|gb|EAK94551.1| histone H2A [Candida albicans SC5314]
 gi|46435210|gb|EAK94597.1| histone H2A [Candida albicans SC5314]
 gi|223640401|emb|CAX44652.1| histone H2A, putative [Candida dubliniensis CD36]
 gi|238879117|gb|EEQ42755.1| histone H2A.2 [Candida albicans WO-1]
          Length = 131

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/95 (74%), Positives = 75/95 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQR+G+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LTFPVGRVHRLLRKGNYAQRIGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLP 123
           LQLAIRNDEELNKLLG VTIAQGGVLPNIHQ+LLP
Sbjct: 84  LQLAIRNDEELNKLLGDVTIAQGGVLPNIHQSLLP 118



>gi|426398304|gb|AFY26295.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398306|gb|AFY26296.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398308|gb|AFY26297.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398310|gb|AFY26298.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398314|gb|AFY26300.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398316|gb|AFY26301.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398318|gb|AFY26302.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398320|gb|AFY26303.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398322|gb|AFY26304.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398324|gb|AFY26305.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398328|gb|AFY26307.1| histone H2A, partial [Plectorhinchus mediterraneus]
 gi|426398330|gb|AFY26308.1| histone H2A, partial [Plectorhinchus mediterraneus]
          Length = 126

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPA 124



>gi|157137721|ref|XP_001657149.1| histone h2a [Aedes aegypti]
 gi|157137727|ref|XP_001657152.1| histone h2a [Aedes aegypti]
 gi|108880806|gb|EAT45031.1| AAEL003687-PA [Aedes aegypti]
 gi|108880809|gb|EAT45034.1| AAEL003706-PA [Aedes aegypti]
          Length = 124

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|391344330|ref|XP_003746454.1| PREDICTED: uncharacterized protein LOC100903667 [Metaseiulus
           occidentalis]
          Length = 412

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 76/101 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 169 LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 228

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K 
Sbjct: 229 LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKA 269



>gi|225713194|gb|ACO12443.1| Histone H2A [Lepeophtheirus salmonis]
 gi|290462775|gb|ADD24435.1| Histone H2A [Lepeophtheirus salmonis]
 gi|290561583|gb|ADD38191.1| Histone H2A [Lepeophtheirus salmonis]
 gi|290561753|gb|ADD38274.1| Histone H2A [Lepeophtheirus salmonis]
 gi|290562834|gb|ADD38812.1| Histone H2A [Lepeophtheirus salmonis]
          Length = 124

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K +
Sbjct: 83  LQLAIRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTEKSS 124



>gi|149030603|gb|EDL85640.1| rCG51948 [Rattus norvegicus]
 gi|149030604|gb|EDL85641.1| rCG51723 [Rattus norvegicus]
          Length = 135

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|327266435|ref|XP_003218011.1| PREDICTED: histone H2A-like [Anolis carolinensis]
          Length = 169

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 78/99 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGSGAPVYLAAVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNIH  LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGGVTIAQGGVLPNIHAVLLPKKTE 122



>gi|255683313|ref|NP_001157464.1| histone H2A [Acyrthosiphon pisum]
 gi|239791195|dbj|BAH72097.1| ACYPI003877 [Acyrthosiphon pisum]
          Length = 125

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 125



>gi|301626032|ref|XP_002942196.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512886338|ref|XP_002942202.2| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
 gi|512886352|ref|XP_004920491.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKAA 127



>gi|512836670|ref|XP_004913875.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTENSKAA 127



>gi|410914848|ref|XP_003970899.1| PREDICTED: histone H2A type 1-like [Takifugu rubripes]
          Length = 124

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|327266433|ref|XP_003218010.1| PREDICTED: histone H2A-like [Anolis carolinensis]
          Length = 169

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 78/99 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGSGAPVYLAAVLEYLSAEILELAGNAARDNKKSRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNIH  LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGGVTIAQGGVLPNIHAVLLPKKTE 122



>gi|358255296|dbj|GAA57009.1| histone H2A [Clonorchis sinensis]
 gi|358337597|dbj|GAA39720.2| histone H2A [Clonorchis sinensis]
          Length = 125

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 77/100 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK+ K
Sbjct: 83  LQLAIRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTDK 122



>gi|499028371|ref|XP_004564912.1| PREDICTED: histone H2A-like [Maylandia zebra]
          Length = 128

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 80/104 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKA 127



>gi|158298161|ref|XP_318365.3| AGAP003913-PA [Anopheles gambiae str. PEST]
 gi|157014390|gb|EAA13647.3| AGAP003913-PA [Anopheles gambiae str. PEST]
          Length = 124

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKNA 124



>gi|156536997|ref|XP_001608288.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
          Length = 124

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K +
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKSS 124



>gi|344238671|gb|EGV94774.1| Histone H3 [Cricetulus griseus]
          Length = 267

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122



>gi|195373575|ref|XP_002046022.1| GM18786 [Drosophila sechellia]
 gi|194122938|gb|EDW44981.1| GM18786 [Drosophila sechellia]
          Length = 124

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|301623051|ref|XP_002940841.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 168

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 62  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 121

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 122 LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAA 165



>gi|478524318|ref|XP_004436359.1| PREDICTED: core histone macro-H2A.1-like [Ceratotherium simum
           simum]
          Length = 289

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122



>gi|78707122|ref|NP_001027366.1| histone H2A [Drosophila melanogaster]
 gi|78707132|ref|NP_001027371.1| histone H2A [Drosophila melanogaster]
 gi|78707142|ref|NP_001027376.1| histone H2A [Drosophila melanogaster]
 gi|72151604|gb|AAZ66562.1| histone H2A [Drosophila melanogaster]
 gi|72151609|gb|AAZ66567.1| histone H2A [Drosophila melanogaster]
 gi|72151614|gb|AAZ66572.1| histone H2A [Drosophila melanogaster]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|391344261|ref|XP_003746420.1| PREDICTED: histone H3-like [Metaseiulus occidentalis]
          Length = 266

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 76/101 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKG 129
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K 
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKA 123



>gi|152012907|gb|AAI50452.1| Gng5 protein [Danio rerio]
          Length = 127

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYAQRVGAGA                   GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAQRVGAGASVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125



>gi|195371634|ref|XP_002045932.1| GM19643 [Drosophila sechellia]
 gi|194122486|gb|EDW44529.1| GM19643 [Drosophila sechellia]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKEA 124



>gi|195092990|ref|XP_001997683.1| GH23503 [Drosophila grimshawi]
 gi|195092999|ref|XP_001997687.1| GH23505 [Drosophila grimshawi]
 gi|193905901|gb|EDW04768.1| GH23503 [Drosophila grimshawi]
 gi|193905905|gb|EDW04772.1| GH23505 [Drosophila grimshawi]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|157674605|gb|ABV60391.1| histone H2A [Artemia franciscana]
          Length = 136

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 81/106 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHR+L+KGNYA+RVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 23  LQFPVGRIHRMLKKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKSRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++  +A A+
Sbjct: 83  LQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKAEGASAKAK 128



>gi|110749621|ref|XP_001120186.1| PREDICTED: histone H2A-like [Apis mellifera]
 gi|340708716|ref|XP_003392968.1| PREDICTED: histone H2A-like [Bombus terrestris]
 gi|350413028|ref|XP_003489852.1| PREDICTED: histone H2A-like [Bombus impatiens]
 gi|380028621|ref|XP_003697993.1| PREDICTED: histone H2A-like [Apis florea]
 gi|307188059|gb|EFN72891.1| Histone H2A [Camponotus floridanus]
 gi|307188079|gb|EFN72911.1| Histone H2A [Camponotus floridanus]
 gi|307194493|gb|EFN76785.1| Histone H2A [Harpegnathos saltator]
 gi|307206936|gb|EFN84780.1| Histone H2A [Harpegnathos saltator]
 gi|322791474|gb|EFZ15871.1| hypothetical protein SINV_05046 [Solenopsis invicta]
 gi|332020073|gb|EGI60519.1| Histone H2A [Acromyrmex echinatior]
 gi|332020075|gb|EGI60521.1| Histone H2A [Acromyrmex echinatior]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|328791683|ref|XP_003251613.1| PREDICTED: histone H2A-like isoform 1 [Apis mellifera]
 gi|328791685|ref|XP_003251614.1| PREDICTED: histone H2A-like isoform 2 [Apis mellifera]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|110749634|ref|XP_001120346.1| PREDICTED: histone H2A-like [Apis mellifera]
 gi|340708722|ref|XP_003392971.1| PREDICTED: histone H2A-like [Bombus terrestris]
 gi|350413037|ref|XP_003489855.1| PREDICTED: histone H2A-like [Bombus impatiens]
 gi|380028619|ref|XP_003697992.1| PREDICTED: histone H2A-like [Apis florea]
 gi|307170632|gb|EFN62816.1| Histone H2A [Camponotus floridanus]
 gi|332023312|gb|EGI63566.1| Histone H2A [Acromyrmex echinatior]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|24585673|ref|NP_724343.1| histone H2A [Drosophila melanogaster]
 gi|78706974|ref|NP_001027292.1| histone H2A [Drosophila melanogaster]
 gi|78706992|ref|NP_001027301.1| histone H2A [Drosophila melanogaster]
 gi|78707002|ref|NP_001027306.1| histone H2A [Drosophila melanogaster]
 gi|78707012|ref|NP_001027311.1| histone H2A [Drosophila melanogaster]
 gi|78707022|ref|NP_001027316.1| histone H2A [Drosophila melanogaster]
 gi|78707032|ref|NP_001027321.1| histone H2A [Drosophila melanogaster]
 gi|78707042|ref|NP_001027326.1| histone H2A [Drosophila melanogaster]
 gi|78707052|ref|NP_001027331.1| histone H2A [Drosophila melanogaster]
 gi|78707062|ref|NP_001027336.1| histone H2A [Drosophila melanogaster]
 gi|78707072|ref|NP_001027341.1| histone H2A [Drosophila melanogaster]
 gi|78707082|ref|NP_001027346.1| histone H2A [Drosophila melanogaster]
 gi|78707092|ref|NP_001027351.1| histone H2A [Drosophila melanogaster]
 gi|78707102|ref|NP_001027356.1| histone H2A [Drosophila melanogaster]
 gi|78707112|ref|NP_001027361.1| histone H2A [Drosophila melanogaster]
 gi|78707152|ref|NP_001027381.1| histone H2A [Drosophila melanogaster]
 gi|78707162|ref|NP_001027386.1| histone H2A [Drosophila melanogaster]
 gi|31194617|ref|XP_306256.1| AGAP012895-PA [Anopheles gambiae str. PEST]
 gi|157114926|ref|XP_001652489.1| histone h2a [Aedes aegypti]
 gi|157137030|ref|XP_001656984.1| histone h2a [Aedes aegypti]
 gi|157137038|ref|XP_001656988.1| histone h2a [Aedes aegypti]
 gi|157137046|ref|XP_001656992.1| histone h2a [Aedes aegypti]
 gi|157137054|ref|XP_001656996.1| histone h2a [Aedes aegypti]
 gi|157138374|ref|XP_001657264.1| histone h2a [Aedes aegypti]
 gi|157138380|ref|XP_001657267.1| histone h2a [Aedes aegypti]
 gi|157138388|ref|XP_001657271.1| histone h2a [Aedes aegypti]
 gi|157138402|ref|XP_001657278.1| histone h2a [Aedes aegypti]
 gi|158284459|ref|XP_307083.3| Anopheles gambiae str. PEST AGAP012711-PA [Anopheles gambiae str.
           PEST]
 gi|170053402|ref|XP_001862656.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053423|ref|XP_001862666.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|170053434|ref|XP_001862671.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|170053442|ref|XP_001862675.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053451|ref|XP_001862679.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|170053461|ref|XP_001862684.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|170053469|ref|XP_001862688.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|170053484|ref|XP_001862695.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|170053489|ref|XP_001862697.1| histone H2A type 1-A [Culex quinquefasciatus]
 gi|170053497|ref|XP_001862701.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053507|ref|XP_001862706.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|170053516|ref|XP_001862710.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053524|ref|XP_001862714.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053533|ref|XP_001862718.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|170053541|ref|XP_001862722.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|170053549|ref|XP_001862726.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|170053558|ref|XP_001862730.1| histone H2A type 1-A [Culex quinquefasciatus]
 gi|194765377|ref|XP_001964803.1| GF22315 [Drosophila ananassae]
 gi|194765387|ref|XP_001964808.1| GF22283 [Drosophila ananassae]
 gi|194765397|ref|XP_001964813.1| GF22255 [Drosophila ananassae]
 gi|194765407|ref|XP_001964818.1| GF22222 [Drosophila ananassae]
 gi|194771406|ref|XP_001967675.1| GF15889 [Drosophila ananassae]
 gi|194771416|ref|XP_001967680.1| GF15886 [Drosophila ananassae]
 gi|194771985|ref|XP_001967727.1| GF15921 [Drosophila ananassae]
 gi|194772403|ref|XP_001967749.1| GF18981 [Drosophila ananassae]
 gi|194773530|ref|XP_001967773.1| GF19280 [Drosophila ananassae]
 gi|194774275|ref|XP_001967816.1| GF22857 [Drosophila ananassae]
 gi|194776924|ref|XP_001967856.1| GF20678 [Drosophila ananassae]
 gi|194778243|ref|XP_001967871.1| GF19309 [Drosophila ananassae]
 gi|194778794|ref|XP_001967877.1| GF23424 [Drosophila ananassae]
 gi|194779667|ref|XP_001967884.1| GF20650 [Drosophila ananassae]
 gi|194780205|ref|XP_001967890.1| GF20540 [Drosophila ananassae]
 gi|194782134|ref|XP_001967916.1| GF21515 [Drosophila ananassae]
 gi|194782256|ref|XP_001967917.1| GF11019 [Drosophila ananassae]
 gi|194783481|ref|XP_001967931.1| GF21520 [Drosophila ananassae]
 gi|194878052|ref|XP_001973990.1| GG21332 [Drosophila erecta]
 gi|194878145|ref|XP_001974005.1| GG21322 [Drosophila erecta]
 gi|194878171|ref|XP_001974010.1| GG21319 [Drosophila erecta]
 gi|194878205|ref|XP_001974015.1| GG21315 [Drosophila erecta]
 gi|194878227|ref|XP_001974020.1| GG21312 [Drosophila erecta]
 gi|194878249|ref|XP_001974025.1| GG21309 [Drosophila erecta]
 gi|194878270|ref|XP_001974030.1| GG21305 [Drosophila erecta]
 gi|194915930|ref|XP_001982890.1| GG11013 [Drosophila erecta]
 gi|194915940|ref|XP_001982895.1| GG11009 [Drosophila erecta]
 gi|194915950|ref|XP_001982900.1| GG11006 [Drosophila erecta]
 gi|194915960|ref|XP_001982905.1| GG11003 [Drosophila erecta]
 gi|194915981|ref|XP_001982914.1| GG13026 [Drosophila erecta]
 gi|194915991|ref|XP_001982919.1| GG13022 [Drosophila erecta]
 gi|194916001|ref|XP_001982924.1| GG13019 [Drosophila erecta]
 gi|194916011|ref|XP_001982929.1| GG13016 [Drosophila erecta]
 gi|194916136|ref|XP_001982950.1| GG12577 [Drosophila erecta]
 gi|194916146|ref|XP_001982955.1| GG12574 [Drosophila erecta]
 gi|194916497|ref|XP_001983003.1| GG19849 [Drosophila erecta]
 gi|194916507|ref|XP_001983008.1| GG19852 [Drosophila erecta]
 gi|194916651|ref|XP_001983019.1| GG18465 [Drosophila erecta]
 gi|194916661|ref|XP_001983024.1| GG18133 [Drosophila erecta]
 gi|194922368|ref|XP_001983054.1| GG10951 [Drosophila erecta]
 gi|194922696|ref|XP_001983058.1| GG16371 [Drosophila erecta]
 gi|194924312|ref|XP_001983068.1| GG19829 [Drosophila erecta]
 gi|194927750|ref|XP_001983094.1| GG12989 [Drosophila erecta]
 gi|194932282|ref|XP_001983098.1| GG10964 [Drosophila erecta]
 gi|194935003|ref|XP_001983103.1| GG13060 [Drosophila erecta]
 gi|194936249|ref|XP_001983107.1| GG19786 [Drosophila erecta]
 gi|194947745|ref|XP_001983147.1| GG19797 [Drosophila erecta]
 gi|194949355|ref|XP_001983153.1| GG19840 [Drosophila erecta]
 gi|195063397|ref|XP_001996374.1| GH25147 [Drosophila grimshawi]
 gi|195063423|ref|XP_001996379.1| GH25151 [Drosophila grimshawi]
 gi|195063449|ref|XP_001996384.1| GH25154 [Drosophila grimshawi]
 gi|195063473|ref|XP_001996389.1| GH25157 [Drosophila grimshawi]
 gi|195063495|ref|XP_001996393.1| GH25159 [Drosophila grimshawi]
 gi|195063516|ref|XP_001996397.1| GH25161 [Drosophila grimshawi]
 gi|195063540|ref|XP_001996402.1| GH25164 [Drosophila grimshawi]
 gi|195063568|ref|XP_001996407.1| GH25167 [Drosophila grimshawi]
 gi|195063599|ref|XP_001996412.1| GH25172 [Drosophila grimshawi]
 gi|195063623|ref|XP_001996417.1| GH25175 [Drosophila grimshawi]
 gi|195063665|ref|XP_001996424.1| GH25178 [Drosophila grimshawi]
 gi|195063698|ref|XP_001996429.1| GH25181 [Drosophila grimshawi]
 gi|195063718|ref|XP_001996433.1| GH25184 [Drosophila grimshawi]
 gi|195063741|ref|XP_001996437.1| GH25186 [Drosophila grimshawi]
 gi|195066359|ref|XP_001996800.1| GH23343 [Drosophila grimshawi]
 gi|195066371|ref|XP_001996802.1| GH23340 [Drosophila grimshawi]
 gi|195066416|ref|XP_001996807.1| GH23337 [Drosophila grimshawi]
 gi|195066434|ref|XP_001996811.1| GH23335 [Drosophila grimshawi]
 gi|195066469|ref|XP_001996818.1| GH23330 [Drosophila grimshawi]
 gi|195075582|ref|XP_001997178.1| GH23878 [Drosophila grimshawi]
 gi|195075610|ref|XP_001997182.1| GH23875 [Drosophila grimshawi]
 gi|195084893|ref|XP_001997408.1| GH23766 [Drosophila grimshawi]
 gi|195084917|ref|XP_001997412.1| GH23763 [Drosophila grimshawi]
 gi|195095129|ref|XP_001997829.1| GH23491 [Drosophila grimshawi]
 gi|195095870|ref|XP_001997851.1| GH22494 [Drosophila grimshawi]
 gi|195096467|ref|XP_001997881.1| GH23787 [Drosophila grimshawi]
 gi|195096606|ref|XP_001997887.1| GH24356 [Drosophila grimshawi]
 gi|195097911|ref|XP_001997924.1| GH11740 [Drosophila grimshawi]
 gi|195097965|ref|XP_001997927.1| GH13008 [Drosophila grimshawi]
 gi|195098765|ref|XP_001997948.1| GH23897 [Drosophila grimshawi]
 gi|195100284|ref|XP_001998008.1| GH12409 [Drosophila grimshawi]
 gi|195100833|ref|XP_001998031.1| GH11738 [Drosophila grimshawi]
 gi|195102537|ref|XP_001998087.1| GH24049 [Drosophila grimshawi]
 gi|195108389|ref|XP_001998775.1| GI23445 [Drosophila mojavensis]
 gi|195108393|ref|XP_001998777.1| GI23444 [Drosophila mojavensis]
 gi|195108401|ref|XP_001998781.1| GI23441 [Drosophila mojavensis]
 gi|195108409|ref|XP_001998785.1| GI23439 [Drosophila mojavensis]
 gi|195115300|ref|XP_002002199.1| GI17250 [Drosophila mojavensis]
 gi|195115308|ref|XP_002002203.1| GI17252 [Drosophila mojavensis]
 gi|195115316|ref|XP_002002207.1| GI17254 [Drosophila mojavensis]
 gi|195116897|ref|XP_002002988.1| GI24878 [Drosophila mojavensis]
 gi|195137133|ref|XP_002012535.1| GI16892 [Drosophila mojavensis]
 gi|195137421|ref|XP_002012560.1| GI21877 [Drosophila mojavensis]
 gi|195139252|ref|XP_002012647.1| GI14523 [Drosophila mojavensis]
 gi|195144266|ref|XP_002013117.1| GL23950 [Drosophila persimilis]
 gi|195144276|ref|XP_002013122.1| GL23953 [Drosophila persimilis]
 gi|195144288|ref|XP_002013128.1| GL23957 [Drosophila persimilis]
 gi|195144298|ref|XP_002013133.1| GL23960 [Drosophila persimilis]
 gi|195144308|ref|XP_002013138.1| GL23963 [Drosophila persimilis]
 gi|195177527|ref|XP_002028919.1| GL17085 [Drosophila persimilis]
 gi|195178711|ref|XP_002029058.1| GL17803 [Drosophila persimilis]
 gi|195356614|ref|XP_002044754.1| GM19718 [Drosophila sechellia]
 gi|195356634|ref|XP_002044764.1| GM19725 [Drosophila sechellia]
 gi|195356642|ref|XP_002044768.1| GM19728 [Drosophila sechellia]
 gi|195357155|ref|XP_002044958.1| GM13195 [Drosophila sechellia]
 gi|195357413|ref|XP_002045026.1| GM11712 [Drosophila sechellia]
 gi|195357419|ref|XP_002045029.1| GM11710 [Drosophila sechellia]
 gi|195357429|ref|XP_002045034.1| GM11707 [Drosophila sechellia]
 gi|195357484|ref|XP_002045049.1| GM13546 [Drosophila sechellia]
 gi|195357498|ref|XP_002045051.1| GM22315 [Drosophila sechellia]
 gi|195357516|ref|XP_002045060.1| GM21848 [Drosophila sechellia]
 gi|195357655|ref|XP_002045099.1| GM19742 [Drosophila sechellia]
 gi|195357708|ref|XP_002045107.1| GM16186 [Drosophila sechellia]
 gi|195357905|ref|XP_002045139.1| GM13169 [Drosophila sechellia]
 gi|195358749|ref|XP_002045247.1| GM10574 [Drosophila sechellia]
 gi|195358849|ref|XP_002045257.1| GM13581 [Drosophila sechellia]
 gi|195359359|ref|XP_002045359.1| GM11168 [Drosophila sechellia]
 gi|195359383|ref|XP_002045362.1| GM11993 [Drosophila sechellia]
 gi|195359391|ref|XP_002045366.1| GM12275 [Drosophila sechellia]
 gi|195359509|ref|XP_002045392.1| GM11180 [Drosophila sechellia]
 gi|195361321|ref|XP_002045482.1| GM19610 [Drosophila sechellia]
 gi|195361387|ref|XP_002045488.1| GM19350 [Drosophila sechellia]
 gi|195361490|ref|XP_002045495.1| GM13001 [Drosophila sechellia]
 gi|195361794|ref|XP_002045520.1| GM16231 [Drosophila sechellia]
 gi|195362100|ref|XP_002045534.1| GM11111 [Drosophila sechellia]
 gi|195362517|ref|XP_002045550.1| GM18816 [Drosophila sechellia]
 gi|195363029|ref|XP_002045568.1| GM19339 [Drosophila sechellia]
 gi|195366594|ref|XP_002045687.1| GM20018 [Drosophila sechellia]
 gi|195366919|ref|XP_002045705.1| GM13214 [Drosophila sechellia]
 gi|195367254|ref|XP_002045723.1| GM16864 [Drosophila sechellia]
 gi|195368065|ref|XP_002045762.1| GM13526 [Drosophila sechellia]
 gi|195368077|ref|XP_002045765.1| GM16390 [Drosophila sechellia]
 gi|195368287|ref|XP_002045776.1| GM13613 [Drosophila sechellia]
 gi|195368483|ref|XP_002045785.1| GM19441 [Drosophila sechellia]
 gi|195368897|ref|XP_002045815.1| GM13661 [Drosophila sechellia]
 gi|195368982|ref|XP_002045819.1| GM22145 [Drosophila sechellia]
 gi|195369002|ref|XP_002045821.1| GM12951 [Drosophila sechellia]
 gi|195369631|ref|XP_002045845.1| GM17440 [Drosophila sechellia]
 gi|195370576|ref|XP_002045891.1| GM16162 [Drosophila sechellia]
 gi|195370611|ref|XP_002045892.1| GM22499 [Drosophila sechellia]
 gi|195370948|ref|XP_002045903.1| GM16102 [Drosophila sechellia]
 gi|195371029|ref|XP_002045909.1| GM16544 [Drosophila sechellia]
 gi|195372077|ref|XP_002045945.1| GM19320 [Drosophila sechellia]
 gi|195372498|ref|XP_002045968.1| GM11651 [Drosophila sechellia]
 gi|195372861|ref|XP_002045984.1| GM16545 [Drosophila sechellia]
 gi|195373793|ref|XP_002046031.1| GM12072 [Drosophila sechellia]
 gi|195373874|ref|XP_002046038.1| GM22645 [Drosophila sechellia]
 gi|195387159|ref|XP_002052267.1| GJ22574 [Drosophila virilis]
 gi|195388848|ref|XP_002053090.1| GJ23691 [Drosophila virilis]
 gi|195388856|ref|XP_002053094.1| GJ23693 [Drosophila virilis]
 gi|195388866|ref|XP_002053099.1| GJ23696 [Drosophila virilis]
 gi|195388892|ref|XP_002053112.1| GJ23704 [Drosophila virilis]
 gi|195388900|ref|XP_002053116.1| GJ23706 [Drosophila virilis]
 gi|195388908|ref|XP_002053120.1| GJ23710 [Drosophila virilis]
 gi|195403910|ref|XP_002060408.1| GJ15447 [Drosophila virilis]
 gi|195404096|ref|XP_002060426.1| GJ16345 [Drosophila virilis]
 gi|195404335|ref|XP_002060454.1| GJ19813 [Drosophila virilis]
 gi|195404650|ref|XP_002060473.1| GJ14624 [Drosophila virilis]
 gi|195404700|ref|XP_002060475.1| GJ18400 [Drosophila virilis]
 gi|195405042|ref|XP_002060487.1| GJ19570 [Drosophila virilis]
 gi|195405510|ref|XP_002060495.1| GJ19814 [Drosophila virilis]
 gi|195405575|ref|XP_002060497.1| GJ15163 [Drosophila virilis]
 gi|195405973|ref|XP_002060506.1| GJ14620 [Drosophila virilis]
 gi|195405986|ref|XP_002060508.1| GJ17835 [Drosophila virilis]
 gi|195407025|ref|XP_002060516.1| GJ19786 [Drosophila virilis]
 gi|195408091|ref|XP_002060524.1| GJ16341 [Drosophila virilis]
 gi|195408328|ref|XP_002060527.1| GJ11134 [Drosophila virilis]
 gi|195410888|ref|XP_002060541.1| GJ14581 [Drosophila virilis]
 gi|195412627|ref|XP_002060557.1| GJ15536 [Drosophila virilis]
 gi|195413400|ref|XP_002060562.1| GJ19233 [Drosophila virilis]
 gi|195442970|ref|XP_002069213.1| GK10382 [Drosophila willistoni]
 gi|195458744|ref|XP_002075765.1| GK23626 [Drosophila willistoni]
 gi|195464524|ref|XP_002075922.1| GK18500 [Drosophila willistoni]
 gi|195507364|ref|XP_002087242.1| GE15127 [Drosophila yakuba]
 gi|195509860|ref|XP_002087344.1| GE14578 [Drosophila yakuba]
 gi|195555860|ref|XP_002077176.1| GD24267 [Drosophila simulans]
 gi|195555872|ref|XP_002077177.1| GD24022 [Drosophila simulans]
 gi|195556123|ref|XP_002077189.1| GD24469 [Drosophila simulans]
 gi|195558985|ref|XP_002077325.1| GD20328 [Drosophila simulans]
 gi|195560688|ref|XP_002077423.1| GD13555 [Drosophila simulans]
 gi|195560749|ref|XP_002077426.1| GD18538 [Drosophila simulans]
 gi|195560993|ref|XP_002077440.1| GD13905 [Drosophila simulans]
 gi|195561651|ref|XP_002077485.1| GD15331 [Drosophila simulans]
 gi|195562255|ref|XP_002077496.1| GD14669 [Drosophila simulans]
 gi|195563539|ref|XP_002077552.1| GD20626 [Drosophila simulans]
 gi|195564205|ref|XP_002077573.1| GD16082 [Drosophila simulans]
 gi|195565909|ref|XP_002106538.1| GD16944 [Drosophila simulans]
 gi|50402136|sp|P84051.2|H2A_DROME RecName: Full=Histone H2A
 gi|50402137|sp|P84052.2|H2A_DROER RecName: Full=Histone H2A
 gi|50402138|sp|P84053.2|H2A_DROHY RecName: Full=Histone H2A
 gi|50402139|sp|P84054.2|H2A_DROSI RecName: Full=Histone H2A
 gi|50402140|sp|P84055.2|H2A_DROYA RecName: Full=Histone H2A
 gi|50402141|sp|P84056.2|H2A_RHYAM RecName: Full=Histone H2A
 gi|50402142|sp|P84057.2|H2A_TIGCA RecName: Full=Histone H2A
 gi|14269421|gb|AAK58063.1|AF378198_3 histone H2A [Rhynchosciara americana]
 gi|7435|emb|CAA36807.1| histone H2a [Drosophila hydei]
 gi|7441|emb|CAA34921.1| unnamed protein product [Drosophila hydei]
 gi|161898|gb|AAC41555.1| histone H2A [Tigriopus californicus]
 gi|260528|gb|AAA12278.1| histone H2A [Tigriopus californicus]
 gi|22947017|gb|AAN11125.1| histone H2A [Drosophila melanogaster]
 gi|27530979|dbj|BAC54548.1| histone 2A [Drosophila simulans]
 gi|27530984|dbj|BAC54552.1| histone 2A [Drosophila erecta]
 gi|27530989|dbj|BAC54556.1| histone 2A [Drosophila yakuba]
 gi|30179522|gb|EAA02465.2| AGAP012895-PA [Anopheles gambiae str. PEST]
 gi|38564152|dbj|BAD02421.1| histone 2A [Drosophila yakuba]
 gi|38564157|dbj|BAD02425.1| histone 2A [Drosophila teissieri]
 gi|38564162|dbj|BAD02429.1| histone 2A [Drosophila orena]
 gi|38564167|dbj|BAD02433.1| histone 2A [Drosophila mauritiana]
 gi|38564172|dbj|BAD02437.1| histone 2A [Drosophila sechellia]
 gi|38564182|dbj|BAD02445.1| histone 2A [Drosophila sechellia]
 gi|72151530|gb|AAZ66488.1| histone H2A [Drosophila melanogaster]
 gi|72151539|gb|AAZ66497.1| histone H2A [Drosophila melanogaster]
 gi|72151544|gb|AAZ66502.1| histone H2A [Drosophila melanogaster]
 gi|72151549|gb|AAZ66507.1| histone H2A [Drosophila melanogaster]
 gi|72151554|gb|AAZ66512.1| histone H2A [Drosophila melanogaster]
 gi|72151559|gb|AAZ66517.1| histone H2A [Drosophila melanogaster]
 gi|72151564|gb|AAZ66522.1| histone H2A [Drosophila melanogaster]
 gi|72151569|gb|AAZ66527.1| histone H2A [Drosophila melanogaster]
 gi|72151574|gb|AAZ66532.1| histone H2A [Drosophila melanogaster]
 gi|72151579|gb|AAZ66537.1| histone H2A [Drosophila melanogaster]
 gi|72151584|gb|AAZ66542.1| histone H2A [Drosophila melanogaster]
 gi|72151589|gb|AAZ66547.1| histone H2A [Drosophila melanogaster]
 gi|72151594|gb|AAZ66552.1| histone H2A [Drosophila melanogaster]
 gi|72151599|gb|AAZ66557.1| histone H2A [Drosophila melanogaster]
 gi|72151619|gb|AAZ66577.1| histone H2A [Drosophila melanogaster]
 gi|72151624|gb|AAZ66582.1| histone H2A [Drosophila melanogaster]
 gi|108877119|gb|EAT41344.1| AAEL007005-PA [Aedes aegypti]
 gi|108880583|gb|EAT44808.1| AAEL003818-PA [Aedes aegypti]
 gi|108880586|gb|EAT44811.1| AAEL003826-PA [Aedes aegypti]
 gi|108880590|gb|EAT44815.1| AAEL003851-PA [Aedes aegypti]
 gi|108880597|gb|EAT44822.1| AAEL003862-PA [Aedes aegypti]
 gi|108884251|gb|EAT48476.1| AAEL000518-PA [Aedes aegypti]
 gi|108884255|gb|EAT48480.1| AAEL000494-PA [Aedes aegypti]
 gi|108884259|gb|EAT48484.1| AAEL000525-PA [Aedes aegypti]
 gi|108884263|gb|EAT48488.1| AAEL000497-PA [Aedes aegypti]
 gi|144226133|dbj|BAF56190.1| histone 2A [Drosophila americana]
 gi|144226139|dbj|BAF56195.1| histone 2A [Drosophila americana]
 gi|157021047|gb|EAA02894.3| AGAP012711-PA [Anopheles gambiae str. PEST]
 gi|167873965|gb|EDS37348.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167873975|gb|EDS37358.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|167873980|gb|EDS37363.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|167873984|gb|EDS37367.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167873988|gb|EDS37371.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|167873993|gb|EDS37376.1| late histone H2A.3 [Culex quinquefasciatus]
 gi|167873997|gb|EDS37380.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|167874004|gb|EDS37387.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|167874006|gb|EDS37389.1| histone H2A type 1-A [Culex quinquefasciatus]
 gi|167874010|gb|EDS37393.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167874015|gb|EDS37398.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|167874019|gb|EDS37402.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167874023|gb|EDS37406.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167874027|gb|EDS37410.1| histone H2A type 1-C [Culex quinquefasciatus]
 gi|167874031|gb|EDS37414.1| late histone H2A.L3 [Culex quinquefasciatus]
 gi|167874035|gb|EDS37418.1| histone H2A type 2-B [Culex quinquefasciatus]
 gi|167874039|gb|EDS37422.1| histone H2A type 1-A [Culex quinquefasciatus]
 gi|190617413|gb|EDV32937.1| GF22315 [Drosophila ananassae]
 gi|190617418|gb|EDV32942.1| GF22283 [Drosophila ananassae]
 gi|190617423|gb|EDV32947.1| GF22255 [Drosophila ananassae]
 gi|190617428|gb|EDV32952.1| GF22222 [Drosophila ananassae]
 gi|190618145|gb|EDV33669.1| GF15889 [Drosophila ananassae]
 gi|190618150|gb|EDV33674.1| GF15886 [Drosophila ananassae]
 gi|190629394|gb|EDV44811.1| GF19309 [Drosophila ananassae]
 gi|190629405|gb|EDV44822.1| GF11019 [Drosophila ananassae]
 gi|190630410|gb|EDV44827.1| GF20650 [Drosophila ananassae]
 gi|190630415|gb|EDV44832.1| GF21520 [Drosophila ananassae]
 gi|190631443|gb|EDV44860.1| GF15921 [Drosophila ananassae]
 gi|190631472|gb|EDV44889.1| GF20540 [Drosophila ananassae]
 gi|190631477|gb|EDV44894.1| GF21515 [Drosophila ananassae]
 gi|190631486|gb|EDV44903.1| GF23424 [Drosophila ananassae]
 gi|190631493|gb|EDV44910.1| GF20678 [Drosophila ananassae]
 gi|190631515|gb|EDV44932.1| GF22857 [Drosophila ananassae]
 gi|190631542|gb|EDV44959.1| GF19280 [Drosophila ananassae]
 gi|190632559|gb|EDV44976.1| GF18981 [Drosophila ananassae]
 gi|190647661|gb|EDV45042.1| GG19840 [Drosophila erecta]
 gi|190647686|gb|EDV45056.1| GG18465 [Drosophila erecta]
 gi|190647691|gb|EDV45061.1| GG18133 [Drosophila erecta]
 gi|190647715|gb|EDV45075.1| GG13060 [Drosophila erecta]
 gi|190647722|gb|EDV45080.1| GG19849 [Drosophila erecta]
 gi|190647727|gb|EDV45085.1| GG19852 [Drosophila erecta]
 gi|190647747|gb|EDV45097.1| GG12989 [Drosophila erecta]
 gi|190647753|gb|EDV45101.1| GG10951 [Drosophila erecta]
 gi|190647778|gb|EDV45118.1| GG13026 [Drosophila erecta]
 gi|190647783|gb|EDV45123.1| GG13022 [Drosophila erecta]
 gi|190647788|gb|EDV45128.1| GG13019 [Drosophila erecta]
 gi|190647793|gb|EDV45133.1| GG13016 [Drosophila erecta]
 gi|190647866|gb|EDV45182.1| GG19797 [Drosophila erecta]
 gi|190647880|gb|EDV45189.1| GG19829 [Drosophila erecta]
 gi|190647998|gb|EDV45296.1| GG12577 [Drosophila erecta]
 gi|190648003|gb|EDV45301.1| GG12574 [Drosophila erecta]
 gi|190648010|gb|EDV45306.1| GG11013 [Drosophila erecta]
 gi|190648015|gb|EDV45311.1| GG11009 [Drosophila erecta]
 gi|190648020|gb|EDV45316.1| GG11006 [Drosophila erecta]
 gi|190648025|gb|EDV45321.1| GG11003 [Drosophila erecta]
 gi|190648039|gb|EDV45333.1| GG16371 [Drosophila erecta]
 gi|190657177|gb|EDV54390.1| GG21332 [Drosophila erecta]
 gi|190657192|gb|EDV54405.1| GG21322 [Drosophila erecta]
 gi|190657197|gb|EDV54410.1| GG21319 [Drosophila erecta]
 gi|190657202|gb|EDV54415.1| GG21315 [Drosophila erecta]
 gi|190657207|gb|EDV54420.1| GG21312 [Drosophila erecta]
 gi|190657212|gb|EDV54425.1| GG21309 [Drosophila erecta]
 gi|190657217|gb|EDV54430.1| GG21305 [Drosophila erecta]
 gi|190662852|gb|EDV60035.1| GG10964 [Drosophila erecta]
 gi|190662865|gb|EDV60040.1| GG19786 [Drosophila erecta]
 gi|193891445|gb|EDV90311.1| GH24049 [Drosophila grimshawi]
 gi|193891458|gb|EDV90324.1| GH11738 [Drosophila grimshawi]
 gi|193895144|gb|EDV94010.1| GH23343 [Drosophila grimshawi]
 gi|193895146|gb|EDV94012.1| GH23340 [Drosophila grimshawi]
 gi|193895151|gb|EDV94017.1| GH23337 [Drosophila grimshawi]
 gi|193895155|gb|EDV94021.1| GH23335 [Drosophila grimshawi]
 gi|193895162|gb|EDV94028.1| GH23330 [Drosophila grimshawi]
 gi|193895239|gb|EDV94105.1| GH25147 [Drosophila grimshawi]
 gi|193895244|gb|EDV94110.1| GH25151 [Drosophila grimshawi]
 gi|193895249|gb|EDV94115.1| GH25154 [Drosophila grimshawi]
 gi|193895254|gb|EDV94120.1| GH25157 [Drosophila grimshawi]
 gi|193895258|gb|EDV94124.1| GH25159 [Drosophila grimshawi]
 gi|193895262|gb|EDV94128.1| GH25161 [Drosophila grimshawi]
 gi|193895267|gb|EDV94133.1| GH25164 [Drosophila grimshawi]
 gi|193895272|gb|EDV94138.1| GH25167 [Drosophila grimshawi]
 gi|193895277|gb|EDV94143.1| GH25172 [Drosophila grimshawi]
 gi|193895282|gb|EDV94148.1| GH25175 [Drosophila grimshawi]
 gi|193895289|gb|EDV94155.1| GH25178 [Drosophila grimshawi]
 gi|193895294|gb|EDV94160.1| GH25181 [Drosophila grimshawi]
 gi|193895298|gb|EDV94164.1| GH25184 [Drosophila grimshawi]
 gi|193895302|gb|EDV94168.1| GH25186 [Drosophila grimshawi]
 gi|193900636|gb|EDV99502.1| GH22494 [Drosophila grimshawi]
 gi|193905538|gb|EDW04405.1| GH23787 [Drosophila grimshawi]
 gi|193905542|gb|EDW04409.1| GH23897 [Drosophila grimshawi]
 gi|193905644|gb|EDW04511.1| GH23766 [Drosophila grimshawi]
 gi|193905648|gb|EDW04515.1| GH23763 [Drosophila grimshawi]
 gi|193905842|gb|EDW04709.1| GH12409 [Drosophila grimshawi]
 gi|193905849|gb|EDW04716.1| GH11740 [Drosophila grimshawi]
 gi|193905857|gb|EDW04724.1| GH23491 [Drosophila grimshawi]
 gi|193905862|gb|EDW04729.1| GH13008 [Drosophila grimshawi]
 gi|193905932|gb|EDW04799.1| GH24356 [Drosophila grimshawi]
 gi|193906171|gb|EDW05038.1| GH23878 [Drosophila grimshawi]
 gi|193906175|gb|EDW05042.1| GH23875 [Drosophila grimshawi]
 gi|193906443|gb|EDW05310.1| GI21877 [Drosophila mojavensis]
 gi|193912774|gb|EDW11641.1| GI17250 [Drosophila mojavensis]
 gi|193912778|gb|EDW11645.1| GI17252 [Drosophila mojavensis]
 gi|193912782|gb|EDW11649.1| GI17254 [Drosophila mojavensis]
 gi|193913563|gb|EDW12430.1| GI24878 [Drosophila mojavensis]
 gi|193915369|gb|EDW14236.1| GI23445 [Drosophila mojavensis]
 gi|193915371|gb|EDW14238.1| GI23444 [Drosophila mojavensis]
 gi|193915375|gb|EDW14242.1| GI23441 [Drosophila mojavensis]
 gi|193915379|gb|EDW14246.1| GI23439 [Drosophila mojavensis]
 gi|193918205|gb|EDW17072.1| GI14523 [Drosophila mojavensis]
 gi|193920954|gb|EDW19821.1| GI16892 [Drosophila mojavensis]
 gi|194102060|gb|EDW24103.1| GL23950 [Drosophila persimilis]
 gi|194102065|gb|EDW24108.1| GL23953 [Drosophila persimilis]
 gi|194102071|gb|EDW24114.1| GL23957 [Drosophila persimilis]
 gi|194102076|gb|EDW24119.1| GL23960 [Drosophila persimilis]
 gi|194102081|gb|EDW24124.1| GL23963 [Drosophila persimilis]
 gi|194104895|gb|EDW26938.1| GL17803 [Drosophila persimilis]
 gi|194107341|gb|EDW29384.1| GL17085 [Drosophila persimilis]
 gi|194121561|gb|EDW43604.1| GM17440 [Drosophila sechellia]
 gi|194122040|gb|EDW44083.1| GM16162 [Drosophila sechellia]
 gi|194122044|gb|EDW44087.1| GM22499 [Drosophila sechellia]
 gi|194122068|gb|EDW44111.1| GM16102 [Drosophila sechellia]
 gi|194122077|gb|EDW44120.1| GM16544 [Drosophila sechellia]
 gi|194122519|gb|EDW44562.1| GM19320 [Drosophila sechellia]
 gi|194122555|gb|EDW44598.1| GM11651 [Drosophila sechellia]
 gi|194122882|gb|EDW44925.1| GM16545 [Drosophila sechellia]
 gi|194123214|gb|EDW45257.1| GM12072 [Drosophila sechellia]
 gi|194123222|gb|EDW45265.1| GM22645 [Drosophila sechellia]
 gi|194126846|gb|EDW48889.1| GM10574 [Drosophila sechellia]
 gi|194126996|gb|EDW49039.1| GM13195 [Drosophila sechellia]
 gi|194127113|gb|EDW49156.1| GM13581 [Drosophila sechellia]
 gi|194127708|gb|EDW49751.1| GM19610 [Drosophila sechellia]
 gi|194127721|gb|EDW49764.1| GM19350 [Drosophila sechellia]
 gi|194128842|gb|EDW50885.1| GM13001 [Drosophila sechellia]
 gi|194129055|gb|EDW51098.1| GM16231 [Drosophila sechellia]
 gi|194129326|gb|EDW51369.1| GM11111 [Drosophila sechellia]
 gi|194129412|gb|EDW51455.1| GM11712 [Drosophila sechellia]
 gi|194129415|gb|EDW51458.1| GM11710 [Drosophila sechellia]
 gi|194129420|gb|EDW51463.1| GM11707 [Drosophila sechellia]
 gi|194129604|gb|EDW51647.1| GM18816 [Drosophila sechellia]
 gi|194130592|gb|EDW52635.1| GM13546 [Drosophila sechellia]
 gi|194130624|gb|EDW52667.1| GM22315 [Drosophila sechellia]
 gi|194130633|gb|EDW52676.1| GM21848 [Drosophila sechellia]
 gi|194130680|gb|EDW52723.1| GM19339 [Drosophila sechellia]
 gi|194130804|gb|EDW52847.1| GM19742 [Drosophila sechellia]
 gi|194131605|gb|EDW53648.1| GM11168 [Drosophila sechellia]
 gi|194131791|gb|EDW53729.1| GM16186 [Drosophila sechellia]
 gi|194132283|gb|EDW53861.1| GM11993 [Drosophila sechellia]
 gi|194132287|gb|EDW53865.1| GM12275 [Drosophila sechellia]
 gi|194133843|gb|EDW55359.1| GM13169 [Drosophila sechellia]
 gi|194133893|gb|EDW55409.1| GM20018 [Drosophila sechellia]
 gi|194133933|gb|EDW55449.1| GM13214 [Drosophila sechellia]
 gi|194134344|gb|EDW55860.1| GM11180 [Drosophila sechellia]
 gi|194134349|gb|EDW55865.1| GM16864 [Drosophila sechellia]
 gi|194134412|gb|EDW55928.1| GM13526 [Drosophila sechellia]
 gi|194134415|gb|EDW55931.1| GM16390 [Drosophila sechellia]
 gi|194134892|gb|EDW56408.1| GM13613 [Drosophila sechellia]
 gi|194134911|gb|EDW56427.1| GM19718 [Drosophila sechellia]
 gi|194134921|gb|EDW56437.1| GM19725 [Drosophila sechellia]
 gi|194134925|gb|EDW56441.1| GM19728 [Drosophila sechellia]
 gi|194134933|gb|EDW56449.1| GM19441 [Drosophila sechellia]
 gi|194134974|gb|EDW56490.1| GM13661 [Drosophila sechellia]
 gi|194134982|gb|EDW56498.1| GM22145 [Drosophila sechellia]
 gi|194134984|gb|EDW56500.1| GM12951 [Drosophila sechellia]
 gi|194140590|gb|EDW57075.1| GJ14581 [Drosophila virilis]
 gi|194140878|gb|EDW57344.1| GJ15536 [Drosophila virilis]
 gi|194141042|gb|EDW57467.1| GJ15447 [Drosophila virilis]
 gi|194148724|gb|EDW64422.1| GJ22574 [Drosophila virilis]
 gi|194151176|gb|EDW66610.1| GJ23691 [Drosophila virilis]
 gi|194151180|gb|EDW66614.1| GJ23693 [Drosophila virilis]
 gi|194151185|gb|EDW66619.1| GJ23696 [Drosophila virilis]
 gi|194151198|gb|EDW66632.1| GJ23704 [Drosophila virilis]
 gi|194151202|gb|EDW66636.1| GJ23706 [Drosophila virilis]
 gi|194151206|gb|EDW66640.1| GJ23710 [Drosophila virilis]
 gi|194155980|gb|EDW71164.1| GJ19814 [Drosophila virilis]
 gi|194156267|gb|EDW71451.1| GJ19233 [Drosophila virilis]
 gi|194156269|gb|EDW71453.1| GJ17835 [Drosophila virilis]
 gi|194156274|gb|EDW71458.1| GJ16341 [Drosophila virilis]
 gi|194156275|gb|EDW71459.1| GJ15163 [Drosophila virilis]
 gi|194156279|gb|EDW71463.1| GJ14620 [Drosophila virilis]
 gi|194156320|gb|EDW71504.1| GJ11134 [Drosophila virilis]
 gi|194156322|gb|EDW71506.1| GJ19786 [Drosophila virilis]
 gi|194156338|gb|EDW71522.1| GJ19570 [Drosophila virilis]
 gi|194156347|gb|EDW71531.1| GJ18400 [Drosophila virilis]
 gi|194156350|gb|EDW71534.1| GJ14624 [Drosophila virilis]
 gi|194156364|gb|EDW71548.1| GJ19813 [Drosophila virilis]
 gi|194156371|gb|EDW71555.1| GJ16345 [Drosophila virilis]
 gi|194165298|gb|EDW80199.1| GK10382 [Drosophila willistoni]
 gi|194171850|gb|EDW86751.1| GK23626 [Drosophila willistoni]
 gi|194172007|gb|EDW86908.1| GK18500 [Drosophila willistoni]
 gi|194186959|gb|EDX00543.1| GE15127 [Drosophila yakuba]
 gi|194187086|gb|EDX00670.1| GE14578 [Drosophila yakuba]
 gi|194202333|gb|EDX15909.1| GD24267 [Drosophila simulans]
 gi|194202337|gb|EDX15913.1| GD24022 [Drosophila simulans]
 gi|194202427|gb|EDX16003.1| GD20328 [Drosophila simulans]
 gi|194202485|gb|EDX16061.1| GD24469 [Drosophila simulans]
 gi|194202534|gb|EDX16110.1| GD13555 [Drosophila simulans]
 gi|194202538|gb|EDX16114.1| GD18538 [Drosophila simulans]
 gi|194202553|gb|EDX16129.1| GD13905 [Drosophila simulans]
 gi|194202599|gb|EDX16175.1| GD15331 [Drosophila simulans]
 gi|194202611|gb|EDX16187.1| GD14669 [Drosophila simulans]
 gi|194202668|gb|EDX16244.1| GD20626 [Drosophila simulans]
 gi|194202691|gb|EDX16267.1| GD16082 [Drosophila simulans]
 gi|194203916|gb|EDX17492.1| GD16944 [Drosophila simulans]
 gi|195972763|dbj|BAG68518.1| histone 2A [Drosophila pseudoobscura]
 gi|195972785|dbj|BAG68510.1| histone 2A [Drosophila lutescens]
 gi|295292766|dbj|BAJ06136.1| histone 2A [Drosophila yakuba]
 gi|307170636|gb|EFN62820.1| Histone H2A [Camponotus floridanus]
 gi|307201537|gb|EFN81300.1| Histone H2A [Harpegnathos saltator]
 gi|332023309|gb|EGI63563.1| Histone H2A [Acromyrmex echinatior]
 gi|357625085|gb|EHJ75637.1| histone H2A [Danaus plexippus]
          Length = 124

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|327283951|ref|XP_003226703.1| PREDICTED: histone H2A type 2-C-like [Anolis carolinensis]
 gi|327283955|ref|XP_003226705.1| PREDICTED: histone H2A type 2-C-like [Anolis carolinensis]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 80/106 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++   A A+
Sbjct: 84  LQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKAKAK 129



>gi|336087638|emb|CBM82464.1| histone H2A.X-III protein, partial [Balanoglossus clavigerus]
 gi|336087650|emb|CBM82470.1| histone H2A.X-IV protein, partial [Balanoglossus clavigerus]
 gi|336087652|emb|CBM82471.1| histone H2A.X-V protein, partial [Balanoglossus clavigerus]
          Length = 128

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 75/98 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HR LRKGNYAQRVGAGAP                  GNAARDNKKSRIIPRH
Sbjct: 16  LQFPVGRVHRFLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 75

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKKS
Sbjct: 76  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKS 113



>gi|320583664|gb|EFW97877.1| histone H2A [Ogataea parapolymorpha DL-1]
          Length = 130

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 76/100 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGRIHRLLR GNYAQRVG+GAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LTFPVGRIHRLLRNGNYAQRVGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLLGHVTIAQGGVLPNI+  LLPKK  K
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNINTELLPKKVGK 124



>gi|148222886|ref|NP_001089684.1| histone H2A type 1 [Xenopus laevis]
 gi|121966|sp|P06897.2|H2A1_XENLA RecName: Full=Histone H2A type 1
 gi|64777|emb|CAA26817.1| unnamed protein product [Xenopus laevis]
 gi|214284|gb|AAA49769.1| histone H2A [Xenopus laevis]
 gi|77748127|gb|AAI06332.1| MGC130860 protein [Xenopus laevis]
          Length = 130

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   +A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSA 127



>gi|385301571|gb|EIF45752.1| histone h2a [Dekkera bruxellensis AWRI1499]
 gi|385302641|gb|EIF46765.1| histone h2a [Dekkera bruxellensis AWRI1499]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLR+GNYAQRVG+GAP                  GNAARDNKKSRIIPRH
Sbjct: 25  LTFPVGRVHRLLRRGNYAQRVGSGAPVYLTAVLEYLTAEILELAGNAARDNKKSRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLLG+VTIAQGGVLPNIH +LLPK+  + +
Sbjct: 85  LQLAIRNDEELNKLLGNVTIAQGGVLPNIHPSLLPKRRARAS 126



>gi|328863252|gb|EGG12352.1| hypothetical protein MELLADRAFT_51457 [Melampsora larici-populina
           98AG31]
          Length = 134

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 76/99 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKG+YAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 26  LQFPVGRIHRLLRKGHYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELN+LLGHV I+QGGVLP IH  LLP KSK
Sbjct: 86  LQLAIRNDEELNRLLGHVVISQGGVLPQIHAELLPAKSK 124



>gi|212545086|ref|XP_002152697.1| histone H2A [Talaromyces marneffei ATCC 18224]
 gi|210065666|gb|EEA19760.1| histone H2A [Talaromyces marneffei ATCC 18224]
          Length = 220

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 73/92 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQN 120
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQS 116



>gi|410933015|ref|XP_003979888.1| PREDICTED: histone H2A-like [Takifugu rubripes]
          Length = 122

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 21  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 80

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 81  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 120



>gi|410908727|ref|XP_003967842.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410908799|ref|XP_003967878.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410908803|ref|XP_003967880.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410908821|ref|XP_003967889.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410931437|ref|XP_003979102.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410931499|ref|XP_003979133.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410932537|ref|XP_003979650.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410932773|ref|XP_003979767.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410932837|ref|XP_003979799.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410932845|ref|XP_003979803.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410933285|ref|XP_003980022.1| PREDICTED: histone H2A-like [Takifugu rubripes]
 gi|410933344|ref|XP_003980051.1| PREDICTED: histone H2A-like [Takifugu rubripes]
          Length = 125

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|156539055|ref|XP_001599770.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156548594|ref|XP_001607717.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
          Length = 125

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K +
Sbjct: 84  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKSS 125



>gi|156536941|ref|XP_001608227.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156538961|ref|XP_001599641.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156538967|ref|XP_001599883.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156539625|ref|XP_001599199.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156544929|ref|XP_001603712.1| PREDICTED: histone H2A [Nasonia vitripennis]
 gi|156544960|ref|XP_001607585.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156544972|ref|XP_001607891.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156544978|ref|XP_001607931.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156544982|ref|XP_001607947.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|156549200|ref|XP_001607826.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|345481867|ref|XP_001605462.2| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|345481869|ref|XP_001605491.2| PREDICTED: histone H2A-like [Nasonia vitripennis]
 gi|345496858|ref|XP_003427836.1| PREDICTED: histone H2A-like [Nasonia vitripennis]
          Length = 125

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K +
Sbjct: 84  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKSS 125



>gi|47225209|emb|CAF98836.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 123

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|209156425|pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 gi|209156429|pdb|3C1B|G Chain G, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 gi|209156435|pdb|3C1C|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 gi|209156439|pdb|3C1C|G Chain G, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
          Length = 129

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 71/99 (71%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 83  LQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTE 121



>gi|328862877|gb|EGG11977.1| hypothetical protein MELLADRAFT_51456 [Melampsora larici-populina
           98AG31]
          Length = 134

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 76/99 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKG+YAQR+GAGAP                  GNAARDNKKSRIIPRH
Sbjct: 26  LQFPVGRIHRLLRKGHYAQRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIIPRH 85

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELN+LLGHV I+QGGVLP IH  LLP KSK
Sbjct: 86  LQLAIRNDEELNRLLGHVVISQGGVLPQIHAELLPAKSK 124



>gi|260800612|ref|XP_002595192.1| hypothetical protein BRAFLDRAFT_129784 [Branchiostoma floridae]
 gi|229280436|gb|EEN51204.1| hypothetical protein BRAFLDRAFT_129784 [Branchiostoma floridae]
          Length = 124

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 76/100 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HR LRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRFLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLL  VTIAQGGVLPNIH  LLPKK+ K
Sbjct: 83  LQLAVRNDEELNKLLSGVTIAQGGVLPNIHAVLLPKKTSK 122



>gi|817939|emb|CAA83210.1| histone H2A [Mus musculus domesticus]
          Length = 137

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 31  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 90

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 91  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 129



>gi|432843014|ref|XP_004065541.1| PREDICTED: histone H2A-like [Oryzias latipes]
 gi|432843216|ref|XP_004065571.1| PREDICTED: histone H2A-like [Oryzias latipes]
 gi|432843218|ref|XP_004065572.1| PREDICTED: histone H2A-like [Oryzias latipes]
 gi|432843228|ref|XP_004065577.1| PREDICTED: histone H2A-like [Oryzias latipes]
 gi|432843244|ref|XP_004065585.1| PREDICTED: histone H2A-like [Oryzias latipes]
          Length = 128

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPA 125



>gi|19075680|ref|NP_588180.1| histone H2A alpha [Schizosaccharomyces pombe 972h-]
 gi|11182422|sp|P04909.3|H2A1_SCHPO RecName: Full=Histone H2A-alpha; AltName: Full=H2A.1
 gi|4959|emb|CAA28848.1| unnamed protein product [Schizosaccharomyces pombe]
 gi|3821327|emb|CAA21864.1| histone H2A alpha [Schizosaccharomyces pombe]
 gi|224832|prf||1202262A histone H2A.1
          Length = 132

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 77/98 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGV+PNI+ +LLPK S
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKTS 122



>gi|71000767|ref|XP_755065.1| histone H2A [Aspergillus fumigatus Af293]
 gi|66852702|gb|EAL93027.1| histone H2A [Aspergillus fumigatus Af293]
 gi|159128079|gb|EDP53194.1| histone H2A [Aspergillus fumigatus A1163]
          Length = 265

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 73/92 (79%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQN 120
           LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQ+
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQS 116



>gi|54400432|ref|NP_001005967.1| histone 2, H2a [Danio rerio]
 gi|53734440|gb|AAH83299.1| Zgc:101846 [Danio rerio]
 gi|182888800|gb|AAI64227.1| Zgc:101846 protein [Danio rerio]
 gi|209732304|gb|ACI67021.1| Histone H2A [Salmo salar]
 gi|225703172|gb|ACO07432.1| Histone H2A [Oncorhynchus mykiss]
 gi|225704110|gb|ACO07901.1| Histone H2A [Oncorhynchus mykiss]
 gi|225704190|gb|ACO07941.1| Histone H2A [Oncorhynchus mykiss]
 gi|225715556|gb|ACO13624.1| Histone H2A.x [Esox lucius]
 gi|225715602|gb|ACO13647.1| Histone H2A.x [Esox lucius]
          Length = 128

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 79/102 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K A
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPA 125



>gi|507112402|emb|CDF36085.1| Histone H2A [Chondrus crispus]
          Length = 122

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 78/107 (72%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHR LRKG YA RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 16  LQFPVGRIHRFLRKGGYADRVGAGAPVYMAAVMEYLTAEVLELAGNAARDNKKTRIIPRH 75

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAEV 135
           +QLA+RNDEELNKLLG VTIA GGV+PNIH  L+P+K  KG A+ EV
Sbjct: 76  IQLAVRNDEELNKLLGGVTIASGGVIPNIHTVLMPRKKSKGDASQEV 122



>gi|403302779|ref|XP_003942030.1| PREDICTED: histone H2A type 2-A-like [Saimiri boliviensis
           boliviensis]
          Length = 192

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 86  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 145

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 146 LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 184



>gi|348544205|ref|XP_003459572.1| PREDICTED: histone H2A-like [Oreochromis niloticus]
 gi|499009257|ref|XP_004556918.1| PREDICTED: histone H2A-like [Maylandia zebra]
          Length = 124

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 83  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 122



>gi|158429126|pdb|2NQB|C Chain C, Drosophila Nucleosome Structure
 gi|158429130|pdb|2NQB|G Chain G, Drosophila Nucleosome Structure
          Length = 123

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 22  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 81

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 82  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 123



>gi|301626427|ref|XP_002942386.1| PREDICTED: histone H2A type 1-like [Xenopus (Silurana) tropicalis]
          Length = 130

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++   AA
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAENSKAA 127



>gi|465954614|gb|EMP26030.1| Histone H2A type 2-C [Chelonia mydas]
          Length = 257

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122



>gi|483521794|gb|EOB06751.1| Histone H2A type 2-C, partial [Anas platyrhynchos]
          Length = 133

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 28  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 87

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 88  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 126



>gi|110764935|ref|XP_001119899.1| PREDICTED: histone H2A-like [Apis mellifera]
 gi|340715682|ref|XP_003396338.1| PREDICTED: histone H2A-like [Bombus terrestris]
 gi|350417902|ref|XP_003491636.1| PREDICTED: histone H2A-like [Bombus impatiens]
 gi|380019299|ref|XP_003693547.1| PREDICTED: histone H2A-like [Apis florea]
          Length = 124

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|194779416|ref|XP_001967880.1| GF22861 [Drosophila ananassae]
 gi|194782354|ref|XP_001967919.1| GF18864 [Drosophila ananassae]
 gi|190631425|gb|EDV44842.1| GF18864 [Drosophila ananassae]
 gi|190631426|gb|EDV44843.1| GF22861 [Drosophila ananassae]
          Length = 135

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|327285099|ref|XP_003227272.1| PREDICTED: histone H2A type 2-C-like [Anolis carolinensis]
          Length = 129

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/106 (69%), Positives = 80/106 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAAAE 134
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++   A A+
Sbjct: 84  LQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKAKAK 129



>gi|297290289|ref|XP_001092924.2| PREDICTED: hypothetical protein LOC701574 [Macaca mulatta]
          Length = 287

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122



>gi|6686554|emb|CAB64684.1| putative H2A histone [Asellus aquaticus]
          Length = 123

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 77/100 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122



>gi|348527408|ref|XP_003451211.1| PREDICTED: histone H2A-like [Oreochromis niloticus]
 gi|348543343|ref|XP_003459143.1| PREDICTED: histone H2A-like [Oreochromis niloticus]
          Length = 128

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|348522855|ref|XP_003448939.1| PREDICTED: histone H2A-like [Oreochromis niloticus]
 gi|499048857|ref|XP_004574969.1| PREDICTED: histone H2A-like [Maylandia zebra]
          Length = 128

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|344275518|ref|XP_003409559.1| PREDICTED: histone H2A type 2-C-like [Loxodonta africana]
 gi|512984041|ref|XP_004853993.1| PREDICTED: histone H2A type 2-C-like [Heterocephalus glaber]
          Length = 129

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKK++
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122



>gi|173404|gb|AAA35311.1| histone H2A-alpha [Schizosaccharomyces pombe]
          Length = 132

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 77/98 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           L FPVGR+HRLLRKGNYAQRVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 25  LAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRH 84

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKS 126
           LQLAIRNDEELNKLLGHVTIAQGGV+PNI+ +LLPK S
Sbjct: 85  LQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKTS 122



>gi|322788651|gb|EFZ14252.1| hypothetical protein SINV_04585 [Solenopsis invicta]
          Length = 124

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 78/102 (76%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGA 130
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK++K A
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124



>gi|332245706|ref|XP_003271994.1| PREDICTED: histone H2A type 1-like [Nomascus leucogenys]
          Length = 128

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 77/99 (77%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSK 127
           LQLAIRNDEELNKLLG VTIAQGGVLPNI   LLPKKS+
Sbjct: 84  LQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKSE 122



>gi|432943836|ref|XP_004083294.1| PREDICTED: histone H2A-like [Oryzias latipes]
          Length = 128

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGR+HRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 24  LQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRH 83

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKK 128
           LQLA+RNDEELNKLLG VTIAQGGVLPNI   LLPKK++K
Sbjct: 84  LQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123



>gi|391329466|ref|XP_003739194.1| PREDICTED: histone H2A-like [Metaseiulus occidentalis]
          Length = 125

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 77/103 (74%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNY +RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYGERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAA 131
           LQLAIRNDEELNKLL  VTIAQGGVLPNI   LLPKK+ K AA
Sbjct: 83  LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDKAAA 125



>gi|156404302|ref|XP_001640346.1| predicted protein [Nematostella vectensis]
 gi|156227480|gb|EDO48283.1| predicted protein [Nematostella vectensis]
          Length = 126

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (75%)

Query: 29  LQFPVGRIHRLLRKGNYAQRVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRH 88
           LQFPVGRIHRLLRKGNYA+RVGAGAP                  GNAARDNKK+RIIPRH
Sbjct: 23  LQFPVGRIHRLLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRH 82

Query: 89  LQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSKKGAAA 132
           LQLA+RNDEELN+LL  VTIAQGGVLPNI   LLPKK++K A A
Sbjct: 83  LQLAVRNDEELNRLLSGVTIAQGGVLPNIQSVLLPKKTEKKAKA 126